3QB8A

Paramecium chlorella bursaria virus1 putative orf a654l is a polyamine acetyltransferase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
197
structure length
197
Chain Sequence
MYTLIKLTSEYTSRAISFTSRNFVASEPTSIALKLTTCDFTTSFQNIMKQCVDYGHSFAFVDADDNIKAQILNIPYDAYENMHYGNIRETDPMFDLFGNLDSYTPDDKCLYVFAIGSEVTGKGLATKLLKKTIEESSSHGFKYIYGDCTNIISQNMFEKHGFETVGSVKYKGYQYGITKPFDSINCTEYIKRMVKTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A654L protein
publication title Paramecium bursaria chlorella virus 1 encodes a polyamine acetyltransferase.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Transferase
total genus 70
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3qb8A00
3I3GA 2ZPAA 4QVTA 2Z0ZA 2FIAA 1PUAA 3DNSA 3QAHA 4HNYB 4AVBA 1PU9A 4E8OA 4R3KA 1MJAA 1KUXA 4KLWA 4ZBGA 2VBQA 2HUZA 3S6FA 4QUSA 5F49A 1M4IA 2EVNA 3D3SA 3T90A 3UY5A 4B5OA 1YVOA 5JPHA 3FYNA 1OZPA 4NF1A 5JQ4A 1IICA 4E0AA 2JLMA 4KOXA 2BUEA 3G8WA 1I21A 3S6HA 3FNCA 4ORFA 4QBJA 1M44A 4JXQA 4AG9A 4CAWA 2AJ6A 2ZW7A 4KLVA 3EFAA 1IYKA 3FBUA 4ONUA 3TO7A 3TO9A 1RXTA 1MJ9A 2WPWA 2FCKA 2R8VA 2K5TA 2B5GA 5KTCA 1QSTA 3FXTA 3GY9A 4NXYA 4XPDB 2VXKA 2C27A 2Q4VA 3EY5A 4PSWA 4KORA 4DNCA 4H6ZA 1MK4A 2BEIA 4KZTA 5DWNA 5J8CA 3QB8A 3EXNA 3B8GA 1YREA 2JDCA 1QSOA 4JXRA 1IB1E 2B3VA 4R87A 2BL1A 2RC4A 2P6GA 3NE7A 2Q0YA 5FVJA 3SXOA 2VZYA 3W6XA 1S7FA 1YX0A 2CY2A 1YLEA 5F46A 3G3SA 4II9A 3DR6A 2G0BA 4CAVA 2R1IA 4PV6A 1Y7RA 2KCWA 4H89A 4J3GA 5J8FA 1Y9KA 5E96A 4PK2A 1XEBA 3R95A 2FIWA 4KVXA 1Q2CA 3VWDA 4R57A 1WWZA 2F5IA 4IUSA 4MBUA 3BJ8A 2ZW5A 2VEZA 3N7ZA 4CRZB 4AG7A 4HNWB 3EC4A 3K9UA 3CXPA 3DDDA 3SXNA 1S7KA 4Y49C 4RI1A 3V8IA 4KVME 5H86A 4QB9A 1S7LA 2J8NA 3GKRA 2R98A 5C82A 3DR8A 3D8PA 2I79A 1B87A 4M3SA 2OZGA 1XE4A 1V0CA 1LRZA 1U6MA 3CXSA 5I0CA 2FS5A 2FSRA 3FB3A 2VZZA 4JWPA 1P0HA 4CRYB 2P0WA 3KKWA 4XPLA 3H4QA 1BO4A 1XMTA 2Q7BA 3TOBA 4KOVA 1TIQA 5F48A 1GHEA 2OB0A 4NSQA 2OU2A 4XNHB 3TE4A 2HV2A 4MI4A 1Z4EA 2P6EA 2A4NA 2WPXA 2I00A 2PC1A 4PK3A 5IX3A 4QC6A 2REEA 1YVKA 2EUIA 2JEVA 4MY0A 4LX9A 3TOAA 3P2HA 3F5BA 3SHPA 3F0AA 4B5PB 4KOSA 5C88A 1M1DA 3R9EA 1QSMA 2G3TA 3BLNA 2B58A 2Q44A 1XIXA 4UBRA 1CJWA 3OWCA 3W91A 2Y0MA 1B6BA 4JJXA 3LD2A 1S3ZA 2B3UA 1Z9UA 4MY3A 4OLLA 1VHSA 1IIDA 4UWJA 4UA3A 5HMNA 3VWEA 5DWMA 4HNXB 3D2PA 2PR8A 1R57A 2Z11A 2B4DB 2FE7A 4L89A 2GE3A 3S6KA 4AB7A 4CAXA 4MJ8A 4YRHA 3DSBA 1RO5A 3WR7A 2OZUA 4PSXA 3R9FA 3TT2A 2D4PA 3PZJA 3W6SA 2QIRA 1FY7A 5EBVA 2Q04A 4KUBA 2D4OA 4KOYA 1IYLA 2O28A 2J8MA 1M4DA 1L0CA 4NCZA 3TCVA 2DXQA 1Y9WA 4GS4A 4I49A 4XPKA 1NMTA 4U9ZA 2CNSA 3LODA 4F6AA 4OADA 3TO6A 4F0YA 2VI7A 4XPDC 3PGPA 1M4GA 5EC4A 3FIXA 4YGOA 2G3AA 3CXQA 4MHDA 2OZHA 1SQHA 4KVOE 2ARHA 1NSLA 2Q4YA 3TFYA 3R9GA 2BSWA 5KTAA 2X7BA 2B5GB 3GYAA 4KUAA 4E2AA 3C26A 4X5KA 5CNPA 5KTDA 1MJBA 2PR1A 2JDDA 2ZW6A 1ON0A 1P4NA 4EVYA 3D2MA 2OH1A 4FD7A 1NE9A 2QMLA 4K30A 3EO4A 2PSWA 1WK4A 2AE6A 2IL4A 4U9YA 4FD5A 4KOWA 2Z10A 1K4JA 2B4BA 4BMHA 2PRBA 2QECA 4JLYA 4CS0B 5IV0A 1S7NA 3I9SA 1I1DA 4R3LA 1KZFA 3E0KA 3IGRA 2J8RA 4KOTA 4AVCA 4UWIA 3F8KA 3RYOA 1S5KA 2P6FA 3JUWA 5HH1A 1KUVA 2ATRA 3ZZIA 3P2FA 3IWGA 1S60A 3FRMA 5F47A 4RS2A 1Z4RA 2CNMA 4U5YA 1UFHA 2GIVA 1J4JA 4OAEA 4KOUA 4JD6A 3JVNA 4Y49B 1BOBA 2VQYA 2R7HA 4FD4A 2PDOA 4M85A 5ISVA 3ZJ0A 2CNTA 3TTHA 1VKCA 1N71A 3BJ7A 3T9YA 4YFJA 4XNHC 3S6GA 1I12A 2PQ8A 1QSRA 1Q2DA 2ZXVA 2REFA 4B5PA 2GANA 3R1KA 2FL4A 1YK3A 4IF5A 4R9MA 1Q2YA 1QSNA 2ZW4A 4L8AA 5GCNA 4HKFA 1XF8A 3PP9A 2H5MA 2NMTA 1YGHA 4H6UA 5H84A 2FT0A 3MGDA 4LUAA 1KUYA 3R96A 1CM0A 4AVAA 2FXFA 4NEXA 1YR0A 2HQYA 4FD6A 5IB0A 2B4DA
chains in the Genus database with same CATH superfamily
