3QB4B

Crystal structure of a tgf-beta ligand-receptor complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
88
structure length
88
Chain Sequence
DTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth/differentiation factor 5
publication title GDF-5 can act as a context-dependent BMP-2 antagonist.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/transferase receptor
total genus 12
structure length 88
sequence length 88
chains with identical sequence D
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3qb4B00
1CXNA 1I02A 1NXBA 2QJAC 2J8BA 1BXPA 1NTXA 2LA1A 2VLWA 1DRSA 4OM4A 4UY2C 1FRAA 1B41B 4RUDA 4QTIU 2QJ9C 1QKDA 4FAOC 1ES7B 5DZ5A 2L03A 2GOOC 3NH7A 1IQ9A 1M9ZA 2K3GA 4EY8B 1JGKA 1KU6B 1V6PA 1IJCA 2X8BB 1LXHA 1HC9A 4DO8A 6EBXA 2CRSA 1FASA 1JBDA 1NEAA 1RGJA 4OM5A 2GOOB 1IKCA 4BIKB 1TFSA 4ZQYA 3PLCA 2MFAA 1TXAA 1KXIA 1FF4A 3HH7A 2ERAA 1CB9A 1L4WA 1IDGA 2FD6U 1CODA 1G6MA 1NYUA 1S4YA 4AEAA 2CCXA 1CHVS 1NORA 1CDQA 1MR6A 2PJYB 1IDIA 1W6BA 1CREA 1QKEA 2H8UA 2H7ZA 4HQPF 2HLRA 1JE9A 4FAOE 1KS6A 1LJZA 2JQPA 1BTEA 2BTXA 3BT2U 1TXBA 2OFSA 2H62D 1CXOA 1ABTA 4XJJA 2ABXA 1CDRA 1KBSA 1LX5B 3NDSA 2MJYA 1REWC 5IMYC 1TGXA 4IYEA 1IK8A 5DU1A 1KBTA 1NYSA 1RL5A 1CDSA 2LCRA 1CVOA 2H64C 1UG4A 1FSCA 2H5FA 2UWRA 2HLQA 1KC4A 3KFDE 1HAAA 2MHYA 2N99A 1VB0A 3FEVA 4P7UA 3KFDI 3VTSA 1CCQA 1F94A 3EBXA 1ONJA 1IDLA 4BDTB 2MUPA 3U74U 1KL8A 1PLOA 2MUOA 1COEA 2MJ0A 5DO6A 1MAHF 1QM7A 3BT1U 1IDHA 2L5SA 1KFHA 1HOYA 3NEQA 3LAQU 3EVSC 1NTNA 1CRFA 2CTXA 2JVEA 3U73U 1ZADA 2H7ZB 3ERAA 1LXGA 1HC9B 5EBXA 1FFJA 1LSIA 1FSSB 2NBTA 2QJBC 1H0JA 1YWHA 1ERGA 1KBAA 1F8UB 1CTXA 1XT3A 2MJ4A 2H62C 2I9BE 3QB4B 2H64B 2QC1A 5IMTD 1HAJA 2BHIA 2CRTA 2CDXA 4LFTA 1KTZB 1CDTA 2UX2A 1ERAA 2PJYC
chains in the Genus database with same CATH superfamily
