3QB3A

Crystal structure of staphylococcal nuclease variant delta+phs i92kl25a at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKAMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYKYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Relocation of internal ionizable residues to cavities created by single alanine substitutions
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3qb3A00
1EYAA 3BDCA 4RKBA 2RDFA 4WRDA 5J1ZA 2KQ3A 5J39A 5IGCA 3MZ5A 4OL7A 1STBA 4K5WA 2EYPA 3DHQA 3HZXA 5KYIA 5C4HA 5K5PA 3ERQA 3VA5A 2F0WA 2EYLA 5EKKA 1SYEA 3SK8A 4ZUIA 1SNCA 4DU9A 5M9OA 5IGBA 5IODA 4DFAA 1ENCA 3D8GA 3LX0A 4KD4A 1A2TA 4ID6A 5ISRA 3NQTA 4HTHA 1JOOA 4RKLA 4K8JA 5KYLA 1ENAA 5F2DA 2EXZA 4I65A 2F3WA 2SNMA 5EGTA 1EZ8A 3TP8A 5CC4A 4EQNA 4PNYA 1TQOA 1EY5A 5IGFA 5CV4A 2EYHA 3NXWA 5HURA 5KEEA 1RKNA 2F3VA 3MVVA 4PMBA 2PZWA 4S3SA 1JORA 1SYBA 1EY4A 4N9TA 1TR5A 2PZTA 4KY6A 2F0FA 3OSOA 1STNA 3U9OA 1A3UA 4N9PA 3MXPA 4K8IA 1KDBA 3T16A 4IUNA 4K6DA 5CV7A 4IALA 2EY2A 4ZQ3A 1SYGA 2F0EA 5C5LA 5IOCA 1STAA 5IGGA 3HEJA 1AEXA 4H7BA 1KDAA 2OXPA 2F0UA 2F0SA 3TMEA 2ENBA 2HQEA 2EYFA 4R8NA 4K5XA 4DGZA 1JOKA 3MHBA 2EYJA 4HMIA 3SK5A 1EYDA 1SNMA 4E6IA 5J22A 5I9OA 4F8MA 3H6MA 1A2UA 3NK9A 3OMCA 1TT2A 2EYMA 2EY6A 1SNPA 3NUCA 1F2YA 3P75A 4MIUA 2F0KA 3OWFA 1A3VA 4KTAA 3TP5A 2F0LA 2F0DA 3BDLA 1SNDA 5KRUA 4EQOA 4QMGA 4ODGA 3TP7A 3SHLA 2SNSA 4WORA 5CV8A 4B9XA 5I6YA 4B9WA 5I9PA 1NSNS 2EY5A 2F0JA 3T13A 4KJNA 2OF1A 2F0MA 3DMUA 4KY7A 1NUCA 1F2ZA 3TP6A 5HGTA 4NKLA 2PW5A 4EQPA 2F0PA 2LKVA 4J1MA 5C4ZA 1EY8A 5IIFA 4J6HA 4K5VA 1KAAA 4KHVA 3C1EA 5CR3A 5E1FA 2F0NA 3SXHA 1EY0A 4K2LA 5JOBA 3QB3A 2RKSA 2EY1A 4KY5A 2EYOA 3SK6A 4HMJA 4LAAA 1U9RA 2OEOA 1SYDA 5CV9A 1IHZA 3SK4A 4NMZA 1STYA 2F0HA 2O4XA 1EY7A 3PMFA 4ZUJA 5I6WA 5EKLA 3NHHA 3R3OA 5DAUA 5JAVA 4ME5A 4QF4A 3S9WA 2KHSA 1SNQA 2F0IA 3C1FA 1EYCA 3P1HA 4K14A 5IGEA 5KIXA 2F0OA 2PW7A 4IZ8A 5C5MA 5C3WA 3D4DA 1EY6A 1SYFA 2F0QA 3OMGA 4NP5A 3RUZA 3EJIA 5E3FA 2QDBA 4KJOA 3V2TA 4DF7A 1A3TA 2M00A 1SYCA 3MEHA 5NUCA 4EVOA 3QOJA 3SR1A 2PQEA 1SNOA 5IGDA 5C3XA 5KGUA 1STGA 5C6AA 4QB4A 2WACA 3E5SA 2F0GA 4KD3A 4K2KA 3NP8A 3EVQA 2RBMA 3D4WA 2SOBA 1F2MA 4KV6A 5CGKA 1JOQA 2F0VA 2PZUA 1KABA 1STHA 3D6CA 2NUCA 1II3A 4YIJA 1EQVA 2PYKA 1EY9A 3QOLA 4NDXA 4TRDA 5DEHA 4G57A 3EROA 4PMCA 4F7XA 5CV6A 5CV5A 2F0TA 1EZ6A 1KDCA 3ITPA
chains in the Genus database with same CATH superfamily
1X65A 2NWGA 1WTHA 4BBSB 1I4HA 3D0FA 4CKEA 2R93H 4YHHL 4DAYB 2O2LD 3T56B 3BVZA 2R92B 1A2TA 4ID6A 3P7JA 4A3DG 1HNWL 1KQSA 2G5DA 2Q2UA 5G3LF 4DV5Q 2A6HC 3CCJA 4DR4Q 2JK8A 1K28A 3NE5B 5C3EH 1TU2B 3TQYA 2PZTA 2Q8RE 3GTJB 2KJXA 1GUGA 2JA8H 3U9OA 4DV3L 2QCPX 4K6LA 5D14A 2AQ1B 3T51B 1PH6A 5C5LA 4L5RC 1F2LA 4GN4B 4DR7L 1XMOL 2MP1A 2NVXB 5T1GA 3PGZA 2D62A 5IP7G 3S2DB 2C5CA 1P8LA 3RR5A 1EYGA 1CSPA 1SE4A 3JAML 1CT1D 2IX0A 3S15H 2ASBA 3M4QA 1HR0L 1HNXQ 3U9SA 3TP6A 3OHXC 5FO8B 1VDZA 3GV6A 1PZJD 2R93G 4G7OC 2NTTA 1YZ6A 5CR3A 1CA6A 2DNEA 2CH4W 2L9HA 1PTOD 4DAVA 4IO9A 1A63A 4B3ML 1CQVA 4CDCC 1UEBA 4DUYL 3FRPB 2K5QA 1NE3A 3J7YW 1S3OA 1K9MC 2K04A 3NPPA 2E74C 5K5PA 3EIVA 2M2LA 4U673 5C3EG 3PUWA 2JA8G 1EU3A 1WOCA 3KBGA 2ZJQA 1D7QA 2AKWB 5JJKA 4NB3A 1KABA 2YTXA 2C35B 1NTGA 4XQQA 1X6OA 2ZM6Q 2HD3A 2LFNA 2CQOA 3BU2A 3NELA 2E2IH 4GLAC 1BOSA 4QL5A 4QY7A 2Z9HA 3C2PA 4OL7A 1WTQA 3TRZA 2PMZB 3G7LA 5FLMH 2Z1CA 3NTIA 3H91A 4X65L 3K7UC 3DUZA 4YY3Q 1GXDC 3HKZG 2ZXPA 5JVH3 1FR3A 1TY0A 2UXCL 1V1PA 3PO2B 4ZCKA 3PUVA 1JE4A 4A3JH 1UAPA 3HKZE 3CQZB 4QGUA 1EZ8A 2K28A 1JJGA 3VR2A 3QIAA 3NXWA 2ZJPA 4A3EH 3PSIA 3KF8A 1JORA 1CHQD 1EEID 3CCMA 3OW2A 1HA6A 1PH5A 5I2YA 3T16A 1K8AC 3TZDA 1FNVA 1BCPC 1ENFA 1VQCA 4OHJA 2Q8IB 3UDIA 2VQFL 1B3AA 1I4QA 2FMMA 3M9BA 2CW0C 3A7AB 1NR2A 4UP8A 2F0UA 3BDOA 5FO7B 4DR5L 1JJCB 4K5XA 4LF4Q 1BCPD 2D5DA 1SNMA 3NSWA 2CW0D 2DN8A 4J8QA 5KRUA 4OO1H 4ODGA 2NN6I 2SNSA 1E24A 3S1QB 1OXVA 1PYSB 5I9PA 1F9SA 4A3KH 1LO5D 1Z9FA 1PYWD 1DOLA 5C4ZA 1EIFA 1CK1A 3J80L 3M3YB 5FLMG 4XIGS 1PRTD 3HOZH 1V8QA 2XRSD 3CCVA 2UU9L 3CKIB 1HHVA 1SSOA 1IXRA 3QJYA 4ZUJA 3S1NB 4A3JG 3R3OA 4DV5L 1B9MA 3GTKH 4DR4L 3RD4A 1Q1EA 3GTLB 3PF5A 4A3GH 1TWHH 1RTOA 1M1KC 1PH3A 4A3EG 1BUVT 4DV2Q 1N36Q 3IL8A 2OCEA 1YJ9A 3U58A 2VUMB 1GD7A 1MJEA 1BNZA 2EJFC 4CBVA 1K0RA 1VQPA 3J7A5 3QWNA 3EA6A 1YJWA 1L0WA 1EQVA 4MTNA 3EFXD 1BBUA 3LGJA 4JI1Q 3HGBA 5CV6A 4ABNA 1JB7A 4POFA 1EZ6A 4MIUA 1BCPB 5FLXE 3BG3A 3G48A 1JWUD 3GQBA 1BO0A 2BA1A 2WAQB 3I7FA 4GLXA 4C1NI 2NZOA 4K5WA 2RHSB 1TWCB 1E7ZA 3VA5A 5IYBH 3RN5A 5EKKA 4OO1G 3DEPA 5IODA 1ENCA 3BVMA 1HNXL 1TIID 1GUWA 3K8AA 1AW7A 4K8JA 1EQTA 1VQ4A 4A3KG 5F2DA 2NVQH 1OXTA 2QDLA 1PRTB 4BA1I 4HJ9A 3I55A 2B2UA 2HCCA 3HOZG 2MO1A 2IHFA 2N88A 2JA6H 1XPRA 3W5OA 4NW2A 2PNHA 1XNQQ 3NWSA 1L0YB 4I7AA 2R7ZH 2NN6H 3TREA 2MQHA 4KHZA 4LF8Q 2QEJC 1ILQA 1KDAA 2OXPA 2EQSA 4A3IH 5EBDA 1YHBA 2LS01 1UWVA 4R8NA 4RAUC 1FVIA 2ZM6L 1ZKOA 4E6IA 3STBD 4F8MA 3CRLC 2FMCA 2ZTEA 5LMNW 2Q2HA 4C1NK 1JWSD 4BY7H 4CGYB 1I4GA 2OQKA 1RF2D 2YU9H 3I4OA 3W1BA 2K33A 1EFID 3GD7A 5IYDG 4PZ6A 4EQPA 1RCVD 4YY3L 5BN5A 3N52A 5IYBG 3FVQA 1EY0A 1QUQB 3CPWA 3PUZA 2VNUD 3D3RA 1IHZA 2HIXA 3ULJA 1VQ8A 1P16A 2O4XA 1A15A 1I3QB 3PMFA 4YCWA 1K8GA 1VS0A 4MTKA 5LMUQ 3FPUB 3K5NA 5E4WC 5IGEA 3KF6A 1A62A 4B3RQ 1KXLA 5KIXA 2F0OA 4YWMA 5D3DA 5DM63 1HZ9A 1X3FA 1YBYA 1X3PA 4P72A 2JA6G 3E3XA 3SR1A 4DA2A 3HOWB 1I50H 1UNSA 5CYUA 1L2FA 4XYQA 1F2MA 3KLSA 2MO0A 2R7ZG 1IKMA 1STHA 4JBJA 3I4MH 3SVMA 4YIJA 1B3QA 2NN6G 1S5ED 2NBFA 4IOCA 4G57A 1QVGA 1SMXA 4A3IG 4DR3Q 1MHWC 3S17B 2ICIA 3CCQA 2F3IA 1LTTD 4BY7G 4LJZC 4DFAA 1YNNC 4RFBA 2EPBA 4KD4A 3WWVA 3CCUA 4O1NA 2QA4A 1ENAA 2RQXA 3JC66 1S5DD 4RMFA 2IX1A 3M4OB 1SN8A 1I4XA 1YNND 3V96A 1H9RA 4A93B 4L5TA 4PNYA 2BDOA 3I73A 1ESRA 5KEEA 1BKBA 1EEFD 3WDNA 2L12A 2K03A 1PZKD 1VQGA 1SXTA 4FNFA 2B63H 1Y1WH 3KLWA 4CDFC 5LMNQ 4DV2L 2I07B 2VS1A 2R61A 2HCIA 3GTPB 3WOFA 2L55A 4HIMA 4FF2A 1JR0D 4TSSA 2CCZA 4QIWB 4JI1L 2K5WA 1X3GA 1A3VA 3PCOB 3BDLA 5I6YA 3UI2A 5CV8A 1XPUA 2JA9A 4YWKA 1CHPD 3OW7A 4B3TQ 2VY3A 3A55A 1QE6A 3VA7A 1X3QA 1JWMD 2D0OA 2KECA 2K5VA 3I91A 1GVPA 5FOBB 3PIOA 2EDGA 1KAAA 1U4LA 3C1EA 4OXPA 3PO3H 1HFNA 4HCSA 3SK6A 3T1YL 1CTMA 3HRZC 4FYDA 2JA7H 1SE3A 1B44D 1STYA 4MHEA 1ET6A 2WB1B 1X54A 2N55A 1B7YB 4IFDI 3CCRA 4GKJQ 1HJPA 1Q90A 3PIO3 1EWHA 2JEAI 4NP5A 2B3GA 3Q23A 3RUZA 1K3RA 1B70B 1NBWA 1SRUA 5EQ0A 2F4VQ 1D5XC 1KC8C 1PMRA 1LTRD 4K2KA 2B63G 1Y1WG 1QWYA 2JA5B 4LF8L 1ET9A 1WJJA 4IUPA 3AFQA 4L63B 2UXDQ 5M3MB 1QZGA 3ITPA 4C2MB 1WD1A 5M3FB 2OTLA 3OIQA 2EYPA 4M8AA 3G71A 2CWPA 3BVGA 2CFMA 3R93A 1O80A 4UY8C 3S1MH 4DU9A 5M9OA 2F03A 1FNUA 3LX0A 2Y0SB 3H3VI 1WTVA 4POGA 3AYHB 1HNZL 2DNCA 2N3SA 4ZKCB 5C0XG 2EXZA 3QG1A 2F3WA 4IJLA 2K01A 2MHVA 2Z0SA 3A8KE 4JBWA 3FKIB 4LNQA 2PI2A 1DZ1A 5LMUL 2JA7G 5ELFA 2O5IC 2R92H 3J7AF 1YEZA 1KDBA 2YV5A 1E2ZA 2GVAA 4IUNA 4A3FH 3KDFA 4HJ7A 2VZAA 1Y69U 4KHPQ 3AMUA 3K58A 2EYFA 4DR1Q 1HH2P 2IJ0A 2NVTB 1GUTA 3S1RB 1EWCA 2EYMA 1Q81C 3VR4A 4HJ8A 2BH8A 5C44H 2B2TC 4DR3L 2QGQA 5FJ8H 3RN2A 3J81i 1IBKQ 1PDQA 2G9DA 1WTOA 4V190 3UE1A 3X3MA 3QB3A 4NPSA 5M5WH 2OEOA 3B6YA 5I6WA 4ME5A 4B08A 1RTNA 1XTCD 2IPKD 3LWEA 4K14A 1QZHA 1VQHA 2RSNA 4CJ2C 3MA2B 4G4KA 4X66Q 4JI6L 2GVBA 1D8LA 4XTCS 3NP8A 1I6VC 3MXNB 1LYLA 3KJPA 5LMNL 2R92G 1EWIA 2F52A 1QCBD 1WFQA 4DV4L 4A3FG 1T9HA 2F4IA 1DYQA 4JK1C 1EOTA 2B29A 2Q2TA 5JVG3 3F2DA 4PMCA 3CRKC 1HPCA 4KI0A 2K5HA 1VQ9A 4WRDA 5C4JB 5FKAC 3M7NA 2L5TA 1MJCA 3PF4A 1X56A 3E0EA 3ERQA 3HOYB 1HTLD 2KUMA 1XMQQ 2QKIC 3U4VA 4A75A 5C44G 3HP3A 5FJ8G 4B3TL 1BBWA 3HOVB 1J6QA 3TEHB 3GTGB 3NBIA 1G291 5KYLA 1KNAA 1MIUA 3GTMB 3BYYB 5IP7H 4OONA 2R7FA 1PFSA 1U4RA 4CJ0B 2EYHA 4C56C 1YJNA 2KBNA 1RKNA 1PFBA 2PPBC 1WCMH 3TN2A 2X6LA 3Q8DA 4CKCA 5IT9E 1HZBA 4IUVA 1E2WA 2AMCB 3NQIA 1GJXA 4K6DA 2GA4B 4JOIC 4AQYQ 2F4VL 1T5XD 4C3JH 3HEJA 1BVSA 4H7BA 3VR5A 1GUNA 4JVZA 1PZID 3K7AB 1PTOH 1X9NA 1ILPA 1RD9D 1EYDA 1TWGB 2G9HD 5J22A 3H6MA 2UUCL 1TT2A 1SNPA 2EY6A 4YCUA 2UXDL 4KTAA 4I7ZC 3VR6A 3S2HH 3TDQA 5FO9B 2A6HD 1QVFA 3IKJA 1PVOA 1H9SB 1RL2A 3RLNA 4KY7A 3PV0A 1PH1A 3H3VC 5HGTA 2MNAA 4J1MA 1AFPA 1ICFB 2RSOA 3ICEA 4LF7L 1MSGA 3FPPA 4RCNA 4HMJA 1U9RA 2AWOA 2RA4A 1YNJC 1VQFA 2IWHA 1Q86C 3J81E 1J5EQ 5DAUA 3R2IA 2CWAA 3D4RA 4GLVB 2KOLA 1YNJD 1KRSA 3F1ZA 2Z6KC 5CC4A 4LW1A 2E2DC 1JT8A 1I5FA 3MEHA 1WCMG 5C4XH 1SFOH 3M3YH 4BXXH 1H9JA 1L1OA 1GM5A 4KD3A 1MGSA 2RBMA 2E5LQ 4A3BB 1PHJA 1G2SA 3Q22A 4C3HB 1ASZA 2EXDA 3QOLA 4KHPL 2ALYB 1CUKA 4C3JG 1XYIA 4OO1I 3EROA 4IN3A 2RF4A 1TS3A 1PFMA 4DR1L 4XT1B 1ICWA 1VQ7A 1STEA 5FLXL 3CCLA 1XJVA 2IW3A 1I6HB 