3QB8A

Paramecium chlorella bursaria virus1 putative orf a654l is a polyamine acetyltransferase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
197
structure length
197
Chain Sequence
MYTLIKLTSEYTSRAISFTSRNFVASEPTSIALKLTTCDFTTSFQNIMKQCVDYGHSFAFVDADDNIKAQILNIPYDAYENMHYGNIRETDPMFDLFGNLDSYTPDDKCLYVFAIGSEVTGKGLATKLLKKTIEESSSHGFKYIYGDCTNIISQNMFEKHGFETVGSVKYKGYQYGITKPFDSINCTEYIKRMVKTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A654L protein
publication title Paramecium bursaria chlorella virus 1 encodes a polyamine acetyltransferase.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Transferase
total genus 70
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3qb8A00
2GIVA 4JLYA 4KZTA 4Y49C 2Q04A 2FIWA 1P4NA 1PUAA 3F0AA 4AVBA 3TO7A 2P6FA 3S6GA 1Y9KA 2B3VA 3SHPA 2X7BA 4KVXA 4B5PB 1S7KA 3N7ZA 2ZW4A 5C82A 4KORA 2GANA 1S60A 2R98A 2CNSA 1QSNA 4UA3A 3S6FA 2I79A 5HH1A 4BMHA 1KZFA 2PSWA 1YVKA 2CNMA 4QB9A 4IF5A 3P2HA 4ONUA 5EBVA 4F0YA 1XIXA 3D8PA 3T9YA 3R95A 4IUSA 1BO4A 4M85A 2OZGA 4KOYA 1NSLA 5E96A 2KCWA 4MY0A 5IV0A 4PK3A 2C27A 4XNHB 2ZW5A 5I0CA 4CAXA 3D2MA 4FD4A 3R96A 2F5IA 1B6BA 2ZW6A 2ATRA 3R9EA 2H5MA 4AG7A 2P6GA 5F48A 2RC4A 4PSWA 1YGHA 3P2FA 1QSTA 2Z10A 3FYNA 2WPWA 2JLMA 3EXNA 2P6EA 3FXTA 4XPDB 1M4DA 2Q0YA 3DR8A 4OAEA 3W91A 2VBQA 3TFYA 2ZW7A 2B4DA 1YK3A 1QSMA 2B4BA 1M44A 4YFJA 4LUAA 1M4GA 4E8OA 4DNCA 2R8VA 3T90A 3H4QA 4CRZB 2PDOA 1L0CA 3DSBA 3KKWA 3GKRA 3QAHA 4MJ8A 3TO6A 2R7HA 4XPLA 2Z11A 4RI1A 3FNCA 4YGOA 2IL4A 4MHDA 1WWZA 3FB3A 2Q4VA 3PP9A 4CAWA 1Q2CA 2BUEA 3VWDA 4H6UA 1Z4EA 3BJ8A 3E0KA 1WK4A 5KTCA 2OB0A 4HNXB 4LX9A 5ISVA 3TOAA 1MJBA 5DWMA 1MJ9A 2ZPAA 3DNSA 3D2PA 1MK4A 2PRBA 3EC4A 4MBUA 4NXYA 3K9UA 4R87A 2QMLA 1IIDA 2CY2A 5HMNA 4X5KA 5GCNA 2Z0ZA 2J8NA 4E0AA 3OWCA 4E2AA 5JQ4A 5IB0A 2QIRA 1LRZA 2Q44A 4HKFA 3V8IA 5FVJA 3TO9A 4F6AA 4PSXA 2BL1A 4U9ZA 3TOBA 5F46A 1XE4A 2JDCA 1GHEA 1S3ZA 1TIQA 2G3AA 2G3TA 1NE9A 2Y0MA 3S6HA 4UBRA 4L8AA 4AVAA 2ARHA 3EFAA 2HUZA 2G0BA 2REEA 1R57A 1SQHA 2DXQA 2QECA 1K4JA 1KUVA 2VXKA 2D4OA 4U9YA 2B58A 2PQ8A 4XNHC 5IX3A 1I12A 3G3SA 3NE7A 3SXOA 4NCZA 3QB8A 2P0WA 4R9MA 3S6KA 2D4PA 4AB7A 3VWEA 2B5GA 5DWNA 1KUXA 4U5YA 3TCVA 4CAVA 2R1IA 2I00A 1PU9A 2FL4A 2VZZA 2AJ6A 4PK2A 3WR7A 1P0HA 4OADA 1IB1E 4YRHA 2VQYA 5KTDA 1QSRA 2OH1A 2J8RA 4XPDC 2GE3A 3GY9A 5H84A 2FE7A 3JVNA 1XF8A 1XEBA 3TT2A 2BSWA 4I49A 3D3SA 3FRMA 3MGDA 2NMTA 1CJWA 3CXSA 3FBUA 4M3SA 2FT0A 4JXQA 3G8WA 1ON0A 5F47A 2B5GB 4MI4A 4KUBA 2J8MA 2HQYA 2VZYA 4RS2A 4XPKA 2Q7BA 1OZPA 1XMTA 1Z9UA 2PR8A 4KVOE 3C26A 4JWPA 2B4DB 3I3GA 3IGRA 2REFA 3CXPA 4KLWA 1S7FA 3BJ7A 1RXTA 5F49A 1MJAA 1YR0A 1S7LA 3ZZIA 1U6MA 4KOVA 2OU2A 1I21A 1IYLA 2OZUA 4NSQA 1M4IA 2K5TA 2JDDA 1M1DA 3BLNA 5H86A 4HNWB 4UWJA 1V0CA 4QC6A 4KLVA 4L89A 4ZBGA 2AE6A 1IYKA 4HNYB 3CXQA 2VEZA 4OLLA 4Y49B 1YLEA 3W6SA 4H89A 1YREA 4R3KA 2FIAA 5JPHA 1B87A 4MY3A 4QBJA 2FCKA 1NMTA 1N71A 1RO5A 2JEVA 2ZXVA 1IICA 5KTAA 1QSOA 4NEXA 4JJXA 5CNPA 4JXRA 4EVYA 2EVNA 2FXFA 3GYAA 2OZHA 4GS4A 4KVME 4II9A 3ZJ0A 2FS5A 4AG9A 3JUWA 3R9FA 5EC4A 4J3GA 3F5BA 1KUYA 1YVOA 4H6ZA 4FD7A 2HV2A 4CS0B 4CRYB 4B5OA 3R1KA 3F8KA 4K30A 3FIXA 4QVTA 5C88A 1VHSA 1Y9WA 3LD2A 4KOTA 3LODA 4R3LA 1UFHA 1FY7A 3TTHA 4PV6A 2FSRA 3DDDA 2EUIA 4KUAA 3PGPA 1Y7RA 4KOSA 3UY5A 2Q4YA 4KOWA 1Q2DA 1I1DA 5J8CA 4ORFA 1Z4RA 3IWGA 3TE4A 3EO4A 3PZJA 2CNTA 3RYOA 2BEIA 3B8GA 1S7NA 2VI7A 4KOUA 1BOBA 1J4JA 1VKCA 3I9SA 1YX0A 2A4NA 4KOXA 3EY5A 1Q2YA 4FD6A 1CM0A 3DR6A 4AVCA 4NF1A 4QUSA 2B3UA 4FD5A 3W6XA 2O28A 4B5PA 3R9GA 2PC1A 1S5KA 4UWIA 2PR1A 4R57A 3SXNA 4JD6A 5J8FA 2WPXA
chains in the Genus database with same CATH superfamily