1CXNA 1I02A 1NXBA 2QJAC 2J8BA 1BXPA 1NTXA 2LA1A 2VLWA 1DRSA 4OM4A 4UY2C 1FRAA 1B41B 4RUDA 4QTIU 2QJ9C 1QKDA 4FAOC 1ES7B 5DZ5A 2L03A 2GOOC 3NH7A 1IQ9A 1M9ZA 2K3GA 4EY8B 1JGKA 1KU6B 1V6PA 1IJCA 2X8BB 1LXHA 1HC9A 4DO8A 6EBXA 2CRSA 1FASA 1JBDA 1NEAA 1RGJA 4OM5A 2GOOB 1IKCA 4BIKB 1TFSA 4ZQYA 3PLCA 2MFAA 1TXAA 1KXIA 1FF4A 3HH7A 2ERAA 1CB9A 1L4WA 1IDGA 2FD6U 1CODA 1G6MA 1NYUA 1S4YA 4AEAA 2CCXA 1CHVS 1NORA 1CDQA 1MR6A 2PJYB 4KSNA 1IDIA 1W6BA 1CREA 1QKEA 2H8UA 2H7ZA 4HQPF 2HLRA 1JE9A 4FAOE 1KS6A 1LJZA 2JQPA 1BTEA 2BTXA 3BT2U 1TXBA 2OFSA 2H62D 1CXOA 1ABTA 4XJJA 2ABXA 1CDRA 1KBSA 1LX5B 3NDSA 2MJYA 1REWC 5IMYC 1TGXA 4IYEA 1IK8A 5DU1A 1KBTA 1NYSA 1RL5A 1CDSA 2LCRA 1CVOA 2H64C 1UG4A 1FSCA 2H5FA 2UWRA 2HLQA 1KC4A 3KFDE 1HAAA 2MHYA 2N99A 1VB0A 3FEVA 4P7UA 3KFDI 3VTSA 1CCQA 1F94A 3EBXA 1ONJA 1IDLA 4BDTB 2MUPA 3U74U 1KL8A 1PLOA 2MUOA 1COEA 2MJ0A 5DO6A 1MAHF 1QM7A 3BT1U 1IDHA 2L5SA 1KFHA 1HOYA 3NEQA 3LAQU 3EVSC 1NTNA 1CRFA 2CTXA 2JVEA 3U73U 1ZADA 2H7ZB 3ERAA 1LXGA 1HC9B 5EBXA 1FFJA 1LSIA 1FSSB 2NBTA 2QJBC 1H0JA 1YWHA 1ERGA 1KBAA 1F8UB 1CTXA 1XT3A 2MJ4A 2H62C 2I9BE 3QB4B 2H64B 2QC1A 5IMTD 1HAJA 2BHIA 2CRTA 2CDXA 4LFTA 1KTZB 1CDTA 2UX2A 1ERAA 2PJYC
chains in the Genus database with same CATH topology
1CXNA 1I02A 1NXBA 2QJAC 2J8BA 1BXPA 1NTXA 2LA1A 2VLWA 1DRSA 4OM4A 4UY2C 1FRAA 1B41B 4RUDA 4QTIU 2QJ9C 1QKDA 4FAOC 1ES7B 5DZ5A 2L03A 2GOOC 3NH7A 1IQ9A 1M9ZA 2K3GA 4EY8B 1JGKA 1KU6B 1V6PA 1IJCA 2X8BB 1LXHA 1HC9A 4DO8A 6EBXA 2CRSA 1FASA 1JBDA 1NEAA 1RGJA 4OM5A 2GOOB 1IKCA 4BIKB 1TFSA 4ZQYA 3PLCA 2MFAA 1TXAA 1KXIA 1FF4A 3HH7A 2ERAA 1CB9A 1L4WA 1IDGA 2FD6U 1CODA 1G6MA 1NYUA 1S4YA 4AEAA 2CCXA 1CHVS 1NORA 1CDQA 1MR6A 2PJYB 4KSNA 1IDIA 1W6BA 1CREA 1QKEA 2H8UA 2H7ZA 4HQPF 2HLRA 1JE9A 4FAOE 1KS6A 1LJZA 2JQPA 1BTEA 2BTXA 3BT2U 1TXBA 2OFSA 2H62D 1CXOA 1ABTA 4XJJA 2ABXA 1CDRA 1KBSA 1LX5B 3NDSA 2MJYA 1REWC 5IMYC 1TGXA 4IYEA 1IK8A 5DU1A 1KBTA 1NYSA 1RL5A 1CDSA 2LCRA 1CVOA 2H64C 1UG4A 1FSCA 2H5FA 2UWRA 2HLQA 1KC4A 3KFDE 1HAAA 2MHYA 2N99A 1VB0A 3FEVA 4P7UA 3KFDI 3VTSA 1CCQA 1F94A 3EBXA 1ONJA 1IDLA 4BDTB 2MUPA 3U74U 1KL8A 1PLOA 2MUOA 1COEA 2MJ0A 5DO6A 