2NYQA 3I3GA 2ZPAA 4QVTA 3PB9X 1Y0RA 2Z0ZA 2JBJA 3HLPA 4UFXA 1LAPA 3PB7X 5K8MA 3WT4A 2ZEGA 2FIAA 1PUAA 3DNSA 3QAHA 3S9NA 4HNYB 4AVBA 2DPTA 1PU9A 2YNDA 1LOKA 3HUVA 3D68A 4E8OA 4R3KA 1X12A 2ZOGA 1X10A 1MJAA 1KUXA 1QQ9A 2WZNA 4KLWA 4ZBGA 4EMEA 2VBQA 4A32A 1CBXA 2HUZA 3S6FA 4QUSA 4OKOA 2QVPA 4TNUA 4ZY2A 3B3SA 5F49A 1M4IA 3D7DA 2EVNA 3SJGA 3D3SA 3T90A 3UY5A 3FX6A 2QJ8A 4MCSA 5K8PA 3KHXA 4B5OA 3D66A 1YVOA 5JPHA 3FYNA 4NGQA 1OZPA 4NF1A 4NJRA 5JQ4A 2PIYA 3PB6X 1IICA 4E0AA 2JLMA 7CPAA 4KOXA 2BUEA 1PCAA 3G8WA 1I21A 3S6HA 4KSFA 2XEJA 3FNCA 3MRUA 4ORFA 3WC7A 3CPXA 1M44A 4JXQA 4QBJA 4AG9A 4CAWA 4A94A 2EWBA 2AJ6A 2ZW7A 4KLVA 2V8GA 1IYKA 2AFMA 3EFAA 4A30A 4CYQA 2CTBA 5D29A 3SI0A 3FBUA 4ONUA 1BPNA 2XEIA 2Q7SA 3IIBA 3TO7A 3TO9A 1RXTA 1MJ9A 2WPWA 4BINA 2FCKA 2R8VA 2K5TA 4NGSA 4B6ZA 1YW4A 2B5GA 2PJ1A 5KTCA 1QSTA 3FXTA 3GY9A 4NXYA 4XPDB 4X8IA 2VXKA 1ZO0A 2CXAA 2C27A 2Q4VA 3EY5A 4PSWA 4CAEA 4KORA 4C7IA 3FECA 2Z3PA 4ZGYB 4DNCA 4H6ZA 1MK4A 1VHEA 4KSAA 2EK9A 2BEIA 3PFEA 2CIJA 4KZTA 4OC4A 5DWNA 5J8CA 2RFHA 3QB8A 3EXNA 3D7GA 3B8GA 1YREA 2JDCA 4OIDA 3KR4A 1TKFA 2QYVA 4CGMA 1QSOA 4JXRA 1IB1E 2B3VA 2F8HA 2BL1A 2RC4A 4R87A 2P6GA 3NE7A 4MCQA 2J9AA 2Q0YA 4PPZA 5K8OA 5ELYA 5FVJA 3I1UA 3SXOA 3WABA 3QNVA 3FH4A 2VZYA 3W6XA 3D7FA 1S7FA 3LACA 1YX0A 1VIXA 3CPAA 4A2ZA 5A27A 2CY2A 4P10A 2ZEPA 4P45A 1YLEA 5F46A 3G3SA 4R8FA 4A31A 4ZYQA 4II9A 3DR6A 2G0BA 4CAVA 2R1IA 4C7HA 4FAIA 4PV6A 1Y7RA 2KCWA 4H89A 4J3GA 5J8FA 1Y9KA 3GLJA 3L2NA 4R9MA 4PK2A 5E96A 1XEBA 3R95A 2FIWA 4HPSA 4OC1A 2GLFA 4KVXA 1Q2CA 3VWDA 4CGLA 3ISZA 4R57A 2EBJA 2C1CA 1WWZA 2F5IA 3WC6A 4IUSA 1DTDA 1EE3P 2Z3OA 4MHZA 4MBUA 2ZELA 3BJ8A 4LQGA 2ZW5A 2VEZA 5LRGA 1ARMA 2YGWA 4NFRA 3N7ZA 3NFZA 3B3VA 4AG7A 4HNWB 4B10A 1Z2LA 4CRZB 1ARLA 1OBRA 3EC4A 4CYPA 3K9UA 3CXPA 4IK2A 3DDDA 3SXNA 4CYNA 1S7KA 1Z8LA 3IU2A 5F09A 4Y49C 4RI1A 3V8IA 4KVME 1JQGA 1HEEA 5H86A 4F0XA 2PJ8A 3WC5A 4JZ0A 4QB9A 4NGMA 2WUUA 1LANA 1S7LA 5CPAA 2C6CA 2J8NA 3GKRA 2R98A 4UIBA 3IO1A 4ZX9A 3DR8A 5C82A 3NH5A 3D8PA 6CPAA 1ZG9A 2I79A 1B87A 4M3SA 4Z65A 5I4MA 2OZGA 2VL1A 4PXDA 4P4EA 4BD9A 4NGTA 4B12A 1XE4A 3LMSA 5AG6A 1V0CA 4B11A 1LRZA 1U6MA 1CG2A 3CXSA 1Y0YA 1YSJA 5I0CA 2FS5A 3H8GA 1LAMA 1XJOA 3IJ3A 4MCRA 4A38A 4GM5A 3PB4X 4DJLA 2FSRA 2BO9A 3FB3A 4UIAA 2VZZA 4JWPA 1P0HA 4CRYB 2Q4ZA 4MFQA 2PVWA 2P0WA 4PXEA 4WWVA 4PXCA 3KKWA 3PFOA 4XPLA 3H4QA 1BO4A 1XMTA 4X3RA 3CZXA 2Q7BA 4WJBA 3TOBA 1AMPA 4M6IA 4KOVA 4UF4A 1TIQA 4CGPA 2PJ7A 5F48A 1GHEA 2OB0A 1HDQA 2HB6A 4YU9A 4NSQA 2OU2A 5D8NA 3IWEA 3FMCA 4XNHB 4F9UA 3TE4A 1BAVA 2HV2A 1Q7LA 1VGYA 3NA6A 4MI4A 4F9VA 1Z4EA 2P6EA 2A4NA 2WPXA 3DGVA 4AXVA 2ZENA 2ZEOA 2I00A 2PC1A 4PK3A 4OC5A 2IMOA 3KR5A 4KSIA 4IHMA 2GREA 5IX3A 4LQ6A 4NGPA 2REEA 4QC6A 3PBEA 4MFZA 3K9TA 2NSMA 1YVKA 2JBKA 4PXBA 2EUIA 2JEVA 4MY0A 4LX9A 5BWAB 3TOAA 5G22A 4M6GA 3P2HA 4UEEA 3RNZA 5AGEA 3F5BA 3SHPA 2ZEDA 2ZOFA 3F0AA 3V38A 4B5PB 4KOSA 4A39A 5C88A 1M1DA 3R9EA 3FEDA 1QSMA 1ZG8A 3BHXA 4UCMA 2G3TA 3BLNA 2B58A 4P44A 2Q44A 4RN7A 4C68A 1Y7EA 5LYIA 1XIXA 4UBRA 1CJWA 3OWCA 3W91A 2Y0MA 1B6BA 4JJXA 5A28A 2XEGA 3LD2A 1S3ZA 1YQEA 2B3UA 1Z9UA 2ZEFA 4UFVA 4DYOA 1H8LA 3IU1A 4MY3A 4OMEA 3PBBA 4OLLA 1VHSA 1IIDA 4CGOA 1IGBA 4UWJA 5AG4A 4UA3A 2JEWA 1ZG7A 2PJ4A 2PCUA 5HMNA 3PRTA 3VWEA 3D7HA 5DWMA 4EFDA 2WSAA 4HNXB 2YNCA 3D2PA 2PR8A 1XOVA 1R57A 2Z11A 4O23A 2B4DB 2YNCC 2FE7A 4L89A 4UEZA 2GE3A 3B7IA 3S6KA 4AB7A 4CAXA 3RAMA 1GYTA 4MJ8A 4YRHA 4NGNA 3DSBA 3KZWA 1RO5A 1F57A 2PJ3A 2G9DA 2WYRA 3QAYA 2OZUA 1IY7A 5G1ZA 3WR7A 4PSXA 3R9FA 2XEFA 2V8DA 3TT2A 2D4PA 3VARA 3PZJA 2Q51A 3W6SA 3IFEA 2QIRA 1FY7A 4UFWA 5EBVA 2Q04A 2ZEEA 3SI1A 4KUBA 2D4OA 5LRJA 1F2PA 3PEIA 1IU8A 4MFPA 4KOYA 4P4DA 2F7VA 1YW6A 4ZY1A 5LYFA 4P4JA 1UWYA 1IYLA 2O28A 2J8MA 4GXHA 1M4DA 1L0CA 4M6HA 4NCZA 2HC9A 2PJ5A 4YWYA 4C2XA 3TX8A 4KS9A 3TCVA 2DF5A 5DS0A 4UCPA 2DXQA 4OIWA 4X2TA 4MHNA 1Y9WA 4G1PA 4GS4A 4I49A 4XPKA 1NMTA 3IEHA 2CNSA 1ELLP 2BOAA 3LODA 4U9ZA 1TKHA 2ZEMA 4OADA 4F6AA 1BLLE 3TO6A 4P4BA 3VH9A 2PJ2A 2VI7A 4XPDC 4F0YA 3PGPA 2GU2A 1M4GA 1Z8XA 5EC4A 3FIXA 2GLJA 4MHYA 3S9LA 4R6TA 4YGOA 4C2ZA 2OR4A 3SJFA 2G3AA 3CXQA 5HVHA 4MHDA 2OZHA 1SQHA 1Z8TA 1CX8A 4KVOE 2ARHA 3D67A 1NSLA 3KASA 3KHZA 1FNOA 2Q4YA 2ZEHA 3TFYA 1ZLHA 1CPXA 3R9GA 2BSWA 5KTAA 2Z3LA 2X7BA 2B5GB 4MMOA 3BI1A 1TF8A 3GYAA 4KUAA 4E2AA 1JWQA 3T8WA 4CGNA 4ONWA 5CBMA 1XRYA 3C26A 1LCPA 3FEEA 4MFJA 4P6YA 4X5KA 1MJBA 5CNPA 5KTDA 2PJ0A 1VHOA 5AG7A 2PR1A 2C6PA 2JDDA 4F8ZA 1TF9A 2ZW6A 1ON0A 1P4NA 5HXDA 3D4UA 4EVYA 3D2MA 2RB7A 3MN8A 3N5FA 2OH1A 3VATA 4FD7A 4DUKA 