3QB8A

Paramecium chlorella bursaria virus1 putative orf a654l is a polyamine acetyltransferase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
197
structure length
197
Chain Sequence
MYTLIKLTSEYTSRAISFTSRNFVASEPTSIALKLTTCDFTTSFQNIMKQCVDYGHSFAFVDADDNIKAQILNIPYDAYENMHYGNIRETDPMFDLFGNLDSYTPDDKCLYVFAIGSEVTGKGLATKLLKKTIEESSSHGFKYIYGDCTNIISQNMFEKHGFETVGSVKYKGYQYGITKPFDSINCTEYIKRMVKTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Paramecium bursaria chlorella virus 1 encodes a polyamine acetyltransferase.
pubmed doi rcsb
molecule keywords A654L protein
source organism Paramecium bursaria chlorella virus 1
molecule tags Transferase
total genus 70
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3qb8A00
4MHDA 2R8VA 2FL4A 2NMTA 1NMTA 2QECA 2F5IA 4DNCA 1GHEA 2R1IA 4YFJA 1S3ZA 3B8GA 4Y49C 3TO6A 4JD6A 3JVNA 5J8CA 1S60A 3TOAA 3GKRA 2Q04A 5KTCA 1Q2YA 5J8FA 4JXQA 2CY2A 1M1DA 1U6MA 1M4IA 5CNPA 4B5PA 4E0AA 2Q44A 3WR7A 5DWMA 2ZW4A 1QSTA 3IWGA 2H5MA 3T90A 3EY5A 5EC4A 1BOBA 4E8OA 4CRYB 1Z4RA 1Y7RA 4XNHB 3W6SA 1Z4EA 2BL1A 2R7HA 3TOBA 4XPDB 2R98A 4NSQA 4HNWB 1Y9WA 2P0WA 2REFA 1XMTA 2PRBA 5H84A 3KKWA 3LD2A 3SXOA 4H6ZA 3G3SA 3BJ8A 3D2PA 3GYAA 2OZGA 4PSXA 3PZJA 2B5GB 4KVME 2G3AA 3TE4A 2ZXVA 5KTAA 1XEBA 4FD4A 3TO7A 2FXFA 3C26A 2B3VA 4CAWA 2Q4YA 2VXKA 5HMNA 1P0HA 3RYOA 4NF1A 3OWCA 3W91A 4AVCA 3R95A 3DR6A 2Q7BA 3TO9A 2QMLA 4QVTA 1CJWA 2JLMA 2OH1A 2PSWA 2BEIA 4IUSA 3DDDA 1M44A 1I12A 4H6UA 2FE7A 4MI4A 4AVBA 2PQ8A 1Z9UA 4UBRA 3G8WA 2Q4VA 2CNSA 4JLYA 4KZTA 2J8RA 5F47A 1QSOA 5ISVA 4KOYA 4RI1A 4GS4A 2QIRA 4AG9A 1N71A 3FIXA 3DR8A 3CXSA 1XF8A 4KOTA 4M3SA 2I00A 4NXYA 2GANA 3H4QA 2AJ6A 2JDDA 4CAVA 2FS5A 3FNCA 5C82A 3N7ZA 4PK2A 1SQHA 1UFHA 5IB0A 1MK4A 2VZYA 5EBVA 2Z0ZA 3QB8A 4HNYB 4KOSA 4LUAA 1IYLA 3R1KA 4NCZA 4LX9A 5F48A 5JQ4A 5F46A 2ZW6A 5JPHA 1YK3A 2CNTA 3D8PA 5HH1A 1PU9A 1P4NA 1IIDA 