3QB5K

Human c3po complex in the presence of mnso4
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
242
structure length
222
Chain Sequence
SSSPVMLAFKSFQQELDARHDKYERLVKLSRDITVESKRTIFLLHRITSAPDMEDILTESEIKLDGVRQKIFQVAQELSGEDMHQFHRAITTGLQEYVEAVSFQHFIKTRSLISMDEINKQLIFTTTWRLRVTPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of C3PO and mechanism of human RISC activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Translin
total genus 92
structure length 222
sequence length 242
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 1 3qb5K01
1.20.58.200 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 2 3qb5K02
3RIUC 2QVAA 1J1JA 3AXJA 1KEYA 3PJAJ 3QB5A 3RIUA 3AXJB 4WYVA 3PJAA 3QB5K 2QRXA
chains in the Genus database with same CATH superfamily
4ZS3A 3VKGA 2Y48B 1XDPA 1E1HB 3ONLC 4DV2T 3ZT6A 1LRZA 2X9XA 3QB5A 1OEDB 2XM1A 5IYZE 1VCTA 3FZMB 1LVKA 1UK5A 2CHNA 2X0HA 3NWIA 4TX5A 3EABA 2X67A 4JI0T 1O3XA 2H7OA 2UUBT 4PAGA 2C5JA 4PJMA 3RH3A 2VL0A 4I0UA 4KMCA 3V5SA 3VRBA 4NPPA 4GYSA 2UUAT 5IUXA 1XZYA 2WP9A 1ZV4X 4B3TT 3EI0A 3RKGA 1UCUA 4HKAA 1HX8A 1W9RA 3NBXX 2JRKA 5FY1A 2UU9T 1H7CA 2LKHA 4AISA 5J2UE 4H9NC 2KZ7B 1WCRA 3IF8B 2YN6A 4CZZB 4LF8T 1KEYA 1CHUA 2K9AA 2D5UA 5AQMB 3EDUA 5LJMA 3B57A 3LG7A 5AQIB 4AKIA 5F8PA 4CI2B 3N2OA 5FXZA 1S35A 3N2KE 4UEMA 1U4QA 4JV5T 2KMFA 3SS1A 3FBZA 4L9IA 5DABA 1Y64B 4ZI2D 4UELA 2RPAA 2D0UA 4EV6A 4DUYT 3GN5B 1D0XA 3ZYKA 4ERRA 2NW7A 3AAAB 5ABFA 4YJ2E 4YTNA 3OYZA 4YHJA 4CN4A 1VCSA 3F57A 2EHOA 1OEDE 2FJAA 2E5VA 4DMVA 4EOZB 5JDLA 1BR0A 5AQHB 5HEUA 2N2NA 3BQIA 4U31A 3Q5DA 4P09A 1QSDA 3ZSSA 4AKRB 3EHZA 4ZZCA 4CI1B 4PK4A 1Y01A 2BBJA 4EEDA 5LNKA 5J0ZA 5ABHA 1NWMX 5FXWA 3VRAA 2EHOD 2C5IT 2M67A 3UT5E 3AE5A 2LHNA 3NKZA 2VB6A 4IE6A 2AXDS 2Q9QB 4UXNB 3RIAA 4ILUA 3WAJA 2CXDA 2DCFA 4OYKA 3FZKB 3RX6A 1ZP0A 3NVOA 5KX5E 1HG5A 3SWHA 5HWXA 5LB7B 3TLWA 2PFVA 2I59A 4IDNA 4ZZBA 4P1NA 3HL6A 2H89A 5IHYA 5JDGA 1MNDA 4WBOA 3AA1B 5LG3A 5JDMA 3O1HA 5C3JA 2ODUA 3NZPA 5TAOA 3RKOA 3AEEA 2Q9QA 3TLVA 2XM2A 4GIWA 4LF4T 3RIFA 1NEKA 1W0AA 2F4VT 3ZYLA 1OEDC 1YKEB 2C5KT 3KINB 2UXNB 5LCYA 3CIRA 2LEHA 4MLKA 3AVRA 3ZKRA 3PJAJ 2LRKA 2I0MA 4PK5A 4EB6E 4U7IA 2X68A 4CXYA 3Q5XA 3PUQA 2CXFA 2V26A 2ZM0A 5AQTB 4WZXA 2XHEB 2R6GF 2WBLA 3NRYA 3AVSA 3ANWB 2DWGA 3OVUA 4OFZA 3UUXB 1NAFA 4QXHB 3UULA 4AQFC 4EGWA 5HXSA 5KMGP 1HNZT 3AECA 2UXCT 5AQSB 2D2SA 2VK9A 3A5XA 4DVDA 3QUJA 5HXHA 2DWKA 2A72A 2GK9A 3T8OA 4DV4T 3UU4A 4B6XA 2W0GA 2E9XC 4L0RA 5FYMA 3A8YC 5LA6E 3EUHA 2BS3A 2XQYA 4LMKA 3UUMA 4EYUA 4AKHA 2HPLA 3PUYF 2BVMA 4M1PA 4TWDA 4UIGA 1YW0A 4YSYA 2FBWA 2MOZA 4B3MT 3HKBE 3PDYA 3ZSTA 1MMAA 4P0BA 3LK3B 1BR2A 2V7IA 2CMRA 3I1AA 2V1DB 4H9OC 4UV9B 5HEGA 1IBKT 3EDVA 5HYAA 2BS2A 2ES0A 3Q5EA 3AXJB 3FZLB 2OLTA 