3FF3A 1NE9A 2QMLA 4MFLA 1AUGA 4K30A 3EO4A 1PYTB 5THWA 2PSWA 5LRKA 1WK4A 2AE6A 2IL4A 3B3TA 5IB9A 1DE4C 3H5ZA 4U9YA 3B3CA 2PE3A 2O4HA 3NH8A 4FD5A 4KOWA 4CPAA 3NE8A 2Z10A 1K4JA 2B4BA 3K2KA 4BMHA 1TXRA 2PVVA 4OC3A 1IOFA 2AFUA 4C2YA 2PRBA 3CT9A 2QECA 4JLYA 4CS0B 3NH4A 1QMUA 2V8HA 5IV0A 2EO8A 1S7NA 3B35A 4NJQA 2PIZA 3I9SA 3KGQA 1I1DA 4R3LA 3V7ZA 1KZFA 3E0KA 1AYEA 3IGRA 4EWTA 2J8RA 4KOTA 4MFKA 4R76A 5HVFA 4AVCA 4UWIA 3F8KA 3RYOA 1S5KA 4CAFA 2P6FA 3RZAA 3CDXA 3JUWA 3FJUA 5HH1A 1KUVA 2ATRA 3ZZIA 3P2FA 2AFWA 2PJAA 3IWGA 4A33A 1S60A 3FRMA 5F47A 4RS2A 1Z4RA 2ODFA 3KI9A 4NGRA 2CNMA 4U5YA 1UFHA 4W9YA 2C6GA 3SJXA 1YMEA 2PJ9A 3IC1A 2GIVA 1J4JA 2AFOA 4OAEA 4B13A 4KOUA 2EK8A 2Z3NA 2V8VA 4JD6A 1YLOA 3H8FA 3JVNA 4Y49B 5LYLA 3A9LA 1A2ZA 1BOBA 2VQYA 4RUHA 2R7HA 3DLJA 4CYOA 2IJZA 4FD4A 1CPSA 3H8EA 5K8NA 3PB8X 2YNEA 2PDOA 2IQ6A 4M85A 2AFSA 3LWUA 1LFWA 2PJ6A 2PJCA 5LYDA 3ZJ0A 5ISVA 4ZY0A 2CNTA 4K3NA 2Q43A 3GUXA 5J1QA 4B14A 2ANPA 2OOTA 2PJBA 3TTHA 2GFQA 1CP6A 1RTQA 4TWEA 4ZX8A 4UCNA 4MCPA 1VKCA 2POKA 1N71A 3BJ7A 3RO0A 3T9YA 2Z3MA 3B2YA 4R7MA 2PRQA 3SI2A 4YFJA 4XNHC 1IOIA 4P4FA 3S6GA 3ISXA 1FT7A 5G21A 1ELMP 1Z8WA 3GB0A 3TC8A 5JGFA 1I12A 1M4LA 1BPMA 3B3WA 2CF4A 1ZLIA 2PQ8A 1QSRA 3BXMA 1Q2DA 3FVLA 5G20A 1XFOA 2BCOA 2V77A 2ZXVA 4UEFA 5HVGA 2REFA 3KQZA 4MXUA 4OC0A 3JTKA 4B5PA 2GANA 4FUUA 3R1KA 2FL4A 4MHPA 4ZI6A 5JM6A 3BI0A 2DPSA 1HDUA 1YK3A 3IWWA 1Q2YA 1QSNA 2ZW4A 3GIUA 3KL9A 4IF5A 4L8AA 4PQAA 5GCNA 4FBEA 4HKFA 5AG5A 1XF8A 3PP9A 1Z5RA 2AFXA 2H5MA 1R43A 2NMTA 3RBUA 1YGHA 2AFZA 4H6UA 1XBUA 4Q7AA 4Q36A 5H84A 2FT0A 5JH9A 3MGDA 4OP4A 4A37A 1NSAA 4P4IA 4FWUA 4A95A 2I3CA 1KWMA 3S9MA 4LUAA 1KUYA 1TKJA 2Z3KA 3R96A 1CM0A 4AVAA 2FXFA 4JYWA 4BBHA 4H2KA 4NEXA 2ABZA 5EMIA 1YR0A 1XMBA 2CTCA 2FVGA 4Q38A 2HQYA 1F2OA 8CPAA 2DEAA 4IAVA 3KQXA 2O53A 1R3NA 3JRUA 4FD6A 4OC2A 1CP7A 2B4DA 3SJEA 5IB0A 4MRIA
chains in the Genus database with same CATH topology
3I3GA 2ZPAA 4QVTA 2Z0ZA 4UFXA 2FIAA 1PUAA 3DNSA 3QAHA 4HNYB 4AVBA 2DPTA 1PU9A 2YNDA 4E8OA 4R3KA 1MJAA 1KUXA 4KLWA 4ZBGA 2VBQA 4A32A 2HUZA 3S6FA 4QUSA 5F49A 1M4IA 2EVNA 3D3SA 3T90A 3UY5A 4B5OA 1YVOA 5JPHA 3FYNA 1OZPA 4NF1A 5JQ4A 1IICA 4E0AA 2JLMA 4KOXA 2BUEA 3G8WA 1I21A 3S6HA 4KSFA 3FNCA 4ORFA 4QBJA 1M44A 4JXQA 4AG9A 4CAWA 2AJ6A 2ZW7A 4KLVA 3EFAA 1IYKA 4A30A 4CYQA 3FBUA 4ONUA 3TO7A 3TO9A 1RXTA 1MJ9A 2WPWA 2FCKA 2R8VA 2K5TA 2B5GA 5KTCA 1QSTA 3FXTA 3GY9A 4NXYA 4XPDB 2VXKA 1ZO0A 2CXAA 2C27A 2Q4VA 3EY5A 4PSWA 4CAEA 4KORA 4C7IA 2Z3PA 4ZGYB 4DNCA 4H6ZA 1MK4A 4KSAA 2BEIA 4KZTA 5DWNA 5J8CA 3QB8A 3EXNA 3B8GA 1YREA 2JDCA 4CGMA 1QSOA 4JXRA 1IB1E 2B3VA 4R87A 2BL1A 2RC4A 2P6GA 3NE7A 2Q0YA 5FVJA 3SXOA 2VZYA 3W6XA 1S7FA 1YX0A 4A2ZA 5A27A 2CY2A 1YLEA 5F46A 3G3SA 4A31A 4II9A 3DR6A 2G0BA 4CAVA 2R1IA 4C7HA 4PV6A 1Y7RA 2KCWA 4H89A 4J3GA 5J8FA 1Y9KA 5E96A 4PK2A 1XEBA 3R95A 2FIWA 4KVXA 1Q2CA 3VWDA 4CGLA 4R57A 1WWZA 2F5IA 4IUSA 2Z3OA 4MBUA 3BJ8A 2ZW5A 2VEZA 2YGWA 3N7ZA 4CRZB 4AG7A 4HNWB 4B10A 3EC4A 4CYPA 3K9UA 3CXPA 3DDDA 3SXNA 4CYNA 1S7KA 3IU2A 4Y49C 4RI1A 3V8IA 4KVME 5H86A 4F0XA 4QB9A 2WUUA 1S7LA 2J8NA 3GKRA 2R98A 5C82A 3DR8A 3D8PA 2I79A 1B87A 4M3SA 2OZGA 4B12A 1XE4A 5AG6A 1V0CA 4B11A 1LRZA 1U6MA 3CXSA 5I0CA 2FS5A 2FSRA 3FB3A 2VZZA 4JWPA 1P0HA 4CRYB 4MFQA 2P0WA 3KKWA 4XPLA 3H4QA 1BO4A 1XMTA 2Q7BA 3TOBA 4KOVA 4CGPA 1TIQA 5F48A 1GHEA 2OB0A 4NSQA 2OU2A 3IWEA 4XNHB 3TE4A 2HV2A 4MI4A 1Z4EA 2P6EA 2A4NA 2WPXA 2I00A 2PC1A 4PK3A 5IX3A 4QC6A 2REEA 4MFZA 1YVKA 2EUIA 2JEVA 4MY0A 4LX9A 5BWAB 3TOAA 5G22A 3P2HA 5AGEA 3F5BA 3SHPA 3F0AA 4B5PB 4KOSA 5C88A 1M1DA 3R9EA 1QSMA 4UCMA 3BLNA 2G3TA 2B58A 4C68A 2Q44A 1XIXA 4UBRA 1CJWA 3OWCA 3W91A 2Y0MA 1B6BA 4JJXA 5A28A 3LD2A 1S3ZA 2B3UA 1Z9UA 4UFVA 4MY3A 3IU1A 4OLLA 1VHSA 1IIDA 4CGOA 4UWJA 5AG4A 4UA3A 5HMNA 3VWEA 5DWMA 2WSAA 4HNXB 2YNCA 3D2PA 2PR8A 1R57A 2Z11A 2B4DB 2YNCC 2FE7A 4L89A 2GE3A 3S6KA 4AB7A 4CAXA 4MJ8A 4YRHA 3DSBA 1RO5A 3WR7A 5G1ZA 2OZUA 4PSXA 3R9FA 3TT2A 2D4PA 3PZJA 3W6SA 2QIRA 1FY7A 4UFWA 5EBVA 2Q04A 4KUBA 2D4OA 4MFPA 4KOYA 1IYLA 2O28A 2J8MA 1M4DA 1L0CA 4NCZA 4C2XA 4KS9A 3TCVA 4UCPA 