1IGBA 4M6GA 2GIVA 4MCSA 4JLYA 4KZTA 5THWA 1ZO0A 2PIYA 2V77A 4Y49C 3PB7X 4F9UA 2Q04A 3NH8A 1XJOA 4OC1A 2FIWA 3T8WA 2C6PA 1P4NA 5AGEA 1PUAA 3F0AA 4AVBA 3TO7A 1ELLP 4NGSA 4ZX8A 2P6FA 3RAMA 3S6GA 1LANA 1Y9KA 2B3VA 3SHPA 1BPMA 2X7BA 1PYTB 4OC2A 4KVXA 4B5PB 4MCPA 3TC8A 2PJ1A 2C1CA 1S7KA 3N7ZA 2OR4A 4IHMA 2WZNA 3FF3A 2ZW4A 2RB7A 3B3CA 5C82A 4KORA 3KL9A 4NJQA 4UIBA 3GIUA 2GANA 2EK9A 2PJ3A 4BBHA 1S60A 2R98A 2AFZA 5G1ZA 4NGMA 4KSAA 2CNSA 4UCMA 1QSNA 3K2KA 3B3WA 2WUUA 4UA3A 3S6FA 2I79A 2F7VA 4UFVA 1IOIA 5HH1A 1YW6A 4GXHA 4BMHA 1KZFA 2PSWA 2GU2A 3K9TA 1YVKA 3NE8A 2CNMA 4ZI6A 4KSIA 4QB9A 4DUKA 4IF5A 3P2HA 4ONUA 5EBVA 4MMOA 4MFJA 4F0YA 1XIXA 3D8PA 2BO9A 4MHPA 3T9YA 3PEIA 3R95A 1FT7A 5A27A 4IUSA 5K8PA 3TX8A 1BO4A 2JEWA 2PJ9A 4M85A 5I4MA 2OZGA 3KR4A 1EE3P 4B11A 6CPAA 2C6GA 5LRGA 4B6ZA 4KOYA 4MHZA 1HDQA 1NSLA 5E96A 2KCWA 4MY0A 5IV0A 4PK3A 2C27A 4XNHB 2ZW5A 1X10A 4Q38A 4GM5A 2G9DA 2Z3MA 3D7GA 3NH5A 4RN7A 5EMIA 5I0CA 4CGNA 2EBJA 4CAXA 4UEZA 3D2MA 3FVLA 4FD4A 1Z2LA 3R96A 3WT4A 2F5IA 4PXEA 1KWMA 1B6BA 2ZW6A 2ZEEA 2XEGA 2ATRA 4A39A 1BPNA 3R9EA 2H5MA 4AG7A 2QVPA 4FUUA 2P6GA 3JTKA 4CYQA 2ZELA 5F48A 2RC4A 4PSWA 1F2PA 1YGHA 3P2FA 3BI1A 2EWBA 4TNUA 1QSTA 4YU9A 4PXCA 2Z10A 5K8MA 3FYNA 2PVWA 1TKHA 2POKA 2WPWA 2JLMA 3EXNA 1LAMA 1Z8WA 2P6EA 5LYLA 2BCOA 1TKFA 2DPSA 1M4DA 2Q0YA 3DR8A 3FXTA 4OAEA 4NGTA 4P4IA 4UFWA 2IQ6A 1XOVA 3W91A 4ZYQA 5HXDA 1OBRA 4P44A 2VBQA 3TFYA 4M6HA 2ZEFA 2ZW7A 2B4DA 2Z3PA 4UEFA 1YK3A 3IC1A 3PB4X 1QSMA 4OKOA 4CYPA 1YSJA 4C68A 5BWAB 2B4BA 1XRYA 4C7HA 3D7FA 1M44A 1M4LA 2JBJA 3IEHA 1R43A 2HB6A 3KZWA 4X3RA 4YFJA 1AYEA 3LMSA 4AXVA 4P4DA 4MFZA 1TKJA 4O23A 1BAVA 3V7ZA 2ZOGA 4LUAA 1M4GA 4E8OA 2PJBA 2QYVA 3B35A 4OC5A 4DNCA 2R8VA 4WJBA 3T90A 5AG4A 2CTCA 3H4QA 4CRZB 4F9VA 2PDOA 1L0CA 3DSBA 3MRUA 3D67A 2Z3OA 4RUHA 3B3TA 3KKWA 3GKRA 3QAHA 4MJ8A 3TO6A 3IFEA 2R7HA 4XPLA 2Z11A 4RI1A 3FNCA 4YGOA 4P4JA 2IL4A 5HVFA 4OC0A 3LACA 4MHDA 2AFUA 1WWZA 2F8HA 3FB3A 2Q4VA 4A38A 2Q51A 4NFRA 4CGMA 2Q7SA 3DLJA 1Q2CA 2BUEA 3PP9A 4CAWA 7CPAA 1YLOA 3VWDA 1X12A 1Z4EA 3BJ8A 3E0KA 4H6UA 2GFQA 4UF4A 1WK4A 3PBEA 5KTCA 2OB0A 5LRKA 1RTQA 4OC4A 4HNXB 4LX9A 5ISVA 4IK2A 3TOAA 1MJBA 3WC6A 4OIDA 1A2ZA 5DWMA 1MJ9A 2XEFA 2ZPAA 4CGOA 3DNSA 1CP7A 3D2PA 3SI1A 4MHYA 3IU2A 1MK4A 4CAFA 2Q43A 1CPSA 2PRBA 4P4BA 3EC4A 4MBUA 4NXYA 5LYDA 3K9UA 4R87A 2QMLA 3FH4A 1IIDA 2CY2A 3D66A 2PCUA 3H8FA 4UIAA 4X5KA 2Z0ZA 5GCNA 5HMNA 2J8NA 3L2NA 4E0AA 3OWCA 2ODFA 2XEJA 2CXAA 4E2AA 2EK8A 4P4EA 2PE3A 4DYOA 1LFWA 3D68A 5JQ4A 1QMUA 1YMEA 2WYRA 5IB0A 2QIRA 2Z3KA 2PJ0A 1LRZA 4C7IA 2Q44A 4HKFA 2NSMA 4TWEA 3V8IA 1XBUA 5FVJA 3TO9A 4F6AA 4PSXA 3SI0A 2CF4A 2V8DA 4ZY0A 4P10A 2BL1A 1ARMA 2OOTA 5LYFA 4U9ZA 1Y0YA 1ZG9A 4R76A 3TOBA 1AUGA 5F46A 4K3NA 1XE4A 2JDCA 3PBBA 1GHEA 4MFPA 1CP6A 1S3ZA 3MN8A 1TIQA 4P4FA 1ZG8A 4UCPA 2G3AA 2G3TA 1NE9A 2Y0MA 1YW4A 3S6HA 3IWEA 4Q7AA 4L8AA 4UBRA 4AVAA 2ARHA 2ZOFA 3EFAA 3S9MA 4A32A 4B13A 5F09A 3KASA 1CX8A 3H5ZA 2ZENA 5HVGA 4WWVA 1LOKA 2G0BA 2HUZA 1R57A 2REEA 4OP4A 3VARA 4EWTA 1SQHA 1HEEA 2DXQA 1CPXA 2QECA 2V8VA 3QNVA 2ANPA 1K4JA 3SI2A 4ZY1A 2GREA 3IIBA 4R8FA 1KUVA 2VXKA 1TF9A 2D4OA 3WC7A 4U9YA 4IAVA 5JGFA 5K8OA 4X8IA 2B58A 2PQ8A 5D29A 4XNHC 3PFEA 1ARLA 1R3NA 2ZEPA 1Q7LA 1VHOA 4MRIA 5IX3A 1I12A 3RBUA 4CPAA 3G3SA 3NE7A 2EO8A 1IU8A 2QJ8A 3SXOA 3PFOA 4NCZA 3QB8A 2CTBA 2P0WA 4R9MA 3S6KA 2D4PA 1TF8A 2PJAA 3FEEA 3GUXA 3VWEA 4AB7A 2B5GA 4MFQA 5DWNA 2AFOA 2I3CA 1KUXA 1JQGA 4U5YA 3TCVA 4CAVA 4OIWA 2R1IA 2I00A 4G1PA 2PJCA 4BD9A 1PU9A 4A2ZA 2FL4A 2YNCA 2VZZA 2AJ6A 4PK2A 3WR7A 1P0HA 3H8GA 3VH9A 4B10A 4OADA 1NSAA 1IB1E 4YRHA 3RO0A 4C2XA 2VQYA 1ZLHA 1QSRA 2OH1A 2J8RA 1LCPA 4XPDC 5AG5A 5KTDA 2GE3A 3GY9A 4ZGYB 4PQAA 4NGNA 5H84A 4F8ZA 3S9NA 3B7IA 3IWWA 4JYWA 3BXMA 2FE7A 5AG7A 3JVNA 1XF8A 1XEBA 3TT2A 2BSWA 4A31A 2DPTA 4I49A 4MFKA 2V8GA 3D3SA 3FRMA 1H8LA 2NMTA 2PIZA 3MGDA 4JZ0A 4UFXA 1CJWA 3CDXA 2ZEGA 2XEIA 3D7HA 1XFOA 3CXSA 3FBUA 2VL1A 4M3SA 5IB9A 2FT0A 2HC9A 3CPXA 3G8WA 4JXQA 4P45A 4C2ZA 1ON0A 4NJRA 2ABZA 3FECA 4H2KA 5F47A 2B5GB 1LAPA 1VIXA 1XMBA 4MI4A 4UEEA 4KUBA 2J8MA 2HQYA 5A28A 2VZYA 4RS2A 4XPKA 2Q7BA 1OZPA 1XMTA 1Z9UA 2PR8A 4X2TA 4UCNA 2ZEOA 3KHXA 4KVOE 3C26A 3NFZA 3KGQA 4JWPA 3D4UA 4YWYA 4DJLA 3QAYA 2V8HA 2B4DB 3I3GA 2PJ2A 3IGRA 5G21A 4CYOA 2REFA 4CYNA 3CXPA 4KLWA 1S7FA 4XPDB 3BJ7A 1RXTA 5JM6A 3KR5A 5F49A 1MJAA 4CGLA 4NGPA 4ONWA 1YR0A 3BI0A 1S7LA 4A95A 3ZZIA 1U6MA 1QQ9A 2FVGA 4KOVA 2OU2A 1I21A 1IYLA 3PB9X 3VATA 2AFWA 2OZUA 2DEAA 2Q4ZA 3N5FA 4NSQA 1M4IA 2GLFA 4OMEA 2C6CA 2K5TA 3JRUA 5LRJA 4W9YA 