3RLFA 5C4HA 2DY8A 4XDXA 2NZ1D 4B3SQ 4APVA 3SK8A 3RZDH 4A3DB 5JEAJ 1I4PA 2L1BA 1BF4A 1IBKL 3LNNA 3W2DA 1C8CA 1EL0A 4CDEC 4JBMA 3U50C 3TP8A 1AE2A 2NVYB 4Y7NH 2FHTA 3I4LA 3MVVA 1WTXA 3OTOQ 4A3MB 3NTHA 3OSOA 5IWAQ 2B2WA 5JJZA 3DWPA 5JJIA 4LMQD 3MXPA 4LUZA 4RGOS 1QJOA 4X66L 2ES2A 1Y1VB 2FXQA 4A3CG 1D6EC 5CMDA 1PA6A 3C46A 2QILA 4BXXG 5C4XG 2LY7A 4X3KA 1CKNB 2KEEA 3UDFA 1E1OA 4F87A 1ESFA 5M5XH 1SR3A 3P75A 1JB3A 1F2YA 1M4VA 4DR2L 2PO4A 4ZRZA 1SNDA 1YHQA 5H1SE 1MI2A 2A1AA 2XIWA 4AYBG 4DNRB 2R93B 1XMQL 1DOMA 2VUMG 1OXUA 1BXTA 4AYBE 1GKHA 4RCOA 1F9QA 4KKSA 1PLFA 4LUOA 1K0SA 2EY1A 4DV1Q 2HHHQ 1HRJA 4PG3A 1IKLA 4DAYA 1PH7A 1EY7A 4X64Q 1VQNA 1FJGQ 4QF4A 2E76C 4FF4A 3A8JE 1RODA 3KJOA 4JI7Q 5C5MA 4CKBA 3GDEA 4DNIA 1XWEA 4IOAA 2JA8B 5GAGC 4DAMA 4DV0Q 4QB4A 2H5XA 3EVQA 4OEMB 4RG1A 2L15A 4C3IH 4H0LC 4AQYL 5LL6X 5ELNA 1U0LA 4X62Q 4XQNA 1IL8A 2XSCA 2Q2IA 1SMYC 3E9IA 4DK3C 4PQXA 5GROA 2VB3X 3GTOH 2I46A 2VW9A 1HZCA 1SMYD 4JI3Q 2KQ3A 5J39A 5J3BA 2K5DA 3P20A 3HOXB 3S15B 2AHOB 1S4ZA 4IUUA 3FHWA 4HJAA 4HTHA 2XTIA 2VB2X 4DNTB 4O42A 1U5KA 3I70A 4DUZQ 4FXKC 4FF3A 4MNOA 1WI5A 2OT2A 1DONA 1TQOA 1EY5A 5CV4A 1IW7C 3KYHC 3ZJYC 2F3VA 2PZWA 1EY4A 5ELEA 5IYDH 4BS9A 1I94Q 2B2VC 1IW7D 3A5ZB 1K83H 4DV7Q 4TVAB 3LWUA 1JE5A 3G6EA 4IFDJ 1IZ6A 4HN7A 2WINB 1Q8IA 1KL9A 5G3LD 3M4OH 1D5ZC 2E5LL 4AIMA 2AUKA 2JYOA 4P2CB 3M4PA 4C3IG 2UXBQ 2LSSA 3J80c 2WKDA 5I9OA 3KUPA 3NUCA 2MGSA 2M9VA 5KNDA 2E2IB 2AWNA 5M5YH 2RCFA 2V1CC 4ZAIA 5BR8Q 1FNWA 4GN5A 5DM73 4TKOB 1U4MA 2K7VA 3DMUA 3L3OC 1R4QB 4RHRA 4B3SL 1TWAH 2F0PA 1X3EA 2B2YC 4JI5Q 4G7HC 3MWYW 5EKIA 3SXHA 5D65A 2E2JH 2E8GA 4JI4Q 3RMHA 2XWJB 2EJMA 4A3JB 1SYDA 2PI2E 5IYCH 4LFCQ 3MFGA 2JN4A 4IPDA 2K75A 2BDNA 1SNQA 3P1HA 2EOTA 2Z6KA 3MXUA 4IUQA 2F0QA 3OTOL 4R1JA 2K50A 3CCSA 5GADC 3QOJA 5IWAL 3KBXA 4GS3A 2I5MX 1B9NA 2E2HB 1LT3D 3Q0AA 2NUCA 1CZWA 5AFWA 4O2DA 4TRDA 1EY9A 2JE6I 5DEHA 1R9TH 3ND8A 2BOSA 3U4ZA 3H94A 4KKTA 1EYAA 4ZLTF 1V1QA 4H13C 1G6ZA 3MZ5A 1SJED 1STBA 1X55A 5C0XI 1KTKA 3URYA 4BBRH 4LF5Q 2VL6A 1TY2A 2JA5H 4GKKQ 3NQTA 4A3KB 1A0IA 1JOOA 1WTPA 1ONLA 1TKWB 4PZ7A 3ONAB 4CDDC 4R4QA 3HS0C 2PQAB 2HDLA 2SNMA 3EQLC 2HHHL 1YI2A 5IGFA 1KIXA 2A73B 2WIIB 2DJFC 4LF4L 1TXYA 4PMBA 4X64L 1SYBA 4HIOA 3GTKB 3CAMA 3QO2A 3HG9A 5IYCG 4JI7L 4A3GB 2TMPA 1TWFH 3RNUA 1C48A 1TWHB 3S16H 2IL8A 1W3SA 5EPJA 1BBXC 4IALA 2EY2A 4IPGA 4DV0L 2HDMA 5ELDA 3CW2C 3CCEA 1EFWA 1C0AA 3GO5A 4RHSA 2EYJA 4X62L 1EOVA 4GOPC 2WB1G 3S14H 2KENA 1UEAB 2F0DA 3PUYA 3SHLA 5K36H 3VDYA 1KLGD 1HZAA 2WB1E 3RLOA 4JI3L 2F0JA 2OF1A 4V0BA 3BZDB 4NXNQ 3GTQH 2JSOA 4UDUC 4OGQC 1N36L 1JQYD 4HSPA 4K5VA 4BBRG 5TSSA 1IYJB 3MXGA 2JA5G 4KY5A 2F1MA 4UAIA 3S1RH 1VQBA 2DUDA 4DUZL 4GNXC 2NVQB 3TS2A 3Q24A 3NHHA 3R2TA 2SDFA 1H9MA 3KK7A 2DJGC 3K5LA 2JA6B 1JICA 1SYCA 3I4NH 2EE1A 1I94L 3ZYYX 3HKSA 5HGQA 5C3XA 2MUYA 4DV7L 2R7ZB 5C0XH 3OOCA 5BN3A 1OXSC 2Y0SG 3DWQA 1YIJA 2EIFA 1CZGA 3L7ZC 4GN3B 2RDHA 2XN9C 2WP8J 2KCNA 2IT1A 2Y0SE 4A3IB 2KHIA 4F7XA 2F0TA 5D3IB 4MZ9A 2ID0A 2IY5B 3S24A 5LL6S 3GP7A 4DPGA 2RDFA 3SGIA 4H44C 5J1ZA 3HOUH 4WFN3 2B8GA 4BY7B 1G91A 5BR8L 2A19A 3HFZB 4HEDA 1XNQL 4ZUIA 2YU9B 1PV4A 5K36G 5FK9C 1LT5D 3D8GA 3A5UA 2AQ3B 1H9KA 4RGTA 3Q6SA 1NJIC 4JI5L 1VQEA 1ZYRC 3I56A 1EQQA 2Z8LA 3D31A 4EQNA 4H02A 1ZYRD 1DD2A 1PH9A 3DXJC 4LFCL 2TSSA 3HOYH 4HSVA 1QUQA 2B2VA 2I5HA 1NMGA 2A5HA 3IFTA 1EU4A 1LTGD 3VYRA 2MFIA 3GTGH 5IT9L 3A56A 1DOKA 3H09A 1I50B 3H0GH 2JXMB 5COYA 3I4NG 2ENBA 1LACA 1TS5A 4DGZA 2MPMA 3MHBA 3MAQA 3I4MB 5GAEC 4L6TB 4BBSH 1PTOF 3J7ZC 3VYTA 1RDPD 3E9HA 2L0CA 1TS4A 5IP9H 3I3CA 3T4AC 3CC2A 4B3RL 4U68A 3L9AX 4OWWB 2HIVA 3HOUG 1F2ZA 2B2YA 4LF5L 4NKLA 5IIFA 1KNEA 4XT3B 4HR7B 1QVCA 1WVLA 4GKKL 2F0NA 3E0JA 5EPLA 3I72A 3K80C 2Q8TA 1WYDA 1VQ6A 4NMZA 2CHBD 4JV5Q 2A68C 2XGTA 2JEBI 3DM1A 2D0PA 1NAPA 3GTJH 3J81L 4WJ4A 2A74C 3C1FA 4IZ8A 1SLJA 1TS2A 3EJIA 2BH2A 1YITA 2XVSA 3HOYG 2BE5C 2B63B 1Y1WB 4P71A 4KV6A 2F0VA 2Z4HA 3CU7A 4B3MQ 1II3A 2NVXH 2BE5D 4Q5VA 1WD0A 4Z9CB 3H0GG 1ML0D 2VXWA 3S2DH 4RWSC 1BQQT 2KHJA 1KHIA 4BBSG 3DHQA 1DCZA 3TSSA 1BDOA 5IP9G 1DM0B 1SNCA 5DLQE 5L37A 2A6EC 4WJWA 5ISRA 4L5SA 2N8NA 4I65A 3PO3B 3I2ZA 1RHPA 2A6ED 5EGTA 1K8MA 2J0TD 1DJRD 1I6HH 2JA7B 1R4PB 1SE2A 2PCFB 1E1TA 2AQ2B 4OELB 3K0YA 1STNA 3K59A 1A3UA 1J9OA 4K0KQ 2X6GA 2RCNA 1M8AA 2EZVA 4DR6Q 1SYGA 3AB9A 5DNFA 5EPKA 4OWTB 1MD2D 1N33Q 1FYCA 1JOKA 3FEWX 4X3SA 1PRTF 4M1UB 1A2UA 3NK9A 4A3MH 4BY1B 4ME3A 1W2BA 1FL0A 1SJHD 2F0LA 3TP7A 1AN8A 3A74A 1NSNS 4GKJL 3F2UA 2K6AA 3PO2H 2LMCB 2PW5A 3MFYA 1EY8A 1QG7A 4OIKA 1M90C 3S1MB 3RZOB 3DWAA 3H15A 3T53B 3CQZH 2FINB 3NBHB 3K81C 4K2LA 4LFBQ 1F77A 2EYOA 4EGVA 4UP7A 3J81j 4DK1A 2HT1A 4XYOA 2BA0A 1B50A 2A69C 2CQAA 3MC0B 1F9RA 3F2CA 1GUOA 4A3LG 2PW7A 2E75C 1EY6A 4JI2Q 4FDBA 4TQUS 4FVMA 3T1HQ 2A69D 1JJ2A 5IGDA 1EIGA 2DY7A 1W6JA 3IRBA 2UU9Q 3D4WA 1Y14B 1RJTA 4A3FB 1Y8PB 3PIPA 3R8BA 4FO2A 2YTYA 2I5LX 4OIJA 2UUBQ 2B2UC 1HUNA 1QOHA 3S1QH 1B8AA 1H95A 3ERSX 4CHTB 5KYIA 3HZXA 5C44B 4A3MG 4A3CH 3PIP3 4P75A 5IGBA 3NENA 1X32A 1Y1VG 4IPCA 2QEXA 1Q12A 2PMZE 3PO2G 3W1GA 1O7YA 1FD7D 1S72A 3S1NH 3WOEA 1WTWA 3W3AA 1UE5A 3VYSA 5M5WB 4DAPA 3FP9A 3EN2A 3GTLH 5CORA 1D5MC 4JV5L 4P74A 3OPOA 1T5EA 3HOXH 2SEBD 4OWXB 2ICEC 2ZTDA 3TBIB 1SDFA 3BYTB 2VUMH 1L0XB 3V05A 1PTOC 5BN4A 2C9OA 4DK0A 1UE7A 3JAMi 4ZQ3A 2NTSA 4DV6Q 2F0EA 1LT4D 3A54A 1Y8NB 2H4OA 1K3BC 1UE1A 3NWTA 3OMCA 4ZKBB 3MXNA 4FXGC 1KAWA 1G2TA 1LTBD 3L0OA 2KCCA 2CH4A 1TWCH 4QMGA 2XNAC 4WORA 4B9XA 3L2PA 1HUMA 3TS0A 4DKAC 2EY5A 5EBCA 1VQ5A 2VQEQ 2F0MA 1JC7A 1EUJA 1BR9A 5C0XJ 3JAMc 1VCIA 4QQBX 3CC4A 2KA7A 1NR4A 1PH8A 1QNUA 2XRQD 4JBKA 4J15A 4OX9Q 3TZUA 4A76A 2B2TA 4RA8A 3G6JB 4JCVE 1N32Q 1WCMB 1CI3M 1GO3E 2QDBA 4DF7A 4LF9Q 5ELCA 3HOXG 1SNOA 5FLXc 1SEBD 4K0KL 1JMCA 4HIKA 3UE0A 1VQKA 4DR6L 4C3JB 1XTDA 4NDXA 1VQIA 1N33L 2B8FA 1PTOB 2K14A 1SE8A 3F8TA 4G7ZC 5I4DA 1IBMQ 1Z47A 2WKCA 3BDCA 2RVLA 3NBHA 4UHVA 1NMFA 4BA2I 2X69A 3KLRA 1GHKA 1O7ZA 3S2HB 2WAQG 5C3EB 4KKUA 1VQOA 2E2HH 4JI8Q 5HY6A 1D1IA 1HQMC 2WAQE 2CKZB 1XXGA 4DXFA 2K05A 1E2VA 3KF6B 1LUZA 4Q0FA 2Z6BA 1I3QH 1H9SA 3PUXA 4JYAQ 4LFBL 4R8IA 3K57A 1XNRQ 1VF7A 3CHBD 4S3SA 4KY6A 1CKOA 2F0FA 1Q8KA 2NYZD 3HOWH 1PRTC 1V9PA 4N9PA 3SEBA 4JI2L 3HKZB 4RGNA 1OXXK 3A0JA 3T1HL 3A8IE 5KNCA 3KFUA 1CA5A 1SFOB 5C4XB 5IOCA 2WFWA 1S40A 3UDXA 4EX5A 4YWLA 4LFAQ 1S5BD 3SK5A 3J80i 1B1ZA 1LLRD 3S17H 3DEOA 2UUBL 1LTLA 1DGSA 4R4IA 3JAME 4EQOA 1J5EL 1LTID 4AYBB 3OIPA 1ZXTA 1NUCA 3NTKA 1NY4A 1C7YA 4JOIA 4L5QA 3ER0A 3RZDB 4UPAA 1GOZA 3PQIA 4A93H 3E6ZX 1IYVA 2F0HA 3KOJA 4LUVA 4RH6A 3BZKA 2LXKA 1AZQA 1I4RA 3S9WA 2KHSA 5IE8A 1VQMA 4Y7NB 4R4CA 4MN3A 4IUTA 3M85A 2UUAQ 1AZPA 2WV6D 1IYUA 5NUCA 4QUCA 4X3UA 4RGMA 4ZK9B 3GTPH 2WACA 3HOWG 2K1BA 3T1YQ 3D6CA 4DV6L 1Z7TA 3UDGA 2LXJA 5GQOA 3D6WA 5CV5A 3KLSX 5M5XB 1A6XA 1Q82C 2V4DA 3AEVA 2OQ0A 5A2QL 1PXUA 1CKNA 4A3EB 4NXMQ 2RDGA 1O7IA 2J7ZA 4A3GG 1S5FD 4IURA 1N9WA 2KCMA 5IY0A 2VQEL 1B4OA 1PYBA 4FF1A 3STBC 4QJFA 1LT6D 1UE6A 1HQRD 1S5CD 2QF7A 1K73C 1OTCA 2JJQA 4YCVA 3DM3A 2GN5A 3CP0A 1D2BA 4A93G 3GV3A 2K5NA 5AJ3Q 1YNXA 4OX9L 1LTSD 2DGYA 2ZXRA 4LK1C 1LTAD 1N32L 4JI0Q 1SBBB 4LF9L 1E0BA 5ELBA 4BWGB 1HNZQ 4FXDA 1AE3A 5EAYA 1STAA 5IGGA 2F0SA 4C3IB 1NCVA 5M3MH 3BJUA 3CD6A 4HMIA 3HOZB 4C2MH 1LM0A 4DV1L 3F2BA 4A4IA 2D2CC 5M3FH 3CPFA 1IBML 3A7LA 1CQFA 1YHAA 1FJGL 3GTOB 4QIWE 4GZYC 4XXEA 1G8ZD 2YTVA 4KJNA 5T1IA 2I0QA 1G6PA 3AFPA 3J80E 2JP1A 4JI8L 5KNBA 4KHVA 2ZJRA 3ULPA 5JOBA 1UUPA 2PNRC 2R6GA 4IJHA 5CV9A 3FKIH 4AH6A 3C3LA 4JYAL 4CJ1B 5I2XA 5JAVA 3SDZA 4LF6Q 1XNRL 2NB0A 1EYCA 3KDFB 4FP5D 1J8IA 2YYZA 1K8OA 1RIPA 3OMGA 3V2TA 4KJOA 1EIHA 1A3TA 4PV1C 1KD1C 5KGUA 1STGA 5C6AA 3I90A 1K83B 1E3PA 2L4NA 2JQOA 2MJ8A 2SOBA 2O5JC 3K6OA 1JOQA 4DN4M 4O0AA 1FGBD 2NVTH 4EQ5A 1G51A 2N49A 3OYYA 4LFAL 3CXCA 4DK6C 1MBYA 5M3MG 1U4PA 4RKBA 4JI6Q 2EVBA 1PFNA 3MTSA 5IGCA 2IHEA 3CC7A 3ULLA 3FDTA 5M3FG 4PZ8A 1N8RC 5M5YB 5A35A 1SYEA 5JEAH 1DXMA 1N34Q 1CM9A 4DV4Q 1ASYA 4IQZA 1TWAB 2RHQB 1Q46A 1HTPA 1SROA 4N8X1 2J4XA 2H1EA 2E2JB 2K32A 3I4MG 1HR0W 5HURA 4HIDA 2FJ2A 4ZYSA 2B39A 2UXBL 2XWBB 3OWEB 5A2QE 3FKIG 4KN7C 1IBLQ 4DXGA 1QNKA 3X3NA 2UUAL 1EQRA 1VMPA 1MSHA 4GOPB 1Z6HA 1AEXA 3CF5A 5JJLA 1Q7YC 3TMEA 2HQLA 2HQEA 2K4KA 5E4XA 1GUSA 3IFDA 5CBEE 4JI4L 4HAEA 5C4JH 1R9TB 1V1OA 2Z4IA 3BZCA 3VYUA 1AP0A 1ZEQX 4Y52H 1VMCA 2IX3A 2KCTA 4YHHQ 4KK7A 1NNXA 3T13A 3CMEA 2AUJD 3HOVH 4NXML 4GNXB 1GHJA 5E7NA 3J7AV 1XX8A 4BBRB 5JPNC 1HNWQ 1XPOA 1L1OC 5GAHC 3GTMH 1B2TA 5E1FA 5JEAG 2RKSA 2UUCQ 4BY1H 3SK4A 1HA5A 1VQAA 3AQQA 1JCKB 2P5ZX 2CVRA 2ATWA 5C3WA 1Q3LA 4R9WA 3D4DA 5AJ3L 1SYFA 5JPMC 4DV3Q 5E3FA 2PQAA 4EVOA 2M00A 3DLLA 1B53A 3RZOH 3K5OA 2PQEA 4LF7Q 1CSQA 1TWFB 2F0GA 4JI0L 3S16B 5CGKA 3K7AH 4DR7Q 1XMOQ 1HFGA 3NEMA 1TWGH 2ZT9C 4R4OA 2PYKA 2A8VA 4KN4C 3PO3G 1HCZA 1C4QA 5ELOA 1AH9A 1CKMA 3I8ZA 1C9OA 1O78A 1KRTA 4P73A 1TVXA 3S14B 1KLUD 2NZHA 4JC0A 4JG2A 1HR0Q 5LHY1 2A68D 1Y8OB 2B2WC 2F0WA 2EYLA 2QW7A 4X6AH 4QCLA 1QB5D 3GTQB 2EJGC 3HOVG 4RKLA 1VQJA 1F9PA 4JW0A 4L8JA 5IT9c 2D9UA 4DUYQ 1MKHA 4KLKA 1L1OB 4BY1G 4N9TA 3IAYA 2N78A 1TR5A 4LF6L 4JPBW 3MEFA 4HCEA 2HUGA 4K8IA 4IFDH 3ND9A 1W6KA 3FMCA 2KEDA 2R3ZA 3K5MA 4A3BH 3I4NB 5CV7A 2R7DA 4C3HH 4NXNL 4UP9A 3AU7A 2ZTCA 3M7GA 4X3TA 3G4SA 3K0XA 4WJ3M 2K52A 4A3LH 1E22A 3TP5A 2F0KA 3OWFA 4R4TA 1BCPF 4F88A 4B9WA 4X65Q 3BS1A 3HOUB 4A3DH 3N6RA 2UXCQ 3J81c 5EJWA 1LABA 3M4YA 4ALPA 1LV9A 2LKVA 1Q1BA 1N34L 4KMUC 4J6HA 2L11A 2KVMA 3QR8A 1EIYB 3EBEA 4IPHA 1FGUA 4XQJA 3H3VH 4LAAA 2NVYH 2FFKB 3VR3A 1V43A 2OWOA 4DR2Q 4GOPA 2OTJA 4HJ5A 1YVCA 5EKLA 1VQLA 3O13A 4PMWA 1OO9B 2F0IA 4N8FA 1PH2A 1V1PB 1IBLL 1VQDA 1O7LA 1Y1VH 1VF5C 4ULLA 4ILWA 1CFMA 4QUFA 1PH4A 2VQFQ 1A8VA 1IL2A 3E5SA 4DR5Q 3SE0A 5CBAE 1D1KA 2PZUA 1WTRA 4IFDG 3KF8B 3H0GB 4A3BG 2BCOA 3CMAA 4C3HG 4GNXA 4LWCA 1QILA 1SAPA 2ZXOA 1KDCA 1HXYD
