3QB5K

Human c3po complex in the presence of mnso4
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
242
structure length
222
Chain Sequence
b'SSSPVMLAFKSFQQELDARHDKYERLVKLSRDITVESKRTIFLLHRITSAPDMEDILTESEIKLDGVRQKIFQVAQELSGEDMHQFHRAITTGLQEYVEAVSFQHFIKTRSLISMDEINKQLIFTTTWRLRVTPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translin
publication title Structure of C3PO and mechanism of human RISC activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 92
structure length 222
sequence length 242
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 1 3qb5K01
1.20.58.200 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 2 3qb5K02
3AXJB 3QB5A 3PJAJ 2QRXA 2QVAA 3PJAA 3QB5K 4WYVA 1KEYA 3AXJA 3RIUA 1J1JA 3RIUC
chains in the Genus database with same CATH superfamily
5AQTB 3C98B 3QUJA 3KV9A 3ZMZB 5ABFA 4KX6A 2XUEA 5BR8T 4ERRA 4EXTA 1YW0A 2ZLYA 3EDVA 2WWVA 5AQHB 4TNVA 5LNKA 2XQAA 3JCFA 2J62A 2XJ7A 3AA0B 2YN6A 3NVOA 1FJGT 1UURA 4DMVA 1MIWA 3GN5A 5LG4A 3CX8B 4NXMT 2OV9A 3VRBA 3NWIA 4B3RT 2VURA 3PUZF 4CI1B 1KFYA 2NR4A 3VKGA 1BR4A 3BQLA 2W2UA 4UELA 2PFVA 2XQYA 1G8XA 2M6BA 2I6HA 4I4TE 4GYRA 4DR3T 4UVCB 3RHWA 3KV6A 4EGWA 4QX8B 3H3MA 5C2TA 2WDQA 3FBLA 4U2ZA 5FP3A 3J7Yq 2N9DA 2J1DG 3ZYMA 3OYXA 1J1JA 4LF7T 2A2FX 2LE8A 3AE7A 4ZXLA 2IC6A 5BMVE 2B1EA 4X65T 3EABA 3FZMB 5LXTE 4HFCA 2E9XC 2X9WA 5JR9A 2XAJB 4JI1T 4ZHQE 3SS1A 1B7TA 4MFRA 4IGUA 3WI3A 4EB6E 3KFWX 4EV6A 3HKDE 4PJJA 5FY7A 5LGNB 2V6YA 2NW9A 2K24A 4JI0T 3PDYA 1D0XA 4HFEA 2WS3A 4LMLA 5FYMA 2V7KA 5HXSA 2V7MA 2D5UA 2YU1A 2CBIA 4DR1T 4GKKT 3GA8A 2E2AA 1BR2A 2A9UA 2Q9QB 3MXZA 4J2CA 2XY8B 3OTOT 3AEDA 2KWIB 4YXDA 3AEBA 4CZZB 4GIWA 2UXNB 3H3AA 5FNVE 3RH3A 3L3PA 3OPCA 2VK9A 3SRZA 5ABHA 4ZI3C 4JI5T 3KV4A 1XDPA 3BK9A 1LVKA 3KBUA 3TLWA 4B3ST 4NPPA 2X0HA 1G73A 2XM1A 3HKEE 5CJ5A 5L3FB 2YU2A 3IF8B 2BZBA 4HWCA 1IJ6A 2KINB 1R8IA 2XSAA 1KF6A 4ZI2D 3PE0A 3VHLA 3Q2MA 4BA9A 2KT9A 3E0ZA 3D0TA 3TLTA 2J4GA 3AEEA 4JEHB 4OX9T 4AQYT 1IAPA 1J5ET 2H88A 3ETUA 4XBFB 3M3ZB 1YQ4A 1ZP0A 2LRLA 2X9HA 2CXFA 3RX6A 2CM0A 4KBMB 2CHOA 1FMVA 4IE0A 3AXJB 3HR0A 4IT4A 3ETVA 3IBPA 5LJNA 3V5SA 1Y64B 4ISTA 1N34T 2JIWA 3MZKB 4JI2T 3HKBE 2X68A 2V7LA 2L3LA 5DABA 4WW0A 1T7SA 2MBGA 2OLTA 2QYWA 2Y48B 4UEMA 4MBQA 4DBRA 3UQ4A 5AQQB 5AFUL 4LF4T 4YLHA 3LK3B 5DJQC 1T98A 2LOPA 1X79A 3EAMA 1BR1A 2X9YA 2WZHA 2N1GA 4EZ4A 4NXNT 4HGAA 3ANWA 5L3GB 3UU8A 4EOZB 3A7MA 3LG7A 3AE2A 4IE6A 1WLXA 4IHJE 3N9OA 3NRXA 5C3JA 3P50A 2DL1A 3ONLC 1KEYA 5JR9C 1D1CA 4P0AA 3E08A 1YKEB 3HL6A 2BBHA 4QX7B 4OK0A 3R6NA 4U7IA 3RLFF 5ADXL 2YDSA 3VR9A 2VB6A 3EVYA 5DQVA 3JADA 2IAKA 3AA6B 2FJDA 3K3OA 4O2AE 3Q5DA 3ZT5A 2LM9A 4HWFA 5KXJA 2PJQA 1MIYA 2MOZA 2DWKA 4X62T 2RPAA 4YTNA 5DQWA 1OEDA 5TAOA 3PUYF 4ILCA 3AE6A 5LG3A 