3ISZA 3SJGA 3DGVA 2JDDA 1M1DA 3BLNA 5JH9A 5H86A 4HNWB 3PRTA 1V0CA 4UWJA 4QC6A 3CZXA 4KLVA 4L89A 4ZBGA 1ZG7A 1Z8TA 2AE6A 4FWUA 1IYKA 4HNYB 3CXQA 1DTDA 2VEZA 4OLLA 4Y49B 1PCAA 1YLEA 3KQZA 1DE4C 2AFSA 4H89A 3W6SA 1YREA 1Z5RA 4R3KA 2FIAA 5JPHA 1B87A 2IMOA 4A30A 4MY3A 1Z8XA 4QBJA 5HVHA 2FCKA 4ZY2A 1NMTA 4MCQA 1F57A 2PJ8A 1N71A 1RO5A 2JEVA 2ZXVA 1Y0RA 1IICA 5KTAA 1QSOA 1VHEA 2DF5A 4NEXA 1IOFA 3SJXA 4M6IA 4JJXA 5CNPA 2Z3NA 3CPAA 3FJUA 4FAIA 4FBEA 4JXRA 4EVYA 1HDUA 2FXFA 3ISXA 3GB0A 3GYAA 2OZHA 2YNEA 1ZLIA 3V38A 4GS4A 4KVME 5AG6A 4II9A 3ZJ0A 1BLLE 2FS5A 4AG9A 3JUWA 2ZEHA 3R9FA 1CBXA 2YNDA 4CGPA 5EC4A 4J3GA 4Z65A 2JBKA 3KHZA 2YGWA 3F5BA 3FX6A 3HUVA 4R7MA 4BINA 1KUYA 4CAEA 3I1UA 4B12A 1YVOA 4H6ZA 3SJFA 4FD7A 2HV2A 2PJ6A 4KS9A 1IY7A 4F0XA 4CS0B 4CRYB 4B5OA 2AFXA 2GLJA 2O4HA 2ZEDA 3NA6A 3R1KA 3F8KA 5J1QA 5G20A 4K30A 3PB8X 2PJ4A 2PJ5A 3IO1A 4A94A 3FIXA 4QVTA 5C88A 1VHSA 2BOAA 1AMPA 1Y9WA 3LD2A 4KOTA 1JWQA 4A33A 3B3VA 4C2YA 3CT9A 3D7DA 3H8EA 3FEDA 3SJEA 3LODA 2Z3LA 5DS0A 5ELYA 3HLPA 4MCRA 2AFMA 1F2OA 1UFHA 4R3LA 4R6TA 1FY7A 1CG2A 3TTHA 3IJ3A 3KQXA 4PV6A 4PXDA 2FSRA 4EMEA 3DDDA 1ELMP 2WPXA 3PB6X 2EUIA 5G22A 4KSFA 4KUAA 3RNZA 3BHXA 1Z8LA 3PGPA 8CPAA 1FNOA 1Y7RA 2PRQA 5CBMA 4KOSA 3GLJA 3UY5A 1GYTA 2CIJA 2Q4YA 3B2YA 4KOWA 2O53A 3FMCA 1Q2DA 3NH4A 1I1DA 4HPSA 4ORFA 1Z4RA 5CPAA 5J8CA 4LQGA 3IWGA 3TE4A 2NYQA 4NGQA 3EO4A 2IJZA 4NGRA 3PZJA 2CNTA 3B3SA 2BEIA 2J9AA 4P6YA 3B8GA 4PXBA 3RYOA 1TXRA 1S7NA 2VI7A 2YNCC 4KOUA 1BOBA 2ZEMA 1J4JA 5D8NA 1VKCA 3I9SA 1YQEA 1YX0A 2A4NA 4MFLA 4OC3A 4KOXA 1Y7EA 3EY5A 3WABA 1Q2YA 3LWUA 1CM0A 4FD6A 4MXUA 4EFDA 2RFHA 3DR6A 4Q36A 2WSAA 4LQ6A 4AVCA 5K8NA 3IU1A 4NF1A 4QUSA 1VGYA 2B3UA 4B14A 4FD5A 3RZAA 2PJ7A 2O28A 3W6XA 4A37A 4B5PA 3WC5A 3R9GA 2PC1A 1S5KA 4UWIA 3KI9A 4MHNA 5LYIA 2PR1A 3S9LA 4ZX9A 4R57A 2PVVA 3A9LA 3SXNA 1UWYA 4PPZA 4JD6A 5J8FA 2EVNA
chains in the Genus database with same CATH topology
2GIVA 4JLYA 4KZTA 1ZO0A 4Y49C 2Q04A 2FIWA 1P4NA 5AGEA 1PUAA 3F0AA 4AVBA 3TO7A 2P6FA 3S6GA 1Y9KA 2B3VA 3SHPA 2X7BA 4KVXA 4B5PB 1S7KA 3N7ZA 2ZW4A 5C82A 4KORA 2GANA 4BBHA 1S60A 2R98A 5G1ZA 4KSAA 2CNSA 4UCMA 1QSNA 2WUUA 4UA3A 3S6FA 2I79A 4UFVA 5HH1A 4BMHA 1KZFA 2PSWA 1YVKA 2CNMA 4QB9A 4IF5A 3P2HA 4ONUA 5EBVA 4MFJA 4F0YA 1XIXA 3D8PA 3T9YA 3R95A 5A27A 4IUSA 1BO4A 4M85A 2OZGA 4B11A 4KOYA 1NSLA 5E96A 2KCWA 4MY0A 5IV0A 4PK3A 2C27A 4XNHB 2ZW5A 4Q38A 2Z3MA 5I0CA 4CGNA 4CAXA 3D2MA 4FD4A 3R96A 2F5IA 1B6BA 2ZW6A 2ATRA 3R9EA 2H5MA 4AG7A 2P6GA 3JTKA 4CYQA 5F48A 2RC4A 4PSWA 5BWAB 1YGHA 3P2FA 1QSTA 2Z10A 3FYNA 2WPWA 2JLMA 3EXNA 2P6EA 2DPSA 3FXTA 1M4DA 2Q0YA 3DR8A 4OAEA 4UFWA 4XPDB 3W91A 2VBQA 3TFYA 2ZW7A 2B4DA 2Z3PA 1YK3A 4CYPA 1QSMA 4C68A 2B4BA 4C7HA 1M44A 4YFJA 4MFZA 4LUAA 1M4GA 4E8OA 4DNCA 2R8VA 3T90A 5AG4A 3H4QA 4CRZB 2PDOA 1L0CA 3DSBA 2Z3OA 3KKWA 3GKRA 3QAHA 4MJ8A 3TO6A 2R7HA 4XPLA 2Z11A 4RI1A 3FNCA 4YGOA 2IL4A 4MHDA 1WWZA 3FB3A 4CGMA 2Q4VA 3PP9A 4CAWA 1Q2CA 2BUEA 3VWDA 4H6UA 1Z4EA 3BJ8A 3E0KA 1WK4A 5KTCA 2OB0A 4HNXB 4LX9A 5ISVA 3TOAA 1MJBA 5DWMA 1MJ9A 2ZPAA 4CGOA 3DNSA 3D2PA 3IU2A 1MK4A 4CAFA 2PRBA 3EC4A 4MBUA 4NXYA 3K9UA 4R87A 2QMLA 1IIDA 2CY2A 5HMNA 4X5KA 5GCNA 2Z0ZA 2J8NA 4E0AA 3OWCA 2CXAA 4E2AA 5JQ4A 5IB0A 2QIRA 2Z3KA 1LRZA 4C7IA 2Q44A 4HKFA 3V8IA 5FVJA 3TO9A 4F6AA 4PSXA 2BL1A 4U9ZA 3TOBA 5F46A 1XE4A 2JDCA 1GHEA 4MFPA 1S3ZA 1TIQA 4UCPA 2G3AA 2G3TA 1NE9A 2Y0MA 3S6HA 3IWEA 4UBRA 4L8AA 4AVAA 2ARHA 3EFAA 4A32A 4B13A 3H5ZA 2HUZA 2G0BA 2REEA 1R57A 1SQHA 2DXQA 2QECA 1K4JA 1KUVA 2VXKA 2D4OA 4U9YA 2B58A 2PQ8A 4XNHC 5IX3A 1I12A 3G3SA 3NE7A 3SXOA 4NCZA 3QB8A 2P0WA 4R9MA 3S6KA 2D4PA 4AB7A 3VWEA 2B5GA 4MFQA 5DWNA 1KUXA 4U5YA 3TCVA 4CAVA 2R1IA 2I00A 1PU9A 4A2ZA 2FL4A 2YNCA 2VZZA 2AJ6A 4PK2A 3WR7A 1P0HA 4B10A 4OADA 1IB1E 4YRHA 4C2XA 2VQYA 5KTDA 1QSRA 2OH1A 2J8RA 4XPDC 5AG5A 2GE3A 3GY9A 4ZGYB 5H84A 2FE7A 5AG7A 3JVNA 1XF8A 1XEBA 3TT2A 2BSWA 4A31A 2DPTA 4I49A 4MFKA 3D3SA 3FRMA 3MGDA 4UFXA 2NMTA 1CJWA 3CXSA 3FBUA 4M3SA 2FT0A 4JXQA 3G8WA 4C2ZA 1ON0A 5F47A 2B5GB 4MI4A 4KUBA 2J8MA 2HQYA 5A28A 2VZYA 4RS2A 4XPKA 2Q7BA 1OZPA 1XMTA 