chains in the Genus database with same CATH topology
2NWGA 4BBSB 1I4HA 4CKEA 2O2LD 3T56B 3BVZA 2R92B 1A2TA 4ID6A 3P7JA 5G3LF 2A6HC 3NE5B 1TU2B 2PZTA 2Q8RE 3GTJB 2KJXA 1GUGA 3U9OA 2QCPX 4K6LA 5D14A 2AQ1B 3T51B 5C5LA 1F2LA 2MP1A 2NVXB 5T1GA 2D62A 3S2DB 2C5CA 1SE4A 3JAML 1CT1D 2IX0A 3U9SA 3TP6A 3OHXC 5FO8B 1VDZA 3GV6A 1PZJD 4G7OC 2NTTA 5CR3A 1CA6A 2DNEA 2L9HA 1PTOD 4DAVA 1CQVA 3FRPB 2K5QA 3J7YW 2K04A 3NPPA 2E74C 5K5PA 2M2LA 4U673 3PUWA 1EU3A 3KBGA 1KABA 4XQQA 2LFNA 1BOSA 3C2PA 4OL7A 1WTQA 2PMZB 3G7LA 2Z1CA 3NTIA 3H91A 3DUZA 1GXDC 2ZXPA 5JVH3 1FR3A 1TY0A 1V1PA 3PO2B 3PUVA 1JE4A 1UAPA 3CQZB 1EZ8A 2K28A 3VR2A 3QIAA 3NXWA 3KF8A 1JORA 1CHQD 1EEID 1HA6A 5I2YA 3T16A 3TZDA 1FNVA 1BCPC 1ENFA 4OHJA 2Q8IB 1B3AA 1I4QA 2FMMA 2CW0C 3A7AB 1NR2A 2F0UA 3BDOA 5FO7B 4K5XA 1BCPD 2D5DA 1SNMA 3NSWA 2CW0D 2DN8A 4J8QA 5KRUA 4OO1H 4ODGA 2NN6I 2SNSA 3S1QB 1OXVA 5I9PA 1F9SA 1LO5D 1PYWD 1DOLA 5C4ZA 1CK1A 3J80L 3M3YB 4XIGS 1PRTD 1V8QA 2XRSD 3CKIB 1HHVA 1SSOA 3QJYA 4ZUJA 3S1NB 3R3OA 1B9MA 3RD4A 1Q1EA 3GTLB 1RTOA 1BUVT 3IL8A 2VUMB 1BNZA 2EJFC 4CBVA 3QWNA 3EA6A 1EQVA 3EFXD 3HGBA 5CV6A 4ABNA 1EZ6A 4MIUA 1BCPB 5FLXE 3BG3A 1JWUD 3GQBA 1BO0A 2BA1A 2WAQB 4C1NI 4K5WA 1TWCB 3VA5A 5EKKA 4OO1G 3DEPA 5IODA 1ENCA 3BVMA 1TIID 1GUWA 1AW7A 4K8JA 1EQTA 5F2DA 1OXTA 1PRTB 4BA1I 2B2UA 2HCCA 2N88A 4NW2A 3NWSA 1L0YB 2NN6H 4KHZA 2QEJC 1ILQA 1KDAA 2OXPA 5EBDA 2LS01 4R8NA 4RAUC 1ZKOA 4E6IA 4F8MA 3CRLC 2FMCA 4C1NK 1JWSD 4CGYB 1I4GA 1RF2D 2K33A 1EFID 3GD7A 4EQPA 1RCVD 5BN5A 3N52A 3FVQA 1EY0A 3PUZA 2VNUD 3D3RA 1IHZA 2O4XA 3PMFA 1A15A 1I3QB 3FPUB 3K5NA 5E4WC 5IGEA 5KIXA 2F0OA 5D3DA 5DM63 1X3PA 3SR1A 4DA2A 3HOWB 1UNSA 5CYUA 4XYQA 1F2MA 3KLSA 1IKMA 1STHA 3SVMA 4YIJA 2NN6G 1S5ED 2NBFA 4G57A 3S17B 2ICIA 1LTTD 4LJZC 4DFAA 1YNNC 4RFBA 2EPBA 4KD4A 4O1NA 1ENAA 2RQXA 1S5DD 2IX1A 3M4OB 1I4XA 1YNND 3V96A 1H9RA 4A93B 4PNYA 2BDOA 3I73A 1ESRA 5KEEA 1EEFD 3WDNA 2L12A 2K03A 1PZKD 1SXTA 4FNFA 2I07B 2R61A 2HCIA 3GTPB 3WOFA 2L55A 4FF2A 1JR0D 4TSSA 4QIWB 2K5WA 1A3VA 3BDLA 5I6YA 3UI2A 5CV8A 1CHPD 3OW7A 3A55A 1QE6A 3VA7A 1X3QA 1JWMD 2KECA 3I91A 5FOBB 2EDGA 1KAAA 1U4LA 3C1EA 1HFNA 4HCSA 3SK6A 1CTMA 3HRZC 4FYDA 1SE3A 1B44D 1STYA 4MHEA 1ET6A 2WB1B 2N55A 4IFDI 1Q90A 3PIO3 1EWHA 2JEAI 4NP5A 3Q23A 3RUZA 5EQ0A 1D5XC 1PMRA 1LTRD 4K2KA 1QWYA 2JA5B 1ET9A 4IUPA 4L63B 5M3MB 3ITPA 4C2MB 1WD1A 5M3FB 3OIQA 2EYPA 4M8AA 3BVGA 3R93A 1O80A 4DU9A 5M9OA 2F03A 1FNUA 3LX0A 2Y0SB 1WTVA 2DNCA 4ZKCB 5C0XG 2EXZA 3QG1A 2F3WA 2K01A 2MHVA 3A8KE 4JBWA 3FKIB 1DZ1A 5ELFA 2O5IC 3J7AF 1KDBA 1E2ZA 4IUNA 1Y69U 3AMUA 3K58A 2EYFA 2IJ0A 2NVTB 1GUTA 3S1RB 1EWCA 2EYMA 3VR4A 2B2TC 1PDQA 2G9DA 1WTOA 4V190 3X3MA 3QB3A 2OEOA 5I6WA 4ME5A 4B08A 1RTNA 1XTCD 2IPKD 3LWEA 4K14A 2RSNA 4CJ2C 3MA2B 4G4KA 4XTCS 3NP8A 1I6VC 1QCBD 2F4IA 4JK1C 1DYQA 1EOTA 5JVG3 4PMCA 3CRKC 1HPCA 4KI0A 4WRDA 5C4JB 5FKAC 3M7NA 2L5TA 3ERQA 3HOYB 1HTLD 2KUMA 2QKIC 3HP3A 3HOVB 3GTGB 3NBIA 1G291 5KYLA 1KNAA 3GTMB 3BYYB 1U4RA 4CJ0B 2EYHA 4C56C 1RKNA 1PFBA 2PPBC 3TN2A 2X6LA 4CKCA 5IT9E 4IUVA 1E2WA 3NQIA 1GJXA 4K6DA 2GA4B 1T5XD 3HEJA 4H7BA 3VR5A 1GUNA 1PZID 3K7AB 1PTOH 1ILPA 1RD9D 1EYDA 1TWGB 2G9HD 5J22A 3H6MA 1TT2A 1SNPA 2EY6A 4KTAA 4I7ZC 3VR6A 3TDQA 5FO9B 2A6HD 3IKJA 1H9SB 4KY7A 3PV0A 3H3VC 5HGTA 4J1MA 1AFPA 2RSOA 1MSGA 3FPPA 4RCNA 4HMJA 1U9RA 2AWOA 2RA4A 1YNJC 2IWHA 3J81E 5DAUA 3R2IA 3D4RA 2KOLA 1YNJD 5CC4A 2E2DC 3MEHA 1H9JA 4KD3A 1MGSA 2RBMA 4A3BB 1G2SA 3Q22A 4C3HB 3QOLA 1XYIA 4C3JG 4OO1I 3EROA 4IN3A 1TS3A 1PFMA 4XT1B 1ICWA 1STEA 5FLXL 2IW3A 1I6HB 3RLFA 5C4HA 2DY8A 4XDXA 2NZ1D 3SK8A 4A3DB 5JEAJ 1I4PA 2L1BA 1BF4A 3LNNA 3W2DA 1C8CA 1EL0A 3TP8A 2NVYB 2FHTA 3I4LA 3MVVA 1WTXA 4A3MB 3NTHA 3OSOA 2B2WA 5JJZA 3DWPA 4LMQD 3MXPA 4RGOS 1QJOA 1Y1VB 1D6EC 5CMDA 3C46A 2QILA 2LY7A 4X3KA 2KEEA 4F87A 1ESFA 3P75A 1JB3A 1F2YA 1M4VA 2PO4A 4ZRZA 1SNDA 1MI2A 2XIWA 4DNRB 2R93B 1DOMA 1OXUA 1BXTA 4RCOA 1F9QA 4KKSA 1PLFA 2EY1A 1HRJA 1IKLA 4DAYA 1EY7A 4QF4A 2E76C 4FF4A 3A8JE 1RODA 5C5MA 4CKBA 1XWEA 2JA8B 4QB4A 3EVQA 4H0LC 5LL6X 4XQNA 1IL8A 2XSCA 1SMYC 4PQXA 2VB3X 2I46A 1SMYD 2KQ3A 5J39A 2K5DA 3P20A 3HOXB 3S15B 1S4ZA 4IUUA 4HTHA 2VB2X 4DNTB 4O42A 3I70A 4FXKC 4FF3A 2OT2A 1DONA 1TQOA 1EY5A 5CV4A 1IW7C 2F3VA 2PZWA 1EY4A 5ELEA 4BS9A 2B2VC 1IW7D 3LWUA 4IFDJ 4HN7A 2WINB 1Q8IA 5G3LD 1D5ZC 2AUKA 2JYOA 4P2CB 4C3IG 2WKDA 5I9OA 3KUPA 3NUCA 2MGSA 2M9VA 5KNDA 2E2IB 2AWNA 4ZAIA 1FNWA 5DM73 4TKOB 1U4MA 2K7VA 3DMUA 1R4QB 3L3OC 4RHRA 2F0PA 2B2YC 4G7HC 3MWYW 5EKIA 3SXHA 5D65A 3RMHA 2XWJB 2EJMA 4A3JB 1SYDA 3MFGA 2BDNA 1SNQA 3P1HA 2EOTA 3MXUA 4IUQA 2F0QA 3QOJA 3KBXA 1B9NA 2E2HB 1LT3D 3Q0AA 2NUCA 1CZWA 5AFWA 4TRDA 1EY9A 2JE6I 5DEHA 3ND8A 2BOSA 3H94A 4KKTA 1EYAA 4ZLTF 4H13C 1G6ZA 3MZ5A 1SJED 1STBA 5C0XI 1KTKA 3URYA 1TY2A 3NQTA 4A3KB 1JOOA 1WTPA 1ONLA 1TKWB 3ONAB 3HS0C 2HDLA 2SNMA 3EQLC 5IGFA 2A73B 2WIIB 4PMBA 1SYBA 3GTKB 3QO2A 3HG9A 4A3GB 2TMPA 1C48A 1TWHB 2IL8A 5EPJA 1BBXC 4IALA 2EY2A 2HDMA 5ELDA 3GO5A 4RHSA 2EYJA 1UEAB 2F0DA 3PUYA 3SHLA 5K36H 1KLGD 2F0JA 2OF1A 4V0BA 3BZDB 2JSOA 4UDUC 4OGQC 1JQYD 4HSPA 4K5VA 5TSSA 3MXGA 4KY5A 2F1MA 4UAIA 2NVQB 3Q24A 3NHHA 3R2TA 2SDFA 1H9MA 3KK7A 3K5LA 2JA6B 1JICA 1SYCA 2EE1A 3ZYYX 5C3XA 2MUYA 2R7ZB 5C0XH 3OOCA 5BN3A 1OXSC 3DWQA 1CZGA 3L7ZC 2RDHA 2XN9C 2WP8J 2KCNA 2IT1A 4A3IB 4F7XA 2F0TA 5D3IB 2ID0A 5LL6S 3GP7A 2RDFA 4H44C 5J1ZA 4WFN3 2B8GA 4BY7B 1G91A 4HEDA 4ZUIA 2YU9B 5K36G 5FK9C 1LT5D 3D8GA 2AQ3B 1H9KA 4RGTA 3Q6SA 1ZYRC 2Z8LA 3D31A 4EQNA 1ZYRD 1DD2A 3DXJC 2TSSA 4HSVA 2B2VA 2A5HA 3IFTA 1EU4A 1LTGD 3VYRA 5IT9L 3A56A 1DOKA 3H09A 1I50B 2JXMB 5COYA 2ENBA 1LACA 1TS5A 4DGZA 2MPMA 3MHBA 3MAQA 3I4MB 4L6TB 1PTOF 3VYTA 1RDPD 2L0CA 1TS4A 3I3CA 3T4AC 4U68A 3L9AX 1F2ZA 2B2YA 4NKLA 5IIFA 1KNEA 4XT3B 4HR7B 1WVLA 2F0NA 3E0JA 5EPLA 3I72A 2Q8TA 4NMZA 2CHBD 2A68C 3DM1A 2JEBI 1NAPA 3J81L 2A74C 3C1FA 4IZ8A 1TS2A 3EJIA 2XVSA 2BE5C 2B63B 1Y1WB 4KV6A 2F0VA 2Z4HA 3CU7A 1II3A 2BE5D 4Q5VA 1WD0A 4Z9CB 1ML0D 2VXWA 4RWSC 1BQQT 3DHQA 1DCZA 3TSSA 1BDOA 1DM0B 1SNCA 2A6EC 4WJWA 5ISRA 4I65A 3PO3B 1RHPA 2A6ED 5EGTA 1K8MA 2J0TD 1DJRD 2JA7B 1R4PB 1SE2A 2PCFB 2AQ2B 3K0YA 1STNA 3K59A 1A3UA 1J9OA 2X6GA 1M8AA 2EZVA 1SYGA 3AB9A 5DNFA 5EPKA 1MD2D 1FYCA 1JOKA 3FEWX 4X3SA 1PRTF 4M1UB 1A2UA 3NK9A 4BY1B 1SJHD 2F0LA 3TP7A 1AN8A 1NSNS 3F2UA 2K6AA 2LMCB 2PW5A 3MFYA 1EY8A 1QG7A 4OIKA 3S1MB 3RZOB 3DWAA 3T53B 2FINB 4K2LA 1F77A 2EYOA 4EGVA 4DK1A 4XYOA 2BA0A 1B50A 2A69C 2CQAA 3MC0B 1F9RA 1GUOA 2PW7A 2E75C 1EY6A 4TQUS 4FVMA 2A69D 5IGDA 1EIGA 2DY7A 1W6JA 3D4WA 1RJTA 4A3FB 1Y8PB 3R8BA 4FO2A 4OIJA 2B2UC 1HUNA 1QOHA 4CHTB 5KYIA 3HZXA 5C44B 3PIP3 5IGBA 1X32A 1Q12A 1O7YA 1FD7D 3WOEA 1WTWA 3W3AA 3VYSA 5M5WB 4DAPA 5CORA 1D5MC 3OPOA 1T5EA 2SEBD 2ICEC 3TBIB 1SDFA 3BYTB 1L0XB 3V05A 1PTOC 5BN4A 2C9OA 4DK0A 4ZQ3A 2NTSA 2F0EA 1LT4D 3A54A 1Y8NB 2H4OA 3NWTA 3OMCA 4ZKBB 3MXNA 4FXGC 1G2TA 1LTBD 2KCCA 4QMGA 2XNAC 4WORA 4B9XA 1HUMA 2EY5A 5EBCA 2F0MA 1JC7A 1BR9A 5C0XJ 1VCIA 2KA7A 1NR4A 1QNUA 2XRQD 3TZUA 2B2TA 4RA8A 3G6JB 1WCMB 1CI3M 2QDBA 4DF7A 5ELCA 1SNOA 1SEBD 4C3JB 4NDXA 2B8FA 1PTOB 4G7ZC 5I4DA 1Z47A 2WKCA 3BDCA 2RVLA 3NBHA 4BA2I 2X69A 3KLRA 1GHKA 1O7ZA 3S2HB 5C3EB 4KKUA 1D1IA 1HQMC 1XXGA 4DXFA 2K05A 1E2VA 4Q0FA 1H9SA 3PUXA 4R8IA 3K57A 1VF7A 3CHBD 4S3SA 4KY6A 2F0FA 2NYZD 1PRTC 4N9PA 3SEBA 3HKZB 4RGNA 1OXXK 3A8IE 