2DXQA 1Y9WA 4GS4A 4I49A 4XPKA 1NMTA 4U9ZA 2CNSA 3LODA 4F6AA 4OADA 3TO6A 4F0YA 2VI7A 4XPDC 3PGPA 1M4GA 5EC4A 3FIXA 4YGOA 4C2ZA 2G3AA 3CXQA 4MHDA 2OZHA 1SQHA 4KVOE 2ARHA 1NSLA 2Q4YA 3TFYA 3R9GA 2BSWA 5KTAA 2Z3LA 2X7BA 2B5GB 3GYAA 4KUAA 4E2AA 4CGNA 3C26A 4MFJA 4X5KA 5CNPA 1MJBA 5KTDA 5AG7A 2PR1A 2JDDA 2ZW6A 1ON0A 1P4NA 4EVYA 3D2MA 2OH1A 4FD7A 1NE9A 2QMLA 4MFLA 4K30A 3EO4A 2PSWA 1WK4A 2AE6A 2IL4A 3H5ZA 4U9YA 4FD5A 4KOWA 2Z10A 1K4JA 2B4BA 4BMHA 4C2YA 2PRBA 2QECA 4JLYA 4CS0B 5IV0A 1S7NA 3I9SA 1I1DA 4R3LA 1KZFA 3E0KA 3IGRA 2J8RA 4KOTA 4MFKA 4AVCA 4UWIA 3F8KA 3RYOA 1S5KA 4CAFA 2P6FA 3JUWA 5HH1A 1KUVA 2ATRA 3ZZIA 3P2FA 4A33A 3IWGA 1S60A 3FRMA 5F47A 4RS2A 1Z4RA 2CNMA 4U5YA 1UFHA 2GIVA 1J4JA 4OAEA 4B13A 4KOUA 2Z3NA 4JD6A 3JVNA 4Y49B 3A9LA 1BOBA 2VQYA 2R7HA 4CYOA 4FD4A 2YNEA 2PDOA 4M85A 5ISVA 3ZJ0A 2CNTA 4B14A 3TTHA 4UCNA 1VKCA 1N71A 3BJ7A 3T9YA 2Z3MA 4YFJA 4XNHC 3S6GA 5G21A 1I12A 2PQ8A 1QSRA 1Q2DA 5G20A 2ZXVA 2REFA 3JTKA 4B5PA 2GANA 3R1KA 2FL4A 2DPSA 1YK3A 4IF5A 4R9MA 1Q2YA 1QSNA 2ZW4A 4L8AA 5GCNA 4HKFA 5AG5A 1XF8A 3PP9A 2H5MA 2NMTA 1YGHA 4H6UA 4Q36A 5H84A 2FT0A 3MGDA 4A95A 4LUAA 1KUYA 2Z3KA 3R96A 1CM0A 4AVAA 2FXFA 4BBHA 4NEXA 1YR0A 4Q38A 2HQYA 4FD6A 5IB0A 2B4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3G A;  2ZPA A;  4QVT A;  2Z0Z A;  2FIA A;  1PUA A;  3DNS A;  3QAH A;  4HNY B;  4AVB A;  1PU9 A;  4E8O A;  4R3K A;  1MJA A;  1KUX A;  4KLW A;  4ZBG A;  2VBQ A;  2HUZ A;  3S6F A;  4QUS A;  5F49 A;  1M4I A;  2EVN A;  3D3S A;  3T90 A;  3UY5 A;  4B5O A;  1YVO A;  5JPH A;  3FYN A;  1OZP A;  4NF1 A;  5JQ4 A;  1IIC A;  4E0A A;  2JLM A;  4KOX A;  2BUE A;  3G8W A;  1I21 A;  3S6H A;  3FNC A;  4ORF A;  4QBJ A;  1M44 A;  4JXQ A;  4AG9 A;  4CAW A;  2AJ6 A;  2ZW7 A;  4KLV A;  3EFA A;  1IYK A;  3FBU A;  4ONU A;  3TO7 A;  3TO9 A;  1RXT A;  1MJ9 A;  2WPW A;  2FCK A;  2R8V A;  2K5T A;  2B5G A;  5KTC A;  1QST A;  3FXT A;  3GY9 A;  4NXY A;  4XPD B;  2VXK A;  2C27 A;  2Q4V A;  3EY5 A;  4PSW A;  4KOR A;  4DNC A;  4H6Z A;  1MK4 A;  2BEI A;  4KZT A;  5DWN A;  5J8C A;  3QB8 A;  3EXN A;  3B8G A;  1YRE A;  2JDC A;  1QSO A;  4JXR A;  1IB1 E;  2B3V A;  4R87 A;  2BL1 A;  2RC4 A;  2P6G A;  3NE7 A;  2Q0Y A;  5FVJ A;  3SXO A;  2VZY A;  3W6X A;  1S7F A;  1YX0 A;  2CY2 A;  1YLE A;  5F46 A;  3G3S A;  4II9 A;  3DR6 A;  2G0B A;  4CAV A;  2R1I A;  4PV6 A;  1Y7R A;  2KCW A;  4H89 A;  4J3G A;  5J8F A;  1Y9K A;  5E96 A;  4PK2 A;  1XEB A;  3R95 A;  2FIW A;  4KVX A;  1Q2C A;  3VWD A;  4R57 A;  1WWZ A;  2F5I A;  4IUS A;  4MBU A;  3BJ8 A;  2ZW5 A;  2VEZ A;  3N7Z A;  4CRZ B;  4AG7 A;  4HNW B;  3EC4 A;  3K9U A;  3CXP A;  3DDD A;  3SXN A;  1S7K A;  4Y49 C;  4RI1 A;  3V8I A;  4KVM E;  5H86 A;  4QB9 A;  1S7L A;  2J8N A;  3GKR A;  2R98 A;  5C82 A;  3DR8 A;  3D8P A;  2I79 A;  1B87 A;  4M3S A;  2OZG A;  1XE4 A;  1V0C A;  1LRZ A;  1U6M A;  3CXS A;  5I0C A;  2FS5 A;  2FSR A;  3FB3 A;  2VZZ A;  4JWP A;  1P0H A;  4CRY B;  2P0W A;  3KKW A;  4XPL A;  3H4Q A;  1BO4 A;  1XMT A;  2Q7B A;  3TOB A;  4KOV A;  1TIQ A;  5F48 A;  1GHE A;  2OB0 A;  4NSQ A;  2OU2 A;  4XNH B;  3TE4 A;  2HV2 A;  4MI4 A;  1Z4E A;  2P6E A;  2A4N A;  2WPX A;  2I00 A;  2PC1 A;  4PK3 A;  5IX3 A;  4QC6 A;  2REE A;  1YVK A;  2EUI A;  2JEV A;  4MY0 A;  4LX9 A;  3TOA A;  3P2H A;  3F5B A;  3SHP A;  3F0A A;  4B5P B;  4KOS A;  5C88 A;  1M1D A;  3R9E A;  1QSM A;  2G3T A;  3BLN A;  2B58 A;  2Q44 A;  1XIX A;  4UBR A;  1CJW A;  3OWC A;  3W91 A;  2Y0M A;  1B6B A;  4JJX A;  3LD2 A;  1S3Z A;  2B3U A;  1Z9U A;  4MY3 A;  4OLL A;  1VHS A;  1IID A;  4UWJ A;  4UA3 A;  5HMN A;  3VWE A;  5DWM A;  4HNX B;  3D2P A;  2PR8 A;  1R57 A;  2Z11 A;  2B4D B;  2FE7 A;  4L89 A;  2GE3 A;  3S6K A;  4AB7 A;  4CAX A;  4MJ8 A;  4YRH A;  3DSB A;  1RO5 A;  3WR7 A;  2OZU A;  4PSX A;  3R9F A;  3TT2 A;  2D4P A;  3PZJ A;  3W6S A;  2QIR A;  1FY7 A;  5EBV A;  2Q04 A;  4KUB A;  2D4O A;  4KOY A;  1IYL A;  2O28 A;  2J8M A;  1M4D A;  1L0C A;  4NCZ A;  3TCV A;  2DXQ A;  1Y9W A;  4GS4 A;  4I49 A;  4XPK A;  1NMT A;  4U9Z A;  2CNS A;  3LOD A;  4F6A A;  