1Z9UA 2PR8A 4UCNA 4KVOE 3C26A 4JWPA 4CYOA 2B4DB 3I3GA 3IGRA 5G21A 2REFA 4CYNA 3CXPA 4KLWA 1S7FA 3BJ7A 1RXTA 5F49A 1MJAA 4CGLA 1YR0A 4A95A 1S7LA 3ZZIA 1U6MA 4KOVA 2OU2A 1I21A 1IYLA 2OZUA 4NSQA 1M4IA 2K5TA 2JDDA 1M1DA 3BLNA 5H86A 4HNWB 4UWJA 1V0CA 4QC6A 4KLVA 4L89A 4ZBGA 2AE6A 1IYKA 4HNYB 3CXQA 2VEZA 4OLLA 4Y49B 1YLEA 3W6SA 4H89A 1YREA 4R3KA 2FIAA 5JPHA 1B87A 4A30A 4MY3A 4QBJA 2FCKA 1NMTA 1N71A 1RO5A 2JEVA 2ZXVA 1IICA 5KTAA 1QSOA 4NEXA 4JJXA 5CNPA 2Z3NA 4JXRA 4EVYA 2EVNA 2FXFA 3GYAA 2OZHA 2YNEA 4GS4A 4KVME 5AG6A 4II9A 3ZJ0A 2FS5A 4AG9A 3JUWA 3R9FA 2YNDA 4CGPA 5EC4A 4J3GA 2YGWA 3F5BA 1KUYA 4CAEA 4B12A 1YVOA 4H6ZA 4FD7A 2HV2A 4KS9A 4F0XA 4CS0B 4CRYB 4B5OA 3R1KA 3F8KA 5G20A 4K30A 3FIXA 4QVTA 5C88A 1VHSA 1Y9WA 3LD2A 4KOTA 4A33A 4C2YA 3LODA 2Z3LA 4R3LA 1UFHA 1FY7A 3TTHA 4PV6A 2FSRA 3DDDA 2EUIA 5G22A 4KSFA 4KUAA 3PGPA 1Y7RA 4KOSA 3UY5A 2Q4YA 4KOWA 1Q2DA 1I1DA 5J8CA 4ORFA 1Z4RA 3IWGA 3TE4A 3EO4A 3PZJA 2CNTA 3RYOA 2BEIA 3B8GA 1S7NA 2VI7A 2YNCC 4KOUA 1BOBA 1J4JA 1VKCA 3I9SA 1YX0A 2A4NA 4MFLA 4KOXA 3EY5A 1Q2YA 4FD6A 1CM0A 3DR6A 4Q36A 2WSAA 4AVCA 3IU1A 4NF1A 4QUSA 2B3UA 4B14A 4FD5A 3W6XA 2O28A 4B5PA 3R9GA 2PC1A 1S5KA 4UWIA 2PR1A 4R57A 3A9LA 3SXNA 4JD6A 5J8FA 2WPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GIV A;  4JLY A;  4KZT A;  4Y49 C;  2Q04 A;  2FIW A;  1P4N A;  1PUA A;  3F0A A;  4AVB A;  3TO7 A;  2P6F A;  3S6G A;  1Y9K A;  2B3V A;  3SHP A;  2X7B A;  4KVX A;  4B5P B;  1S7K A;  3N7Z A;  2ZW4 A;  5C82 A;  4KOR A;  2GAN A;  1S60 A;  2R98 A;  2CNS A;  1QSN A;  4UA3 A;  3S6F A;  2I79 A;  5HH1 A;  4BMH A;  1KZF A;  2PSW A;  1YVK A;  2CNM A;  4QB9 A;  4IF5 A;  3P2H A;  4ONU A;  5EBV A;  4F0Y A;  1XIX A;  3D8P A;  3T9Y A;  3R95 A;  4IUS A;  1BO4 A;  4M85 A;  2OZG A;  4KOY A;  1NSL A;  5E96 A;  2KCW A;  4MY0 A;  5IV0 A;  4PK3 A;  2C27 A;  4XNH B;  2ZW5 A;  5I0C A;  4CAX A;  3D2M A;  4FD4 A;  3R96 A;  2F5I A;  1B6B A;  2ZW6 A;  2ATR A;  3R9E A;  2H5M A;  4AG7 A;  2P6G A;  5F48 A;  2RC4 A;  4PSW A;  1YGH A;  3P2F A;  1QST A;  2Z10 A;  3FYN A;  2WPW A;  2JLM A;  3EXN A;  2P6E A;  3FXT A;  4XPD B;  1M4D A;  2Q0Y A;  3DR8 A;  4OAE A;  3W91 A;  2VBQ A;  3TFY A;  2ZW7 A;  2B4D A;  1YK3 A;  1QSM A;  2B4B A;  1M44 A;  4YFJ A;  4LUA A;  1M4G A;  4E8O A;  4DNC A;  2R8V A;  3T90 A;  3H4Q A;  4CRZ B;  2PDO A;  1L0C A;  3DSB A;  3KKW A;  3GKR A;  3QAH A;  4MJ8 A;  3TO6 A;  2R7H A;  4XPL A;  2Z11 A;  4RI1 A;  3FNC A;  4YGO A;  2IL4 A;  4MHD A;  1WWZ A;  3FB3 A;  2Q4V A;  3PP9 A;  4CAW A;  1Q2C A;  2BUE A;  3VWD A;  4H6U A;  1Z4E A;  3BJ8 A;  3E0K A;  1WK4 A;  5KTC A;  2OB0 A;  4HNX B;  4LX9 A;  5ISV A;  3TOA A;  1MJB A;  5DWM A;  1MJ9 A;  2ZPA A;  3DNS A;  3D2P A;  1MK4 A;  2PRB A;  3EC4 A;  4MBU A;  4NXY A;  3K9U A;  4R87 A;  2QML A;  1IID A;  2CY2 A;  5HMN A;  4X5K A;  5GCN A;  2Z0Z A;  2J8N A;  4E0A A;  3OWC A;  4E2A A;  5JQ4 A;  5IB0 A;  2QIR A;  1LRZ A;  2Q44 A;  4HKF A;  3V8I A;  5FVJ A;  3TO9 A;  4F6A A;  4PSX A;  2BL1 A;  4U9Z A;  3TOB A;  5F46 A;  1XE4 A;  2JDC A;  1GHE A;  1S3Z A;  1TIQ A;  2G3A A;  2G3T A;  1NE9 A;  2Y0M A;  3S6H A;  4UBR A;  4L8A A;  4AVA A;  2ARH A;  3EFA A;  2HUZ A;  2G0B A;  2REE A;  1R57 A;  1SQH A;  2DXQ A;  2QEC A;  1K4J A;  1KUV A;  2VXK A;  2D4O A;  4U9Y A;  2B58 A;  2PQ8 A;  4XNH C;  5IX3 A;  1I12 A;  3G3S A;  3NE7 A;  3SXO A;  4NCZ A;  3QB8 A;  2P0W A;  4R9M A;  3S6K A;  2D4P A;  4AB7 A;  3VWE A;  2B5G A;  5DWN A;  1KUX A;  4U5Y A;  3TCV A;  4CAV A;  2R1I A;  2I00 A;  1PU9 A;  2FL4 A;  2VZZ A;  2AJ6 A;  4PK2 A;  3WR7 A;  1P0H A;  4OAD A;  1IB1 E;  4YRH A;  2VQY A;  5KTD A;  1QSR A;  2OH1 A;  2J8R A;  4XPD C;  2GE3 A;  3GY9 A;  5H84 A;  2FE7 A;  3JVN A;  1XF8 A;  1XEB A;  3TT2 A;  2BSW A;  4I49 A;  3D3S A;  3FRM A;  3MGD A;  2NMT A;  1CJW A;  3CXS A;  3FBU A;  4M3S A;  2FT0 A;  4JXQ A;  3G8W A;  1ON0 A;  5F47 A;  2B5G B;  4MI4 A;  4KUB A;  2J8M A;  2HQY A;  2VZY A;  4RS2 A;  4XPK A;  2Q7B A;  1OZP A;  1XMT A;  1Z9U A;  2PR8 A;  4KVO E;  3C26 A;  4JWP A;  2B4D B;  3I3G A;  3IGR A;  2REF A;  