2LSYA 3JAEA 3FZLB 4KP3C 2BVLA 1YKHB 5IWAT 2YEVC 2I59A 3RI5A 2B76A 2ODUA 4HFVA 3C50A 4X1KE 2LJLA 2UU9T 1Z8UA 4AISA 4O2BE 3OBVE 4JLEA 4JV5T 5HEOA 4QH4A 4AKHA 1D0YA 5JRCA 4HWIB 1M7KA 2CRBA 5AQSB 3ZSTA 1O3XA 2EHOB 2VKOA 4H9OC 1H7CA 2NW8A 1MMDA 4PK6A 4TNWA 3I9YA 2E5LT 3P7IA 2K5BB 4A98A 5HCMA 4IIJE 2BKPA 3JC6D 5IUXA 4ZI2C 4LMJA 2FUPA 3ZYKA 1E2AA 5LOVE 2W67A 4OYJA 2Y8DA 4EYUA 2LM2A 4U33A 2IC9A 2WDRA 4QWNB 1UX4A 1MMAA 3LBXB 1XMOT 1BR0A 4AI6A 2K48A 3KINB 5EK2A 3UU3A 2CBJA 2IMLA 2XQ6A 1JNRA 2C5KT 4HFDA 4P0BA 4YSXA 5AQIB 2D0TA 3B5MA 3Q5XA 4EEDA 3LK42 1IBMT 3ZEFB 1ZKEA 4ZOLE 2V8SV 2FJEA 3QOFA 4UVAB 4QH5A 3OYZA 2XAGB 3JAFA 1FEWA 4HFBA 1CHUA 5LHHB 2JQQA 2D9DA 2ES0A 4DV4T 4OFZA 5LBQB 4ILAA 2VL0A 4PJLA 3KBTA 4WYVA 2IHR1 4TV9E 3C4ZA 4B3MT 5FL0A 2H3RA 4DV1T 1UCUA 3RYCE 3BQIA 2VL8A 4DBQA 5CGMA 3F57A 2LOSA 4CN4A 2MAWA 5FL1A 2BG9A 4A97A 2V5DA 3ZMUB 3GMIA 3VRAA 5LHIB 3UU6A 5LMUT 3PUQA 1WCRA 4IDQA 3BQKA 1W09A 3RQUA 3HKCE 2HHHT 2XQ7A 3UUXB 4KHZF 4EAHA 1DU2A 3PJAJ 3CK6A 3DP7A 5AQJB 2R6GF 3N9NA 4DR6T 1ZEEA 3PUXF 5JTGA 2WCAA 1WR0A 4QH1A 3ZSSA 2V1DB 2UXXB 3RQWA 2CCQA 4TWFA 1NAFA 2BG9E 4QXHB 5HAXA 2HN2A 2E9XB 4JBWF 2WQYA 5FY1A 3KVBA 3W15B 2C0SA 2WZIA 3OKQA 1D1AA 4YHHT 3PUVF 4HFHA 3SWHA 3WAJA 4CQIA 2FBWA 3ZC0A 2CA5A 3PU3A 5HEUA 2J47A 1HFAA 3ZJ2A 5HXHA 2LEHA 1VCSA 5H6QB 3R84B 4OHFA 2VQET 4U31A 1IJ5A 5A1LA 4DR2T 4UF0B 1IBLT 2BS3A 4MHCA 2WWUA 3ABVA 2LSKA 2UXBT 3Q5EA 3HI2A 5JREA 1JNZA 5C8YE 4GOUA 4NUVA 4YJ3E 1S94A 1X9BA 2VKJA 3V5UA 2VVSA 2LRKA 2CXDA 3AE5A 3CMLA 5FXVA 1I94T 4U72A 4AXPA 5HXRA 3C51A 4IDOA 2UXCT 3JC6C 5KX5E 3SFDA 5LA6E 4DUYT 4DV2T 4TWDA 3RC3A 4ZS3A 3ZKRA 2DLRA 3ZJ1A 3ZN1B 5AQFB 2BBJA 3AXJA 3RRCA 4NIQA 3UU5A 3RRWA 2XTLA 5LJMA 4P09A 1L0VA 4FJOA 3ZMTB 3ZPOA 1XNQT 5J1GA 2LSIA 3RIFA 3AE3A 1HNWT 1YQ3A 3AE1A 3B57A 3P4QA 2ZM6T 1QLBA 2YDQA 2JQKA 2XAHB 5EK3A 4CXXA 4H9RC 5L3DB 4WNKA 4H63H 4N78D 3MJXA 4DO0A 3UFEA 2VWAA 3T8OA 2CE7A 4JYAT 3VU7H 4IDZA 3N9MA 2C5IT 4QHOA 2KNDA 2CPTA 1UUSA 5EK4A 2ACZA 5L3EB 4NUUA 3QK6A 3RIUA 5FVLA 4E7SA 1D1BA 1HS7A 4MLKA 4I0UA 5GONE 5AQMB 4IE7A 4L5GA 3CQCB 4HWDA 4PK4A 4Z90A 3N9QA 4AIUA 2BG9C 4TWHA 5JDLA 5LBMA 5LB7B 4COFA 5FXZA 1W0AA 4JI6T 4AQFA 3AVSA 2DHRA 3ZCIA 3PJAA 3K3QC 1N36T 4LF6T 4GYSA 4YHJA 2H89A 3RIAA 4CI2B 3B13A 1S35A 3M65A 3UULA 4H9QC 2M6IA 4I43B 2W00A 3FXDB 3NZPA 3S4UA 2LSJA 5JR9B 4UVBB 3F2EA 2QVAA 2E5VA 4KMCA 2WY2A 2BKOA 3PURA 2MTQA 1J5WA 3PUSA 3CX6B 2V6YB 5KDMC 2CXLA 5JDFA 1XWMA 4DMWA 5J0ZA 5J2UE 5AQVB 4DR4T 3PUGA 2AE9A 3LK2B 3PU8A 2JQ9A 2VQFT 2WAUA 4TZ4C 2XQ8A 2YK0A 3UT5E 4E7ZA 2DCFA 1SE7A 4I50E 5ABEA 5HEGA 1KK7A 1V9DA 1Y01A 2Y6XA 5AQNB 5IHYA 3VR8A 3RKGA 3LBXA 3AAEB 4F8HA 4X1YE 4LFCT 2V6XA 3QC9A 4HE8A 4FI5A 4GK5E 2W4XA 1NENA 4IREA 4KHPT 1E1HB 5HYAA 3RKOA 5AQLB 2X67A 