5KNCA 1CA5A 1SFOB 5C4XB 5IOCA 1S5BD 3SK5A 1B1ZA 1LLRD 3DEOA 3JAME 4EQOA 1LTID 4AYBB 3OIPA 1ZXTA 1NUCA 3NTKA 3RZDB 1GOZA 3E6ZX 1IYVA 2F0HA 4RH6A 1AZQA 1I4RA 3S9WA 2KHSA 4Y7NB 4MN3A 4IUTA 3M85A 1AZPA 2WV6D 1IYUA 5NUCA 4QUCA 4X3UA 4RGMA 4ZK9B 2WACA 2K1BA 3D6CA 1Z7TA 3D6WA 5CV5A 3KLSX 5M5XB 1A6XA 2V4DA 5A2QL 1PXUA 4A3EB 2RDGA 2J7ZA 1S5FD 4IURA 1B4OA 4FF1A 1LT6D 1HQRD 1S5CD 2QF7A 1D2BA 3GV3A 1LTSD 2ZXRA 4LK1C 1LTAD 1SBBB 1E0BA 5ELBA 4BWGB 4FXDA 1STAA 5IGGA 2F0SA 4C3IB 1NCVA 4HMIA 3HOZB 2D2CC 3A7LA 1CQFA 3GTOB 4GZYC 4XXEA 1G8ZD 4KJNA 5T1IA 3J80E 2JP1A 5KNBA 4KHVA 5JOBA 1UUPA 2PNRC 2R6GA 5CV9A 3C3LA 4CJ1B 5I2XA 5JAVA 3SDZA 2NB0A 1EYCA 1J8IA 4FP5D 2YYZA 1K8OA 3OMGA 3V2TA 4KJOA 1EIHA 1A3TA 4PV1C 5KGUA 1STGA 5C6AA 3I90A 1K83B 2L4NA 2MJ8A 2SOBA 2O5JC 3K6OA 1JOQA 4DN4M 1FGBD 1MBYA 1U4PA 4RKBA 2EVBA 1PFNA 3MTSA 5IGCA 3FDTA 5M5YB 5A35A 1SYEA 5JEAH 1DXMA 1CM9A 4IQZA 1TWAB 1HTPA 2J4XA 2H1EA 2E2JB 2K32A 5HURA 2FJ2A 4ZYSA 2B39A 2XWBB 3OWEB 5A2QE 4KN7C 4DXGA 1QNKA 3X3NA 1VMPA 1MSHA 1Z6HA 1AEXA 3TMEA 2HQEA 5E4XA 1GUSA 3IFDA 5CBEE 4HAEA 1R9TB 1V1OA 2Z4IA 3VYUA 1AP0A 1ZEQX 1VMCA 2IX3A 4KK7A 3T13A 2AUJD 1GHJA 3J7AV 1XX8A 4BBRB 5JPNC 1B2TA 5E1FA 5JEAG 2RKSA 3SK4A 1HA5A 1JCKB 2CVRA 5C3WA 1Q3LA 4R9WA 3D4DA 1SYFA 5JPMC 5E3FA 4EVOA 2M00A 1B53A 3K5OA 2PQEA 1TWFB 2F0GA 3S16B 5CGKA 1HFGA 2ZT9C 2PYKA 4KN4C 1HCZA 1C4QA 3I8ZA 1O78A 1TVXA 3S14B 1KLUD 5LHY1 2A68D 1Y8OB 2B2WC 2F0WA 2EYLA 4QCLA 1QB5D 3GTQB 2EJGC 4RKLA 1F9PA 4L8JA 2D9UA 4N9TA 3IAYA 1TR5A 4HCEA 2HUGA 4K8IA 4IFDH 3ND9A 1W6KA 3FMCA 2KEDA 2R3ZA 3K5MA 3I4NB 5CV7A 3AU7A 3M7GA 4X3TA 3TP5A 2F0KA 3OWFA 1BCPF 4F88A 4B9WA 3BS1A 3HOUB 3N6RA 5EJWA 1LABA 3M4YA 1LV9A 2LKVA 1Q1BA 4KMUC 4J6HA 2L11A 2KVMA 4XQJA 4LAAA 3VR3A 2FFKB 1V43A 5EKLA 3O13A 4PMWA 1OO9B 2F0IA 1V1PB 1O7LA 1VF5C 4ULLA 4ILWA 1CFMA 4QUFA 3E5SA 3SE0A 5CBAE 1D1KA 2PZUA 1WTRA 4IFDG 3H0GB 2BCOA 4C3HG 1QILA 1SAPA 2ZXOA 1KDCA 1HXYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYA A;  3BDC A;  4RKB A;  2RDF A;  4WRD A;  5J1Z A;  2KQ3 A;  5J39 A;  5IGC A;  3MZ5 A;  4OL7 A;  1STB A;  4K5W A;  2EYP A;  3DHQ A;  3HZX A;  5KYI A;  5C4H A;  5K5P A;  3ERQ A;  3VA5 A;  2F0W A;  2EYL A;  5EKK A;  1SYE A;  3SK8 A;  4ZUI A;  1SNC A;  4DU9 A;  5M9O A;  5IGB A;  5IOD A;  4DFA A;  1ENC A;  3D8G A;  3LX0 A;  4KD4 A;  1A2T A;  4ID6 A;  5ISR A;  3NQT A;  4HTH A;  1JOO A;  4RKL A;  4K8J A;  5KYL A;  1ENA A;  5F2D A;  2EXZ A;  4I65 A;  2F3W A;  2SNM A;  5EGT A;  1EZ8 A;  3TP8 A;  5CC4 A;  4EQN A;  4PNY A;  1TQO A;  1EY5 A;  5IGF A;  5CV4 A;  2EYH A;  3NXW A;  5HUR A;  5KEE A;  1RKN A;  2F3V A;  3MVV A;  4PMB A;  2PZW A;  4S3S A;  1JOR A;  1SYB A;  1EY4 A;  4N9T A;  1TR5 A;  2PZT A;  4KY6 A;  2F0F A;  3OSO A;  1STN A;  3U9O A;  1A3U A;  4N9P A;  3MXP A;  4K8I A;  1KDB A;  3T16 A;  4IUN A;  4K6D A;  5CV7 A;  4IAL A;  2EY2 A;  4ZQ3 A;  1SYG A;  2F0E A;  5C5L A;  5IOC A;  1STA A;  5IGG A;  3HEJ A;  1AEX A;  4H7B A;  1KDA A;  2OXP A;  2F0U A;  2F0S A;  3TME A;  2ENB A;  2HQE A;  2EYF A;  4R8N A;  4K5X A;  4DGZ A;  1JOK A;  3MHB A;  2EYJ A;  4HMI A;  3SK5 A;  1EYD A;  1SNM A;  4E6I A;  5J22 A;  5I9O A;  4F8M A;  3H6M A;  1A2U A;  3NK9 A;  3OMC A;  1TT2 A;  2EYM A;  2EY6 A;  1SNP A;  3NUC A;  1F2Y A;  3P75 A;  4MIU A;  2F0K A;  3OWF A;  1A3V A;  4KTA A;  3TP5 A;  2F0L A;  2F0D A;  3BDL A;  1SND A;  5KRU A;  4EQO A;  4QMG A;  4ODG A;  3TP7 A;  3SHL A;  2SNS A;  4WOR A;  5CV8 A;  4B9X A;  5I6Y A;  4B9W A;  5I9P A;  1NSN S;  2EY5 A;  2F0J A;  3T13 A;  4KJN A;  2OF1 A;  2F0M A;  3DMU A;  4KY7 A;  1NUC A;  1F2Z A;  3TP6 A;  5HGT A;  4NKL A;  2PW5 A;  4EQP A;  2F0P A;  2LKV A;  4J1M A;  5C4Z A;  1EY8 A;  5IIF A;  4J6H A;  4K5V A;  1KAA A;  4KHV A;  3C1E A;  5CR3 A;  5E1F A;  2F0N A;  3SXH A;  1EY0 A;  4K2L A;  5JOB A;  3QB3 A;  2RKS A;  2EY1 A;  4KY5 A;  2EYO A;  3SK6 A;  4HMJ A;  4LAA A;  1U9R A;  2OEO A;  1SYD A;  5CV9 A;  1IHZ A;  3SK4 A;  4NMZ A;  1STY A;  2F0H A;  2O4X A;  1EY7 A;  3PMF A;  4ZUJ A;  5I6W A;  5EKL A;  3NHH A;  3R3O A;  5DAU A;  5JAV A;  4ME5 A;  4QF4 A;  3S9W A;  2KHS A;  1SNQ A;  2F0I A;  3C1F A;  1EYC A;  3P1H A;  4K14 A;  5IGE A;  5KIX A;  2F0O A;  2PW7 A;  4IZ8 A;  5C5M A;  5C3W A;  3D4D A;  1EY6 A;  1SYF A;  2F0Q A;  3OMG A;  4NP5 A;  3RUZ A;  3EJI A;  5E3F A;  2QDB A;  4KJO A;  3V2T A;  4DF7 A;  1A3T A;  2M00 A;  1SYC A;  3MEH A;  5NUC A;  4EVO A;  3QOJ A;  3SR1 A;  2PQE A;  1SNO A;  5IGD A;  5C3X A;  5KGU A;  1STG A;  5C6A A;  4QB4 A;  2WAC A;  3E5S A;  2F0G A;  4KD3 A;  4K2K A;  3NP8 A;  3EVQ A;  2RBM A;  3D4W A;  2SOB A;  1F2M A;  4KV6 A;  5CGK A;  1JOQ A;  2F0V A;  2PZU A;  1KAB A;  1STH A;  3D6C A;  2NUC A;  1II3 A;  4YIJ A;  1EQV A;  2PYK A;  1EY9 A;  3QOL A;  4NDX A;  4TRD A;  5DEH A;  4G57 A;  3ERO A;  4PMC A;  4F7X A;  5CV6 A;  5CV5 A;  2F0T A;  1EZ6 A;  1KDC A;  3ITP A; 
#chains in the Genus database with same CATH topology
 1X65 A;  2NWG A;  1WTH A;  4BBS B;  1I4H A;  3D0F A;  4CKE A;  2R93 H;  4YHH L;  4DAY B;  2O2L D;  3T56 B;  3BVZ A;  2R92 B;  1A2T A;  4ID6 A;  3P7J A;  4A3D G;  1HNW L;  1KQS A;  2G5D A;  2Q2U A;  5G3L F;  4DV5 Q;  2A6H C;  3CCJ A;  4DR4 Q;  2JK8 A;  1K28 A;  3NE5 B;  5C3E H;  1TU2 B;  3TQY A;  2PZT A;  2Q8R E;  3GTJ B;  2KJX A;  1GUG A;  2JA8 H;  3U9O A;  4DV3 L;  2QCP X;  4K6L A;  5D14 A;  2AQ1 B;  3T51 B;  1PH6 A;  5C5L A;  4L5R C;  1F2L A;  4GN4 B;  4DR7 L;  1XMO L;  2MP1 A;  2NVX B;  5T1G A;  3PGZ A;  2D62 A;  5IP7 G;  3S2D B;  2C5C A;  1P8L A;  3RR5 A;  1EYG A;  1CSP A;  1SE4 A;  3JAM L;  1CT1 D;  2IX0 A;  3S15 H;  2ASB A;  3M4Q A;  1HR0 L;  1HNX Q;  3U9S A;  3TP6 A;  3OHX C;  5FO8 B;  1VDZ A;  3GV6 A;  1PZJ D;  2R93 G;  4G7O C;  2NTT A;  1YZ6 A;  5CR3 A;  1CA6 A;  2DNE A;  2CH4 W;  2L9H A;  1PTO D;  4DAV A;  4IO9 A;  1A63 A;  4B3M L;  1CQV A;  4CDC C;  1UEB A;  4DUY L;  3FRP B;  2K5Q A;  1NE3 A;  3J7Y W;  1S3O A;  1K9M C;  2K04 A;  3NPP A;  2E74 C;  5K5P A;  3EIV A;  2M2L A;  4U67 3;  5C3E G;  3PUW A;  2JA8 G;  1EU3 A;  1WOC A;  3KBG A;  2ZJQ A;  1D7Q A;  2AKW B;  5JJK A;  4NB3 A;  1KAB A;  2YTX A;  2C35 B;  1NTG A;  4XQQ A;  1X6O A;  2ZM6 Q;  2HD3 A;  2LFN A;  2CQO A;  3BU2 A;  3NEL A;  2E2I H;  4GLA C;  1BOS A;  4QL5 A;  4QY7 A;  2Z9H A;  3C2P A;  4OL7 A;  1WTQ A;  3TRZ A;  2PMZ B;  3G7L A;  5FLM H;  2Z1C A;  3NTI A;  3H91 A;  4X65 L;  3K7U C;  3DUZ A;  4YY3 Q;  1GXD C;  3HKZ G;  2ZXP A;  5JVH 3;  1FR3 A;  1TY0 A;  2UXC L;  1V1P A;  3PO2 B;  4ZCK A;  3PUV A;  1JE4 A;  4A3J H;  1UAP A;  3HKZ E;  3CQZ B;  4QGU A;  1EZ8 A;  2K28 A;  1JJG A;  3VR2 A;  3QIA A;  3NXW A;  2ZJP A;  4A3E H;  3PSI A;  3KF8 A;  1JOR A;  1CHQ D;  1EEI D;  3CCM A;  3OW2 A;  1HA6 A;  1PH5 A;  5I2Y A;  3T16 A;  1K8A C;  3TZD A;  1FNV A;  1BCP C;  1ENF A;  1VQC A;  4OHJ A;  2Q8I B;  3UDI A;  2VQF L;  1B3A A;  1I4Q A;  2FMM A;  3M9B A;  2CW0 C;  3A7A B;  1NR2 A;  4UP8 A;  2F0U A;  3BDO A;  5FO7 B;  4DR5 L;  1JJC B;  4K5X A;  4LF4 Q;  1BCP D;  2D5D A;  1SNM A;  3NSW A;  2CW0 D;  2DN8 A;  4J8Q A;  5KRU A;  4OO1 H;  4ODG A;  2NN6 I;  2SNS A;  1E24 A;  3S1Q B;  1OXV A;  1PYS B;  5I9P A;  1F9S A;  4A3K H;  1LO5 D;  1Z9F A;  1PYW D;  1DOL A;  5C4Z A;  1EIF A;  1CK1 A;  3J80 L;  3M3Y B;  5FLM G;  4XIG S;  1PRT D;  3HOZ H;  1V8Q A;  2XRS D;  3CCV A;  2UU9 L;  3CKI B;  1HHV A;  1SSO A;  1IXR A;  3QJY A;  4ZUJ A;  3S1N B;  4A3J G;  3R3O A;  4DV5 L;  1B9M A;  3GTK H;  4DR4 L;  3RD4 A;  1Q1E A;  3GTL B;  3PF5 A;  4A3G H;  1TWH H;  1RTO A;  1M1K C;  1PH3 A;  4A3E G;  1BUV T;  4DV2 Q;  1N36 Q;  3IL8 A;  2OCE A;  1YJ9 A;  3U58 A;  2VUM B;  1GD7 A;  1MJE A;  1BNZ A;  2EJF C;  4CBV A;  1K0R A;  1VQP A;  3J7A 5;  3QWN A;  3EA6 A;  1YJW A;  1L0W A;  1EQV A;  4MTN A;  3EFX D;  1BBU A;  3LGJ A;  4JI1 Q;  3HGB A;  5CV6 A;  4ABN A;  1JB7 A;  4POF A;  1EZ6 A;  4MIU A;  1BCP B;  5FLX E;  3BG3 A;  3G48 A;  1JWU D;  3GQB A;  1BO0 A;  2BA1 A;  2WAQ B;  3I7F A;  4GLX A;  4C1N I;  2NZO A;  4K5W A;  2RHS B;  1TWC B;  1E7Z A;  3VA5 A;  5IYB H;  3RN5 A;  5EKK A;  4OO1 G;  3DEP A;  5IOD A;  1ENC A;  3BVM A;  1HNX L;  1TII D;  1GUW A;  3K8A A;  1AW7 A;  4K8J A;  1EQT A;  1VQ4 A;  4A3K G;  5F2D A;  2NVQ H;  1OXT A;  2QDL A;  1PRT B;  4BA1 I;  4HJ9 A;  3I55 A;  2B2U A;  2HCC A;  3HOZ G;  2MO1 A;  2IHF A;  2N88 A;  2JA6 H;  1XPR A;  3W5O A;  4NW2 A;  2PNH A;  1XNQ Q;  3NWS A;  1L0Y B;  4I7A A;  2R7Z H;  2NN6 H;  3TRE A;  2MQH A;  4KHZ A;  4LF8 Q;  2QEJ C;  1ILQ A;  1KDA