3CXP A;  4KLW A;  1S7F A;  3BJ7 A;  1RXT A;  5F49 A;  1MJA A;  1YR0 A;  1S7L A;  3ZZI A;  1U6M A;  4KOV A;  2OU2 A;  1I21 A;  1IYL A;  2OZU A;  4NSQ A;  1M4I A;  2K5T A;  2JDD A;  1M1D A;  3BLN A;  5H86 A;  4HNW B;  4UWJ A;  1V0C A;  4QC6 A;  4KLV A;  4L89 A;  4ZBG A;  2AE6 A;  1IYK A;  4HNY B;  3CXQ A;  2VEZ A;  4OLL A;  4Y49 B;  1YLE A;  3W6S A;  4H89 A;  1YRE A;  4R3K A;  2FIA A;  5JPH A;  1B87 A;  4MY3 A;  4QBJ A;  2FCK A;  1NMT A;  1N71 A;  1RO5 A;  2JEV A;  2ZXV A;  1IIC A;  5KTA A;  1QSO A;  4NEX A;  4JJX A;  5CNP A;  4JXR A;  4EVY A;  2EVN A;  2FXF A;  3GYA A;  2OZH A;  4GS4 A;  4KVM E;  4II9 A;  3ZJ0 A;  2FS5 A;  4AG9 A;  3JUW A;  3R9F A;  5EC4 A;  4J3G A;  3F5B A;  1KUY A;  1YVO A;  4H6Z A;  4FD7 A;  2HV2 A;  4CS0 B;  4CRY B;  4B5O A;  3R1K A;  3F8K A;  4K30 A;  3FIX A;  4QVT A;  5C88 A;  1VHS A;  1Y9W A;  3LD2 A;  4KOT A;  3LOD A;  4R3L A;  1UFH A;  1FY7 A;  3TTH A;  4PV6 A;  2FSR A;  3DDD A;  2EUI A;  4KUA A;  3PGP A;  1Y7R A;  4KOS A;  3UY5 A;  2Q4Y A;  4KOW A;  1Q2D A;  1I1D A;  5J8C A;  4ORF A;  1Z4R A;  3IWG A;  3TE4 A;  3EO4 A;  3PZJ A;  2CNT A;  3RYO A;  2BEI A;  3B8G A;  1S7N A;  2VI7 A;  4KOU A;  1BOB A;  1J4J A;  1VKC A;  3I9S A;  1YX0 A;  2A4N A;  4KOX A;  3EY5 A;  1Q2Y A;  4FD6 A;  1CM0 A;  3DR6 A;  4AVC A;  4NF1 A;  4QUS A;  2B3U A;  4FD5 A;  3W6X A;  2O28 A;  4B5P A;  3R9G A;  2PC1 A;  1S5K A;  4UWI A;  2PR1 A;  4R57 A;  3SXN A;  4JD6 A;  5J8F A;  2WPX A; 
#chains in the Genus database with same CATH topology
 1IGB A;  4M6G A;  2GIV A;  4MCS A;  4JLY A;  4KZT A;  5THW A;  1ZO0 A;  2PIY A;  2V77 A;  4Y49 C;  3PB7 X;  4F9U A;  2Q04 A;  3NH8 A;  1XJO A;  4OC1 A;  2FIW A;  3T8W A;  2C6P A;  1P4N A;  5AGE A;  1PUA A;  3F0A A;  4AVB A;  3TO7 A;  1ELL P;  4NGS A;  4ZX8 A;  2P6F A;  3RAM A;  3S6G A;  1LAN A;  1Y9K A;  2B3V A;  3SHP A;  1BPM A;  2X7B A;  1PYT B;  4OC2 A;  4KVX A;  4B5P B;  4MCP A;  3TC8 A;  2PJ1 A;  2C1C A;  1S7K A;  3N7Z A;  2OR4 A;  4IHM A;  2WZN A;  3FF3 A;  2ZW4 A;  2RB7 A;  3B3C A;  5C82 A;  4KOR A;  3KL9 A;  4NJQ A;  4UIB A;  3GIU A;  2GAN A;  2EK9 A;  2PJ3 A;  4BBH A;  1S60 A;  2R98 A;  2AFZ A;  5G1Z A;  4NGM A;  4KSA A;  2CNS A;  4UCM A;  1QSN A;  3K2K A;  3B3W A;  2WUU A;  4UA3 A;  3S6F A;  2I79 A;  2F7V A;  4UFV A;  1IOI A;  5HH1 A;  1YW6 A;  4GXH A;  4BMH A;  1KZF A;  2PSW A;  2GU2 A;  3K9T A;  1YVK A;  3NE8 A;  2CNM A;  4ZI6 A;  4KSI A;  4QB9 A;  4DUK A;  4IF5 A;  3P2H A;  4ONU A;  5EBV A;  4MMO A;  4MFJ A;  4F0Y A;  1XIX A;  3D8P A;  2BO9 A;  4MHP A;  3T9Y A;  3PEI A;  3R95 A;  1FT7 A;  5A27 A;  4IUS A;  5K8P A;  3TX8 A;  1BO4 A;  2JEW A;  2PJ9 A;  4M85 A;  5I4M A;  2OZG A;  3KR4 A;  1EE3 P;  4B11 A;  6CPA A;  2C6G A;  5LRG A;  4B6Z A;  4KOY A;  4MHZ A;  1HDQ A;  1NSL A;  5E96 A;  2KCW A;  4MY0 A;  5IV0 A;  4PK3 A;  2C27 A;  4XNH B;  2ZW5 A;  1X10 A;  4Q38 A;  4GM5 A;  2G9D A;  2Z3M A;  3D7G A;  3NH5 A;  4RN7 A;  5EMI A;  5I0C A;  4CGN A;  2EBJ A;  4CAX A;  4UEZ A;  3D2M A;  3FVL A;  4FD4 A;  1Z2L A;  3R96 A;  3WT4 A;  2F5I A;  4PXE A;  1KWM A;  1B6B A;  2ZW6 A;  2ZEE A;  2XEG A;  2ATR A;  4A39 A;  1BPN A;  3R9E A;  2H5M A;  4AG7 A;  2QVP A;  4FUU A;  2P6G A;  3JTK A;  4CYQ A;  2ZEL A;  5F48 A;  2RC4 A;  4PSW A;  1F2P A;  1YGH A;  3P2F A;  3BI1 A;  2EWB A;  4TNU A;  1QST A;  4YU9 A;  4PXC A;  2Z10 A;  5K8M A;  3FYN A;  2PVW A;  1TKH A;  2POK A;  2WPW A;  2JLM A;  3EXN A;  1LAM A;  1Z8W A;  2P6E A;  5LYL A;  2BCO A;  1TKF A;  2DPS A;  1M4D A;  2Q0Y A;  3DR8 A;  3FXT A;  4OAE A;  4NGT A;  4P4I A;  4UFW A;  2IQ6 A;  1XOV A;  3W91 A;  4ZYQ A;  5HXD A;  1OBR A;  4P44 A;  2VBQ A;  3TFY A;  4M6H A;  2ZEF A;  2ZW7 A;  2B4D A;  2Z3P A;  4UEF A;  1YK3 A;  3IC1 A;  3PB4 X;  1QSM A;  4OKO A;  4CYP A;  1YSJ A;  4C68 A;  5BWA B;  2B4B A;  1XRY A;  4C7H A;  3D7F A;  1M44 A;  1M4L A;  2JBJ A;  3IEH A;  1R43 A;  2HB6 A;  3KZW A;  4X3R A;  4YFJ A;  1AYE A;  3LMS A;  4AXV A;  4P4D A;  4MFZ A;  1TKJ A;  4O23 A;  1BAV A;  3V7Z A;  2ZOG A;  4LUA A;  1M4G A;  4E8O A;  2PJB A;  