2XY8B 4IL9A 2E2AA 4AIUA 4HE8A 3PUSA 4HWIB 4U74A 3U78A 1HCIA 3ZCJA 1UURA 2L8KA 4U2YA 1WYBA 3AEGA 3I9WA 2NOXA 1HFAA 2X9HA 3PU8A 4TUYE 1D1AA 5A1LA 4KP3C 5HEHA 5M4YA 1KF6A 3ZMZB 1IJ6A 5FY7A 5JDQA 5FMNA 4IGUA 3AAEB 2YDSA 4JUYA 2CBIA 1OEDA 2VKDA 4YJ3E 4CN1A 2IMLA 2PTFA 2XQ5A 2DI4A 1YQ4A 3ZCIA 1ZKEA 3AEAA 3RQUA 3BQLA 3KV9A 2IAKA 3K8PC 3CVRA 4L5GA 3UFGA 4C91A 4O8SA 1XWMA 1N33T 3PUAA 3T1YT 3RI5A 2H7VC 2NTXA 2LSIA 5JTGA 2A9UA 1I94T 1U5PA 1HTJF 1UGOA 3C51A 1W09A 3KBTA 4EIWA 4HTEA 4DR6T 2OV9A 5LBQB 4QX8B 2KT9A 3CX7B 3MK7C 4GOUA 3KV5A 1UX4A 3PUGA 3N2GE 3KV4A 1G8XA 3L8RA 2EHOB 5L3CB 2KWHA 4O4JE 4X65T 2BKNA 2BZBA 4KUMB 3LBXA 4H9QC 4DV6T 3T1HT 2MTQA 3P4WA 2RP4A 3PUZF 3RC3A 1VOMA 1N36T 2XQ9A 2LJLA 3P50A 5BR8T 4DV7T 1HNWT 4QH4A 1FMWA 4HWDA 4IDPA 2N1GA 3ZN0B 2V5DA 2YU1A 3GA8A 2V5CA 3LK2B 3AE2A 2QGSA 5LMUT 1IBMT 2CHOA 2VWAA 2YOEA 4JBWF 3JAEA 3JADA 2XQ6A 4G63A 5HWYA 3ZYMA 2XZEA 4YSXA 5LHHB 4J2CA 5JVDE 3JC6D 5JDHA 2KWIB 1MMGA 3E08A 1MMNA 2X51A 1MNEA 3ZC0A 3P4PA 5JDFA 5KXJA 4LF9T 2MPKA 4N78D 3RIUC 3OBVE 3RYHE 2VQET 2Z6EA 2XAJB 1WR0A 4C90A 1FIOA 2BG9E 3TLUA 1DU2A 2Y8DA 3BQKA 3ONJA 1SHZC 5ETWA 3ONXA 4HFIA 4GYRA 1D0ZA 3AEBA 4IE7A 4LMJA 2WMOA 5L3FB 4JI4T 2J47A 1XNRT 4EXTA 4AQGA 5L2LA 1KNRA 5F3JA 4ANJA 4YTPA 2UXBT 1I6ZA 3DTOA 3JCFA 4UVBB 4KHZF 2LHRA 2LRLA 4CXXA 3LDQB 4JEUB 2WDVA 4MFRA 2QRXA 2M6IA 1N32T 3EAMA 5AQUB 4DR5T 1US7B 4IDOA 2LKGA 4AXPA 5LG4A 3O9XA 1J5ET 3AE7A 4I43B 4A5XA 4FJOA 1IJ5A 2V6XA 3K1SA 2VKHA 3K3OA 3LK42 4PFPA 4P0AA 3MZKB 3QOFA 5DQVA 5L3GB 3ESLA 4OYJA 3SOLA 3C4WA 2LM9A 5JR9C 4HFDA 5JRCB 2J4GA 2ZM6T 2VVNA 5BMVE 4JI8T 2A3DA 3WAKA 5AQNB 1T72A 2AE9A 4DR4T 3QC9A 3J7Yq 3RF1A 2KSRA 3ZJ1A 1HR0T 2XTLA 3A7MA 4UVCB 4CQIA 3AE8A 4IHJE 1CUNA 2BVLA 2OA5A 4TZ4C 4ZS2A 4YHHT 1WRDA 5HCMA 4HN9A 5EZYE 3TKLB 4I55E 5AQOB 4U33A 1L0VA 3ZJ2A 3VKHA 2BBHA 2DL1A 3MJXA 3RYFE 3SFEA 2B76A 2M6BA 1JNRA 4QWNB 4X1KE 2YEVC 3VR9A 3CKDA 5AQPB 2WCAA 4DNDA 2BKOA 5HXEA 4MBQA 3EVYA 2P9BA 3UU5A 4YY3T 2CEAA 5HAXA 2W63A 3W15B 2CCQA 4HFVA 4X1YE 5J1GA 3UU8A 4ISSA 1BR1A 4X64T 4ZI3C 3UTKA 3X1DA 3RHWA 2ZMAA 2YDQA 1J1JA 1WR6A 3FZHB 5FKYA 2WU5A 4PJNA 4PJLA 4V1Av 2VQFT 1XNQT 3ZC1A 4HFBA 4UV8B 5AQKB 4EZ4A 2YDRA 5L3DB 3FZFB 2XPKA 5CFBA 1D0YA 3L3PA 4Z90A 4KBMB 1M7KA 2X9YA 2ZM8A 2H3RA 5AQGB 4NXNT 2JIWA 3AE3A 1VRBA 3HI2A 5LGNB 4QX7B 4PJJA 4X66T 2YINA 1XMOT 2X0LB 4LF6T 4GK5E 2NR4A 4WYVA 3UQ7A 4JI6T 1R8IA 5CA0E 3M65A 1FMVA 2XAGB 2G0UA 2PG8A 5EK4A 4ZXLA 2H88A 2X66A 3CX8B 4ILAA 2LOPA 1N34T 3OJAA 2E9XD 2DNXA 3PUXF 1T8BA 4IE0A 2PBIA 2PJQA 3RQWA 3VU7H 5HEJA 2MAWA 3D0TA 4HFCA 5LMNT 2W62A 2BG9B 4ZI7E 5JDNA 4YLHA 3AA7B 2QVAA 1QLBA 4ILCA 4KX6A 5ABEA 3R6NA 4IT4A 4AQYT 2J62A 5DJQC 2V7MA 5ABGA 3N9QA 4JI7T 4HGAA 4DR7T 3PUVF 4YSZA 2E8IA 5FVLA 2IIUA 2UXXB 2VURA 