2FIAA 3I9SA 4Y49B 1Q2CA 4HKFA 3F5BA 3FRMA 4ZBGA 2HUZA 3R9EA 4FD7A 1YVKA 4IF5A 1ON0A 4B5PB 2B5GA 2OZHA 4H89A 2G3TA 3PP9A 3F0AA 1YX0A 4CAXA 4PSWA 4AB7A 1S5KA 4BMHA 2B4DA 1B6BA 3DSBA 4ORFA 1V0CA 4R57A 4RS2A 1OZPA 3F8KA 3K9UA 4U9ZA 4KLWA 3S6KA 1KUVA 2KCWA 3TTHA 4MY0A 3CXPA 3CXQA 2EVNA 2Z10A 2Z11A 2GIVA 4AG7A 2ATRA 3I3GA 4XPKA 1RO5A 2IL4A 4KOXA 1KZFA 2D4PA 3BLNA 4KUBA 1NSLA 2J8MA 4F6AA 4EVYA 2BSWA 4KORA 3R9GA 4XPLA 3R9FA 2HV2A 3TCVA 2FT0A 2PC1A 2D4OA 2PDOA 2Y0MA 1YREA 1QSMA 2ARHA 3FYNA 2K5TA 4I49A 5IX3A 3P2HA 1MJBA 4K30A 3MGDA 2ZPAA 2Q0YA 1QSRA 3FBUA 2JDCA 4II9A 5DWNA 4E2AA 1QSNA 5F49A 3SXNA 3W6XA 4CRZB 1L0CA 2ZW5A 1WWZA 5IV0A 3TFYA 1S7LA 4NEXA 2CNMA 4J3GA 2WPXA 4KVXA 4UWIA 1VHSA 4L89A 1R57A 2FCKA 3DNSA 1S7FA 2P6FA 4KOVA 1LRZA 4MBUA 1XIXA 2P6GA 1YLEA 4XNHC 3E0KA 1CM0A 4XPDC 4R87A 2FSRA 3PGPA 1WK4A 3GY9A 4QC6A 4FD5A 4OAEA 2VBQA 2GE3A 1XE4A 4R3LA 4YGOA 3VWEA 1I1DA 3FXTA 2G0BA 2WPWA 2A4NA 2J8NA 4FD6A 4X5KA 3VWDA 1FY7A 1MJAA 4KOUA 3S6FA 1IB1E 3D3SA 2ZW7A 4QUSA 2VQYA 1Q2DA 4UWJA 4KUAA 4U5YA 4YRHA 5H86A 1RXTA 4M85A 4UA3A 2PR1A 1S7NA 2PR8A 3TT2A 4KLVA 4JXRA 2VZZA 4R3KA 3QAHA 4B5OA 1Y9KA 3UY5A 1B87A 2OU2A 5E96A 3JUWA 3ZJ0A 4PK3A 3SHPA 4CS0B 1YVOA 3LODA 5C88A 2B4BA 4L8AA 4OADA 2HQYA 3EC4A 2FIWA 2EUIA 1S7KA 1BO4A 2O28A 5GCNA 2REEA 1VKCA 2DXQA 3R96A 2B4DB 4QBJA 4JWPA 1MJ9A 3V8IA 2X7BA 3NE7A 2P6EA 2AE6A 3D2MA 1M4GA 1IICA 1KUXA 1YR0A 4MY3A 5FVJA 1NE9A 3P2FA 1IYKA 2VEZA 2VI7A 5KTDA 3IGRA 4R9MA 3T9YA 3EXNA 3ZZIA 1YGHA 1M4DA 2B58A 4PV6A 2BUEA 1J4JA 4OLLA 2B3UA 1I21A 1TIQA 2C27A 2OB0A 4U9YA 4ONUA 3S6HA 2I79A 2RC4A 2OZUA 4JJXA 1PUAA 1K4JA 4F0YA 3BJ7A 3EO4A 1KUYA 4KVOE 2JEVA 4KOWA 4AVAA 3S6GA 5I0CA 4MJ8A 3EFAA 4QB9A 4HNXB 3FB3A
chains in the Genus database with same CATH superfamily