2QYV A;  3B35 A;  4OC5 A;  4DNC A;  2R8V A;  4WJB A;  3T90 A;  5AG4 A;  2CTC A;  3H4Q A;  4CRZ B;  4F9V A;  2PDO A;  1L0C A;  3DSB A;  3MRU A;  3D67 A;  2Z3O A;  4RUH A;  3B3T A;  3KKW A;  3GKR A;  3QAH A;  4MJ8 A;  3TO6 A;  3IFE A;  2R7H A;  4XPL A;  2Z11 A;  4RI1 A;  3FNC A;  4YGO A;  4P4J A;  2IL4 A;  5HVF A;  4OC0 A;  3LAC A;  4MHD A;  2AFU A;  1WWZ A;  2F8H A;  3FB3 A;  2Q4V A;  4A38 A;  2Q51 A;  4NFR A;  4CGM A;  2Q7S A;  3DLJ A;  1Q2C A;  2BUE A;  3PP9 A;  4CAW A;  7CPA A;  1YLO A;  3VWD A;  1X12 A;  1Z4E A;  3BJ8 A;  3E0K A;  4H6U A;  2GFQ A;  4UF4 A;  1WK4 A;  3PBE A;  5KTC A;  2OB0 A;  5LRK A;  1RTQ A;  4OC4 A;  4HNX B;  4LX9 A;  5ISV A;  4IK2 A;  3TOA A;  1MJB A;  3WC6 A;  4OID A;  1A2Z A;  5DWM A;  1MJ9 A;  2XEF A;  2ZPA A;  4CGO A;  3DNS A;  1CP7 A;  3D2P A;  3SI1 A;  4MHY A;  3IU2 A;  1MK4 A;  4CAF A;  2Q43 A;  1CPS A;  2PRB A;  4P4B A;  3EC4 A;  4MBU A;  4NXY A;  5LYD A;  3K9U A;  4R87 A;  2QML A;  3FH4 A;  1IID A;  2CY2 A;  3D66 A;  2PCU A;  3H8F A;  4UIA A;  4X5K A;  2Z0Z A;  5GCN A;  5HMN A;  2J8N A;  3L2N A;  4E0A A;  3OWC A;  2ODF A;  2XEJ A;  2CXA A;  4E2A A;  2EK8 A;  4P4E A;  2PE3 A;  4DYO A;  1LFW A;  3D68 A;  5JQ4 A;  1QMU A;  1YME A;  2WYR A;  5IB0 A;  2QIR A;  2Z3K A;  2PJ0 A;  1LRZ A;  4C7I A;  2Q44 A;  4HKF A;  2NSM A;  4TWE A;  3V8I A;  1XBU A;  5FVJ A;  3TO9 A;  4F6A A;  4PSX A;  3SI0 A;  2CF4 A;  2V8D A;  4ZY0 A;  4P10 A;  2BL1 A;  1ARM A;  2OOT A;  5LYF A;  4U9Z A;  1Y0Y A;  1ZG9 A;  4R76 A;  3TOB A;  1AUG A;  5F46 A;  4K3N A;  1XE4 A;  2JDC A;  3PBB A;  1GHE A;  4MFP A;  1CP6 A;  1S3Z A;  3MN8 A;  1TIQ A;  4P4F A;  1ZG8 A;  4UCP A;  2G3A A;  2G3T A;  1NE9 A;  2Y0M A;  1YW4 A;  3S6H A;  3IWE A;  4Q7A A;  4L8A A;  4UBR A;  4AVA A;  2ARH A;  2ZOF A;  3EFA A;  3S9M A;  4A32 A;  4B13 A;  5F09 A;  3KAS A;  1CX8 A;  3H5Z A;  2ZEN A;  5HVG A;  4WWV A;  1LOK A;  2G0B A;  2HUZ A;  1R57 A;  2REE A;  4OP4 A;  3VAR A;  4EWT A;  1SQH A;  1HEE A;  2DXQ A;  1CPX A;  2QEC A;  2V8V A;  3QNV A;  2ANP A;  1K4J A;  3SI2 A;  4ZY1 A;  2GRE A;  3IIB A;  4R8F A;  1KUV A;  2VXK A;  1TF9 A;  2D4O A;  3WC7 A;  4U9Y A;  4IAV A;  5JGF A;  5K8O A;  4X8I A;  2B58 A;  2PQ8 A;  5D29 A;  4XNH C;  3PFE A;  1ARL A;  1R3N A;  2ZEP A;  1Q7L A;  1VHO A;  4MRI A;  5IX3 A;  1I12 A;  3RBU A;  4CPA A;  3G3S A;  3NE7 A;  2EO8 A;  1IU8 A;  2QJ8 A;  3SXO A;  3PFO A;  4NCZ A;  3QB8 A;  2CTB A;  2P0W A;  4R9M A;  3S6K A;  2D4P A;  1TF8 A;  2PJA A;  3FEE A;  3GUX A;  3VWE A;  4AB7 A;  2B5G A;  4MFQ A;  5DWN A;  2AFO A;  2I3C A;  1KUX A;  1JQG A;  4U5Y A;  3TCV A;  4CAV A;  4OIW A;  2R1I A;  2I00 A;  4G1P A;  2PJC A;  4BD9 A;  1PU9 A;  4A2Z A;  2FL4 A;  2YNC A;  2VZZ A;  2AJ6 A;  4PK2 A;  3WR7 A;  1P0H A;  3H8G A;  3VH9 A;  4B10 A;  4OAD A;  1NSA A;  1IB1 E;  4YRH A;  3RO0 A;  4C2X A;  2VQY A;  1ZLH A;  1QSR A;  2OH1 A;  2J8R A;  1LCP A;  4XPD C;  5AG5 A;  5KTD A;  2GE3 A;  3GY9 A;  4ZGY B;  4PQA A;  4NGN A;  5H84 A;  4F8Z A;  3S9N A;  3B7I A;  3IWW A;  4JYW A;  3BXM A;  2FE7 A;  5AG7 A;  3JVN A;  1XF8 A;  1XEB A;  3TT2 A;  2BSW A;  4A31 A;  2DPT A;  4I49 A;  4MFK A;  2V8G A;  3D3S A;  3FRM A;  1H8L A;  2NMT A;  2PIZ A;  3MGD A;  4JZ0 A;  4UFX A;  1CJW A;  3CDX A;  2ZEG A;  2XEI A;  3D7H A;  1XFO A;  3CXS A;  3FBU A;  2VL1 A;  4M3S A;  5IB9 A;  2FT0 A;  2HC9 A;  3CPX A;  3G8W A;  4JXQ A;  4P45 A;  4C2Z A;  1ON0 A;  4NJR A;  2ABZ A;  3FEC A;  4H2K A;  5F47 A;  2B5G B;  1LAP A;  1VIX A;  1XMB A;  4MI4 A;  4UEE A;  4KUB A;  2J8M A;  2HQY A;  5A28 A;  2VZY A;  4RS2 A;  4XPK A;  2Q7B A;  1OZP A;  1XMT A;  1Z9U A;  2PR8 A;  4X2T A;  4UCN A;  2ZEO A;  3KHX A;  4KVO E;  3C26 A;  3NFZ A;  3KGQ A;  4JWP A;  3D4U A;  4YWY A;  4DJL A;  3QAY A;  2V8H A;  2B4D B;  3I3G A;  2PJ2 A;  3IGR A;  5G21 A;  4CYO A;  2REF A;  4CYN A;  3CXP A;  4KLW A;  1S7F A;  4XPD B;  3BJ7 A;  1RXT A;  5JM6 A;  3KR5 A;  5F49 A;  1MJA A;  4CGL A;  4NGP A;  4ONW A;  1YR0 A;  3BI0 A;  1S7L A;  4A95 A;  3ZZI A;  1U6M A;  1QQ9 A;  2FVG A;  4KOV A;  2OU2 A;  