A;  2OXP A;  2EQS A;  4A3I H;  5EBD A;  1YHB A;  2LS0 1;  1UWV A;  4R8N A;  4RAU C;  1FVI A;  2ZM6 L;  1ZKO A;  4E6I A;  3STB D;  4F8M A;  3CRL C;  2FMC A;  2ZTE A;  5LMN W;  2Q2H A;  4C1N K;  1JWS D;  4BY7 H;  4CGY B;  1I4G A;  2OQK A;  1RF2 D;  2YU9 H;  3I4O A;  3W1B A;  2K33 A;  1EFI D;  3GD7 A;  5IYD G;  4PZ6 A;  4EQP A;  1RCV D;  4YY3 L;  5BN5 A;  3N52 A;  5IYB G;  3FVQ A;  1EY0 A;  1QUQ B;  3CPW A;  3PUZ A;  2VNU D;  3D3R A;  1IHZ A;  2HIX A;  3ULJ A;  1VQ8 A;  1P16 A;  2O4X A;  1A15 A;  1I3Q B;  3PMF A;  4YCW A;  1K8G A;  1VS0 A;  4MTK A;  5LMU Q;  3FPU B;  3K5N A;  5E4W C;  5IGE A;  3KF6 A;  1A62 A;  4B3R Q;  1KXL A;  5KIX A;  2F0O A;  4YWM A;  5D3D A;  5DM6 3;  1HZ9 A;  1X3F A;  1YBY A;  1X3P A;  4P72 A;  2JA6 G;  3E3X A;  3SR1 A;  4DA2 A;  3HOW B;  1I50 H;  1UNS A;  5CYU A;  1L2F A;  4XYQ A;  1F2M A;  3KLS A;  2MO0 A;  2R7Z G;  1IKM A;  1STH A;  4JBJ A;  3I4M H;  3SVM A;  4YIJ A;  1B3Q A;  2NN6 G;  1S5E D;  2NBF A;  4IOC A;  4G57 A;  1QVG A;  1SMX A;  4A3I G;  4DR3 Q;  1MHW C;  3S17 B;  2ICI A;  3CCQ A;  2F3I A;  1LTT D;  4BY7 G;  4LJZ C;  4DFA A;  1YNN C;  4RFB A;  2EPB A;  4KD4 A;  3WWV A;  3CCU A;  4O1N A;  2QA4 A;  1ENA A;  2RQX A;  3JC6 6;  1S5D D;  4RMF A;  2IX1 A;  3M4O B;  1SN8 A;  1I4X A;  1YNN D;  3V96 A;  1H9R A;  4A93 B;  4L5T A;  4PNY A;  2BDO A;  3I73 A;  1ESR A;  5KEE A;  1BKB A;  1EEF D;  3WDN A;  2L12 A;  2K03 A;  1PZK D;  1VQG A;  1SXT A;  4FNF A;  2B63 H;  1Y1W H;  3KLW A;  4CDF C;  5LMN Q;  4DV2 L;  2I07 B;  2VS1 A;  2R61 A;  2HCI A;  3GTP B;  3WOF A;  2L55 A;  4HIM A;  4FF2 A;  1JR0 D;  4TSS A;  2CCZ A;  4QIW B;  4JI1 L;  2K5W A;  1X3G A;  1A3V A;  3PCO B;  3BDL A;  5I6Y A;  3UI2 A;  5CV8 A;  1XPU A;  2JA9 A;  4YWK A;  1CHP D;  3OW7 A;  4B3T Q;  2VY3 A;  3A55 A;  1QE6 A;  3VA7 A;  1X3Q A;  1JWM D;  2D0O A;  2KEC A;  2K5V A;  3I91 A;  1GVP A;  5FOB B;  3PIO A;  2EDG A;  1KAA A;  1U4L A;  3C1E A;  4OXP A;  3PO3 H;  1HFN A;  4HCS A;  3SK6 A;  3T1Y L;  1CTM A;  3HRZ C;  4FYD A;  2JA7 H;  1SE3 A;  1B44 D;  1STY A;  4MHE A;  1ET6 A;  2WB1 B;  1X54 A;  2N55 A;  1B7Y B;  4IFD I;  3CCR A;  4GKJ Q;  1HJP A;  1Q90 A;  3PIO 3;  1EWH A;  2JEA I;  4NP5 A;  2B3G A;  3Q23 A;  3RUZ A;  1K3R A;  1B70 B;  1NBW A;  1SRU A;  5EQ0 A;  2F4V Q;  1D5X C;  1KC8 C;  1PMR A;  1LTR D;  4K2K A;  2B63 G;  1Y1W G;  1QWY A;  2JA5 B;  4LF8 L;  1ET9 A;  1WJJ A;  4IUP A;  3AFQ A;  4L63 B;  2UXD Q;  5M3M B;  1QZG A;  3ITP A;  4C2M B;  1WD1 A;  5M3F B;  2OTL A;  3OIQ A;  2EYP A;  4M8A A;  3G71 A;  2CWP A;  3BVG A;  2CFM A;  3R93 A;  1O80 A;  4UY8 C;  3S1M H;  4DU9 A;  5M9O A;  2F03 A;  1FNU A;  3LX0 A;  2Y0S B;  3H3V I;  1WTV A;  4POG A;  3AYH B;  1HNZ L;  2DNC A;  2N3S A;  4ZKC B;  5C0X G;  2EXZ A;  3QG1 A;  2F3W A;  4IJL A;  2K01 A;  2MHV A;  2Z0S A;  3A8K E;  4JBW A;  3FKI B;  4LNQ A;  2PI2 A;  1DZ1 A;  5LMU L;  2JA7 G;  5ELF A;  2O5I C;  2R92 H;  3J7A F;  1YEZ A;  1KDB A;  2YV5 A;  1E2Z A;  2GVA A;  4IUN A;  4A3F H;  3KDF A;  4HJ7 A;  2VZA A;  1Y69 U;  4KHP Q;  3AMU A;  3K58 A;  2EYF A;  4DR1 Q;  1HH2 P;  2IJ0 A;  2NVT B;  1GUT A;  3S1R B;  1EWC A;  2EYM A;  1Q81 C;  3VR4 A;  4HJ8 A;  2BH8 A;  5C44 H;  2B2T C;  4DR3 L;  2QGQ A;  5FJ8 H;  3RN2 A;  3J81 i;  1IBK Q;  1PDQ A;  2G9D A;  1WTO A;  4V19 0;  3UE1 A;  3X3M A;  3QB3 A;  4NPS A;  5M5W H;  2OEO A;  3B6Y A;  5I6W A;  4ME5 A;  4B08 A;  1RTN A;  1XTC D;  2IPK D;  3LWE A;  4K14 A;  1QZH A;  1VQH A;  2RSN A;  4CJ2 C;  3MA2 B;  4G4K A;  4X66 Q;  4JI6 L;  2GVB A;  1D8L A;  4XTC S;  3NP8 A;  1I6V C;  3MXN B;  1LYL A;  3KJP A;  5LMN L;  2R92 G;  1EWI A;  2F52 A;  1QCB D;  1WFQ A;  4DV4 L;  4A3F G;  1T9H A;  2F4I A;  1DYQ A;  4JK1 C;  1EOT A;  2B29 A;  2Q2T A;  5JVG 3;  3F2D A;  4PMC A;  3CRK C;  1HPC A;  4KI0 A;  2K5H A;  1VQ9 A;  4WRD A;  5C4J B;  5FKA C;  3M7N A;  2L5T A;  1MJC A;  3PF4 A;  1X56 A;  3E0E A;  3ERQ A;  3HOY B;  1HTL D;  2KUM A;  1XMQ Q;  2QKI C;  3U4V A;  4A75 A;  5C44 G;  3HP3 A;  5FJ8 G;  4B3T L;  1BBW A;  3HOV B;  1J6Q A;  3TEH B;  3GTG B;  3NBI A;  1G29 1;  5KYL A;  1KNA A;  1MIU A;  3GTM B;  3BYY B;  5IP7 H;  4OON A;  2R7F A;  1PFS A;  1U4R A;  4CJ0 B;  2EYH A;  4C56 C;  1YJN A;  2KBN A;  1RKN A;  1PFB A;  2PPB C;  1WCM H;  3TN2 A;  2X6L A;  3Q8D A;  4CKC A;  5IT9 E;  1HZB A;  4IUV A;  1E2W A;  2AMC B;  3NQI A;  1GJX A;  4K6D A;  2GA4 B;  4JOI C;  4AQY Q;  2F4V L;  1T5X D;  4C3J H;  3HEJ A;  1BVS A;  4H7B A;  3VR5 A;  1GUN A;  4JVZ A;  1PZI D;  3K7A B;  1PTO H;  1X9N A;  1ILP A;  1RD9 D;  1EYD A;  1TWG B;  2G9H D;  5J22 A;  3H6M A;  2UUC L;  1TT2 A;  1SNP A;  2EY6 A;  4YCU A;  2UXD L;  4KTA A;  4I7Z C;  3VR6 A;  3S2H H;  3TDQ A;  5FO9 B;  2A6H D;  1QVF A;  3IKJ A;  1PVO A;  1H9S B;  1RL2 A;  3RLN A;  4KY7 A;  3PV0 A;  1PH1 A;  3H3V C;  5HGT A;  2MNA A;  4J1M A;  1AFP A;  1ICF B;  2RSO A;  3ICE A;  4LF7 L;  1MSG A;  3FPP A;  4RCN A;  4HMJ A;  1U9R A;  2AWO A;  2RA4 A;  1YNJ C;  1VQF A;  2IWH A;  1Q86 C;  3J81 E;  1J5E Q;  5DAU A;  3R2I A;  2CWA A;  3D4R A;  4GLV B;  2KOL A;  1YNJ D;  1KRS A;  3F1Z A;  2Z6K C;  5CC4 A;  4LW1 A;  2E2D C;  1JT8 A;  1I5F A;  3MEH A;  1WCM G;  5C4X H;  1SFO H;  3M3Y H;  4BXX H;  1H9J A;  1L1O A;  1GM5 A;  4KD3 A;  1MGS A;  2RBM A;  2E5L Q;  4A3B B;  1PHJ A;  1G2S A;  3Q22 A;  4C3H B;  1ASZ A;  2EXD A;  3QOL A;  4KHP L;  2ALY B;  1CUK A;  4C3J G;  1XYI A;  4OO1 I;  3ERO A;  4IN3 A;  2RF4 A;  1TS3 A;  1PFM A;  4DR1 L;  4XT1 B;  1ICW A;  1VQ7 A;  1STE A;  5FLX L;  3CCL A;  1XJV A;  2IW3 A;  1I6H B;  3RLF A;  5C4H A;  2DY8 A;  4XDX A;  2NZ1 D;  4B3S Q;  4APV A;  3SK8 A;  3RZD H;  4A3D B;  5JEA J;  1I4P A;  2L1B A;  1BF4 A;  1IBK L;  3LNN A;  3W2D A;  1C8C A;  1EL0 A;  4CDE C;  4JBM A;  3U50 C;  3TP8 A;  1AE2 A;  2NVY B;  4Y7N H;  2FHT A;  3I4L A;  3MVV A;  1WTX A;  3OTO Q;  4A3M B;  3NTH A;  3OSO A;  5IWA Q;  2B2W A;  5JJZ A;  3DWP A;  5JJI A;  4LMQ D;  3MXP A;  4LUZ A;  4RGO S;  1QJO A;  4X66 L;  2ES2 A;  1Y1V B;  2FXQ A;  4A3C G;  1D6E C;  5CMD A;  1PA6 A;  3C46 A;  2QIL A;  4BXX G;  5C4X G;  2LY7 A;  4X3K A;  1CKN B;  2KEE A;  3UDF A;  1E1O A;  4F87 A;  1ESF A;  5M5X H;  1SR3 A;  3P75 A;  1JB3 A;  1F2Y A;  1M4V A;  4DR2 L;  2PO4 A;  4ZRZ A;  1SND A;  1YHQ A;  5H1S E;  1MI2 A;  2A1A A;  2XIW A;  4AYB G;  4DNR B;  2R93 B;  1XMQ L;  1DOM A;  2VUM G;  1OXU A;  1BXT A;  4AYB E;  1GKH A;  4RCO A;  1F9Q A;  4KKS A;  1PLF A;  4LUO A;  1K0S A;  2EY1 A;  4DV1 Q;  2HHH Q;  1HRJ A;  4PG3 A;  1IKL A;  4DAY A;  1PH7 A;  1EY7 A;  4X64 Q;  1VQN A;  1FJG Q;  4QF4 A;  2E76 C;  4FF4 A;  3A8J E;  1ROD A;  3KJO A;  4JI7 Q;  5C5M A;  4CKB A;  3GDE A;  4DNI A;  1XWE A;  4IOA A;  2JA8 B;  5GAG C;  4DAM A;  4DV0 Q;  4QB4 A;  2H5X A;  3EVQ A;  4OEM B;  4RG1 A;  2L15 A;  4C3I H;  4H0L C;  4AQY L;  5LL6 X;  5ELN A;  1U0L A;  4X62 Q;  4XQN A;  1IL8 A;  2XSC A;  2Q2I A;  1SMY C;  3E9I A;  4DK3 C;  4PQX A;  5GRO A;  2VB3 X;  3GTO H;  2I46 A;  2VW9 A;  1HZC A;  1SMY D;  4JI3 Q;  2KQ3 A;  5J39 A;  5J3B A;  2K5D A;  3P20 A;  3HOX B;  3S15 B;  2AHO B;  1S4Z A;  4IUU A;  3FHW A;  4HJA A;  4HTH A;  2XTI A;  2VB2 X;  4DNT B;  4O42 A;  1U5K A;  3I70 A;  4DUZ Q;  4FXK C;  4FF3 A;  4MNO A;  1WI5 A;  2OT2 A;  1DON A;  1TQO A;  1EY5 A;  5CV4 A;  1IW7 C;  3KYH C;  3ZJY C;  2F3V A;  2PZW A;  1EY4 A;  5ELE A;  5IYD H;  4BS9 A;  1I94 Q;  2B2V C;  1IW7 D;  3A5Z B;  1K83 H;  4DV7 Q;  4TVA B;  3LWU A;  1JE5 A;  3G6E A;  4IFD J;  1IZ6 A;  4HN7 A;  2WIN B;  1Q8I A;  1KL9 A;  5G3L D;  3M4O H;  1D5Z C;  2E5L L;  4AIM A;  2AUK A;  2JYO A;  4P2C B;  3M4P A;  4C3I G;  2UXB Q;  2LSS A;  3J80 c;  2WKD A;  5I9O A;  3KUP A;  3NUC A;  2MGS A;  2M9V A;  5KND A;  2E2I B;  2AWN A;  5M5Y H;  2RCF A;  2V1C C;  4ZAI A;  5BR8 Q;  1FNW A;  4GN5 A;  5DM7 3;  4TKO B;  1U4M A;  2K7V A;  3DMU A;  3L3O C;  1R4Q B;  4RHR A;  4B3S L;  1TWA H;  2F0P A;  1X3E A;  2B2Y C;  4JI5 Q;  4G7H C;  3MWY W;  5EKI A;  3SXH A;  5D65 A;  2E2J H;  2E8G A;  4JI4 Q;  3RMH A;  2XWJ B;  2EJM A;  4A3J B;  1SYD A;  2PI2 E;  5IYC H;  4LFC Q;  3MFG A;  2JN4 A;  4IPD A;  2K75 A;  2BDN A;  1SNQ A;  3P1H A;  2EOT A;  2Z6K A;  3MXU A;  4IUQ A;  2F0Q A;  3OTO L;  4R1J A;  2K50 A;  3CCS A;  5GAD C;  3QOJ A;  5IWA L;  3KBX A;  4GS3 A;  2I5M X;  1B9N A;  2E2H B;  1LT3 D;  3Q0A A;  2NUC A;  1CZW A;  5AFW A;  4O2D A;  4TRD A;  1EY9 A;  2JE6 I;  5DEH A;  1R9T H;  3ND8 A;  2BOS A;  3U4Z A;  3H94 A;  4KKT A;  1EYA A;  4ZLT F;  1V1Q