3AEAA 4IDPA 5HXEA 3NRYA 3TLSA 4DIDB 1UGOA 2WB5A 4YT0A 3AA1B 5LMNT 4ISSA 3QB5A 4UR9A 4DNDA 1XNRT 3P8CD 1FMWA 2M67A 2DWGA 1WRDA 4HFIA 3I1AA 2I0MA 3RYIE 4QXCB 2OA5A 3AVRA 3ZYLA 2H7VC 1US7B 3O1IA 4UXNB 3EI0A 2XM2A 3CWZB 4DV6T 3CPZA 5IYZE 3RIUC 1MIVA 1NEKA 3TLUA 2KWHA 5KMGP 1VOMA 5J2TE 1OEDE 3N9LA 2WU5A 3AE4A 4K0UA 4CXYA 3AAAB 3MACA 3ZLIA 1Z0PA 4CN1A 3AAIA 2W0GA 4QXBB 3RGLA 4JEUB 4AQFC 1SHZC 1YXRA 3N9PA 1HG2A 4BJNA 2X9XA 1UX5A 3Q9DA 3ZCJA 5AQPB 2LT3A 3ZN0B 2WU2A 2ZM2A 1YD8G 3U78A 4KI0F 1HNZT 2IDOB 4ASKA 2ZM8A 3VKHA 1CUNA 4DV0T 2HN1A 2KXPB 5AQOB 3X1DA 5L3BB 2BS4A 3ZMSB 2W63A 3N2KE 3L09A 4K0KT 4ZEYA 3IEEA 3FB2A 3NKZA 2N2NA 4ZZBA 3C4XA 4ANJA 4UF0A 5FXXA 2IW5B 4UIGA 3FHNA 3Q5WA 5L4EA 4U3CA 2MPKA 4U2YA 2BS2A 3N2OA 4X64T 2K9AA 3O1JA 3SOLA 3PTRB 5HWXA 3K1SA 3EHZA 4IL9A 5AQUB 4YTPA 2G0UA 5LYJE 3LSVA 2ACXA 1HX1B 4CXWA 3CQXC 1MNDA 4A56A 1VRBA 3I0QA 5JRCB 2VVNA 2WSSV 1ZOYA 4A5XA 2YOEA 1NWMX 5LP6E 3PUWF 4B3TT 1XDOA 4XZCA 2UUBT 3CQGB 3O4XE 5M4YA 5CFBA 4G63A 2NP9A 5EZYE 1WFDA 1HG5A 2LSGA 1D0ZA 4H9PC 3A5XA 5H6RB 3MKDA 5JDHA 3KDSE 2UUCT 2Q9QD 1ZV4X 1U4QA 4LMKA 1OEDC 2V26A 2Q9QA 1SA0E 1VCTA 3O9XA 2L9QA 2GK9A 4PAGA 3I0OA 3RC8A 2XHEB 2KZ7B 2XQ9A 2V5CA 2XZEA 2FJBA 4AKIA 2JMHA 1UK5A 2X0LB 4IDNA 2PG8A 1QSDA 2RP4A 5FKYA 4HKAA 4Z91A 2XQ4A 2PTFA 1T8BA 4V1Av 5AQGB 2CLYC 5L4HA 2H7OA 3DJBA 4PJMA 2LHRA 1U5PA 4LF9T 2WDVA 3FBZA 3EUHA 4XAXB 4DV5T 2VKDA 4PK5A 5ABGA 3KV5A 2NOXA 4M1PA 1QUUA 1HNXT 2WMNA 2VKHA 4MALA 1T72A 1HF8A 1HR0T 5HEJA 3QNUA 1XZYA 4F6RC 2BG9B 2JRKA 5CA0E 2FJAA 4L9IA 3FXEB 4WZXA 4AQGA 2LHNA 5F3JA 2CWYA 2UXDT 5ETWA 3N2GE 5ABFB 2KLQA 3HA4A 3DTOA 2W61A 2W66A 4YTMA 3C4WA 3E22E 3OVUA 4WBNE 4JI3T 2XQ5A 4IE4A 3ONXA 2HH7A 3ESLA 2C5JA 3GN5B 2AXDS 4P1NA 2WM9A 4ZZCA 3FZFB 4DVDA 2ZM0A 3AECA 4Q25A 3PUAA 2LKGA 2KMFA 2WMOA 4JI4T 4TV8E 5HCJA 4U74A 2NTYA 2Z6EA 4O8SA 3T1HT 2X0YA 2YKSA 4TX5A 3MA9A 3GWHA 5FMNA 2JMKA 1MMGA 5FVKA 1MNEA 5AQRB 2JQHA 4LFAT 5HWYA 2NTXA 2E8IA 2RA1A 2CMRA 2CEAA 5HXCA 3UTKA 4PFPA 5FXWA 2K3WA 2WBLA 2Q9QC 3AEFA 3EDUA 5LGTB 5F5WA 3PV0F 5CB4E 2V7IA 2UUAT 4EIWA 4LF8T 3FZHB 4ILBA 1M62A 3P4RA 4O4HE 2EHOD 4O4LE 4QKNA 3H37A 3AE9A 1E7PA 4ADZA 2KSRA 4C91A 2EHOA 2BVMA 2L8KA 4O4JE 3CVRA 3CX7B 5JDMA 3RPUA 1WYCA 1HCIA 5E0OA 4DV3T 2SPCA 4LFBT 1HX8A 4YJ2E 4ZI7E 4B6XA 4IE5A 4H9SE 4DR5T 5JQGE 2WP9A 4PW8A 3UUMA 1IBKT 3ZT7A 2YDRA 2X66A 4HN9A 4ILUA 1HTJF 4GK0E 5AQKB 4U7YA 4BJMA 3RF1A 2MYSA 1I6ZA 1KNZA 4HTEA 3F31A 4X66T 5FY0A 4YSZA 3ZC1A 4OYKA 1SUMB 3NBXX 5CA1E 3UQ7A 1LVFA 2XAFB 4H63V 2JJ9A 3QB5K 2CHNA 4EZHA 2IUBA 4G2AA 1IZNB 1LKXA 3UUNA 1OWAA 5JDNA 3AB3B 2PBIA 3L39A 3G06A 3K8PC 4EEBA 3LFMA 4HEAA 4JI7T 2QGSA 3P4WA 4C90A 2W62A 4AKRB 3J9X1 2XAQB 3AEGA 4YFSA 2XASB 4DV7T 5F8PA 3OJAA 4DR7T 3KVAA 2A72A 4H9NC 3WAKA 3LDQB 4Z8XA 