1KNZA 2XAQB 4JYAT 2CWYA 2CRBA 4LMLA 5ABFB 3HKDE 2XUEA 2HPJA 3N9NA 5FXVA 2UUCT 2ODVA 3U3IA 3GN5A 3L39A 2BG9A 3ABVA 4HWHA 4WBNE 3KVAA 5LHIB 5LBMA 3IEEA 3I9YA 3N9OA 3AA0B 2WM9A 4OX9T 3VHLA 3MA9A 3ZT5A 3UUNA 4O4LE 3UU6A 4B3ST 4JI3T 2XSBA 3MACA 3PU3A 4U72A 4DR2T 4COFA 4ZI3D 2XQ8A 4X62T 1OXZA 2E9XA 3AE9A 3K3NA 4QKNA 1WYCA 4UVAB 2MBGA 1HF8A 4DV5T 1J5WA 4G2AA 2X0YA 3RPUA 2XASB 2LSKA 4H63V 2FJBA 4PFOA 3J9X1 3P4RA 3C50A 4LFCT 5HXRA 1UUSA 3MKDA 4GKKT 1UX5A 1XDOA 5FXXA 3RYCE 1YQ3A 3RLFF 2WDRA 3HR0A 4BJMA 2JQQA 1M62A 2XAFB 2YU2A 3AE1A 3VR8A 2CLYC 3CQXC 4ADZA 1YD8G 4TNWA 5FVKA 2DLRA 3H3AA 5HCJA 3UU3A 5JR9B 2VL8A 2K24A 4K0UA 4QH1A 3OTOT 3CX6B 3AXJA 2JQKA 5L47A 3R84B 3I0QA 4EYYR 4U7YA 3AE6A 4AI6A 1LKXA 4MHCA 3V5UA 2HN2A 1KFYA 2QA7A 2IC6A 2HH7A 4CN6A 1Z0PA 4HWFA 5FL0A 4H9RC 4HEAA 3F31A 5CGMA 2CLYB 5C8YE 4AKGA 4IREA 2ZM2A 3CK6A 3N9MA 5EK3A 3K3QC 5E0OA 1XMQT 1IZNB 5L4EA 3O1JA 2XAHB 2XQ4A 3B13A 2XQAA 3ZPOA 2IUBA 4WNKA 3LSVA 4JI1T 2WZIA 4X20E 1HNXT 4NIQA 1LVFA 3P4SA 2NW8A 1V9DA 4JI2T 3AEDA 2BS4A 3ZN1B 3WI3A 3ANWA 1YXRA 4DUZT 3TLSA 5CB4E 5CJ5A 2JMKA 3B5MA 4UF0B 2A2FX 4ZHQE 5AQQB 1WLXA 1G73A 1MIVA 5AQJB 3P7IA 5J2TE 3C4ZA 2LOSA 2WSSV 2XQ3A 3HKCE 4MALA 4TWFA 5GONE 5HXCA 4EEBA 4DBQA 1E2AA 3FHNA 4NXMT 5LXTE 3DJBA 2VKOA 4X1IE 3LBXB 2CWOA 3IHRA 2Y6XA 1W0BA 2IDOB 2IHR1 1MIYA 2N9DA 3RYIE 1FEWA 4DO0A 5H6QB 4OHFA 5CA1E 2BDEA 3O4XE 4O2AE 3PV0F 2E9XB 4QXCB 4DV1T 5EK2A 2BG9C 2W61A 4HFHA 4TV8E 4UF0A 4TWHA 2CA5A 4XAXB 4YXDA 3N9LA 5AFUL 3NRXA 3ZLIA 3QNUA 1HX1B 3FBLA 4IL4A 3RIUA 2WMNA 4H63H 5HEOA 3ZMVB 5F5WA 1T7SA 4TNVA 3M3ZB 3GMIA 2LM2A 2V6YB 5JREA 2WS3A 2NP9A 1X9BA 2D9DA 3DP7A 3LJCA 3CPZA 4CXWA 3H3MA 3AB3B 2JQHA 2WAUA 2VKJA 5DQWA 5L4HA 1D1BA 1B7TA 3SRZA 4A98A 2JQ9A 3NZQA 5JR9A 3C98B 2WWUA 4JI5T 5H6RB 2E5LT 3FB2A 2NW9A 5LP6E 5IWAT 1E7PA 2ZLYA 2JJ9A 4KI0F 3AA6B 4AQFA 4DBRA 2CXLA 3I0OA 4DR1T 3RGLA 2CE7A 3P4QA 3ETVA 2B1EA 4ZEYA 3S4UA 1MIWA 2J1DG 3P8CD 4IE5A 4E7SA 4LF5T 1JNZA 2ACXA 2XQ7A 2V7KA 1QUUA 1D1CA 2WQYA 3HA4A 2Q9QC 3PUWF 2W66A 4GK0E 4TN7B 1BR4A 4YFSA 4Z91A 2YK0A 1FJGT 3E22E 3UUBA 4KHPT 5FP3A 3H37A 3FXEB 1SUMB 5LHGB 3KV6A 1AJ3A 4JEHB 3KBUA 3Q9DA 4IIJE 4U2ZA 3ZMUB 3ETUA 5C2TA 2QYWA 3CMLA 3L09A 5LJNA 2WB5A 2L9QA 4O4IE 4O4HE 4YTMA 2LSYA 2SPCA 2L3LA 3HKEE 2W2UA 2V8SV 5LGTB 4LFBT 4HWCA 2V7JA 4H9SE 3MXZA 2LT3A 3CQCB 3RRCA 4DV0T 4XBFB 5ADXL 2WZHA 5LYJE 5JRCA 2WWVA 1HS7A 3F2EA 3AE4A 3KDSE 1EZ3A 4WW0A 3CQGB 5L3BB 3UQ4A 4H9PC 1X79A 4BA9A 2K3WA 4GKJT 3OYXA 3PE0A 2DHRA 3C64A 4IDQA 4IE4A 5KDMC 4B3RT 4LF7T 5FNVE 4O2BE 2HHHT 2WU2A 4LFAT 2K48A 3IBPA 1KNPA 2EHOC 3JC6C 3ZMSB 4I50E 4DMWA 2V7LA 2RA1A 1OWAA 1ZEEA 4I4TE 5LGUB 4EZHA 3IA3A 1SE7A 2ACZA 2W4XA 2IC9A 3G06A 2NTYA 1Z8UA 1YKHB 2D0TA 2FUPA 1ZOYA 1GQEA 2V6YA 4UR9A 2VVSA 