1MAHF 1QM7A 3BT1U 1IDHA 2L5SA 1KFHA 1HOYA 3NEQA 3LAQU 3EVSC 1NTNA 1CRFA 2CTXA 2JVEA 3U73U 1ZADA 2H7ZB 3ERAA 1LXGA 1HC9B 5EBXA 1FFJA 1LSIA 1FSSB 2NBTA 2QJBC 1H0JA 1YWHA 1ERGA 1KBAA 1F8UB 1CTXA 1XT3A 2MJ4A 2H62C 2I9BE 3QB4B 2H64B 2QC1A 5IMTD 1HAJA 2BHIA 2CRTA 2CDXA 4LFTA 1KTZB 1CDTA 2UX2A 1ERAA 2PJYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CXN A;  1I02 A;  1NXB A;  2QJA C;  2J8B A;  1BXP A;  1NTX A;  2LA1 A;  2VLW A;  1DRS A;  4OM4 A;  4UY2 C;  1FRA A;  1B41 B;  4RUD A;  4QTI U;  2QJ9 C;  1QKD A;  4FAO C;  1ES7 B;  5DZ5 A;  2L03 A;  2GOO C;  3NH7 A;  1IQ9 A;  1M9Z A;  2K3G A;  4EY8 B;  1JGK A;  1KU6 B;  1V6P A;  1IJC A;  2X8B B;  1LXH A;  1HC9 A;  4DO8 A;  6EBX A;  2CRS A;  1FAS A;  1JBD A;  1NEA A;  1RGJ A;  4OM5 A;  2GOO B;  1IKC A;  4BIK B;  1TFS A;  4ZQY A;  3PLC A;  2MFA A;  1TXA A;  1KXI A;  1FF4 A;  3HH7 A;  2ERA A;  1CB9 A;  1L4W A;  1IDG A;  2FD6 U;  1COD A;  1G6M A;  1NYU A;  1S4Y A;  4AEA A;  2CCX A;  1CHV S;  1NOR A;  1CDQ A;  1MR6 A;  2PJY B;  1IDI A;  1W6B A;  1CRE A;  1QKE A;  2H8U A;  2H7Z A;  4HQP F;  2HLR A;  1JE9 A;  4FAO E;  1KS6 A;  1LJZ A;  2JQP A;  1BTE A;  2BTX A;  3BT2 U;  1TXB A;  2OFS A;  2H62 D;  1CXO A;  1ABT A;  4XJJ A;  2ABX A;  1CDR A;  1KBS A;  1LX5 B;  3NDS A;  2MJY A;  1REW C;  5IMY C;  1TGX A;  4IYE A;  1IK8 A;  5DU1 A;  1KBT A;  1NYS A;  1RL5 A;  1CDS A;  2LCR A;  1CVO A;  2H64 C;  1UG4 A;  1FSC A;  2H5F A;  2UWR A;  2HLQ A;  1KC4 A;  3KFD E;  1HAA A;  2MHY A;  2N99 A;  1VB0 A;  3FEV A;  4P7U A;  3KFD I;  3VTS A;  1CCQ A;  1F94 A;  3EBX A;  1ONJ A;  1IDL A;  4BDT B;  2MUP A;  3U74 U;  1KL8 A;  1PLO A;  2MUO A;  1COE A;  2MJ0 A;  5DO6 A;  1MAH F;  1QM7 A;  3BT1 U;  1IDH A;  2L5S A;  1KFH A;  1HOY A;  3NEQ A;  3LAQ U;  3EVS C;  1NTN A;  1CRF A;  2CTX A;  2JVE A;  3U73 U;  1ZAD A;  2H7Z B;  3ERA A;  1LXG A;  1HC9 B;  5EBX A;  1FFJ A;  1LSI A;  1FSS B;  2NBT A;  2QJB C;  1H0J A;  1YWH A;  1ERG A;  1KBA A;  1F8U B;  1CTX A;  1XT3 A;  2MJ4 A;  2H62 C;  2I9B E;  3QB4 B;  2H64 B;  2QC1 A;  5IMT D;  1HAJ A;  2BHI A;  2CRT A;  2CDX A;  4LFT A;  1KTZ B;  1CDT A;  2UX2 A;  1ERA A;  2PJY C; 