1OXZA 4JUYA 3IHRA 3AA7B 4PNIA 4YSYA 3UFGA 2DNXA 3CKDA 3ANWB 3CIRA 1FIOA 3TKLB 1WYBA 1AJ3A 2F4VT 3U3IA 2P9BA 2E9XD 5L2LA 3N5LA 2BDEA 1XMQT 4KUMB 4X20E 4ZS2A 3I9WA 4BAYB 1MMNA 4IL4A 1N32T 1N33T 4L0RA 2YINA 2E9XA 3NZQA 3ZT6A 4GKJT 5L3CB 3LJCA 4O4IE 1WR6A 4YY3T 4UV9B 5LCYA 4EYYR 3FZKB 4X5TA 4AKLA 3RYHE 1W0BA 2XPKA 2XSBA 2VASA 2LLYA 4CN6A 3TLVA 4UV8B 3ZMVB 4TUYE 3UUBA 4AKGA 2CWOA 1EZ3A 2HPLA 2EHOC 5JH7E 4HWHA 2NW7A 1W9RA 1OEDB 2DI4A 1ZHCA 4PFOA 1KNPA 4JI8T 4CI3B 2HPJA 3AE8A 2NWBA 3UU4A 2QA7A 2D0UA 1GQEA 2X51A 3P4PA 2ODVA 4ZI3D 2JPFA 3K3NA 2XQ3A 4X1IE 3T1YT 3ONJA 4TN7B 3A8YC 5L47A 5LHGB 1KNRA 5LGUB 3SFEA 4PJNA 5HEHA 5JVDE 4LF5T 5JDGA 4DUZT 2LKHA 2CLYB 3IA3A 2IIUA 2A3DA 1LRZA 2ZMAA 2QRXA 2V7JA 3MK7C 3RYFE 5JDQA 2D2SA 3L8RA 4WBOA 4I55E 3P4SA 3O1HA 3C64A 2BKNA
chains in the Genus database with same CATH topology
3AXJB 3QB5A 3PJAJ 2QRXA 2QVAA 3PJAA 3QB5K 4WYVA 1KEYA 3AXJA 3RIUA 1J1JA 3RIUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AXJ B;  3QB5 A;  3PJA J;  2QRX A;  2QVA A;  3PJA A;  3QB5 K;  4WYV A;  1KEY A;  3AXJ A;  3RIU A;  1J1J A;  3RIU C; 
#chains in the Genus database with same CATH topology
 5AQT B;  3C98 B;  3QUJ A;  3KV9 A;  3ZMZ B;  5ABF A;  4KX6 A;  2XUE A;  5BR8 T;  4ERR A;  4EXT A;  1YW0 A;  2ZLY A;  3EDV A;  2WWV A;  5AQH B;  4TNV A;  5LNK A;  2XQA A;  3JCF A;  2J62 A;  2XJ7 A;  3AA0 B;  2YN6 A;  3NVO A;  1FJG T;  1UUR A;  4DMV A;  1MIW A;  3GN5 A;  5LG4 A;  3CX8 B;  4NXM T;  2OV9 A;  3VRB A;  3NWI A;  4B3R T;  2VUR A;  3PUZ F;  4CI1 B;  1KFY A;  2NR4 A;  3VKG A;  1BR4 A;  3BQL A;  2W2U A;  4UEL A;  2PFV A;  2XQY A;  1G8X A;  2M6B A;  2I6H A;  4I4T E;  4GYR A;  4DR3 T;  4UVC B;  3RHW A;  3KV6 A;  4EGW A;  4QX8 B;  3H3M A;  5C2T A;  2WDQ A;  3FBL A;  4U2Z A;  5FP3 A;  3J7Y q;  2N9D A;  2J1D G;  3ZYM A;  3OYX A;  1J1J A;  4LF7 T;  2A2F X;  2LE8 A;  3AE7 A;  4ZXL A;  2IC6 A;  5BMV E;  2B1E A;  4X65 T;  3EAB A;  3FZM B;  5LXT E;  4HFC A;  2E9X C;  2X9W A;  5JR9 A;  2XAJ B;  4JI1 T;  4ZHQ E;  3SS1 A;  1B7T A;  4MFR A;  4IGU A;  3WI3 A;  4EB6 E;  3KFW X;  4EV6 A;  3HKD E;  4PJJ A;  5FY7 A;  5LGN B;  2V6Y A;  2NW9 A;  2K24 A;  4JI0 T;  3PDY A;  1D0X A;  4HFE A;  2WS3 A;  4LML A;  5FYM A;  2V7K A;  5HXS A;  2V7M A;  2D5U A;  2YU1 A;  2CBI A;  4DR1 T;  4GKK T;  3GA8 A;  2E2A A;  1BR2 A;  2A9U A;  2Q9Q B;  3MXZ A;  4J2C A;  2XY8 B;  3OTO T;  3AED A;  2KWI B;  4YXD A;  3AEB A;  4CZZ B;  4GIW A;  2UXN B;  3H3A A;  5FNV E;  3RH3 A;  3L3P A;  3OPC A;  2VK9 A;  3SRZ A;  5ABH A;  4ZI3 C;  4JI5 T;  3KV4 A;  1XDP A;  3BK9 A;  1LVK A;  3KBU A;  3TLW A;  4B3S T;  4NPP A;  2X0H A;  1G73 A;  2XM1 A;  3HKE E;  5CJ5 A;  5L3F B;  2YU2 A;  3IF8 B;  2BZB A;  4HWC A;  1IJ6 A;  2KIN B;  