4ASKA 3KFWX 4DR3T 4E7ZA 5L3EB 4PW8A 4EAHA 3LFMA 1NENA 3KVBA 2LLYA 1T98A 2HN1A 2X9WA 2YKSA 2K5BB 3AEFA 3QK6A 3N9PA 3PURA 4ILBA 4ISTA 2FJDA 4X5TA 2KLQA 2NWBA 5FY0A 1WFDA 5LOVE 3UFEA 4NUUA 4BAYB 5AQLB 5AQVB 3BK9A 4XZCA 2C0SA 3O1IA 4FI5A 2CBJA 3JAFA 4BJNA 3Q2MA 4JLEA 5JQGE 3ZMTB 2VASA 4F6RC 1HG2A 2Q9QD 3PJAA 5FL1A 1ZHCA 4OK0A 3E0ZA 4A97A 4TV9E 4QXBB 1MMDA 1IBLT 3C4XA 4PNIA 5AQRB 2XSAA 3QB5K 5JH7E 2BKPA 2CPTA 1SA0E 3Q5WA 3ZT7A 4ZI2C 4AKLA 2KNDA 1S94A 2LSJA 2WDQA 2MYSA 4QH5A 4Z8XA 2LE8A 3RRWA 3SFDA 4DV3T 2W00A 4U3CA 4IDZA 2KXPB 3OKQA 4K0KT 4QHOA 2WY2A 3TLTA 3AAIA 2XJ7A 4YT0A 3N5LA 2FJEA 2IW5B 2I6HA 4CI3B 2JPFA 1KK7A 3PTRB 3RC8A 4Q25A 4NUVA 4PK6A 4A56A 4DIDB 5AQFB 2JMHA 2LSGA 2KINB 3FXDB 3GWHA 3ZEFB 3OPCA 4F8HA 2CM0A 2UXDT 4HFEA 1IAPA 3CWZB 4ZOLE 2W67A
chains in the Genus database with same CATH topology
3RIUC 2QVAA 1J1JA 3AXJA 1KEYA 3PJAJ 3QB5A 3RIUA 3AXJB 4WYVA 3PJAA 3QB5K 2QRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RIU C;  2QVA A;  1J1J A;  3AXJ A;  1KEY A;  3PJA J;  3QB5 A;  3RIU A;  3AXJ B;  4WYV A;  3PJA A;  3QB5 K;  2QRX A; 
#chains in the Genus database with same CATH topology
 4ZS3 A;  3VKG A;  2Y48 B;  1XDP A;  1E1H B;  3ONL C;  4DV2 T;  3ZT6 A;  1LRZ A;  2X9X A;  3QB5 A;  1OED B;  2XM1 A;  5IYZ E;  1VCT A;  3FZM B;  1LVK A;  1UK5 A;  2CHN A;  2X0H A;  3NWI A;  4TX5 A;  3EAB A;  2X67 A;  4JI0 T;  1O3X A;  2H7O A;  2UUB T;  4PAG A;  2C5J A;  4PJM A;  3RH3 A;  2VL0 A;  4I0U A;  4KMC A;  3V5S A;  3VRB A;  4NPP A;  4GYS A;  2UUA T;  5IUX A;  1XZY A;  2WP9 A;  1ZV4 X;  4B3T T;  3EI0 A;  3RKG A;  1UCU A;  4HKA A;  1HX8 A;  1W9R A;  3NBX X;  2JRK A;  5FY1 A;  2UU9 T;  1H7C A;  2LKH A;  4AIS A;  5J2U E;  4H9N C;  2KZ7 B;  1WCR A;  3IF8 B;  2YN6 A;  4CZZ B;  4LF8 T;  1KEY A;  1CHU A;  2K9A A;  2D5U A;  5AQM B;  3EDU A;  5LJM A;  3B57 A;  3LG7 A;  5AQI B;  4AKI A;  5F8P A;  4CI2 B;  3N2O A;  5FXZ A;  1S35 A;  3N2K E;  4UEM A;  1U4Q A;  4JV5 T;  2KMF A;  3SS1 A;  3FBZ A;  4L9I A;  5DAB A;  1Y64 B;  4ZI2 D;  4UEL A;  2RPA A;  2D0U A;  4EV6 A;  4DUY T;  3GN5 B;  1D0X A;  3ZYK A;  4ERR A;  2NW7 A;  3AAA B;  5ABF A;  4YJ2 E;  4YTN A;  3OYZ A;  4YHJ A;  4CN4 A;  1VCS A;  3F57 A;  2EHO A;  1OED E;  2FJA A;  2E5V A;  4DMV A;  4EOZ B;  5JDL A;  1BR0 A;  5AQH B;  5HEU A;  2N2N A;  3BQI A;  4U31 A;  3Q5D A;  4P09 A;  1QSD A;  3ZSS A;  4AKR B;  3EHZ A;  4ZZC A;  4CI1 B;  4PK4 A;  1Y01 A;  2BBJ A;  4EED A;  5LNK A;  5J0Z A;  5ABH A;  1NWM X;  5FXW A;  3VRA A;  2EHO D;  2C5I T;  2M67 A;  3UT5 E;  3AE5 A;  2LHN A;  3NKZ A;  2VB6 A;  4IE6 A;  2AXD S;  2Q9Q B;  4UXN B;  3RIA A;  4ILU A;  3WAJ A;  2CXD A;  2DCF A;  4OYK A;  3FZK B;  3RX6 A;  1ZP0 A;  3NVO A;  5KX5 E;  1HG5 A;  3SWH A;  