4MHDA 2R8VA 2FL4A 1ELLP 1XFOA 2NMTA 1F2OA 1CG2A 1NMTA 2QECA 3IJ3A 2F5IA 4R8FA 2DPSA 4DNCA 1GHEA 2R1IA 1FT7A 4YFJA 1S3ZA 1TF9A 3B8GA 4Y49C 3TO6A 2ZENA 3CZXA 1IY7A 4JD6A 4KS9A 2ZEPA 3FVLA 3JVNA 5THWA 5J8CA 1S60A 4O23A 3TOAA 3GKRA 2Q04A 4RN7A 5KTCA 1Q2YA 5LRGA 1PYTB 3IIBA 4JXQA 4P45A 5J8FA 2AFOA 2CY2A 4P6YA 4A33A 1M1DA 1U6MA 2PJCA 2PVVA 1M4IA 5CNPA 2PRQA 2ZOFA 4B5PA 4E0AA 3B3SA 5HVFA 5JGFA 4FAIA 2C1CA 2Q44A 3WR7A 5DWMA 2GREA 4PXDA 2F8HA 1VHEA 1FNOA 2ZW4A 4UCNA 3SJXA 4OP4A 1QSTA 1VHOA 1XBUA 3IWGA 2H5MA 5EMIA 3EY5A 3T90A 4IK2A 5EC4A 1BOBA 4E8OA 4P4DA 4CRYB 1Z4RA 2XEFA 2OOTA 2CF4A 1Y7RA 1JWQA 1Z2LA 4XNHB 3W6SA 2YGWA 1Z4EA 2BL1A 2R7HA 3TOBA 2PCUA 4XPDB 2JEWA 2PJ2A 4MHYA 3VATA 2PJ0A 2R98A 3VARA 4A39A 3TC8A 2NYQA 4ZGYB 4NSQA 4HNWB 1Y9WA 2BOAA 2P0WA 1XMTA 2REFA 4UIBA 2Z3MA 2PRBA 2Z3KA 5H84A 2AFUA 4F0YA 4UCPA 3CPXA 3KKWA 3LD2A 4KSAA 2AFXA 3SXOA 4H6ZA 3G3SA 3BJ8A 3D2PA 4M6IA 4Q38A 3GYAA 3KR4A 2OZGA 1UWYA 3I1UA 4PSXA 3PZJA 8CPAA 2B5GB 2POKA 2QVPA 4KVME 2G3AA 3TE4A 2ZXVA 5K8PA 3KQZA 5KTAA 1XEBA 4FD4A 3TO7A 2PJ1A 4CGOA 2FXFA 3C26A 2CXAA 4P10A 2B3VA 4CAWA 1M4LA 2Q4YA 3H5ZA 4WJBA 2VXKA 5HMNA 1P0HA 3RYOA 5A28A 4NF1A 3SJEA 2PVWA 1HEEA 3OWCA 3W91A 3D7FA 2YNEA 3D4UA 4AVCA 2OR4A 2Z3LA 2EO8A 1KWMA 3R95A 3DR6A 2Q7BA 3TO9A 5K8NA 2QMLA 4QVTA 2IMOA 4F8ZA 1X12A 2DEAA 2JLMA 2Q51A 2OH1A 4NGQA 3VH9A 4MFKA 2PSWA 4NJRA 1GYTA 3IWWA 2BEIA 5CBMA 4IUSA 3KGQA 4OC0A 3DDDA 1M44A 3K9TA 1XOVA 1I12A 4H6UA 5ELYA 2FE7A 2EWBA 4MI4A 4OIWA 4TWEA 1TKFA 5D8NA 4AVBA 3NH5A 1XMBA 2PQ8A 1HDQA 4OC1A 4C2YA 1Z9UA 4UBRA 1QMUA 4ZY1A 3G8WA 2Q4VA 2CNSA 4JLYA 4KZTA 2J8RA 4UF4A 5F47A 3RO0A 4Z65A 1QSOA 5ISVA 2HB6A 4KOYA 4B14A 1TXRA 5IB9A 4RI1A 4MFQA 4C2ZA 1OBRA 5D29A 3IC1A 1YLOA 3LWUA 1ARLA 4GS4A 2PIYA 2QIRA 4AG9A 1N71A 3FIXA 4EMEA 3DR8A 2PE3A 4CAFA 2CIJA 3CXSA 3IO1A 4UIAA 4M6HA 3SI2A 1LCPA 1XF8A 4KOTA 4M3SA 2VL1A 4ZI6A 4DYOA 4OMEA 2I00A 4NXYA 4MFJA 2GANA 3H4QA 4FWUA 1Y7EA 3KQXA 3JTKA 4NGSA 3QAYA 2PJAA 3RBUA 3V7ZA 2QJ8A 2AJ6A 1Z8TA 