1R8I A;  2XSA A;  1KF6 A;  4ZI2 D;  3PE0 A;  3VHL A;  3Q2M A;  4BA9 A;  2KT9 A;  3E0Z A;  3D0T A;  3TLT A;  2J4G A;  3AEE A;  4JEH B;  4OX9 T;  4AQY T;  1IAP A;  1J5E T;  2H88 A;  3ETU A;  4XBF B;  3M3Z B;  1YQ4 A;  1ZP0 A;  2LRL A;  2X9H A;  2CXF A;  3RX6 A;  2CM0 A;  4KBM B;  2CHO A;  1FMV A;  4IE0 A;  3AXJ B;  3HR0 A;  4IT4 A;  3ETV A;  3IBP A;  5LJN A;  3V5S A;  1Y64 B;  4IST A;  1N34 T;  2JIW A;  3MZK B;  4JI2 T;  3HKB E;  2X68 A;  2V7L A;  2L3L A;  5DAB A;  4WW0 A;  1T7S A;  2MBG A;  2OLT A;  2QYW A;  2Y48 B;  4UEM A;  4MBQ A;  4DBR A;  3UQ4 A;  5AQQ B;  5AFU L;  4LF4 T;  4YLH A;  3LK3 B;  5DJQ C;  1T98 A;  2LOP A;  1X79 A;  3EAM A;  1BR1 A;  2X9Y A;  2WZH A;  2N1G A;  4EZ4 A;  4NXN T;  4HGA A;  3ANW A;  5L3G B;  3UU8 A;  4EOZ B;  3A7M A;  3LG7 A;  3AE2 A;  4IE6 A;  1WLX A;  4IHJ E;  3N9O A;  3NRX A;  5C3J A;  3P50 A;  2DL1 A;  3ONL C;  1KEY A;  5JR9 C;  1D1C A;  4P0A A;  3E08 A;  1YKE B;  3HL6 A;  2BBH A;  4QX7 B;  4OK0 A;  3R6N A;  4U7I A;  3RLF F;  5ADX L;  2YDS A;  3VR9 A;  2VB6 A;  3EVY A;  5DQV A;  3JAD A;  2IAK A;  3AA6 B;  2FJD A;  3K3O A;  4O2A E;  3Q5D A;  3ZT5 A;  2LM9 A;  4HWF A;  5KXJ A;  2PJQ A;  1MIY A;  2MOZ A;  2DWK A;  4X62 T;  2RPA A;  4YTN A;  5DQW A;  1OED A;  5TAO A;  3PUY F;  4ILC A;  3AE6 A;  5LG3 A;  2LSY A;  3JAE A;  3FZL B;  4KP3 C;  2BVL A;  1YKH B;  5IWA T;  2YEV C;  2I59 A;  3RI5 A;  2B76 A;  2ODU A;  4HFV A;  3C50 A;  4X1K E;  2LJL A;  2UU9 T;  1Z8U A;  4AIS A;  4O2B E;  3OBV E;  4JLE A;  4JV5 T;  5HEO A;  4QH4 A;  4AKH A;  1D0Y A;  5JRC A;  4HWI B;  1M7K A;  2CRB A;  5AQS B;  3ZST A;  1O3X A;  2EHO B;  2VKO A;  4H9O C;  1H7C A;  2NW8 A;  1MMD A;  4PK6 A;  4TNW A;  3I9Y A;  2E5L T;  3P7I A;  2K5B B;  4A98 A;  5HCM A;  4IIJ E;  2BKP A;  3JC6 D;  5IUX A;  4ZI2 C;  4LMJ A;  2FUP A;  3ZYK A;  1E2A A;  5LOV E;  2W67 A;  4OYJ A;  2Y8D A;  4EYU A;  2LM2 A;  4U33 A;  2IC9 A;  2WDR A;  4QWN B;  1UX4 A;  1MMA A;  3LBX B;  1XMO T;  1BR0 A;  4AI6 A;  2K48 A;  3KIN B;  5EK2 A;  3UU3 A;  2CBJ A;  2IML A;  2XQ6 A;  1JNR A;  2C5K T;  4HFD A;  4P0B A;  4YSX A;  5AQI B;  2D0T A;  3B5M A;  3Q5X A;  4EED A;  3LK4 2;  1IBM T;  3ZEF B;  1ZKE A;  4ZOL E;  2V8S V;  2FJE A;  3QOF A;  4UVA B;  4QH5 A;  3OYZ A;  2XAG B;  3JAF A;  1FEW A;  4HFB A;  1CHU A;  5LHH B;  2JQQ A;  2D9D A;  2ES0 A;  4DV4 T;  4OFZ A;  5LBQ B;  4ILA A;  2VL0 A;  4PJL A;  3KBT A;  4WYV A;  2IHR 1;  4TV9 E;  3C4Z A;  4B3M T;  5FL0 A;  2H3R A;  4DV1 T;  1UCU A;  3RYC E;  3BQI A;  2VL8 A;  4DBQ A;  5CGM A;  3F57 A;  2LOS A;  4CN4 A;  2MAW A;  5FL1 A;  2BG9 A;  4A97 A;  2V5D A;  3ZMU B;  3GMI A;  3VRA A;  5LHI B;  3UU6 A;  5LMU T;  3PUQ A;  1WCR A;  4IDQ A;  3BQK A;  1W09 A;  3RQU A;  3HKC E;  2HHH