#chains in the Genus database with same CATH topology
 1CXN A;  1I02 A;  1NXB A;  2QJA C;  2J8B A;  1BXP A;  1NTX A;  2LA1 A;  2VLW A;  1DRS A;  4OM4 A;  4UY2 C;  1FRA A;  1B41 B;  4RUD A;  4QTI U;  2QJ9 C;  1QKD A;  4FAO C;  1ES7 B;  5DZ5 A;  2L03 A;  2GOO C;  3NH7 A;  1IQ9 A;  1M9Z A;  2K3G A;  4EY8 B;  1JGK A;  1KU6 B;  1V6P A;  1IJC A;  2X8B B;  1LXH A;  1HC9 A;  4DO8 A;  6EBX A;  2CRS A;  1FAS A;  1JBD A;  1NEA A;  1RGJ A;  4OM5 A;  2GOO B;  1IKC A;  4BIK B;  1TFS A;  4ZQY A;  3PLC A;  2MFA A;  1TXA A;  1KXI A;  1FF4 A;  3HH7 A;  2ERA A;  1CB9 A;  1L4W A;  1IDG A;  2FD6 U;  1COD A;  1G6M A;  1NYU A;  1S4Y A;  4AEA A;  2CCX A;  1CHV S;  1NOR A;  1CDQ A;  1MR6 A;  2PJY B;  4KSN A;  1IDI A;  1W6B A;  1CRE A;  1QKE A;  2H8U A;  2H7Z A;  4HQP F;  2HLR A;  1JE9 A;  4FAO E;  1KS6 A;  1LJZ A;  2JQP A;  1BTE A;  2BTX A;  3BT2 U;  1TXB A;  2OFS A;  2H62 D;  1CXO A;  1ABT A;  4XJJ A;  2ABX A;  1CDR A;  1KBS A;  1LX5 B;  3NDS A;  2MJY A;  1REW C;  5IMY C;  1TGX A;  4IYE A;  1IK8 A;  5DU1 A;  1KBT A;  1NYS A;  1RL5 A;  1CDS A;  2LCR A;  1CVO A;  2H64 C;  1UG4 A;  1FSC A;  2H5F A;  2UWR A;  2HLQ A;  1KC4 A;  3KFD E;  1HAA A;  2MHY A;  2N99 A;  1VB0 A;  3FEV A;  4P7U A;  3KFD I;  3VTS A;  1CCQ A;  1F94 A;  3EBX A;  1ONJ A;  1IDL A;  4BDT B;  2MUP A;  3U74 U;  1KL8 A;  1PLO A;  2MUO A;  1COE A;  2MJ0 A;  5DO6 A;  1MAH F;  1QM7 A;  3BT1 U;  1IDH A;  2L5S A;  1KFH A;  1HOY A;  3NEQ A;  3LAQ U;  3EVS C;  1NTN A;  1CRF A;  2CTX A;  2JVE A;  3U73 U;  1ZAD A;  2H7Z B;  3ERA A;  1LXG A;  1HC9 B;  5EBX A;  1FFJ A;  1LSI A;  1FSS B;  2NBT A;  2QJB C;  1H0J A;  1YWH A;  1ERG A;  1KBA A;  1F8U B;  1CTX A;  1XT3 A;  2MJ4 A;  2H62 C;  2I9B E;  3QB4 B;  2H64 B;  2QC1 A;  5IMT D;  1HAJ A;  2BHI A;  2CRT A;  2CDX A;  4LFT A;  1KTZ B;  1CDT A;  2UX2 A;  1ERA A;  2PJY C; 