5HWX A;  5LB7 B;  3TLW A;  2PFV A;  2I59 A;  4IDN A;  4ZZB A;  4P1N A;  3HL6 A;  2H89 A;  5IHY A;  5JDG A;  1MND A;  4WBO A;  3AA1 B;  5LG3 A;  5JDM A;  3O1H A;  5C3J A;  2ODU A;  3NZP A;  5TAO A;  3RKO A;  3AEE A;  2Q9Q A;  3TLV A;  2XM2 A;  4GIW A;  4LF4 T;  3RIF A;  1NEK A;  1W0A A;  2F4V T;  3ZYL A;  1OED C;  1YKE B;  2C5K T;  3KIN B;  2UXN B;  5LCY A;  3CIR A;  2LEH A;  4MLK A;  3AVR A;  3ZKR A;  3PJA J;  2LRK A;  2I0M A;  4PK5 A;  4EB6 E;  4U7I A;  2X68 A;  4CXY A;  3Q5X A;  3PUQ A;  2CXF A;  2V26 A;  2ZM0 A;  5AQT B;  4WZX A;  2XHE B;  2R6G F;  2WBL A;  3NRY A;  3AVS A;  3ANW B;  2DWG A;  3OVU A;  4OFZ A;  3UUX B;  1NAF A;  4QXH B;  3UUL A;  4AQF C;  4EGW A;  5HXS A;  5KMG P;  1HNZ T;  3AEC A;  2UXC T;  5AQS B;  2D2S A;  2VK9 A;  3A5X A;  4DVD A;  3QUJ A;  5HXH A;  2DWK A;  2A72 A;  2GK9 A;  3T8O A;  4DV4 T;  3UU4 A;  4B6X A;  2W0G A;  2E9X C;  4L0R A;  5FYM A;  3A8Y C;  5LA6 E;  3EUH A;  2BS3 A;  2XQY A;  4LMK A;  3UUM A;  4EYU A;  4AKH A;  2HPL A;  3PUY F;  2BVM A;  4M1P A;  4TWD A;  4UIG A;  1YW0 A;  4YSY A;  2FBW A;  2MOZ A;  4B3M T;  3HKB E;  3PDY A;  3ZST A;  1MMA A;  4P0B A;  3LK3 B;  1BR2 A;  2V7I A;  2CMR A;  3I1A A;  2V1D B;  4H9O C;  4UV9 B;  5HEG A;  1IBK T;  3EDV A;  5HYA A;  2BS2 A;  2ES0 A;  3Q5E A;  3AXJ B;  3FZL B;  2OLT A;  2XY8 B;  4IL9 A;  2E2A A;  4AIU A;  4HE8 A;  3PUS A;  4HWI B;  4U74 A;  3U78 A;  1HCI A;  3ZCJ A;  1UUR A;  2L8K A;  4U2Y A;  1WYB A;  3AEG A;  3I9W A;  2NOX A;  1HFA A;  2X9H A;  3PU8 A;  4TUY E;  1D1A A;  5A1L A;  4KP3 C;  5HEH A;  5M4Y A;  1KF6 A;  3ZMZ B;  1IJ6 A;  5FY7 A;  5JDQ A;  5FMN A;  4IGU A;  3AAE B;  2YDS A;  4JUY A;  2CBI A;  1OED A;  2VKD A;  4YJ3 E;  4CN1 A;  2IML A;  2PTF A;  2XQ5 A;  2DI4 A;  1YQ4 A;  3ZCI A;  1ZKE A;  3AEA A;  3RQU A;  3BQL A;  3KV9 A;  2IAK A;  3K8P C;  3CVR A;  4L5G A;  3UFG A;  4C91 A;  4O8S A;  1XWM A;  1N33 T;  3PUA A;  3T1Y T;  3RI5 A;  2H7V C;  2NTX A;  2LSI A;  5JTG A;  2A9U A;  1I94 T;  1U5P A;  1HTJ F;  1UGO A;  3C51 A;  1W09 A;  3KBT A;  4EIW A;  4HTE A;  4DR6 T;  2OV9 A;  5LBQ B;  4QX8 B;  2KT9 A;  3CX7 B;  3MK7 C;  4GOU A;  3KV5 A;  1UX4 A;  3PUG A;  3N2G E;  3KV4 A;  1G8X A;  3L8R A;  2EHO B;  5L3C B;  2KWH A;  4O4J E;  4X65 T;  2BKN A;  2BZB A;  4KUM B;  3LBX A;  4H9Q C;  4DV6 T;  3T1H T;  2MTQ A;  3P4W A;  2RP4 A;  3PUZ F;  3RC3 A;  1VOM A;  1N36 T;  2XQ9 A;  2LJL A;  3P50 A;  5BR8 T;  4DV7 T;  1HNW T;  4QH4 A;  1FMW A;  4HWD A;  4IDP A;  2N1G A;  3ZN0 B;  2V5D A;  2YU1 A;  3GA8 A;  2V5C A;  3LK2 B;  3AE2 A;  2QGS A;  5LMU T;  1IBM T;  2CHO A;  2VWA A;  2YOE A;  4JBW F;  3JAE A;  3JAD A;  2XQ6 A;  4G63 A;  5HWY A;  3ZYM A;  2XZE A;  4YSX A;  5LHH B;  4J2C A;  5JVD E;  3JC6 D;  5JDH