T;  2XQ7 A;  3UUX B;  4KHZ F;  4EAH A;  1DU2 A;  3PJA J;  3CK6 A;  3DP7 A;  5AQJ B;  2R6G F;  3N9N A;  4DR6 T;  1ZEE A;  3PUX F;  5JTG A;  2WCA A;  1WR0 A;  4QH1 A;  3ZSS A;  2V1D B;  2UXX B;  3RQW A;  2CCQ A;  4TWF A;  1NAF A;  2BG9 E;  4QXH B;  5HAX A;  2HN2 A;  2E9X B;  4JBW F;  2WQY A;  5FY1 A;  3KVB A;  3W15 B;  2C0S A;  2WZI A;  3OKQ A;  1D1A A;  4YHH T;  3PUV F;  4HFH A;  3SWH A;  3WAJ A;  4CQI A;  2FBW A;  3ZC0 A;  2CA5 A;  3PU3 A;  5HEU A;  2J47 A;  1HFA A;  3ZJ2 A;  5HXH A;  2LEH A;  1VCS A;  5H6Q B;  3R84 B;  4OHF A;  2VQE T;  4U31 A;  1IJ5 A;  5A1L A;  4DR2 T;  4UF0 B;  1IBL T;  2BS3 A;  4MHC A;  2WWU A;  3ABV A;  2LSK A;  2UXB T;  3Q5E A;  3HI2 A;  5JRE A;  1JNZ A;  5C8Y E;  4GOU A;  4NUV A;  4YJ3 E;  1S94 A;  1X9B A;  2VKJ A;  3V5U A;  2VVS A;  2LRK A;  2CXD A;  3AE5 A;  3CML A;  5FXV A;  1I94 T;  4U72 A;  4AXP A;  5HXR A;  3C51 A;  4IDO A;  2UXC T;  3JC6 C;  5KX5 E;  3SFD A;  5LA6 E;  4DUY T;  4DV2 T;  4TWD A;  3RC3 A;  4ZS3 A;  3ZKR A;  2DLR A;  3ZJ1 A;  3ZN1 B;  5AQF B;  2BBJ A;  3AXJ A;  3RRC A;  4NIQ A;  3UU5 A;  3RRW A;  2XTL A;  5LJM A;  4P09 A;  1L0V A;  4FJO A;  3ZMT B;  3ZPO A;  1XNQ T;  5J1G A;  2LSI A;  3RIF A;  3AE3 A;  1HNW T;  1YQ3 A;  3AE1 A;  3B57 A;  3P4Q A;  2ZM6 T;  1QLB A;  2YDQ A;  2JQK A;  2XAH B;  5EK3 A;  4CXX A;  4H9R C;  5L3D B;  4WNK A;  4H63 H;  4N78 D;  3MJX A;  4DO0 A;  3UFE A;  2VWA A;  3T8O A;  2CE7 A;  4JYA T;  3VU7 H;  4IDZ A;  3N9M A;  2C5I T;  4QHO A;  2KND A;  2CPT A;  1UUS A;  5EK4 A;  2ACZ A;  5L3E B;  4NUU A;  3QK6 A;  3RIU A;  5FVL A;  4E7S A;  1D1B A;  1HS7 A;  4MLK A;  4I0U A;  5GON E;  5AQM B;  4IE7 A;  4L5G A;  3CQC B;  4HWD A;  4PK4 A;  4Z90 A;  3N9Q A;  4AIU A;  2BG9 C;  4TWH A;  5JDL A;  5LBM A;  5LB7 B;  4COF A;  5FXZ A;  1W0A A;  4JI6 T;  4AQF A;  3AVS A;  2DHR A;  3ZCI A;  3PJA A;  3K3Q C;  1N36 T;  4LF6 T;  4GYS A;  4YHJ A;  2H89 A;  3RIA A;  4CI2 B;  3B13 A;  1S35 A;  3M65 A;  3UUL A;  4H9Q C;  2M6I A;  4I43 B;  2W00 A;  3FXD B;  3NZP A;  3S4U A;  2LSJ A;  5JR9 B;  4UVB B;  3F2E A;  2QVA A;  2E5V A;  4KMC A;  2WY2 A;  2BKO A;  3PUR A;  2MTQ A;  1J5W A;  3PUS A;  3CX6 B;  2V6Y B;  5KDM C;  2CXL A;  5JDF A;  1XWM A;  4DMW A;  5J0Z A;  5J2U E;  5AQV B;  4DR4 T;  3PUG A;  2AE9 A;  3LK2 B;  3PU8 A;  2JQ9 A;  2VQF T;  2WAU A;  4TZ4 C;  2XQ8 A;  2YK0 A;  3UT5 E;  4E7Z A;  2DCF A;  1SE7 A;  4I50 E;  5ABE A;  5HEG A;  1KK7 A;  1V9D A;  1Y01 A;  2Y6X A;  5AQN B;  5IHY A;  3VR8 A;  3RKG A;  3LBX A;  3AAE B;  4F8H A;  4X1Y E;  4LFC T;  2V6X A;  3QC9 A;  4HE8 A;  4FI5 A;  4GK5 E;  2W4X A;  1NEN A;  4IRE A;  4KHP T;  1E1H B;  5HYA A;  3RKO A;  5AQL B;  2X67 A;  3AEA A;  4IDP A;  5HXE A;  3NRY A;  3TLS A;  4DID B;  1UGO A;  