#chains in the Genus database with same CATH homology
 1CXN A;  1I02 A;  1NXB A;  2QJA C;  2J8B A;  1BXP A;  1NTX A;  2LA1 A;  2VLW A;  1DRS A;  4OM4 A;  4UY2 C;  1FRA A;  1B41 B;  4RUD A;  4QTI U;  2QJ9 C;  1QKD A;  4FAO C;  1ES7 B;  5DZ5 A;  2L03 A;  2GOO C;  3NH7 A;  1IQ9 A;  1M9Z A;  2K3G A;  4EY8 B;  1JGK A;  1KU6 B;  1V6P A;  1IJC A;  2X8B B;  1LXH A;  1HC9 A;  4DO8 A;  6EBX A;  2CRS A;  1FAS A;  1JBD A;  1NEA A;  1RGJ A;  4OM5 A;  2GOO B;  1IKC A;  4BIK B;  1TFS A;  4ZQY A;  3PLC A;  2MFA A;  1TXA A;  1KXI A;  1FF4 A;  3HH7 A;  2ERA A;  1CB9 A;  1L4W A;  1IDG A;  2FD6 U;  1COD A;  1G6M A;  1NYU A;  1S4Y A;  4AEA A;  2CCX A;  1CHV S;  1NOR A;  1CDQ A;  1MR6 A;  2PJY B;  4KSN A;  1IDI A;  1W6B A;  1CRE A;  1QKE A;  2H8U A;  2H7Z A;  4HQP F;  2HLR A;  1JE9 A;  4FAO E;  1KS6 A;  1LJZ A;  2JQP A;  1BTE A;  2BTX A;  3BT2 U;  1TXB A;  2OFS A;  2H62 D;  1CXO A;  1ABT A;  4XJJ A;  2ABX A;  1CDR A;  1KBS A;  1LX5 B;  3NDS A;  2MJY A;  1REW C;  5IMY C;  1TGX A;  4IYE A;  1IK8 A;  5DU1 A;  1KBT A;  1NYS A;  1RL5 A;  1CDS A;  2LCR A;  1CVO A;  2H64 C;  1UG4 A;  1FSC A;  2H5F A;  2UWR A;  2HLQ A;  1KC4 A;  3KFD E;  1HAA A;  2MHY A;  2N99 A;  1VB0 A;  3FEV A;  4P7U A;  3KFD I;  3VTS A;  1CCQ A;  1F94 A;  3EBX A;  1ONJ A;  1IDL A;  4BDT B;  2MUP A;  3U74 U;  1KL8 A;  1PLO A;  2MUO A;  1COE A;  2MJ0 A;  5DO6 A;  1MAH F;  1QM7 A;  3BT1 U;  1IDH A;  2L5S A;  1KFH A;  1HOY A;  3NEQ A;  3LAQ U;  3EVS C;  1NTN A;  1CRF A;  2CTX A;  2JVE A;  3U73 U;  1ZAD A;  2H7Z B;  3ERA A;  1LXG A;  1HC9 B;  5EBX A;  1FFJ A;  1LSI A;  1FSS B;  2NBT A;  2QJB C;  1H0J A;  1YWH A;  1ERG A;  1KBA A;  1F8U B;  1CTX A;  1XT3 A;  2MJ4 A;  2H62 C;  2I9B E;  3QB4 B;  2H64 B;  2QC1 A;  5IMT D;  1HAJ A;  2BHI A;  2CRT A;  2CDX A;  4LFT A;  1KTZ B;  1CDT A;  2UX2 A;  1ERA A;  2PJY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...