A;  2KWI B;  1MMG A;  3E08 A;  1MMN A;  2X51 A;  1MNE A;  3ZC0 A;  3P4P A;  5JDF A;  5KXJ A;  4LF9 T;  2MPK A;  4N78 D;  3RIU C;  3OBV E;  3RYH E;  2VQE T;  2Z6E A;  2XAJ B;  1WR0 A;  4C90 A;  1FIO A;  2BG9 E;  3TLU A;  1DU2 A;  2Y8D A;  3BQK A;  3ONJ A;  1SHZ C;  5ETW A;  3ONX A;  4HFI A;  4GYR A;  1D0Z A;  3AEB A;  4IE7 A;  4LMJ A;  2WMO A;  5L3F B;  4JI4 T;  2J47 A;  1XNR T;  4EXT A;  4AQG A;  5L2L A;  1KNR A;  5F3J A;  4ANJ A;  4YTP A;  2UXB T;  1I6Z A;  3DTO A;  3JCF A;  4UVB B;  4KHZ F;  2LHR A;  2LRL A;  4CXX A;  3LDQ B;  4JEU B;  2WDV A;  4MFR A;  2QRX A;  2M6I A;  1N32 T;  3EAM A;  5AQU B;  4DR5 T;  1US7 B;  4IDO A;  2LKG A;  4AXP A;  5LG4 A;  3O9X A;  1J5E T;  3AE7 A;  4I43 B;  4A5X A;  4FJO A;  1IJ5 A;  2V6X A;  3K1S A;  2VKH A;  3K3O A;  3LK4 2;  4PFP A;  4P0A A;  3MZK B;  3QOF A;  5DQV A;  5L3G B;  3ESL A;  4OYJ A;  3SOL A;  3C4W A;  2LM9 A;  5JR9 C;  4HFD A;  5JRC B;  2J4G A;  2ZM6 T;  2VVN A;  5BMV E;  4JI8 T;  2A3D A;  3WAK A;  5AQN B;  1T72 A;  2AE9 A;  4DR4 T;  3QC9 A;  3J7Y q;  3RF1 A;  2KSR A;  3ZJ1 A;  1HR0 T;  2XTL A;  3A7M A;  4UVC B;  4CQI A;  3AE8 A;  4IHJ E;  1CUN A;  2BVL A;  2OA5 A;  4TZ4 C;  4ZS2 A;  4YHH T;  1WRD A;  5HCM A;  4HN9 A;  5EZY E;  3TKL B;  4I55 E;  5AQO B;  4U33 A;  1L0V A;  3ZJ2 A;  3VKH A;  2BBH A;  2DL1 A;  3MJX A;  3RYF E;  3SFE A;  2B76 A;  2M6B A;  1JNR A;  4QWN B;  4X1K E;  2YEV C;  3VR9 A;  3CKD A;  5AQP B;  2WCA A;  4DND A;  2BKO A;  5HXE A;  4MBQ A;  3EVY A;  2P9B A;  3UU5 A;  4YY3 T;  2CEA A;  5HAX A;  2W63 A;  3W15 B;  2CCQ A;  4HFV A;  4X1Y E;  5J1G A;  3UU8 A;  4ISS A;  1BR1 A;  4X64 T;  4ZI3 C;  3UTK A;  3X1D A;  3RHW A;  2ZMA A;  2YDQ A;  1J1J A;  1WR6 A;  3FZH B;  5FKY A;  2WU5 A;  4PJN A;  4PJL A;  4V1A v;  2VQF T;  1XNQ T;  3ZC1 A;  4HFB A;  4UV8 B;  5AQK B;  4EZ4 A;  2YDR A;  5L3D B;  3FZF B;  2XPK A;  5CFB A;  1D0Y A;  3L3P A;  4Z90 A;  4KBM B;  1M7K A;  2X9Y A;  2ZM8 A;  2H3R A;  5AQG B;  4NXN T;  2JIW A;  3AE3 A;  1VRB A;  3HI2 A;  5LGN B;  4QX7 B;  4PJJ A;  4X66 T;  2YIN A;  1XMO T;  2X0L B;  4LF6 T;  4GK5 E;  2NR4 A;  4WYV A;  3UQ7 A;  4JI6 T;  1R8I A;  5CA0 E;  3M65 A;  1FMV A;  2XAG B;  2G0U A;  2PG8 A;  5EK4 A;  4ZXL A;  2H88 A;  2X66 A;  3CX8 B;  4ILA A;  2LOP A;  1N34 T;  3OJA A;  2E9X D;  2DNX A;  3PUX F;  1T8B A;  4IE0 A;  2PBI A;  2PJQ A;  3RQW A;  3VU7 H;  5HEJ A;  2MAW A;  3D0T A;  4HFC A;  5LMN T;  2W62 A;  2BG9 B;  4ZI7 E;  5JDN A;  4YLH A;  3AA7 B;  2QVA A;  1QLB A;  4ILC A;  4KX6 A;  5ABE A;  3R6N A;  4IT4 A;  4AQY T;  2J62 A;  5DJQ C;  2V7M A;  5ABG A;  3N9Q A;  4JI7 T;  4HGA A;  4DR7 T;  3PUV F;  4YSZ A;  2E8I A;  5FVL A;  2IIU A;  2UXX B;  2VUR A;  1KNZ A;  2XAQ B;  4JYA T;  2CWY A;  2CRB