4OAD A;  3TO6 A;  4F0Y A;  2VI7 A;  4XPD C;  3PGP A;  1M4G A;  5EC4 A;  3FIX A;  4YGO A;  2G3A A;  3CXQ A;  4MHD A;  2OZH A;  1SQH A;  4KVO E;  2ARH A;  1NSL A;  2Q4Y A;  3TFY A;  3R9G A;  2BSW A;  5KTA A;  2X7B A;  2B5G B;  3GYA A;  4KUA A;  4E2A A;  3C26 A;  4X5K A;  5CNP A;  5KTD A;  1MJB A;  2PR1 A;  2JDD A;  2ZW6 A;  1ON0 A;  1P4N A;  4EVY A;  3D2M A;  2OH1 A;  4FD7 A;  1NE9 A;  2QML A;  4K30 A;  3EO4 A;  2PSW A;  1WK4 A;  2AE6 A;  2IL4 A;  4U9Y A;  4FD5 A;  4KOW A;  2Z10 A;  1K4J A;  2B4B A;  4BMH A;  2PRB A;  2QEC A;  4JLY A;  4CS0 B;  5IV0 A;  1S7N A;  3I9S A;  1I1D A;  4R3L A;  1KZF A;  3E0K A;  3IGR A;  2J8R A;  4KOT A;  4AVC A;  4UWI A;  3F8K A;  3RYO A;  1S5K A;  2P6F A;  3JUW A;  5HH1 A;  1KUV A;  2ATR A;  3ZZI A;  3P2F A;  3IWG A;  1S60 A;  3FRM A;  5F47 A;  4RS2 A;  1Z4R A;  2CNM A;  4U5Y A;  1UFH A;  2GIV A;  1J4J A;  4OAE A;  4KOU A;  4JD6 A;  3JVN A;  4Y49 B;  1BOB A;  2VQY A;  2R7H A;  4FD4 A;  2PDO A;  4M85 A;  5ISV A;  3ZJ0 A;  2CNT A;  3TTH A;  1VKC A;  1N71 A;  3BJ7 A;  3T9Y A;  4YFJ A;  4XNH C;  3S6G A;  1I12 A;  2PQ8 A;  1QSR A;  1Q2D A;  2ZXV A;  2REF A;  4B5P A;  2GAN A;  3R1K A;  2FL4 A;  1YK3 A;  4IF5 A;  4R9M A;  1Q2Y A;  1QSN A;  2ZW4 A;  4L8A A;  5GCN A;  4HKF A;  1XF8 A;  3PP9 A;  2H5M A;  2NMT A;  1YGH A;  4H6U A;  5H84 A;  2FT0 A;  3MGD A;  4LUA A;  1KUY A;  3R96 A;  1CM0 A;  4AVA A;  2FXF A;  4NEX A;  1YR0 A;  2HQY A;  4FD6 A;  5IB0 A;  2B4D A; 
#chains in the Genus database with same CATH topology
 2NYQ A;  3I3G A;  2ZPA A;  4QVT A;  3PB9 X;  1Y0R A;  2Z0Z A;  2JBJ A;  3HLP A;  4UFX A;  1LAP A;  3PB7 X;  5K8M A;  3WT4 A;  2ZEG A;  2FIA A;  1PUA A;  3DNS A;  3QAH A;  3S9N A;  4HNY B;  4AVB A;  2DPT A;  1PU9 A;  2YND A;  1LOK A;  3HUV A;  3D68 A;  4E8O A;  4R3K A;  1X12 A;  2ZOG A;  1X10 A;  1MJA A;  1KUX A;  1QQ9 A;  2WZN A;  4KLW A;  4ZBG A;  4EME A;  2VBQ A;  4A32 A;  1CBX A;  2HUZ A;  3S6F A;  4QUS A;  4OKO A;  2QVP A;  4TNU A;  4ZY2 A;  3B3S A;  5F49 A;  1M4I A;  3D7D A;  2EVN A;  3SJG A;  3D3S A;  3T90 A;  3UY5 A;  3FX6 A;  2QJ8 A;  4MCS A;  5K8P A;  3KHX A;  4B5O A;  3D66 A;  1YVO A;  5JPH A;  3FYN A;  4NGQ A;  1OZP A;  4NF1 A;  4NJR A;  5JQ4 A;  2PIY A;  3PB6 X;  1IIC A;  4E0A A;  2JLM A;  7CPA A;  4KOX A;  2BUE A;  1PCA A;  3G8W A;  1I21 A;  3S6H A;  4KSF A;  2XEJ A;  3FNC A;  3MRU A;  4ORF A;  3WC7 A;  3CPX A;  1M44 A;  4JXQ A;  4QBJ A;  4AG9 A;  4CAW A;  4A94 A;  2EWB A;  2AJ6 A;  2ZW7 A;  4KLV A;  2V8G A;  1IYK A;  2AFM A;  3EFA A;  4A30 A;  4CYQ A;  2CTB A;  5D29 A;  3SI0 A;  3FBU A;  4ONU A;  1BPN A;  2XEI A;  2Q7S A;  3IIB A;  3TO7 A;  3TO9 A;  1RXT A;  1MJ9 A;  2WPW A;  4BIN A;  2FCK A;  2R8V A;  2K5T A;  4NGS A;  4B6Z A;  1YW4 A;  2B5G A;  2PJ1 A;  5KTC A;  1QST A;  3FXT A;  3GY9 A;  4NXY A;  4XPD B;  4X8I A;  2VXK A;  1ZO0 A;  2CXA A;  2C27 A;  2Q4V A;  3EY5 A;  4PSW A;  4CAE A;  4KOR A;  4C7I A;  3FEC A;  2Z3P A;  4ZGY B;  4DNC A;  4H6Z A;  1MK4 A;  1VHE A;  4KSA A;  2EK9 A;  2BEI A;  3PFE A;  2CIJ A;  4KZT A;  4OC4 A;  5DWN A;  5J8C A;  2RFH A;  3QB8 A;  3EXN A;  3D7G A;  3B8G A;  1YRE A;  2JDC A;  4OID A;  3KR4 A;  1TKF A;  2QYV A;  4CGM A;  1QSO A;  4JXR A;  1IB1 E;  2B3V A;  2F8H A;  2BL1 A;  2RC4 A;  4R87 A;  2P6G A;  3NE7 A;  4MCQ A;  2J9A A;  2Q0Y A;  4PPZ A;  5K8O A;  5ELY A;  5FVJ A;  3I1U A;  3SXO A;  3WAB A;  3QNV A;  3FH4 A;  2VZY A;  3W6X A;  3D7F A;  1S7F A;  3LAC A;  1YX0 A;  1VIX A;  3CPA A;  4A2Z A;  5A27 A;  2CY2 A;  4P10 A;  2ZEP A;  4P45 A;  1YLE A;  5F46 A;  3G3S A;  4R8F A;  4A31 A;  4ZYQ A;  4II9 A;  3DR6 A;  2G0B A;  4CAV A;  2R1I A;  4C7H A;  4FAI A;  4PV6 A;  1Y7R A;  2KCW A;  4H89 A;  4J3G A;  5J8F A;  1Y9K A;  3GLJ A;  3L2N A;  4R9M A;  4PK2 A;  5E96 A;  1XEB A;  3R95 A;  2FIW A;  4HPS A;  4OC1 A;  2GLF A;  4KVX A;  1Q2C A;  3VWD A;  4CGL A;  3ISZ A;  4R57 A;  2EBJ A;  2C1C A;  1WWZ A;  2F5I A;  3WC6 A;  4IUS A;  1DTD A;  1EE3 P;  2Z3O A;  4MHZ A;  4MBU A;  2ZEL A;  3BJ8 A;  4LQG A;  2ZW5 A;  2VEZ A;  5LRG A;  1ARM A;  