2WB5 A;  4YT0 A;  3AA1 B;  5LMN T;  4ISS A;  3QB5 A;  4UR9 A;  4DND A;  1XNR T;  3P8C D;  1FMW A;  2M67 A;  2DWG A;  1WRD A;  4HFI A;  3I1A A;  2I0M A;  3RYI E;  4QXC B;  2OA5 A;  3AVR A;  3ZYL A;  2H7V C;  1US7 B;  3O1I A;  4UXN B;  3EI0 A;  2XM2 A;  3CWZ B;  4DV6 T;  3CPZ A;  5IYZ E;  3RIU C;  1MIV A;  1NEK A;  3TLU A;  2KWH A;  5KMG P;  1VOM A;  5J2T E;  1OED E;  3N9L A;  2WU5 A;  3AE4 A;  4K0U A;  4CXY A;  3AAA B;  3MAC A;  3ZLI A;  1Z0P A;  4CN1 A;  3AAI A;  2W0G A;  4QXB B;  3RGL A;  4JEU B;  4AQF C;  1SHZ C;  1YXR A;  3N9P A;  1HG2 A;  4BJN A;  2X9X A;  1UX5 A;  3Q9D A;  3ZCJ A;  5AQP B;  2LT3 A;  3ZN0 B;  2WU2 A;  2ZM2 A;  1YD8 G;  3U78 A;  4KI0 F;  1HNZ T;  2IDO B;  4ASK A;  2ZM8 A;  3VKH A;  1CUN A;  4DV0 T;  2HN1 A;  2KXP B;  5AQO B;  3X1D A;  5L3B B;  2BS4 A;  3ZMS B;  2W63 A;  3N2K E;  3L09 A;  4K0K T;  4ZEY A;  3IEE A;  3FB2 A;  3NKZ A;  2N2N A;  4ZZB A;  3C4X A;  4ANJ A;  4UF0 A;  5FXX A;  2IW5 B;  4UIG A;  3FHN A;  3Q5W A;  5L4E A;  4U3C A;  2MPK A;  4U2Y A;  2BS2 A;  3N2O A;  4X64 T;  2K9A A;  3O1J A;  3SOL A;  3PTR B;  5HWX A;  3K1S A;  3EHZ A;  4IL9 A;  5AQU B;  4YTP A;  2G0U A;  5LYJ E;  3LSV A;  2ACX A;  1HX1 B;  4CXW A;  3CQX C;  1MND A;  4A56 A;  1VRB A;  3I0Q A;  5JRC B;  2VVN A;  2WSS V;  1ZOY A;  4A5X A;  2YOE A;  1NWM X;  5LP6 E;  3PUW F;  4B3T T;  1XDO A;  4XZC A;  2UUB T;  3CQG B;  3O4X E;  5M4Y A;  5CFB A;  4G63 A;  2NP9 A;  5EZY E;  1WFD A;  1HG5 A;  2LSG A;  1D0Z A;  4H9P C;  3A5X A;  5H6R B;  3MKD A;  5JDH A;  3KDS E;  2UUC T;  2Q9Q D;  1ZV4 X;  1U4Q A;  4LMK A;  1OED C;  2V26 A;  2Q9Q A;  1SA0 E;  1VCT A;  3O9X A;  2L9Q A;  2GK9 A;  4PAG A;  3I0O A;  3RC8 A;  2XHE B;  2KZ7 B;  2XQ9 A;  2V5C A;  2XZE A;  2FJB A;  4AKI A;  2JMH A;  1UK5 A;  2X0L B;  4IDN A;  2PG8 A;  1QSD A;  2RP4 A;  5FKY A;  4HKA A;  4Z91 A;  2XQ4 A;  2PTF A;  1T8B A;  4V1A v;  5AQG B;  2CLY C;  5L4H A;  2H7O A;  3DJB A;  4PJM A;  2LHR A;  1U5P A;  4LF9 T;  2WDV A;  3FBZ A;  3EUH A;  4XAX B;  4DV5 T;  2VKD A;  4PK5 A;  5ABG A;  3KV5 A;  2NOX A;  4M1P A;  1QUU A;  1HNX T;  2WMN A;  2VKH A;  4MAL A;  1T72 A;  1HF8 A;  1HR0 T;  5HEJ A;  3QNU A;  1XZY A;  4F6R C;  2BG9 B;  2JRK A;  5CA0 E;  2FJA A;  4L9I A;  3FXE B;  4WZX A;  4AQG A;  2LHN A;  5F3J A;  2CWY A;  2UXD T;  5ETW A;  3N2G E;  5ABF B;  2KLQ A;  3HA4 A;  3DTO A;  2W61 A;  2W66 A;  4YTM A;  3C4W A;  3E22 E;  3OVU A;  4WBN E;  4JI3 T;  2XQ5 A;  4IE4 A;  3ONX A;  2HH7 A;  3ESL A;  2C5J A;  3GN5 B;  2AXD S;  4P1N A;  2WM9 A;  4ZZC A;  3FZF B;  4DVD A;  2ZM0 A;  3AEC A;  4Q25 A;  3PUA A;  2LKG A;  2KMF A;  2WMO A;  4JI4 T;  4TV8 E;  5HCJ A;  4U74 A;  2NTY A;  2Z6E A;  4O8S A;  3T1H T;  2X0Y A;  2YKS A;  4TX5 A;  3MA9 A;  3GWH