A;  4H13 C;  1G6Z A;  3MZ5 A;  1SJE D;  1STB A;  1X55 A;  5C0X I;  1KTK A;  3URY A;  4BBR H;  4LF5 Q;  2VL6 A;  1TY2 A;  2JA5 H;  4GKK Q;  3NQT A;  4A3K B;  1A0I A;  1JOO A;  1WTP A;  1ONL A;  1TKW B;  4PZ7 A;  3ONA B;  4CDD C;  4R4Q A;  3HS0 C;  2PQA B;  2HDL A;  2SNM A;  3EQL C;  2HHH L;  1YI2 A;  5IGF A;  1KIX A;  2A73 B;  2WII B;  2DJF C;  4LF4 L;  1TXY A;  4PMB A;  4X64 L;  1SYB A;  4HIO A;  3GTK B;  3CAM A;  3QO2 A;  3HG9 A;  5IYC G;  4JI7 L;  4A3G B;  2TMP A;  1TWF H;  3RNU A;  1C48 A;  1TWH B;  3S16 H;  2IL8 A;  1W3S A;  5EPJ A;  1BBX C;  4IAL A;  2EY2 A;  4IPG A;  4DV0 L;  2HDM A;  5ELD A;  3CW2 C;  3CCE A;  1EFW A;  1C0A A;  3GO5 A;  4RHS A;  2EYJ A;  4X62 L;  1EOV A;  4GOP C;  2WB1 G;  3S14 H;  2KEN A;  1UEA B;  2F0D A;  3PUY A;  3SHL A;  5K36 H;  3VDY A;  1KLG D;  1HZA A;  2WB1 E;  3RLO A;  4JI3 L;  2F0J A;  2OF1 A;  4V0B A;  3BZD B;  4NXN Q;  3GTQ H;  2JSO A;  4UDU C;  4OGQ C;  1N36 L;  1JQY D;  4HSP A;  4K5V A;  4BBR G;  5TSS A;  1IYJ B;  3MXG A;  2JA5 G;  4KY5 A;  2F1M A;  4UAI A;  3S1R H;  1VQB A;  2DUD A;  4DUZ L;  4GNX C;  2NVQ B;  3TS2 A;  3Q24 A;  3NHH A;  3R2T A;  2SDF A;  1H9M A;  3KK7 A;  2DJG C;  3K5L A;  2JA6 B;  1JIC A;  1SYC A;  3I4N H;  2EE1 A;  1I94 L;  3ZYY X;  3HKS A;  5HGQ A;  5C3X A;  2MUY A;  4DV7 L;  2R7Z B;  5C0X H;  3OOC A;  5BN3 A;  1OXS C;  2Y0S G;  3DWQ A;  1YIJ A;  2EIF A;  1CZG A;  3L7Z C;  4GN3 B;  2RDH A;  2XN9 C;  2WP8 J;  2KCN A;  2IT1 A;  2Y0S E;  4A3I B;  2KHI A;  4F7X A;  2F0T A;  5D3I B;  4MZ9 A;  2ID0 A;  2IY5 B;  3S24 A;  5LL6 S;  3GP7 A;  4DPG A;  2RDF A;  3SGI A;  4H44 C;  5J1Z A;  3HOU H;  4WFN 3;  2B8G A;  4BY7 B;  1G91 A;  5BR8 L;  2A19 A;  3HFZ B;  4HED A;  1XNQ L;  4ZUI A;  2YU9 B;  1PV4 A;  5K36 G;  5FK9 C;  1LT5 D;  3D8G A;  3A5U A;  2AQ3 B;  1H9K A;  4RGT A;  3Q6S A;  1NJI C;  4JI5 L;  1VQE A;  1ZYR C;  3I56 A;  1EQQ A;  2Z8L A;  3D31 A;  4EQN A;  4H02 A;  1ZYR D;  1DD2 A;  1PH9 A;  3DXJ C;  4LFC L;  2TSS A;  3HOY H;  4HSV A;  1QUQ A;  2B2V A;  2I5H A;  1NMG A;  2A5H A;  3IFT A;  1EU4 A;  1LTG D;  3VYR A;  2MFI A;  3GTG H;  5IT9 L;  3A56 A;  1DOK A;  3H09 A;  1I50 B;  3H0G H;  2JXM B;  5COY A;  3I4N G;  2ENB A;  1LAC A;  1TS5 A;  4DGZ A;  2MPM A;  3MHB A;  3MAQ A;  3I4M B;  5GAE C;  4L6T B;  4BBS H;  1PTO F;  3J7Z C;  3VYT A;  1RDP D;  3E9H A;  2L0C A;  1TS4 A;  5IP9 H;  3I3C A;  3T4A C;  3CC2 A;  4B3R L;  4U68 A;  3L9A X;  4OWW B;  2HIV A;  3HOU G;  1F2Z A;  2B2Y A;  4LF5 L;  4NKL A;  5IIF A;  1KNE A;  4XT3 B;  4HR7 B;  1QVC A;  1WVL A;  4GKK L;  2F0N A;  3E0J A;  5EPL A;  3I72 A;  3K80 C;  2Q8T A;  1WYD A;  1VQ6 A;  4NMZ A;  2CHB D;  4JV5 Q;  2A68 C;  2XGT A;  2JEB I;  3DM1 A;  2D0P A;  1NAP A;  3GTJ H;  3J81 L;  4WJ4 A;  2A74 C;  3C1F A;  4IZ8 A;  1SLJ A;  1TS2 A;  3EJI A;  2BH2 A;  1YIT A;  2XVS A;  3HOY G;  2BE5 C;  2B63 B;  1Y1W B;  4P71 A;  4KV6 A;  2F0V A;  2Z4H A;  3CU7 A;  4B3M Q;  1II3 A;  2NVX H;  2BE5 D;  4Q5V A;  1WD0 A;  4Z9C B;  3H0G G;  1ML0 D;  2VXW A;  3S2D H;  4RWS C;  1BQQ T;  2KHJ A;  1KHI A;  4BBS G;  3DHQ A;  1DCZ A;  3TSS A;  1BDO A;  5IP9 G;  1DM0 B;  1SNC A;  5DLQ E;  5L37 A;  2A6E C;  4WJW A;  5ISR A;  4L5S A;  2N8N A;  4I65 A;  3PO3 B;  3I2Z A;  1RHP A;  2A6E D;  5EGT A;  1K8M A;  2J0T D;  1DJR D;  1I6H H;  2JA7 B;  1R4P B;  1SE2 A;  2PCF B;  1E1T A;  2AQ2 B;  4OEL B;  3K0Y A;  1STN A;  3K59 A;  1A3U A;  1J9O A;  4K0K Q;  2X6G A;  2RCN A;  1M8A A;  2EZV A;  4DR6 Q;  1SYG A;  3AB9 A;  5DNF A;  5EPK A;  4OWT B;  1MD2 D;  1N33 Q;  1FYC A;  1JOK A;  3FEW X;  4X3S A;  1PRT F;  4M1U B;  1A2U A;  3NK9 A;  4A3M H;  4BY1 B;  4ME3 A;  1W2B A;  1FL0 A;  1SJH D;  2F0L A;  3TP7 A;  1AN8 A;  3A74 A;  1NSN S;  4GKJ L;  3F2U A;  2K6A A;  3PO2 H;  2LMC B;  2PW5 A;  3MFY A;  1EY8 A;  1QG7 A;  4OIK A;  1M90 C;  3S1M B;  3RZO B;  3DWA A;  3H15 A;  3T53 B;  3CQZ H;  2FIN B;  3NBH B;  3K81 C;  4K2L A;  4LFB Q;  1F77 A;  2EYO A;  4EGV A;  4UP7 A;  3J81 j;  4DK1 A;  2HT1 A;  4XYO A;  2BA0 A;  1B50 A;  2A69 C;  2CQA A;  3MC0 B;  1F9R A;  3F2C A;  1GUO A;  4A3L G;  2PW7 A;  2E75 C;  1EY6 A;  4JI2 Q;  4FDB A;  4TQU S;  4FVM A;  3T1H Q;  2A69 D;  1JJ2 A;  5IGD A;  1EIG A;  2DY7 A;  1W6J A;  3IRB A;  2UU9 Q;  3D4W A;  1Y14 B;  1RJT A;  4A3F B;  1Y8P B;  3PIP A;  3R8B A;  4FO2 A;  2YTY A;  2I5L X;  4OIJ A;  2UUB Q;  2B2U C;  1HUN A;  1QOH A;  3S1Q H;  1B8A A;  1H95 A;  3ERS X;  4CHT B;  5KYI A;  3HZX A;  5C44 B;  4A3M G;  4A3C H;  3PIP 3;  4P75 A;  5IGB A;  3NEN A;  1X32 A;  1Y1V G;  4IPC A;  2QEX A;  1Q12 A;  2PMZ E;  3PO2 G;  3W1G A;  1O7Y A;  1FD7 D;  1S72 A;  3S1N H;  3WOE A;  1WTW A;  3W3A A;  1UE5 A;  3VYS A;  5M5W B;  4DAP A;  3FP9 A;  3EN2 A;  3GTL H;  5COR A;  1D5M C;  4JV5 L;  4P74 A;  3OPO A;  1T5E A;  3HOX H;  2SEB D;  4OWX B;  2ICE C;  2ZTD A;  3TBI B;  1SDF A;  3BYT B;  2VUM H;  1L0X B;  3V05 A;  1PTO C;  5BN4 A;  2C9O A;  4DK0 A;  1UE7 A;  3JAM i;  4ZQ3 A;  2NTS A;  4DV6 Q;  2F0E A;  1LT4 D;  3A54 A;  1Y8N B;  2H4O A;  1K3B C;  1UE1 A;  3NWT A;  3OMC A;  4ZKB B;  3MXN A;  4FXG C;  1KAW A;  1G2T A;  1LTB D;  3L0O A;  2KCC A;  2CH4 A;  1TWC H;  4QMG A;  2XNA C;  4WOR A;  4B9X A;  3L2P A;  1HUM A;  3TS0 A;  4DKA C;  2EY5 A;  5EBC A;  1VQ5 A;  2VQE Q;  2F0M A;  1JC7 A;  1EUJ A;  1BR9 A;  5C0X J;  3JAM c;  1VCI A;  4QQB X;  3CC4 A;  2KA7 A;  1NR4 A;  1PH8 A;  1QNU A;  2XRQ D;  4JBK A;  4J15 A;  4OX9 Q;  3TZU A;  4A76 A;  2B2T A;  4RA8 A;  3G6J B;  4JCV E;  1N32 Q;  1WCM B;  1CI3 M;  1GO3 E;  2QDB A;  4DF7 A;  4LF9 Q;  5ELC A;  3HOX G;  1SNO A;  5FLX c;  1SEB D;  4K0K L;  1JMC A;  4HIK A;  3UE0 A;  1VQK A;  4DR6 L;  4C3J B;  1XTD A;  4NDX A;  1VQI A;  1N33 L;  2B8F A;  1PTO B;  2K14 A;  1SE8 A;  3F8T A;  4G7Z C;  5I4D A;  1IBM Q;  1Z47 A;  2WKC A;  3BDC A;  2RVL A;  3NBH A;  4UHV A;  1NMF A;  4BA2 I;  2X69 A;  3KLR A;  1GHK A;  1O7Z A;  3S2H B;  2WAQ G;  5C3E B;  4KKU A;  1VQO A;  2E2H H;  4JI8 Q;  5HY6 A;  1D1I A;  1HQM C;  2WAQ E;  2CKZ B;  1XXG A;  4DXF A;  2K05 A;  1E2V A;  3KF6 B;  1LUZ A;  4Q0F A;  2Z6B A;  1I3Q H;  1H9S A;  3PUX A;  4JYA Q;  4LFB L;  4R8I A;  3K57 A;  1XNR Q;  1VF7 A;  3CHB D;  4S3S A;  4KY6 A;  1CKO A;  2F0F A;  1Q8K A;  2NYZ D;  3HOW H;  1PRT C;  1V9P A;  4N9P A;  3SEB A;  4JI2 L;  3HKZ B;  4RGN A;  1OXX K;  3A0J A;  3T1H L;  3A8I E;  5KNC A;  3KFU A;  1CA5 A;  1SFO B;  5C4X B;  5IOC A;  2WFW A;  1S40 A;  3UDX A;  4EX5 A;  4YWL A;  4LFA Q;  1S5B D;  3SK5 A;  3J80 i;  1B1Z A;  1LLR D;  3S17 H;  3DEO A;  2UUB L;  1LTL A;  1DGS A;  4R4I A;  3JAM E;  4EQO A;  1J5E L;  1LTI D;  4AYB B;  3OIP A;  1ZXT A;  1NUC A;  3NTK A;  1NY4 A;  1C7Y A;  4JOI A;  4L5Q A;  3ER0 A;  3RZD B;  4UPA A;  1GOZ A;  3PQI A;  4A93 H;  3E6Z X;  1IYV A;  2F0H A;  3KOJ A;  4LUV A;  4RH6 A;  3BZK A;  2LXK A;  1AZQ A;  1I4R A;  3S9W A;  2KHS A;  5IE8 A;  1VQM A;  4Y7N B;  4R4C A;  4MN3 A;  4IUT A;  3M85 A;  2UUA Q;  1AZP A;  2WV6 D;  1IYU A;  5NUC A;  4QUC A;  4X3U A;  4RGM A;  4ZK9 B;  3GTP H;  2WAC A;  3HOW G;  2K1B A;  3T1Y Q;  3D6C A;  4DV6 L;  1Z7T A;  3UDG A;  2LXJ A;  5GQO A;  3D6W A;  5CV5 A;  3KLS X;  5M5X B;  1A6X A;  1Q82 C;  2V4D A;  3AEV A;  2OQ0 A;  5A2Q L;  1PXU A;  1CKN A;  4A3E B;  4NXM Q;  2RDG A;  1O7I A;  2J7Z A;  4A3G G;  1S5F D;  4IUR A;  1N9W A;  2KCM A;  5IY0 A;  2VQE L;  1B4O A;  1PYB A;  4FF1 A;  3STB C;  4QJF A;  1LT6 D;  1UE6 A;  1HQR D;  1S5C D;  2QF7 A;  1K73 C;  1OTC A;  2JJQ A;  4YCV A;  3DM3 A;  2GN5 A;  3CP0 A;  1D2B A;  4A93 G;  3GV3 A;  2K5N A;  5AJ3 Q;  1YNX A;  4OX9 L;  1LTS D;  2DGY A;  2ZXR A;  4LK1 C;  1LTA D;  1N32 L;  4JI0 Q;  1SBB B;  4LF9 L;  1E0B A;  5ELB A;  4BWG B;  1HNZ Q;  4FXD A;  1AE3 A;  5EAY A;  1STA A;  5IGG A;  2F0S A;  4C3I B;  1NCV A;  5M3M H;  3BJU A;  3CD6 A;  4HMI A;  3HOZ B;  4C2M H;  1LM0 A;  4DV1 L;  3F2B A;  4A4I A;  2D2C C;  5M3F H;  3CPF A;  1IBM L;  3A7L A;  1CQF A;  1YHA A;  1FJG L;  3GTO B;  4QIW E;  4GZY C;  4XXE A;  1G8Z D;  2YTV A;  4KJN A;  5T1I A;  2I0Q A;  1G6P A;  3AFP A;  3J80 E;  2JP1 A;  4JI8 L;  5KNB A;  4KHV A;  2ZJR A;  3ULP A;  5JOB A;  1UUP A;  2PNR C;  2R6G A;  4IJH A;  5CV9 A;  3FKI H;  4AH6 A;  3C3L A;  4JYA L;  4CJ1 B;  5I2X A;  5JAV A;  3SDZ A;  4LF6 Q;  1XNR L;  2NB0 A;  1EYC A;  3KDF B;  4FP5 D;  1J8I A;  2YYZ A;  1K8O A;  1RIP A;  3OMG A;  3V2T A;  4KJO A;  1EIH A;  1A3T A;  4PV1 C;  1KD1 C;  5KGU A;  1STG A;  5C6A A;  3I90 A;  1K83 B;  1E3P A;  2L4N A;  2JQO