A;  4LML A;  5ABF B;  3HKD E;  2XUE A;  2HPJ A;  3N9N A;  5FXV A;  2UUC T;  2ODV A;  3U3I A;  3GN5 A;  3L39 A;  2BG9 A;  3ABV A;  4HWH A;  4WBN E;  3KVA A;  5LHI B;  5LBM A;  3IEE A;  3I9Y A;  3N9O A;  3AA0 B;  2WM9 A;  4OX9 T;  3VHL A;  3MA9 A;  3ZT5 A;  3UUN A;  4O4L E;  3UU6 A;  4B3S T;  4JI3 T;  2XSB A;  3MAC A;  3PU3 A;  4U72 A;  4DR2 T;  4COF A;  4ZI3 D;  2XQ8 A;  4X62 T;  1OXZ A;  2E9X A;  3AE9 A;  3K3N A;  4QKN A;  1WYC A;  4UVA B;  2MBG A;  1HF8 A;  4DV5 T;  1J5W A;  4G2A A;  2X0Y A;  3RPU A;  2XAS B;  2LSK A;  4H63 V;  2FJB A;  4PFO A;  3J9X 1;  3P4R A;  3C50 A;  4LFC T;  5HXR A;  1UUS A;  3MKD A;  4GKK T;  1UX5 A;  1XDO A;  5FXX A;  3RYC E;  1YQ3 A;  3RLF F;  2WDR A;  3HR0 A;  4BJM A;  2JQQ A;  1M62 A;  2XAF B;  2YU2 A;  3AE1 A;  3VR8 A;  2CLY C;  3CQX C;  4ADZ A;  1YD8 G;  4TNW A;  5FVK A;  2DLR A;  3H3A A;  5HCJ A;  3UU3 A;  5JR9 B;  2VL8 A;  2K24 A;  4K0U A;  4QH1 A;  3OTO T;  3CX6 B;  3AXJ A;  2JQK A;  5L47 A;  3R84 B;  3I0Q A;  4EYY R;  4U7Y A;  3AE6 A;  4AI6 A;  1LKX A;  4MHC A;  3V5U A;  2HN2 A;  1KFY A;  2QA7 A;  2IC6 A;  2HH7 A;  4CN6 A;  1Z0P A;  4HWF A;  5FL0 A;  4H9R C;  4HEA A;  3F31 A;  5CGM A;  2CLY B;  5C8Y E;  4AKG A;  4IRE A;  2ZM2 A;  3CK6 A;  3N9M A;  5EK3 A;  3K3Q C;  5E0O A;  1XMQ T;  1IZN B;  5L4E A;  3O1J A;  2XAH B;  2XQ4 A;  3B13 A;  2XQA A;  3ZPO A;  2IUB A;  4WNK A;  3LSV A;  4JI1 T;  2WZI A;  4X20 E;  1HNX T;  4NIQ A;  1LVF A;  3P4S A;  2NW8 A;  1V9D A;  4JI2 T;  3AED A;  2BS4 A;  3ZN1 B;  3WI3 A;  3ANW A;  1YXR A;  4DUZ T;  3TLS A;  5CB4 E;  5CJ5 A;  2JMK A;  3B5M A;  4UF0 B;  2A2F X;  4ZHQ E;  5AQQ B;  1WLX A;  1G73 A;  1MIV A;  5AQJ B;  3P7I A;  5J2T E;  3C4Z A;  2LOS A;  2WSS V;  2XQ3 A;  3HKC E;  4MAL A;  4TWF A;  5GON E;  5HXC A;  4EEB A;  4DBQ A;  1E2A A;  3FHN A;  4NXM T;  5LXT E;  3DJB A;  2VKO A;  4X1I E;  3LBX B;  2CWO A;  3IHR A;  2Y6X A;  1W0B A;  2IDO B;  2IHR 1;  1MIY A;  2N9D A;  3RYI E;  1FEW A;  4DO0 A;  5H6Q B;  4OHF A;  5CA1 E;  2BDE A;  3O4X E;  4O2A E;  3PV0 F;  2E9X B;  4QXC B;  4DV1 T;  5EK2 A;  2BG9 C;  2W61 A;  4HFH A;  4TV8 E;  4UF0 A;  4TWH A;  2CA5 A;  4XAX B;  4YXD A;  3N9L A;  5AFU L;  3NRX A;  3ZLI A;  3QNU A;  1HX1 B;  3FBL A;  4IL4 A;  3RIU A;  2WMN A;  4H63 H;  5HEO A;  3ZMV B;  5F5W A;  1T7S A;  4TNV A;  3M3Z B;  3GMI A;  2LM2 A;  2V6Y B;  5JRE A;  2WS3 A;  2NP9 A;  1X9B A;  2D9D A;  3DP7 A;  3LJC A;  3CPZ A;  4CXW A;  3H3M A;  3AB3 B;  2JQH A;  2WAU A;  2VKJ A;  5DQW A;  5L4H A;  1D1B A;  1B7T A;  3SRZ A;  4A98 A;  2JQ9 A;  3NZQ A;  5JR9 A;  3C98 B;  2WWU A;  4JI5 T;  5H6R B;  2E5L T;  3FB2 A;  2NW9 A;  5LP6 E;  5IWA T;  1E7P A;  2ZLY A;  2JJ9 A;  4KI0 F;  3AA6 B;  4AQF A;  4DBR A;  2CXL A;  3I0O