2YGW A;  4NFR A;  3N7Z A;  3NFZ A;  3B3V A;  4AG7 A;  4HNW B;  4B10 A;  1Z2L A;  4CRZ B;  1ARL A;  1OBR A;  3EC4 A;  4CYP A;  3K9U A;  3CXP A;  4IK2 A;  3DDD A;  3SXN A;  4CYN A;  1S7K A;  1Z8L A;  3IU2 A;  5F09 A;  4Y49 C;  4RI1 A;  3V8I A;  4KVM E;  1JQG A;  1HEE A;  5H86 A;  4F0X A;  2PJ8 A;  3WC5 A;  4JZ0 A;  4QB9 A;  4NGM A;  2WUU A;  1LAN A;  1S7L A;  5CPA A;  2C6C A;  2J8N A;  3GKR A;  2R98 A;  4UIB A;  3IO1 A;  4ZX9 A;  3DR8 A;  5C82 A;  3NH5 A;  3D8P A;  6CPA A;  1ZG9 A;  2I79 A;  1B87 A;  4M3S A;  4Z65 A;  5I4M A;  2OZG A;  2VL1 A;  4PXD A;  4P4E A;  4BD9 A;  4NGT A;  4B12 A;  1XE4 A;  3LMS A;  5AG6 A;  1V0C A;  4B11 A;  1LRZ A;  1U6M A;  1CG2 A;  3CXS A;  1Y0Y A;  1YSJ A;  5I0C A;  2FS5 A;  3H8G A;  1LAM A;  1XJO A;  3IJ3 A;  4MCR A;  4A38 A;  4GM5 A;  3PB4 X;  4DJL A;  2FSR A;  2BO9 A;  3FB3 A;  4UIA A;  2VZZ A;  4JWP A;  1P0H A;  4CRY B;  2Q4Z A;  4MFQ A;  2PVW A;  2P0W A;  4PXE A;  4WWV A;  4PXC A;  3KKW A;  3PFO A;  4XPL A;  3H4Q A;  1BO4 A;  1XMT A;  4X3R A;  3CZX A;  2Q7B A;  4WJB A;  3TOB A;  1AMP A;  4M6I A;  4KOV A;  4UF4 A;  1TIQ A;  4CGP A;  2PJ7 A;  5F48 A;  1GHE A;  2OB0 A;  1HDQ A;  2HB6 A;  4YU9 A;  4NSQ A;  2OU2 A;  5D8N A;  3IWE A;  3FMC A;  4XNH B;  4F9U A;  3TE4 A;  1BAV A;  2HV2 A;  1Q7L A;  1VGY A;  3NA6 A;  4MI4 A;  4F9V A;  1Z4E A;  2P6E A;  2A4N A;  2WPX A;  3DGV A;  4AXV A;  2ZEN A;  2ZEO A;  2I00 A;  2PC1 A;  4PK3 A;  4OC5 A;  2IMO A;  3KR5 A;  4KSI A;  4IHM A;  2GRE A;  5IX3 A;  4LQ6 A;  4NGP A;  2REE A;  4QC6 A;  3PBE A;  4MFZ A;  3K9T A;  2NSM A;  1YVK A;  2JBK A;  4PXB A;  2EUI A;  2JEV A;  4MY0 A;  4LX9 A;  5BWA B;  3TOA A;  5G22 A;  4M6G A;  3P2H A;  4UEE A;  3RNZ A;  5AGE A;  3F5B A;  3SHP A;  2ZED A;  2ZOF A;  3F0A A;  3V38 A;  4B5P B;  4KOS A;  4A39 A;  5C88 A;  1M1D A;  3R9E A;  3FED A;  1QSM A;  1ZG8 A;  3BHX A;  4UCM A;  2G3T A;  3BLN A;  2B58 A;  4P44 A;  2Q44 A;  4RN7 A;  4C68 A;  1Y7E A;  5LYI A;  1XIX A;  4UBR A;  1CJW A;  3OWC A;  3W91 A;  2Y0M A;  1B6B A;  4JJX A;  5A28 A;  2XEG A;  3LD2 A;  1S3Z A;  1YQE A;  2B3U A;  1Z9U A;  2ZEF A;  4UFV A;  4DYO A;  1H8L A;  3IU1 A;  4MY3 A;  4OME A;  3PBB A;  4OLL A;  1VHS A;  1IID A;  4CGO A;  1IGB A;  4UWJ A;  5AG4 A;  4UA3 A;  2JEW A;  1ZG7 A;  2PJ4 A;  2PCU A;  5HMN A;  3PRT A;  3VWE A;  3D7H A;  5DWM A;  4EFD A;  2WSA A;  4HNX B;  2YNC A;  3D2P A;  2PR8 A;  1XOV A;  1R57 A;  2Z11 A;  4O23 A;  2B4D B;  2YNC C;  2FE7 A;  4L89 A;  4UEZ A;  2GE3 A;  3B7I A;  3S6K A;  4AB7 A;  4CAX A;  3RAM A;  1GYT A;  4MJ8 A;  4YRH A;  4NGN A;  3DSB A;  3KZW A;  1RO5 A;  1F57 A;  2PJ3 A;  2G9D A;  2WYR A;  3QAY A;  2OZU A;  1IY7 A;  5G1Z A;  3WR7 A;  4PSX A;  3R9F A;  2XEF A;  2V8D A;  3TT2 A;  2D4P A;  3VAR A;  3PZJ A;  2Q51 A;  3W6S A;  3IFE A;  2QIR A;  1FY7 A;  4UFW A;  5EBV A;  2Q04 A;  2ZEE A;  3SI1 A;  4KUB A;  2D4O A;  5LRJ A;  1F2P A;  3PEI A;  1IU8 A;  4MFP A;  4KOY A;  4P4D A;  2F7V A;  1YW6 A;  4ZY1 A;  5LYF A;  4P4J A;  1UWY A;  1IYL A;  2O28 A;  2J8M A;  4GXH A;  1M4D A;  1L0C A;  4M6H A;  4NCZ A;  2HC9 A;  2PJ5 A;  4YWY A;  4C2X A;  3TX8 A;  4KS9 A;  3TCV A;  2DF5 A;  5DS0 A;  4UCP A;  2DXQ A;  4OIW A;  4X2T A;  4MHN A;  1Y9W A;  4G1P A;  4GS4 A;  4I49 A;  4XPK A;  1NMT A;  3IEH A;  2CNS A;  1ELL P;  2BOA A;  3LOD A;  4U9Z A;  1TKH A;  2ZEM A;  4OAD A;  4F6A A;  1BLL E;  3TO6 A;  4P4B A;  3VH9 A;  2PJ2 A;  2VI7 A;  4XPD C;  4F0Y A;  3PGP A;  2GU2 A;  1M4G A;  1Z8X A;  5EC4 A;  3FIX A;  2GLJ A;  4MHY A;  3S9L A;  4R6T A;  4YGO A;  4C2Z A;  2OR4 A;  3SJF A;  2G3A A;  3CXQ A;  5HVH A;  4MHD A;  2OZH A;  1SQH A;  1Z8T A;  1CX8 A;  4KVO E;  2ARH A;  3D67 A;  1NSL A;  3KAS A;  3KHZ A;  1FNO A;  2Q4Y A;  2ZEH A;  3TFY A;  1ZLH A;  1CPX A;  3R9G A;  2BSW A;  5KTA A;  2Z3L A;  2X7B A;  2B5G B;  4MMO A;  3BI1 A;  1TF8 A;  3GYA A;  4KUA A;  4E2A A;  1JWQ A;  3T8W A;  4CGN A;  4ONW A;  5CBM A;  1XRY A;  3C26 A;  1LCP A;  3FEE A;  4MFJ A;  4P6Y A;  4X5K A;  1MJB A;  5CNP A;  5KTD A;  2PJ0 A;  1VHO A;  5AG7 A;  2PR1 A;  