A;  2MJ8 A;  2SOB A;  2O5J C;  3K6O A;  1JOQ A;  4DN4 M;  4O0A A;  1FGB D;  2NVT H;  4EQ5 A;  1G51 A;  2N49 A;  3OYY A;  4LFA L;  3CXC A;  4DK6 C;  1MBY A;  5M3M G;  1U4P A;  4RKB A;  4JI6 Q;  2EVB A;  1PFN A;  3MTS A;  5IGC A;  2IHE A;  3CC7 A;  3ULL A;  3FDT A;  5M3F G;  4PZ8 A;  1N8R C;  5M5Y B;  5A35 A;  1SYE A;  5JEA H;  1DXM A;  1N34 Q;  1CM9 A;  4DV4 Q;  1ASY A;  4IQZ A;  1TWA B;  2RHQ B;  1Q46 A;  1HTP A;  1SRO A;  4N8X 1;  2J4X A;  2H1E A;  2E2J B;  2K32 A;  3I4M G;  1HR0 W;  5HUR A;  4HID A;  2FJ2 A;  4ZYS A;  2B39 A;  2UXB L;  2XWB B;  3OWE B;  5A2Q E;  3FKI G;  4KN7 C;  1IBL Q;  4DXG A;  1QNK A;  3X3N A;  2UUA L;  1EQR A;  1VMP A;  1MSH A;  4GOP B;  1Z6H A;  1AEX A;  3CF5 A;  5JJL A;  1Q7Y C;  3TME A;  2HQL A;  2HQE A;  2K4K A;  5E4X A;  1GUS A;  3IFD A;  5CBE E;  4JI4 L;  4HAE A;  5C4J H;  1R9T B;  1V1O A;  2Z4I A;  3BZC A;  3VYU A;  1AP0 A;  1ZEQ X;  4Y52 H;  1VMC A;  2IX3 A;  2KCT A;  4YHH Q;  4KK7 A;  1NNX A;  3T13 A;  3CME A;  2AUJ D;  3HOV H;  4NXM L;  4GNX B;  1GHJ A;  5E7N A;  3J7A V;  1XX8 A;  4BBR B;  5JPN C;  1HNW Q;  1XPO A;  1L1O C;  5GAH C;  3GTM H;  1B2T A;  5E1F A;  5JEA G;  2RKS A;  2UUC Q;  4BY1 H;  3SK4 A;  1HA5 A;  1VQA A;  3AQQ A;  1JCK B;  2P5Z X;  2CVR A;  2ATW A;  5C3W A;  1Q3L A;  4R9W A;  3D4D A;  5AJ3 L;  1SYF A;  5JPM C;  4DV3 Q;  5E3F A;  2PQA A;  4EVO A;  2M00 A;  3DLL A;  1B53 A;  3RZO H;  3K5O A;  2PQE A;  4LF7 Q;  1CSQ A;  1TWF B;  2F0G A;  4JI0 L;  3S16 B;  5CGK A;  3K7A H;  4DR7 Q;  1XMO Q;  1HFG A;  3NEM A;  1TWG H;  2ZT9 C;  4R4O A;  2PYK A;  2A8V A;  4KN4 C;  3PO3 G;  1HCZ A;  1C4Q A;  5ELO A;  1AH9 A;  1CKM A;  3I8Z A;  1C9O A;  1O78 A;  1KRT A;  4P73 A;  1TVX A;  3S14 B;  1KLU D;  2NZH A;  4JC0 A;  4JG2 A;  1HR0 Q;  5LHY 1;  2A68 D;  1Y8O B;  2B2W C;  2F0W A;  2EYL A;  2QW7 A;  4X6A H;  4QCL A;  1QB5 D;  3GTQ B;  2EJG C;  3HOV G;  4RKL A;  1VQJ A;  1F9P A;  4JW0 A;  4L8J A;  5IT9 c;  2D9U A;  4DUY Q;  1MKH A;  4KLK A;  1L1O B;  4BY1 G;  4N9T A;  3IAY A;  2N78 A;  1TR5 A;  4LF6 L;  4JPB W;  3MEF A;  4HCE A;  2HUG A;  4K8I A;  4IFD H;  3ND9 A;  1W6K A;  3FMC A;  2KED A;  2R3Z A;  3K5M A;  4A3B H;  3I4N B;  5CV7 A;  2R7D A;  4C3H H;  4NXN L;  4UP9 A;  3AU7 A;  2ZTC A;  3M7G A;  4X3T A;  3G4S A;  3K0X A;  4WJ3 M;  2K52 A;  4A3L H;  1E22 A;  3TP5 A;  2F0K A;  3OWF A;  4R4T A;  1BCP F;  4F88 A;  4B9W A;  4X65 Q;  3BS1 A;  3HOU B;  4A3D H;  3N6R A;  2UXC Q;  3J81 c;  5EJW A;  1LAB A;  3M4Y A;  4ALP A;  1LV9 A;  2LKV A;  1Q1B A;  1N34 L;  4KMU C;  4J6H A;  2L11 A;  2KVM A;  3QR8 A;  1EIY B;  3EBE A;  4IPH A;  1FGU A;  4XQJ A;  3H3V H;  4LAA A;  2NVY H;  2FFK B;  3VR3 A;  1V43 A;  2OWO A;  4DR2 Q;  4GOP A;  2OTJ A;  4HJ5 A;  1YVC A;  5EKL A;  1VQL A;  3O13 A;  4PMW A;  1OO9 B;  2F0I A;  4N8F A;  1PH2 A;  1V1P B;  1IBL L;  1VQD A;  1O7L A;  1Y1V H;  1VF5 C;  4ULL A;  4ILW A;  1CFM A;  4QUF A;  1PH4 A;  2VQF Q;  1A8V A;  1IL2 A;  3E5S A;  4DR5 Q;  3SE0 A;  5CBA E;  1D1K A;  2PZU A;  1WTR A;  4IFD G;  3KF8 B;  3H0G B;  4A3B G;  2BCO A;  3CMA A;  4C3H G;  4GNX A;  4LWC A;  1QIL A;  1SAP A;  2ZXO A;  1KDC A;  1HXY D; 
#chains in the Genus database with same CATH homology
 2NWG A;  4BBS B;  1I4H A;  4CKE A;  2O2L D;  3T56 B;  3BVZ A;  2R92 B;  1A2T A;  4ID6 A;  3P7J A;  5G3L F;  2A6H C;  3NE5 B;  1TU2 B;  2PZT A;  2Q8R E;  3GTJ B;  2KJX A;  1GUG A;  3U9O A;  2QCP X;  4K6L A;  5D14 A;  2AQ1 B;  3T51 B;  5C5L A;  1F2L A;  2MP1 A;  2NVX B;  5T1G A;  2D62 A;  3S2D B;  2C5C A;  1SE4 A;  3JAM L;  1CT1 D;  2IX0 A;  3U9S A;  3TP6 A;  3OHX C;  5FO8 B;  1VDZ A;  3GV6 A;  1PZJ D;  4G7O C;  2NTT A;  5CR3 A;  1CA6 A;  2DNE A;  2L9H A;  1PTO D;  4DAV A;  1CQV A;  3FRP B;  2K5Q A;  3J7Y W;  2K04 A;  3NPP A;  2E74 C;  5K5P A;  2M2L A;  4U67 3;  3PUW A;  1EU3 A;  3KBG A;  1KAB A;  4XQQ A;  2LFN A;  1BOS A;  3C2P A;  4OL7 A;  1WTQ A;  2PMZ B;  3G7L A;  2Z1C A;  3NTI A;  3H91 A;  3DUZ A;  1GXD C;  2ZXP A;  5JVH 3;  1FR3 A;  1TY0 A;  1V1P A;  3PO2 B;  3PUV A;  1JE4 A;  1UAP A;  3CQZ B;  1EZ8 A;  2K28 A;  3VR2 A;  3QIA A;  3NXW A;  3KF8 A;  1JOR A;  1CHQ D;  1EEI D;  1HA6 A;  5I2Y A;  3T16 A;  3TZD A;  1FNV A;  1BCP C;  1ENF A;  4OHJ A;  2Q8I B;  1B3A A;  1I4Q A;  2FMM A;  2CW0 C;  3A7A B;  1NR2 A;  2F0U A;  3BDO A;  5FO7 B;  4K5X A;  1BCP D;  2D5D A;  1SNM A;  3NSW A;  2CW0 D;  2DN8 A;  4J8Q A;  5KRU A;  4OO1 H;  4ODG A;  2NN6 I;  2SNS A;  3S1Q B;  1OXV A;  5I9P A;  1F9S A;  1LO5 D;  1PYW D;  1DOL A;  5C4Z A;  1CK1 A;  3J80 L;  3M3Y B;  4XIG S;  1PRT D;  1V8Q A;  2XRS D;  3CKI B;  1HHV A;  1SSO A;  3QJY A;  4ZUJ A;  3S1N B;  3R3O A;  1B9M A;  3RD4 A;  1Q1E A;  3GTL B;  1RTO A;  1BUV T;  3IL8 A;  2VUM B;  1BNZ A;  2EJF C;  4CBV A;  3QWN A;  3EA6 A;  1EQV A;  3EFX D;  3HGB A;  5CV6 A;  4ABN A;  1EZ6 A;  4MIU A;  1BCP B;  5FLX E;  3BG3 A;  1JWU D;  3GQB A;  1BO0 A;  2BA1 A;  2WAQ B;  4C1N I;  4K5W A;  1TWC B;  3VA5 A;  5EKK A;  4OO1 G;  3DEP A;  5IOD A;  1ENC A;  3BVM A;  1TII D;  1GUW A;  1AW7 A;  4K8J A;  1EQT A;  5F2D A;  1OXT A;  1PRT B;  4BA1 I;  2B2U A;  2HCC A;  2N88 A;  4NW2 A;  3NWS A;  1L0Y B;  2NN6 H;  4KHZ A;  2QEJ C;  1ILQ A;  1KDA A;  2OXP A;  5EBD A;  2LS0 1;  4R8N A;  4RAU C;  1ZKO A;  4E6I A;  4F8M A;  3CRL C;  2FMC A;  4C1N K;  1JWS D;  4CGY B;  1I4G A;  1RF2 D;  2K33 A;  1EFI D;  3GD7 A;  4EQP A;  1RCV D;  5BN5 A;  3N52 A;  3FVQ A;  1EY0 A;  3PUZ A;  2VNU D;  3D3R A;  1IHZ A;  2O4X A;  3PMF A;  1A15 A;  1I3Q B;  3FPU B;  3K5N A;  5E4W C;  5IGE A;  5KIX A;  2F0O A;  5D3D A;  5DM6 3;  1X3P A;  3SR1 A;  4DA2 A;  3HOW B;  1UNS A;  5CYU A;  4XYQ A;  1F2M A;  3KLS A;  1IKM A;  1STH A;  3SVM A;  4YIJ A;  2NN6 G;  1S5E D;  2NBF A;  4G57 A;  3S17 B;  2ICI A;  1LTT D;  4LJZ C;  4DFA A;  1YNN C;  4RFB A;  2EPB A;  4KD4 A;  4O1N A;  1ENA A;  2RQX A;  1S5D D;  2IX1 A;  3M4O B;  1I4X A;  1YNN D;  3V96 A;  1H9R A;  4A93 B;  4PNY A;  2BDO A;  3I73 A;  1ESR A;  5KEE A;  1EEF D;  3WDN A;  2L12 A;  2K03 A;  1PZK D;  1SXT A;  4FNF A;  2I07 B;  2R61 A;  2HCI A;  3GTP B;  3WOF A;  2L55 A;  4FF2 A;  1JR0 D;  4TSS A;  4QIW B;  2K5W A;  1A3V A;  3BDL A;  5I6Y A;  3UI2 A;  5CV8 A;  1CHP D;  3OW7 A;  3A55 A;  1QE6 A;  3VA7 A;  1X3Q A;  1JWM D;  2KEC A;  3I91 A;  5FOB B;  2EDG A;  1KAA A;  1U4L A;  3C1E A;  1HFN A;  4HCS A;  3SK6 A;  1CTM A;  3HRZ C;  4FYD A;  1SE3 A;  1B44 D;  1STY A;  4MHE A;  1ET6 A;  2WB1 B;  2N55 A;  4IFD I;  1Q90 A;  3PIO 3;  1EWH A;  2JEA I;  4NP5 A;  3Q23 A;  3RUZ A;  5EQ0 A;  1D5X C;  1PMR A;  1LTR D;  4K2K A;  1QWY A;  2JA5 B;  1ET9 A;  4IUP A;  4L63 B;  5M3M B;  3ITP A;  4C2M B;  1WD1 A;  5M3F B;  3OIQ A;  2EYP A;  4M8A A;  3BVG A;  3R93 A;  1O80 A;  4DU9 A;  5M9O A;  2F03 A;  1FNU A;  3LX0 A;  2Y0S B;  1WTV A;  2DNC A;  4ZKC B;  5C0X G;  2EXZ A;  3QG1 A;  2F3W A;  2K01 A;  2MHV A;  3A8K E;  4JBW A;  3FKI B;  1DZ1 A;  5ELF A;  2O5I C;  3J7A F;  1KDB A;  1E2Z A;  4IUN A;  1Y69 U;  3AMU A;  3K58 A;  2EYF A;  2IJ0 A;  2NVT B;  1GUT A;  3S1R B;  1EWC A;  2EYM A;  3VR4 A;  2B2T C;  1PDQ A;  2G9D A;  1WTO A;  4V19 0;  3X3M A;  3QB3 A;  2OEO A;  5I6W A;  4ME5 A;  4B08 A;  1RTN A;  1XTC D;  2IPK D;  3LWE A;  4K14 A;  2RSN A;  4CJ2 C;  3MA2 B;  4G4K A;  4XTC S;  3NP8 A;  1I6V C;  1QCB D;  2F4I A;  4JK1 C;  1DYQ A;  1EOT A;  5JVG 3;  4PMC A;  3CRK C;  1HPC A;  4KI0 A;  4WRD A;  5C4J B;  5FKA C;  3M7N A;  2L5T A;  3ERQ A;  3HOY B;  1HTL D;  2KUM A;  2QKI C;  3HP3 A;  3HOV B;  3GTG B;  3NBI A;  1G29 1;  5KYL A;  1KNA A;  3GTM B;  3BYY B;  1U4R A;  4CJ0 B;  2EYH A;  4C56 C;  1RKN A;  1PFB A;  2PPB C;  3TN2 A;  2X6L A;  4CKC A;  5IT9 E;  4IUV A;  1E2W A;  3NQI A;  1GJX A;  4K6D A;  2GA4 B;  1T5X D;  3HEJ A;  4H7B A;  3VR5 A;  1GUN A;  1PZI D;  3K7A B;  1PTO H;  1ILP A;  1RD9 D;  1EYD A;  1TWG B;  2G9H D;  5J22 A;  3H6M A;  1TT2 A;  1SNP A;  2EY6 A;  4KTA A;  4I7Z C;  3VR6 A;  3TDQ A;  5FO9 B;  2A6H D;  3IKJ A;  1H9S B;  4KY7 A;  3PV0 A;  3H3V C;  5HGT A;  4J1M A;  1AFP A;  2RSO A;  1MSG A;  3FPP A;  4RCN A;  4HMJ A;  1U9R A;  2AWO A;  2RA4 A;  1YNJ C;  2IWH A;  3J81 E;  5DAU A;  3R2I A;  3D4R A;  2KOL A;  1YNJ D;  5CC4 A;  2E2D C;  3MEH A;  1H9J A;  4KD3 A;  1MGS A;  2RBM A;  4A3B B;  1G2S A;  3Q22 A;  4C3H B;  3QOL A;  1XYI A;  4C3J G;  4OO1 I;  3ERO A;  4IN3 A;  1TS3 A;  1PFM A;  4XT1 B;  1ICW A;  1STE A;  5FLX L;  2IW3 A;  1I6H B;  3RLF A;  5C4H A;  2DY8 A;  4XDX A;  2NZ1 D;  3SK8 A;  4A3D