A;  4DR1 T;  3RGL A;  2CE7 A;  3P4Q A;  3ETV A;  2B1E A;  4ZEY A;  3S4U A;  1MIW A;  2J1D G;  3P8C D;  4IE5 A;  4E7S A;  4LF5 T;  1JNZ A;  2ACX A;  2XQ7 A;  2V7K A;  1QUU A;  1D1C A;  2WQY A;  3HA4 A;  2Q9Q C;  3PUW F;  2W66 A;  4GK0 E;  4TN7 B;  1BR4 A;  4YFS A;  4Z91 A;  2YK0 A;  1FJG T;  3E22 E;  3UUB A;  4KHP T;  5FP3 A;  3H37 A;  3FXE B;  1SUM B;  5LHG B;  3KV6 A;  1AJ3 A;  4JEH B;  3KBU A;  3Q9D A;  4IIJ E;  4U2Z A;  3ZMU B;  3ETU A;  5C2T A;  2QYW A;  3CML A;  3L09 A;  5LJN A;  2WB5 A;  2L9Q A;  4O4I E;  4O4H E;  4YTM A;  2LSY A;  2SPC A;  2L3L A;  3HKE E;  2W2U A;  2V8S V;  5LGT B;  4LFB T;  4HWC A;  2V7J A;  4H9S E;  3MXZ A;  2LT3 A;  3CQC B;  3RRC A;  4DV0 T;  4XBF B;  5ADX L;  2WZH A;  5LYJ E;  5JRC A;  2WWV A;  1HS7 A;  3F2E A;  3AE4 A;  3KDS E;  1EZ3 A;  4WW0 A;  3CQG B;  5L3B B;  3UQ4 A;  4H9P C;  1X79 A;  4BA9 A;  2K3W A;  4GKJ T;  3OYX A;  3PE0 A;  2DHR A;  3C64 A;  4IDQ A;  4IE4 A;  5KDM C;  4B3R T;  4LF7 T;  5FNV E;  4O2B E;  2HHH T;  2WU2 A;  4LFA T;  2K48 A;  3IBP A;  1KNP A;  2EHO C;  3JC6 C;  3ZMS B;  4I50 E;  4DMW A;  2V7L A;  2RA1 A;  1OWA A;  1ZEE A;  4I4T E;  5LGU B;  4EZH A;  3IA3 A;  1SE7 A;  2ACZ A;  2W4X A;  2IC9 A;  3G06 A;  2NTY A;  1Z8U A;  1YKH B;  2D0T A;  2FUP A;  1ZOY A;  1GQE A;  2V6Y A;  4UR9 A;  2VVS A;  4ASK A;  3KFW X;  4DR3 T;  4E7Z A;  5L3E B;  4PW8 A;  4EAH A;  3LFM A;  1NEN A;  3KVB A;  2LLY A;  1T98 A;  2HN1 A;  2X9W A;  2YKS A;  2K5B B;  3AEF A;  3QK6 A;  3N9P A;  3PUR A;  4ILB A;  4IST A;  2FJD A;  4X5T A;  2KLQ A;  2NWB A;  5FY0 A;  1WFD A;  5LOV E;  3UFE A;  4NUU A;  4BAY B;  5AQL B;  5AQV B;  3BK9 A;  4XZC A;  2C0S A;  3O1I A;  4FI5 A;  2CBJ A;  3JAF A;  4BJN A;  3Q2M A;  4JLE A;  5JQG E;  3ZMT B;  2VAS A;  4F6R C;  1HG2 A;  2Q9Q D;  3PJA A;  5FL1 A;  1ZHC A;  4OK0 A;  3E0Z A;  4A97 A;  4TV9 E;  4QXB B;  1MMD A;  1IBL T;  3C4X A;  4PNI A;  5AQR B;  2XSA A;  3QB5 K;  5JH7 E;  2BKP A;  2CPT A;  1SA0 E;  3Q5W A;  3ZT7 A;  4ZI2 C;  4AKL A;  2KND A;  1S94 A;  2LSJ A;  2WDQ A;  2MYS A;  4QH5 A;  4Z8X A;  2LE8 A;  3RRW A;  3SFD A;  4DV3 T;  2W00 A;  4U3C A;  4IDZ A;  2KXP B;  3OKQ A;  4K0K T;  4QHO A;  2WY2 A;  3TLT A;  3AAI A;  2XJ7 A;  4YT0 A;  3N5L A;  2FJE A;  2IW5 B;  2I6H A;  4CI3 B;  2JPF A;  1KK7 A;  3PTR B;  3RC8 A;  4Q25 A;  4NUV A;  4PK6 A;  4A56 A;  4DID B;  5AQF B;  2JMH A;  2LSG A;  2KIN B;  3FXD B;  3GWH A;  3ZEF B;  3OPC A;  4F8H A;  2CM0 A;  2UXD T;  4HFE A;  1IAP A;  3CWZ B;  4ZOL E;  2W67 A; 
#chains in the Genus database with same CATH homology
 3RIU C;  2QVA A;  1J1J A;  3AXJ A;  1KEY A;  3PJA J;  3QB5 A;  3RIU A;  3AXJ B;  4WYV A;  3PJA A;  3QB5 K;  2QRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...