1I21 A;  1IYL A;  3PB9 X;  3VAT A;  2AFW A;  2OZU A;  2DEA A;  2Q4Z A;  3N5F A;  4NSQ A;  1M4I A;  2GLF A;  4OME A;  2C6C A;  2K5T A;  3JRU A;  5LRJ A;  4W9Y A;  3ISZ A;  3SJG A;  3DGV A;  2JDD A;  1M1D A;  3BLN A;  5JH9 A;  5H86 A;  4HNW B;  3PRT A;  1V0C A;  4UWJ A;  4QC6 A;  3CZX A;  4KLV A;  4L89 A;  4ZBG A;  1ZG7 A;  1Z8T A;  2AE6 A;  4FWU A;  1IYK A;  4HNY B;  3CXQ A;  1DTD A;  2VEZ A;  4OLL A;  4Y49 B;  1PCA A;  1YLE A;  3KQZ A;  1DE4 C;  2AFS A;  4H89 A;  3W6S A;  1YRE A;  1Z5R A;  4R3K A;  2FIA A;  5JPH A;  1B87 A;  2IMO A;  4A30 A;  4MY3 A;  1Z8X A;  4QBJ A;  5HVH A;  2FCK A;  4ZY2 A;  1NMT A;  4MCQ A;  1F57 A;  2PJ8 A;  1N71 A;  1RO5 A;  2JEV A;  2ZXV A;  1Y0R A;  1IIC A;  5KTA A;  1QSO A;  1VHE A;  2DF5 A;  4NEX A;  1IOF A;  3SJX A;  4M6I A;  4JJX A;  5CNP A;  2Z3N A;  3CPA A;  3FJU A;  4FAI A;  4FBE A;  4JXR A;  4EVY A;  1HDU A;  2FXF A;  3ISX A;  3GB0 A;  3GYA A;  2OZH A;  2YNE A;  1ZLI A;  3V38 A;  4GS4 A;  4KVM E;  5AG6 A;  4II9 A;  3ZJ0 A;  1BLL E;  2FS5 A;  4AG9 A;  3JUW A;  2ZEH A;  3R9F A;  1CBX A;  2YND A;  4CGP A;  5EC4 A;  4J3G A;  4Z65 A;  2JBK A;  3KHZ A;  2YGW A;  3F5B A;  3FX6 A;  3HUV A;  4R7M A;  4BIN A;  1KUY A;  4CAE A;  3I1U A;  4B12 A;  1YVO A;  4H6Z A;  3SJF A;  4FD7 A;  2HV2 A;  2PJ6 A;  4KS9 A;  1IY7 A;  4F0X A;  4CS0 B;  4CRY B;  4B5O A;  2AFX A;  2GLJ A;  2O4H A;  2ZED A;  3NA6 A;  3R1K A;  3F8K A;  5J1Q A;  5G20 A;  4K30 A;  3PB8 X;  2PJ4 A;  2PJ5 A;  3IO1 A;  4A94 A;  3FIX A;  4QVT A;  5C88 A;  1VHS A;  2BOA A;  1AMP A;  1Y9W A;  3LD2 A;  4KOT A;  1JWQ A;  4A33 A;  3B3V A;  4C2Y A;  3CT9 A;  3D7D A;  3H8E A;  3FED A;  3SJE A;  3LOD A;  2Z3L A;  5DS0 A;  5ELY A;  3HLP A;  4MCR A;  2AFM A;  1F2O A;  1UFH A;  4R3L A;  4R6T A;  1FY7 A;  1CG2 A;  3TTH A;  3IJ3 A;  3KQX A;  4PV6 A;  4PXD A;  2FSR A;  4EME A;  3DDD A;  1ELM P;  2WPX A;  3PB6 X;  2EUI A;  5G22 A;  4KSF A;  4KUA A;  3RNZ A;  3BHX A;  1Z8L A;  3PGP A;  8CPA A;  1FNO A;  1Y7R A;  2PRQ A;  5CBM A;  4KOS A;  3GLJ A;  3UY5 A;  1GYT A;  2CIJ A;  2Q4Y A;  3B2Y A;  4KOW A;  2O53 A;  3FMC A;  1Q2D A;  3NH4 A;  1I1D A;  4HPS A;  4ORF A;  1Z4R A;  5CPA A;  5J8C A;  4LQG A;  3IWG A;  3TE4 A;  2NYQ A;  4NGQ A;  3EO4 A;  2IJZ A;  4NGR A;  3PZJ A;  2CNT A;  3B3S A;  2BEI A;  2J9A A;  4P6Y A;  3B8G A;  4PXB A;  3RYO A;  1TXR A;  1S7N A;  2VI7 A;  2YNC C;  4KOU A;  1BOB A;  2ZEM A;  1J4J A;  5D8N A;  1VKC A;  3I9S A;  1YQE A;  1YX0 A;  2A4N A;  4MFL A;  4OC3 A;  4KOX A;  1Y7E A;  3EY5 A;  3WAB A;  1Q2Y A;  3LWU A;  1CM0 A;  4FD6 A;  4MXU A;  4EFD A;  2RFH A;  3DR6 A;  4Q36 A;  2WSA A;  4LQ6 A;  4AVC A;  5K8N A;  3IU1 A;  4NF1 A;  4QUS A;  1VGY A;  2B3U A;  4B14 A;  4FD5 A;  3RZA A;  2PJ7 A;  2O28 A;  3W6X A;  4A37 A;  4B5P A;  3WC5 A;  3R9G A;  2PC1 A;  1S5K A;  4UWI A;  3KI9 A;  4MHN A;  5LYI A;  2PR1 A;  3S9L A;  4ZX9 A;  4R57 A;  2PVV A;  3A9L A;  3SXN A;  1UWY A;  4PPZ A;  4JD6 A;  5J8F A;  2EVN A; 
#chains in the Genus database with same CATH homology
 2GIV A;  4JLY A;  4KZT A;  1ZO0 A;  4Y49 C;  2Q04 A;  2FIW A;  1P4N A;  5AGE A;  1PUA A;  3F0A A;  4AVB A;  3TO7 A;  2P6F A;  3S6G A;  1Y9K A;  2B3V A;  3SHP A;  2X7B A;  4KVX A;  4B5P B;  1S7K A;  3N7Z A;  2ZW4 A;  5C82 A;  4KOR A;  2GAN A;  4BBH A;  1S60 A;  2R98 A;  5G1Z A;  4KSA A;  2CNS A;  4UCM A;  1QSN A;  2WUU A;  4UA3 A;  3S6F A;  2I79 A;  4UFV A;  5HH1 A;  4BMH A;  1KZF A;  2PSW A;  1YVK A;  2CNM A;  4QB9 A;  4IF5 A;  3P2H A;  4ONU A;  5EBV A;  4MFJ A;  4F0Y A;  1XIX A;  3D8P A;  3T9Y A;  3R95 A;  5A27 A;  4IUS A;  1BO4 A;  4M85 A;  2OZG A;  4B11 A;  4KOY A;  1NSL A;  5E96 A;  2KCW A;  4MY0 A;  5IV0 A;  4PK3 A;  2C27 A;  4XNH B;  2ZW5 A;  4Q38 A;  2Z3M A;  5I0C A;  4CGN A;  4CAX A;  3D2M A;  4FD4 A;  3R96 A;  2F5I A;  1B6B A;  2ZW6 A;  2ATR A;  3R9E A;  2H5M A;  4AG7 A;  2P6G A;  3JTK A;  4CYQ A;  5F48 A;  2RC4 A;  4PSW A;  5BWA B;  1YGH A;  3P2F A;  1QST A;  2Z10 A;  3FYN A;  2WPW A;  2JLM A;  3EXN A;  2P6E A;  2DPS A;  3FXT A;  1M4D A;  2Q0Y A;  3DR8 A;  4OAE