B;  5JEA J;  1I4P A;  2L1B A;  1BF4 A;  3LNN A;  3W2D A;  1C8C A;  1EL0 A;  3TP8 A;  2NVY B;  2FHT A;  3I4L A;  3MVV A;  1WTX A;  4A3M B;  3NTH A;  3OSO A;  2B2W A;  5JJZ A;  3DWP A;  4LMQ D;  3MXP A;  4RGO S;  1QJO A;  1Y1V B;  1D6E C;  5CMD A;  3C46 A;  2QIL A;  2LY7 A;  4X3K A;  2KEE A;  4F87 A;  1ESF A;  3P75 A;  1JB3 A;  1F2Y A;  1M4V A;  2PO4 A;  4ZRZ A;  1SND A;  1MI2 A;  2XIW A;  4DNR B;  2R93 B;  1DOM A;  1OXU A;  1BXT A;  4RCO A;  1F9Q A;  4KKS A;  1PLF A;  2EY1 A;  1HRJ A;  1IKL A;  4DAY A;  1EY7 A;  4QF4 A;  2E76 C;  4FF4 A;  3A8J E;  1ROD A;  5C5M A;  4CKB A;  1XWE A;  2JA8 B;  4QB4 A;  3EVQ A;  4H0L C;  5LL6 X;  4XQN A;  1IL8 A;  2XSC A;  1SMY C;  4PQX A;  2VB3 X;  2I46 A;  1SMY D;  2KQ3 A;  5J39 A;  2K5D A;  3P20 A;  3HOX B;  3S15 B;  1S4Z A;  4IUU A;  4HTH A;  2VB2 X;  4DNT B;  4O42 A;  3I70 A;  4FXK C;  4FF3 A;  2OT2 A;  1DON A;  1TQO A;  1EY5 A;  5CV4 A;  1IW7 C;  2F3V A;  2PZW A;  1EY4 A;  5ELE A;  4BS9 A;  2B2V C;  1IW7 D;  3LWU A;  4IFD J;  4HN7 A;  2WIN B;  1Q8I A;  5G3L D;  1D5Z C;  2AUK A;  2JYO A;  4P2C B;  4C3I G;  2WKD A;  5I9O A;  3KUP A;  3NUC A;  2MGS A;  2M9V A;  5KND A;  2E2I B;  2AWN A;  4ZAI A;  1FNW A;  5DM7 3;  4TKO B;  1U4M A;  2K7V A;  3DMU A;  1R4Q B;  3L3O C;  4RHR A;  2F0P A;  2B2Y C;  4G7H C;  3MWY W;  5EKI A;  3SXH A;  5D65 A;  3RMH A;  2XWJ B;  2EJM A;  4A3J B;  1SYD A;  3MFG A;  2BDN A;  1SNQ A;  3P1H A;  2EOT A;  3MXU A;  4IUQ A;  2F0Q A;  3QOJ A;  3KBX A;  1B9N A;  2E2H B;  1LT3 D;  3Q0A A;  2NUC A;  1CZW A;  5AFW A;  4TRD A;  1EY9 A;  2JE6 I;  5DEH A;  3ND8 A;  2BOS A;  3H94 A;  4KKT A;  1EYA A;  4ZLT F;  4H13 C;  1G6Z A;  3MZ5 A;  1SJE D;  1STB A;  5C0X I;  1KTK A;  3URY A;  1TY2 A;  3NQT A;  4A3K B;  1JOO A;  1WTP A;  1ONL A;  1TKW B;  3ONA B;  3HS0 C;  2HDL A;  2SNM A;  3EQL C;  5IGF A;  2A73 B;  2WII B;  4PMB A;  1SYB A;  3GTK B;  3QO2 A;  3HG9 A;  4A3G B;  2TMP A;  1C48 A;  1TWH B;  2IL8 A;  5EPJ A;  1BBX C;  4IAL A;  2EY2 A;  2HDM A;  5ELD A;  3GO5 A;  4RHS A;  2EYJ A;  1UEA B;  2F0D A;  3PUY A;  3SHL A;  5K36 H;  1KLG D;  2F0J A;  2OF1 A;  4V0B A;  3BZD B;  2JSO A;  4UDU C;  4OGQ C;  1JQY D;  4HSP A;  4K5V A;  5TSS A;  3MXG A;  4KY5 A;  2F1M A;  4UAI A;  2NVQ B;  3Q24 A;  3NHH A;  3R2T A;  2SDF A;  1H9M A;  3KK7 A;  3K5L A;  2JA6 B;  1JIC A;  1SYC A;  2EE1 A;  3ZYY X;  5C3X A;  2MUY A;  2R7Z B;  5C0X H;  3OOC A;  5BN3 A;  1OXS C;  3DWQ A;  1CZG A;  3L7Z C;  2RDH A;  2XN9 C;  2WP8 J;  2KCN A;  2IT1 A;  4A3I B;  4F7X A;  2F0T A;  5D3I B;  2ID0 A;  5LL6 S;  3GP7 A;  2RDF A;  4H44 C;  5J1Z A;  4WFN 3;  2B8G A;  4BY7 B;  1G91 A;  4HED A;  4ZUI A;  2YU9 B;  5K36 G;  5FK9 C;  1LT5 D;  3D8G A;  2AQ3 B;  1H9K A;  4RGT A;  3Q6S A;  1ZYR C;  2Z8L A;  3D31 A;  4EQN A;  1ZYR D;  1DD2 A;  3DXJ C;  2TSS A;  4HSV A;  2B2V A;  2A5H A;  3IFT A;  1EU4 A;  1LTG D;  3VYR A;  5IT9 L;  3A56 A;  1DOK A;  3H09 A;  1I50 B;  2JXM B;  5COY A;  2ENB A;  1LAC A;  1TS5 A;  4DGZ A;  2MPM A;  3MHB A;  3MAQ A;  3I4M B;  4L6T B;  1PTO F;  3VYT A;  1RDP D;  2L0C A;  1TS4 A;  3I3C A;  3T4A C;  4U68 A;  3L9A X;  1F2Z A;  2B2Y A;  4NKL A;  5IIF A;  1KNE A;  4XT3 B;  4HR7 B;  1WVL A;  2F0N A;  3E0J A;  5EPL A;  3I72 A;  2Q8T A;  4NMZ A;  2CHB D;  2A68 C;  3DM1 A;  2JEB I;  1NAP A;  3J81 L;  2A74 C;  3C1F A;  4IZ8 A;  1TS2 A;  3EJI A;  2XVS A;  2BE5 C;  2B63 B;  1Y1W B;  4KV6 A;  2F0V A;  2Z4H A;  3CU7 A;  1II3 A;  2BE5 D;  4Q5V A;  1WD0 A;  4Z9C B;  1ML0 D;  2VXW A;  4RWS C;  1BQQ T;  3DHQ A;  1DCZ A;  3TSS A;  1BDO A;  1DM0 B;  1SNC A;  2A6E C;  4WJW A;  5ISR A;  4I65 A;  3PO3 B;  1RHP A;  2A6E D;  5EGT A;  1K8M A;  2J0T D;  1DJR D;  2JA7 B;  1R4P B;  1SE2 A;  2PCF B;  2AQ2 B;  3K0Y A;  1STN A;  3K59 A;  1A3U A;  1J9O A;  2X6G A;  1M8A A;  2EZV A;  1SYG A;  3AB9 A;  5DNF A;  5EPK A;  1MD2 D;  1FYC A;  1JOK A;  3FEW X;  4X3S A;  1PRT F;  4M1U B;  1A2U A;  3NK9 A;  4BY1 B;  1SJH D;  2F0L A;  3TP7 A;  1AN8 A;  1NSN S;  3F2U A;  2K6A A;  2LMC B;  2PW5 A;  3MFY A;  1EY8 A;  1QG7 A;  4OIK A;  3S1M B;  3RZO B;  3DWA A;  3T53 B;  2FIN B;  4K2L A;  1F77 A;  2EYO A;  4EGV A;  4DK1 A;  4XYO A;  2BA0 A;  1B50 A;  2A69 C;  2CQA A;  3MC0 B;  1F9R A;  1GUO A;  2PW7 A;  2E75 C;  1EY6 A;  4TQU S;  4FVM A;  2A69 D;  5IGD A;  1EIG A;  2DY7 A;  1W6J A;  3D4W A;  1RJT A;  4A3F B;  1Y8P B;  3R8B A;  4FO2 A;  4OIJ A;  2B2U C;  1HUN A;  1QOH A;  4CHT B;  5KYI A;  3HZX A;  5C44 B;  3PIP 3;  5IGB A;  1X32 A;  1Q12 A;  1O7Y A;  1FD7 D;  3WOE A;  1WTW A;  3W3A A;  3VYS A;  5M5W B;  4DAP A;  5COR A;  1D5M C;  3OPO A;  1T5E A;  2SEB D;  2ICE C;  3TBI B;  1SDF A;  3BYT B;  1L0X B;  3V05 A;  1PTO C;  5BN4 A;  2C9O A;  4DK0 A;  4ZQ3 A;  2NTS A;  2F0E A;  1LT4 D;  3A54 A;  1Y8N B;  2H4O A;  3NWT A;  3OMC A;  4ZKB B;  3MXN A;  4FXG C;  1G2T A;  1LTB D;  2KCC A;  4QMG A;  2XNA C;  4WOR A;  4B9X A;  1HUM A;  2EY5 A;  5EBC A;  2F0M A;  1JC7 A;  1BR9 A;  5C0X J;  1VCI A;  2KA7 A;  1NR4 A;  1QNU A;  2XRQ D;  3TZU A;  2B2T A;  4RA8 A;  3G6J B;  1WCM B;  1CI3 M;  2QDB A;  4DF7 A;  5ELC A;  1SNO A;  1SEB D;  4C3J B;  4NDX A;  2B8F A;  1PTO B;  4G7Z C;  5I4D A;  1Z47 A;  2WKC A;  3BDC A;  2RVL A;  3NBH A;  4BA2 I;  2X69 A;  3KLR A;  1GHK A;  1O7Z A;  3S2H B;  5C3E B;  4KKU A;  1D1I A;  1HQM C;  1XXG A;  4DXF A;  2K05 A;  1E2V A;  4Q0F A;  1H9S A;  3PUX A;  4R8I A;  3K57 A;  1VF7 A;  3CHB D;  4S3S A;  4KY6 A;  2F0F A;  2NYZ D;  1PRT C;  4N9P A;  3SEB A;  3HKZ B;  4RGN A;  1OXX K;  3A8I E;  5KNC A;  1CA5 A;  1SFO B;  5C4X B;  5IOC A;  1S5B D;  3SK5 A;  1B1Z A;  1LLR D;  3DEO A;  3JAM E;  4EQO A;  1LTI D;  4AYB B;  3OIP A;  1ZXT A;  1NUC A;  3NTK A;  3RZD B;  1GOZ A;  3E6Z X;  1IYV A;  2F0H A;  4RH6 A;  1AZQ A;  1I4R A;  3S9W A;  2KHS A;  4Y7N B;  4MN3 A;  4IUT A;  3M85 A;  1AZP A;  2WV6 D;  1IYU A;  5NUC A;  4QUC A;  4X3U A;  4RGM A;  4ZK9 B;  2WAC A;  2K1B A;  3D6C A;  1Z7T A;  3D6W A;  5CV5 A;  3KLS X;  5M5X B;  1A6X A;  2V4D A;  5A2Q L;  1PXU A;  4A3E B;  2RDG A;  2J7Z A;  1S5F D;  4IUR A;  1B4O A;  4FF1 A;  1LT6 D;  1HQR D;  1S5C D;  2QF7 A;  1D2B A;  3GV3 A;  1LTS D;  2ZXR A;  4LK1 C;  1LTA D;  1SBB B;  1E0B A;  5ELB A;  4BWG B;  4FXD A;  1STA A;  5IGG A;  2F0S A;  4C3I B;  1NCV A;  4HMI A;  3HOZ B;  2D2C C;  3A7L A;  1CQF A;  3GTO B;  4GZY C;  4XXE A;  1G8Z D;  4KJN A;  5T1I A;  3J80 E;  2JP1 A;  5KNB A;  4KHV A;  5JOB A;  1UUP A;  2PNR C;  2R6G A;  5CV9 A;  3C3L A;  4CJ1 B;  5I2X A;  5JAV A;  3SDZ A;  2NB0 A;  1EYC A;  1J8I A;  4FP5 D;  2YYZ A;  1K8O A;  3OMG A;  3V2T A;  4KJO A;  1EIH A;  1A3T A;  4PV1 C;  5KGU A;  1STG A;  5C6A A;  3I90 A;  1K83 B;  2L4N A;  2MJ8 A;  2SOB A;  2O5J C;  3K6O A;  1JOQ A;  4DN4 M;  1FGB D;  1MBY A;  1U4P A;  4RKB A;  2EVB A;  1PFN A;  3MTS A;  5IGC A;  3FDT A;  5M5Y B;  5A35 A;  1SYE A;  5JEA H;  1DXM A;  1CM9 A;  4IQZ A;  1TWA B;  1HTP A;  2J4X A;  2H1E A;  2E2J B;  2K32 A;  5HUR A;  2FJ2 A;  4ZYS A;  2B39 A;  2XWB B;  3OWE B;  5A2Q E;  4KN7 C;  4DXG A;  1QNK A;  3X3N A;  1VMP A;  1MSH A;  1Z6H A;  1AEX A;  3TME A;  2HQE A;  5E4X A;  1GUS A;  3IFD A;  5CBE E;  4HAE A;  1R9T B;  1V1O A;  2Z4I A;  3VYU A;  1AP0 A;  1ZEQ X;  1VMC A;  2IX3 A;  4KK7 A;  3T13 A;  2AUJ D;  1GHJ A;  3J7A V;  1XX8 A;  4BBR B;  5JPN C;  1B2T A;  5E1F A;  5JEA G;  2RKS A;  3SK4 A;  1HA5 A;  1JCK B;  2CVR A;  5C3W A;  1Q3L A;  4R9W A;  3D4D A;  1SYF A;  5JPM C;  5E3F A;  4EVO A;  2M00 A;  1B53 A;  3K5O A;  2PQE A;  1TWF B;  2F0G A;  3S16 B;  5CGK A;  1HFG A;  2ZT9 C;  2PYK A;  4KN4 C;  1HCZ A;  1C4Q A;  3I8Z A;  1O78 A;  1TVX A;  3S14 B;  1KLU D;  5LHY 1;  2A68 D;  1Y8O B;  2B2W C;  2F0W A;  2EYL A;  4QCL A;  1QB5 D;  3GTQ B;  2EJG C;  4RKL A;  1F9P A;  4L8J A;  2D9U A;  4N9T A;  3IAY A;  1TR5 A;  4HCE A;  2HUG A;  4K8I A;  4IFD H;  3ND9 A;  1W6K A;  3FMC A;  2KED A;  2R3Z A;  3K5M A;  3I4N B;  5CV7 A;  3AU7 A;  3M7G A;  4X3T A;  3TP5 A;  2F0K A;  3OWF A;  1BCP F;  4F88 A;  4B9W A;  3BS1 A;  3HOU B;  3N6R A;  5EJW A;  1LAB A;  3M4Y A;  1LV9 A;  2LKV A;  1Q1B A;  4KMU C;  4J6H A;  2L11 A;  2KVM A;  4XQJ A;  4LAA A;  3VR3 A;  2FFK B;  1V43 A;  5EKL A;  3O13 A;  4PMW A;  1OO9 B;  2F0I A;  1V1P B;  1O7L A;  1VF5 C;  4ULL A;  4ILW A;  1CFM A;  4QUF A;  3E5S A;  3SE0 A;  5CBA E;  1D1K A;  2PZU A;  1WTR A;  4IFD G;  3H0G B;  2BCO A;  4C3H G;  1QIL A;  1SAP A;  2ZXO A;  1KDC A;  1HXY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...