2C6P A;  2JDD A;  4F8Z A;  1TF9 A;  2ZW6 A;  1ON0 A;  1P4N A;  5HXD A;  3D4U A;  4EVY A;  3D2M A;  2RB7 A;  3MN8 A;  3N5F A;  2OH1 A;  3VAT A;  4FD7 A;  4DUK A;  3FF3 A;  1NE9 A;  2QML A;  4MFL A;  1AUG A;  4K30 A;  3EO4 A;  1PYT B;  5THW A;  2PSW A;  5LRK A;  1WK4 A;  2AE6 A;  2IL4 A;  3B3T A;  5IB9 A;  1DE4 C;  3H5Z A;  4U9Y A;  3B3C A;  2PE3 A;  2O4H A;  3NH8 A;  4FD5 A;  4KOW A;  4CPA A;  3NE8 A;  2Z10 A;  1K4J A;  2B4B A;  3K2K A;  4BMH A;  1TXR A;  2PVV A;  4OC3 A;  1IOF A;  2AFU A;  4C2Y A;  2PRB A;  3CT9 A;  2QEC A;  4JLY A;  4CS0 B;  3NH4 A;  1QMU A;  2V8H A;  5IV0 A;  2EO8 A;  1S7N A;  3B35 A;  4NJQ A;  2PIZ A;  3I9S A;  3KGQ A;  1I1D A;  4R3L A;  3V7Z A;  1KZF A;  3E0K A;  1AYE A;  3IGR A;  4EWT A;  2J8R A;  4KOT A;  4MFK A;  4R76 A;  5HVF A;  4AVC A;  4UWI A;  3F8K A;  3RYO A;  1S5K A;  4CAF A;  2P6F A;  3RZA A;  3CDX A;  3JUW A;  3FJU A;  5HH1 A;  1KUV A;  2ATR A;  3ZZI A;  3P2F A;  2AFW A;  2PJA A;  3IWG A;  4A33 A;  1S60 A;  3FRM A;  5F47 A;  4RS2 A;  1Z4R A;  2ODF A;  3KI9 A;  4NGR A;  2CNM A;  4U5Y A;  1UFH A;  4W9Y A;  2C6G A;  3SJX A;  1YME A;  2PJ9 A;  3IC1 A;  2GIV A;  1J4J A;  2AFO A;  4OAE A;  4B13 A;  4KOU A;  2EK8 A;  2Z3N A;  2V8V A;  4JD6 A;  1YLO A;  3H8F A;  3JVN A;  4Y49 B;  5LYL A;  3A9L A;  1A2Z A;  1BOB A;  2VQY A;  4RUH A;  2R7H A;  3DLJ A;  4CYO A;  2IJZ A;  4FD4 A;  1CPS A;  3H8E A;  5K8N A;  3PB8 X;  2YNE A;  2PDO A;  2IQ6 A;  4M85 A;  2AFS A;  3LWU A;  1LFW A;  2PJ6 A;  2PJC A;  5LYD A;  3ZJ0 A;  5ISV A;  4ZY0 A;  2CNT A;  4K3N A;  2Q43 A;  3GUX A;  5J1Q A;  4B14 A;  2ANP A;  2OOT A;  2PJB A;  3TTH A;  2GFQ A;  1CP6 A;  1RTQ A;  4TWE A;  4ZX8 A;  4UCN A;  4MCP A;  1VKC A;  2POK A;  1N71 A;  3BJ7 A;  3RO0 A;  3T9Y A;  2Z3M A;  3B2Y A;  4R7M A;  2PRQ A;  3SI2 A;  4YFJ A;  4XNH C;  1IOI A;  4P4F A;  3S6G A;  3ISX A;  1FT7 A;  5G21 A;  1ELM P;  1Z8W A;  3GB0 A;  3TC8 A;  5JGF A;  1I12 A;  1M4L A;  1BPM A;  3B3W A;  2CF4 A;  1ZLI A;  2PQ8 A;  1QSR A;  3BXM A;  1Q2D A;  3FVL A;  5G20 A;  1XFO A;  2BCO A;  2V77 A;  2ZXV A;  4UEF A;  5HVG A;  2REF A;  3KQZ A;  4MXU A;  4OC0 A;  3JTK A;  4B5P A;  2GAN A;  4FUU A;  3R1K A;  2FL4 A;  4MHP A;  4ZI6 A;  5JM6 A;  3BI0 A;  2DPS A;  1HDU A;  1YK3 A;  3IWW A;  1Q2Y A;  1QSN A;  2ZW4 A;  3GIU A;  3KL9 A;  4IF5 A;  4L8A A;  4PQA A;  5GCN A;  4FBE A;  4HKF A;  5AG5 A;  1XF8 A;  3PP9 A;  1Z5R A;  2AFX A;  2H5M A;  1R43 A;  2NMT A;  3RBU A;  1YGH A;  2AFZ A;  4H6U A;  1XBU A;  4Q7A A;  4Q36 A;  5H84 A;  2FT0 A;  5JH9 A;  3MGD A;  4OP4 A;  4A37 A;  1NSA A;  4P4I A;  4FWU A;  4A95 A;  2I3C A;  1KWM A;  3S9M A;  4LUA A;  1KUY A;  1TKJ A;  2Z3K A;  3R96 A;  1CM0 A;  4AVA A;  2FXF A;  4JYW A;  4BBH A;  4H2K A;  4NEX A;  2ABZ A;  5EMI A;  1YR0 A;  1XMB A;  2CTC A;  2FVG A;  4Q38 A;  2HQY A;  1F2O A;  8CPA A;  2DEA A;  4IAV A;  3KQX A;  2O53 A;  1R3N A;  3JRU A;  4FD6 A;  4OC2 A;  1CP7 A;  2B4D A;  3SJE A;  5IB0 A;  4MRI A; 
#chains in the Genus database with same CATH homology
 3I3G A;  2ZPA A;  4QVT A;  2Z0Z A;  4UFX A;  2FIA A;  1PUA A;  3DNS A;  3QAH A;  4HNY B;  4AVB A;  2DPT A;  1PU9 A;  2YND A;  4E8O A;  4R3K A;  1MJA A;  1KUX A;  4KLW A;  4ZBG A;  2VBQ A;  4A32 A;  2HUZ A;  3S6F A;  4QUS A;  5F49 A;  1M4I A;  2EVN A;  3D3S A;  3T90 A;  3UY5 A;  4B5O A;  1YVO A;  5JPH A;  3FYN A;  1OZP A;  4NF1 A;  5JQ4 A;  1IIC A;  4E0A A;  2JLM A;  4KOX A;  2BUE A;  3G8W A;  1I21 A;  3S6H A;  4KSF A;  3FNC A;  4ORF A;  4QBJ A;  1M44 A;  4JXQ A;  4AG9 A;  4CAW A;  2AJ6 A;  2ZW7 A;  4KLV A;  3EFA A;  1IYK A;  4A30 A;  4CYQ A;  3FBU A;  4ONU A;  3TO7 A;  3TO9 A;  1RXT A;  1MJ9 A;  2WPW A;  2FCK A;  2R8V A;  2K5T A;  2B5G A;  5KTC A;  1QST A;  3FXT A;  3GY9 A;  4NXY A;  4XPD B;  2VXK A;  1ZO0 A;  2CXA A;  2C27 A;  2Q4V A;  3EY5 A;  4PSW A;  4CAE A;  4KOR A;  4C7I A;  2Z3P A;  4ZGY B;  4DNC A;  4H6Z A;  1MK4 A;  4KSA A;  2BEI A;  4KZT A;  5DWN A;  5J8C A;  3QB8 A;  3EXN A;  3B8G A;  1YRE A;  2JDC A;  4CGM A;  1QSO A;  4JXR A;  1IB1 E;  2B3V A;  4R87 A;  2BL1 