A;  4UFW A;  4XPD B;  3W91 A;  2VBQ A;  3TFY A;  2ZW7 A;  2B4D A;  2Z3P A;  1YK3 A;  4CYP A;  1QSM A;  4C68 A;  2B4B A;  4C7H A;  1M44 A;  4YFJ A;  4MFZ A;  4LUA A;  1M4G A;  4E8O A;  4DNC A;  2R8V A;  3T90 A;  5AG4 A;  3H4Q A;  4CRZ B;  2PDO A;  1L0C A;  3DSB A;  2Z3O A;  3KKW A;  3GKR A;  3QAH A;  4MJ8 A;  3TO6 A;  2R7H A;  4XPL A;  2Z11 A;  4RI1 A;  3FNC A;  4YGO A;  2IL4 A;  4MHD A;  1WWZ A;  3FB3 A;  4CGM A;  2Q4V A;  3PP9 A;  4CAW A;  1Q2C A;  2BUE A;  3VWD A;  4H6U A;  1Z4E A;  3BJ8 A;  3E0K A;  1WK4 A;  5KTC A;  2OB0 A;  4HNX B;  4LX9 A;  5ISV A;  3TOA A;  1MJB A;  5DWM A;  1MJ9 A;  2ZPA A;  4CGO A;  3DNS A;  3D2P A;  3IU2 A;  1MK4 A;  4CAF A;  2PRB A;  3EC4 A;  4MBU A;  4NXY A;  3K9U A;  4R87 A;  2QML A;  1IID A;  2CY2 A;  5HMN A;  4X5K A;  5GCN A;  2Z0Z A;  2J8N A;  4E0A A;  3OWC A;  2CXA A;  4E2A A;  5JQ4 A;  5IB0 A;  2QIR A;  2Z3K A;  1LRZ A;  4C7I A;  2Q44 A;  4HKF A;  3V8I A;  5FVJ A;  3TO9 A;  4F6A A;  4PSX A;  2BL1 A;  4U9Z A;  3TOB A;  5F46 A;  1XE4 A;  2JDC A;  1GHE A;  4MFP A;  1S3Z A;  1TIQ A;  4UCP A;  2G3A A;  2G3T A;  1NE9 A;  2Y0M A;  3S6H A;  3IWE A;  4UBR A;  4L8A A;  4AVA A;  2ARH A;  3EFA A;  4A32 A;  4B13 A;  3H5Z A;  2HUZ A;  2G0B A;  2REE A;  1R57 A;  1SQH A;  2DXQ A;  2QEC A;  1K4J A;  1KUV A;  2VXK A;  2D4O A;  4U9Y A;  2B58 A;  2PQ8 A;  4XNH C;  5IX3 A;  1I12 A;  3G3S A;  3NE7 A;  3SXO A;  4NCZ A;  3QB8 A;  2P0W A;  4R9M A;  3S6K A;  2D4P A;  4AB7 A;  3VWE A;  2B5G A;  4MFQ A;  5DWN A;  1KUX A;  4U5Y A;  3TCV A;  4CAV A;  2R1I A;  2I00 A;  1PU9 A;  4A2Z A;  2FL4 A;  2YNC A;  2VZZ A;  2AJ6 A;  4PK2 A;  3WR7 A;  1P0H A;  4B10 A;  4OAD A;  1IB1 E;  4YRH A;  4C2X A;  2VQY A;  5KTD A;  1QSR A;  2OH1 A;  2J8R A;  4XPD C;  5AG5 A;  2GE3 A;  3GY9 A;  4ZGY B;  5H84 A;  2FE7 A;  5AG7 A;  3JVN A;  1XF8 A;  1XEB A;  3TT2 A;  2BSW A;  4A31 A;  2DPT A;  4I49 A;  4MFK A;  3D3S A;  3FRM A;  3MGD A;  4UFX A;  2NMT A;  1CJW A;  3CXS A;  3FBU A;  4M3S A;  2FT0 A;  4JXQ A;  3G8W A;  4C2Z A;  1ON0 A;  5F47 A;  2B5G B;  4MI4 A;  4KUB A;  2J8M A;  2HQY A;  5A28 A;  2VZY A;  4RS2 A;  4XPK A;  2Q7B A;  1OZP A;  1XMT A;  1Z9U A;  2PR8 A;  4UCN A;  4KVO E;  3C26 A;  4JWP A;  4CYO A;  2B4D B;  3I3G A;  3IGR A;  5G21 A;  2REF A;  4CYN A;  3CXP A;  4KLW A;  1S7F A;  3BJ7 A;  1RXT A;  5F49 A;  1MJA A;  4CGL A;  1YR0 A;  4A95 A;  1S7L A;  3ZZI A;  1U6M A;  4KOV A;  2OU2 A;  1I21 A;  1IYL A;  2OZU A;  4NSQ A;  1M4I A;  2K5T A;  2JDD A;  1M1D A;  3BLN A;  5H86 A;  4HNW B;  4UWJ A;  1V0C A;  4QC6 A;  4KLV A;  4L89 A;  4ZBG A;  2AE6 A;  1IYK A;  4HNY B;  3CXQ A;  2VEZ A;  4OLL A;  4Y49 B;  1YLE A;  3W6S A;  4H89 A;  1YRE A;  4R3K A;  2FIA A;  5JPH A;  1B87 A;  4A30 A;  4MY3 A;  4QBJ A;  2FCK A;  1NMT A;  1N71 A;  1RO5 A;  2JEV A;  2ZXV A;  1IIC A;  5KTA A;  1QSO A;  4NEX A;  4JJX A;  5CNP A;  2Z3N A;  4JXR A;  4EVY A;  2EVN A;  2FXF A;  3GYA A;  2OZH A;  2YNE A;  4GS4 A;  4KVM E;  5AG6 A;  4II9 A;  3ZJ0 A;  2FS5 A;  4AG9 A;  3JUW A;  3R9F A;  2YND A;  4CGP A;  5EC4 A;  4J3G A;  2YGW A;  3F5B A;  1KUY A;  4CAE A;  4B12 A;  1YVO A;  4H6Z A;  4FD7 A;  2HV2 A;  4KS9 A;  4F0X A;  4CS0 B;  4CRY B;  4B5O A;  3R1K A;  3F8K A;  5G20 A;  4K30 A;  3FIX A;  4QVT A;  5C88 A;  1VHS A;  1Y9W A;  3LD2 A;  4KOT A;  4A33 A;  4C2Y A;  3LOD A;  2Z3L A;  4R3L A;  1UFH A;  1FY7 A;  3TTH A;  4PV6 A;  2FSR A;  3DDD A;  2EUI A;  5G22 A;  4KSF A;  4KUA A;  3PGP A;  1Y7R A;  4KOS A;  3UY5 A;  2Q4Y A;  4KOW A;  1Q2D A;  1I1D A;  5J8C A;  4ORF A;  1Z4R A;  3IWG A;  3TE4 A;  3EO4 A;  3PZJ A;  2CNT A;  3RYO A;  2BEI A;  3B8G A;  1S7N A;  2VI7 A;  2YNC C;  4KOU A;  1BOB A;  1J4J A;  1VKC A;  3I9S A;  1YX0 A;  2A4N A;  4MFL A;  4KOX A;  3EY5 A;  1Q2Y A;  4FD6 A;  1CM0 A;  3DR6 A;  4Q36 A;  2WSA A;  4AVC A;  3IU1 A;  4NF1 A;  4QUS A;  2B3U A;  4B14 A;  4FD5 A;  3W6X A;  2O28 A;  4B5P A;  3R9G A;  2PC1 A;  1S5K A;  4UWI A;  2PR1 A;  4R57 A;  3A9L A;  3SXN A;  4JD6 A;  5J8F A;  2WPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...