A;  5FMN A;  2JMK A;  1MMG A;  5FVK A;  1MNE A;  5AQR B;  2JQH A;  4LFA T;  5HWY A;  2NTX A;  2E8I A;  2RA1 A;  2CMR A;  2CEA A;  5HXC A;  3UTK A;  4PFP A;  5FXW A;  2K3W A;  2WBL A;  2Q9Q C;  3AEF A;  3EDU A;  5LGT B;  5F5W A;  3PV0 F;  5CB4 E;  2V7I A;  2UUA T;  4EIW A;  4LF8 T;  3FZH B;  4ILB A;  1M62 A;  3P4R A;  4O4H E;  2EHO D;  4O4L E;  4QKN A;  3H37 A;  3AE9 A;  1E7P A;  4ADZ A;  2KSR A;  4C91 A;  2EHO A;  2BVM A;  2L8K A;  4O4J E;  3CVR A;  3CX7 B;  5JDM A;  3RPU A;  1WYC A;  1HCI A;  5E0O A;  4DV3 T;  2SPC A;  4LFB T;  1HX8 A;  4YJ2 E;  4ZI7 E;  4B6X A;  4IE5 A;  4H9S E;  4DR5 T;  5JQG E;  2WP9 A;  4PW8 A;  3UUM A;  1IBK T;  3ZT7 A;  2YDR A;  2X66 A;  4HN9 A;  4ILU A;  1HTJ F;  4GK0 E;  5AQK B;  4U7Y A;  4BJM A;  3RF1 A;  2MYS A;  1I6Z A;  1KNZ A;  4HTE A;  3F31 A;  4X66 T;  5FY0 A;  4YSZ A;  3ZC1 A;  4OYK A;  1SUM B;  3NBX X;  5CA1 E;  3UQ7 A;  1LVF A;  2XAF B;  4H63 V;  2JJ9 A;  3QB5 K;  2CHN A;  4EZH A;  2IUB A;  4G2A A;  1IZN B;  1LKX A;  3UUN A;  1OWA A;  5JDN A;  3AB3 B;  2PBI A;  3L39 A;  3G06 A;  3K8P C;  4EEB A;  3LFM A;  4HEA A;  4JI7 T;  2QGS A;  3P4W A;  4C90 A;  2W62 A;  4AKR B;  3J9X 1;  2XAQ B;  3AEG A;  4YFS A;  2XAS B;  4DV7 T;  5F8P A;  3OJA A;  4DR7 T;  3KVA A;  2A72 A;  4H9N C;  3WAK A;  3LDQ B;  4Z8X A;  1OXZ A;  4JUY A;  3IHR A;  3AA7 B;  4PNI A;  4YSY A;  3UFG A;  2DNX A;  3CKD A;  3ANW B;  3CIR A;  1FIO A;  3TKL B;  1WYB A;  1AJ3 A;  2F4V T;  3U3I A;  2P9B A;  2E9X D;  5L2L A;  3N5L A;  2BDE A;  1XMQ T;  4KUM B;  4X20 E;  4ZS2 A;  3I9W A;  4BAY B;  1MMN A;  4IL4 A;  1N32 T;  1N33 T;  4L0R A;  2YIN A;  2E9X A;  3NZQ A;  3ZT6 A;  4GKJ T;  5L3C B;  3LJC A;  4O4I E;  1WR6 A;  4YY3 T;  4UV9 B;  5LCY A;  4EYY R;  3FZK B;  4X5T A;  4AKL A;  3RYH E;  1W0B A;  2XPK A;  2XSB A;  2VAS A;  2LLY A;  4CN6 A;  3TLV A;  4UV8 B;  3ZMV B;  4TUY E;  3UUB A;  4AKG A;  2CWO A;  1EZ3 A;  2HPL A;  2EHO C;  5JH7 E;  4HWH A;  2NW7 A;  1W9R A;  1OED B;  2DI4 A;  1ZHC A;  4PFO A;  1KNP A;  4JI8 T;  4CI3 B;  2HPJ A;  3AE8 A;  2NWB A;  3UU4 A;  2QA7 A;  2D0U A;  1GQE A;  2X51 A;  3P4P A;  2ODV A;  4ZI3 D;  2JPF A;  3K3N A;  2XQ3 A;  4X1I E;  3T1Y T;  3ONJ A;  4TN7 B;  3A8Y C;  5L47 A;  5LHG B;  1KNR A;  5LGU B;  3SFE A;  4PJN A;  5HEH A;  5JVD E;  4LF5 T;  5JDG A;  4DUZ T;  2LKH A;  2CLY B;  3IA3 A;  2IIU A;  2A3D A;  1LRZ A;  2ZMA A;  2QRX A;  2V7J A;  3MK7 C;  3RYF E;  5JDQ A;  2D2S A;  3L8R A;  4WBO A;  4I55 E;  3P4S A;  3O1H A;  3C64 A;  2BKN A; 
#chains in the Genus database with same CATH homology
 3AXJ B;  3QB5 A;  3PJA J;  2QRX A;  2QVA A;  3PJA A;  3QB5 K;  4WYV A;  1KEY A;  3AXJ A;  3RIU A;  1J1J A;  3RIU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...