A;  2RC4 A;  2P6G A;  3NE7 A;  2Q0Y A;  5FVJ A;  3SXO A;  2VZY A;  3W6X A;  1S7F A;  1YX0 A;  4A2Z A;  5A27 A;  2CY2 A;  1YLE A;  5F46 A;  3G3S A;  4A31 A;  4II9 A;  3DR6 A;  2G0B A;  4CAV A;  2R1I A;  4C7H A;  4PV6 A;  1Y7R A;  2KCW A;  4H89 A;  4J3G A;  5J8F A;  1Y9K A;  5E96 A;  4PK2 A;  1XEB A;  3R95 A;  2FIW A;  4KVX A;  1Q2C A;  3VWD A;  4CGL A;  4R57 A;  1WWZ A;  2F5I A;  4IUS A;  2Z3O A;  4MBU A;  3BJ8 A;  2ZW5 A;  2VEZ A;  2YGW A;  3N7Z A;  4CRZ B;  4AG7 A;  4HNW B;  4B10 A;  3EC4 A;  4CYP A;  3K9U A;  3CXP A;  3DDD A;  3SXN A;  4CYN A;  1S7K A;  3IU2 A;  4Y49 C;  4RI1 A;  3V8I A;  4KVM E;  5H86 A;  4F0X A;  4QB9 A;  2WUU A;  1S7L A;  2J8N A;  3GKR A;  2R98 A;  5C82 A;  3DR8 A;  3D8P A;  2I79 A;  1B87 A;  4M3S A;  2OZG A;  4B12 A;  1XE4 A;  5AG6 A;  1V0C A;  4B11 A;  1LRZ A;  1U6M A;  3CXS A;  5I0C A;  2FS5 A;  2FSR A;  3FB3 A;  2VZZ A;  4JWP A;  1P0H A;  4CRY B;  4MFQ A;  2P0W A;  3KKW A;  4XPL A;  3H4Q A;  1BO4 A;  1XMT A;  2Q7B A;  3TOB A;  4KOV A;  4CGP A;  1TIQ A;  5F48 A;  1GHE A;  2OB0 A;  4NSQ A;  2OU2 A;  3IWE A;  4XNH B;  3TE4 A;  2HV2 A;  4MI4 A;  1Z4E A;  2P6E A;  2A4N A;  2WPX A;  2I00 A;  2PC1 A;  4PK3 A;  5IX3 A;  4QC6 A;  2REE A;  4MFZ A;  1YVK A;  2EUI A;  2JEV A;  4MY0 A;  4LX9 A;  5BWA B;  3TOA A;  5G22 A;  3P2H A;  5AGE A;  3F5B A;  3SHP A;  3F0A A;  4B5P B;  4KOS A;  5C88 A;  1M1D A;  3R9E A;  1QSM A;  4UCM A;  3BLN A;  2G3T A;  2B58 A;  4C68 A;  2Q44 A;  1XIX A;  4UBR A;  1CJW A;  3OWC A;  3W91 A;  2Y0M A;  1B6B A;  4JJX A;  5A28 A;  3LD2 A;  1S3Z A;  2B3U A;  1Z9U A;  4UFV A;  4MY3 A;  3IU1 A;  4OLL A;  1VHS A;  1IID A;  4CGO A;  4UWJ A;  5AG4 A;  4UA3 A;  5HMN A;  3VWE A;  5DWM A;  2WSA A;  4HNX B;  2YNC A;  3D2P A;  2PR8 A;  1R57 A;  2Z11 A;  2B4D B;  2YNC C;  2FE7 A;  4L89 A;  2GE3 A;  3S6K A;  4AB7 A;  4CAX A;  4MJ8 A;  4YRH A;  3DSB A;  1RO5 A;  3WR7 A;  5G1Z A;  2OZU A;  4PSX A;  3R9F A;  3TT2 A;  2D4P A;  3PZJ A;  3W6S A;  2QIR A;  1FY7 A;  4UFW A;  5EBV A;  2Q04 A;  4KUB A;  2D4O A;  4MFP A;  4KOY A;  1IYL A;  2O28 A;  2J8M A;  1M4D A;  1L0C A;  4NCZ A;  4C2X A;  4KS9 A;  3TCV A;  4UCP A;  2DXQ A;  1Y9W A;  4GS4 A;  4I49 A;  4XPK A;  1NMT A;  4U9Z A;  2CNS A;  3LOD A;  4F6A A;  4OAD A;  3TO6 A;  4F0Y A;  2VI7 A;  4XPD C;  3PGP A;  1M4G A;  5EC4 A;  3FIX A;  4YGO A;  4C2Z A;  2G3A A;  3CXQ A;  4MHD A;  2OZH A;  1SQH A;  4KVO E;  2ARH A;  1NSL A;  2Q4Y A;  3TFY A;  3R9G A;  2BSW A;  5KTA A;  2Z3L A;  2X7B A;  2B5G B;  3GYA A;  4KUA A;  4E2A A;  4CGN A;  3C26 A;  4MFJ A;  4X5K A;  5CNP A;  1MJB A;  5KTD A;  5AG7 A;  2PR1 A;  2JDD A;  2ZW6 A;  1ON0 A;  1P4N A;  4EVY A;  3D2M A;  2OH1 A;  4FD7 A;  1NE9 A;  2QML A;  4MFL A;  4K30 A;  3EO4 A;  2PSW A;  1WK4 A;  2AE6 A;  2IL4 A;  3H5Z A;  4U9Y A;  4FD5 A;  4KOW A;  2Z10 A;  1K4J A;  2B4B A;  4BMH A;  4C2Y A;  2PRB A;  2QEC A;  4JLY A;  4CS0 B;  5IV0 A;  1S7N A;  3I9S A;  1I1D A;  4R3L A;  1KZF A;  3E0K A;  3IGR A;  2J8R A;  4KOT A;  4MFK A;  4AVC A;  4UWI A;  3F8K A;  3RYO A;  1S5K A;  4CAF A;  2P6F A;  3JUW A;  5HH1 A;  1KUV A;  2ATR A;  3ZZI A;  3P2F A;  4A33 A;  3IWG A;  1S60 A;  3FRM A;  5F47 A;  4RS2 A;  1Z4R A;  2CNM A;  4U5Y A;  1UFH A;  2GIV A;  1J4J A;  4OAE A;  4B13 A;  4KOU A;  2Z3N A;  4JD6 A;  3JVN A;  4Y49 B;  3A9L A;  1BOB A;  2VQY A;  2R7H A;  4CYO A;  4FD4 A;  2YNE A;  2PDO A;  4M85 A;  5ISV A;  3ZJ0 A;  2CNT A;  4B14 A;  3TTH A;  4UCN A;  1VKC A;  1N71 A;  3BJ7 A;  3T9Y A;  2Z3M A;  4YFJ A;  4XNH C;  3S6G A;  5G21 A;  1I12 A;  2PQ8 A;  1QSR A;  1Q2D A;  5G20 A;  2ZXV A;  2REF A;  3JTK A;  4B5P A;  2GAN A;  3R1K A;  2FL4 A;  2DPS A;  1YK3 A;  4IF5 A;  4R9M A;  1Q2Y A;  1QSN A;  2ZW4 A;  4L8A A;  5GCN A;  4HKF A;  5AG5 A;  1XF8 A;  3PP9 A;  2H5M A;  2NMT A;  1YGH A;  4H6U A;  4Q36 A;  5H84 A;  2FT0 A;  3MGD A;  4A95 A;  4LUA A;  1KUY A;  2Z3K A;  3R96 A;  1CM0 A;  4AVA A;  2FXF A;  4BBH A;  4NEX A;  1YR0 A;  4Q38 A;  2HQY A;  4FD6 A;  5IB0 A;  2B4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...