4Q36A 2JDDA 3IU1A 4MHPA 5CPAA 4CAVA 2FS5A 3FNCA 4P4FA 3N7ZA 1Z5RA 5C82A 4PK2A 2C6CA 4H2KA 1A2ZA 1SQHA 4MRIA 4MFLA 1EE3P 3L2NA 3CDXA 1UFHA 5IB0A 3FF3A 3KR5A 1MK4A 2WYRA 3DLJA 2VZYA 1LAPA 4TNUA 2FVGA 5EBVA 2Z0ZA 3MRUA 3QB8A 4HNYB 2XEIA 4KOSA 3NH8A 4LUAA 2C6PA 1IYLA 4MCPA 2ZEDA 3R1KA 4NGTA 3LMSA 4DUKA 4NCZA 4GM5A 4LX9A 4M6GA 5F48A 5F46A 5JQ4A 2ZW6A 5JPHA 2CTBA 1YK3A 2CNTA 3D8PA 5HH1A 1PU9A 1VGYA 4UFWA 3SJGA 4AXVA 1P4NA 1IIDA 1TF8A 4P4BA 4UFVA 4B12A 2FIAA 3I9SA 2NSMA 3FEEA 4Y49B 1Q2CA 2WSAA 4HKFA 5LYIA 3FECA 4X8IA 1IOIA 3H8GA 3F5BA 3FRMA 4KSFA 3RAMA 4EWTA 4PQAA 4ZBGA 1ZG9A 2HUZA 3R9EA 4FD7A 4CYQA 3DGVA 2AFWA 5I4MA 3GIUA 2AFSA 1YVKA 3CPAA 1CBXA 1CX8A 1Z8WA 4IF5A 1ON0A 2GU2A 2B5GA 4B5PB 2OZHA 4LQGA 4H89A 5AG4A 2PJ4A 2G3TA 6CPAA 4OIDA 5HXDA 3PP9A 2JBJA 4UEFA 4DJLA 4A95A 3F0AA 3S9NA 1HDUA 3SI0A 2C6GA 1YX0A 4A38A 1XRYA 2YNDA 5JH9A 4CAXA 4PSWA 4A2ZA 4AB7A 1S5KA 3FH4A 4NGPA 2B4DA 1B6BA 3DSBA 3IFEA 4BMHA 4X3RA 4ORFA 2PJ5A 2V77A 1V0CA 4CYNA 3WC5A 4R57A 4RS2A 5HVHA 2O4HA 1OZPA 2PJ9A 3F8KA 3ISXA 3K9UA 4U9ZA 4KLWA 3PB8X 5K8OA 3S6KA 5G20A 4WWVA 5DS0A 4R6TA 1KUVA 4GXHA 4MCQA 2KCWA 3TTHA 5BWAB 2JBKA 4MY0A 3FMCA 4CGPA 3CXPA 3CXQA 4RUHA 2EVNA 2Z10A 3B3VA 2O53A 2PJ6A 2RB7A 3GUXA 4UCMA 2Z11A 2GIVA 4AG7A 2ATRA 2Q4ZA 3I3GA 5G1ZA 1IOFA 4XPKA 3B3CA 2WZNA 1AYEA 1RO5A 2IL4A 2RFHA 4KOXA 4F0XA 4F9UA 1KZFA 2D4PA 2YNCC 3BLNA 4KUBA 3B7IA 1ZLIA 3IEHA 3V38A 4CGLA 1LAMA 1QQ9A 2YNCA 1NSLA 2J8MA 3TX8A 2V8VA 5LYFA 3B3TA 4F6AA 4CAEA 4EVYA 1TKHA 3FX6A 2BSWA 1IU8A 3QNVA 4KORA 3R9GA 5LYLA 4XPLA 3R9FA 2HV2A 3TCVA 2FT0A 1XJOA 4BINA 4IHMA 2PC1A 2D4OA 2PDOA 2Y0MA 1LOKA 3BI1A 4OC4A 1ZG8A 1YREA 1QSMA 1R3NA 2ARHA 2K5TA 1ZLHA 3FYNA 4I49A 4C2XA 5IX3A 5G22A 3P2HA 1MJBA 4K30A 4G1PA 1BPNA 4A30A 5HVGA 2J9AA 1Z8LA 3CT9A 3MGDA 1R43A 4BD9A 2ZPAA 2BCOA 4CGMA 4K3NA 2CTCA 2Q0YA 4A37A 4ZY0A 4X2TA 2IJZA 2V8GA 2Z3OA 3MN8A 5LYDA 1QSRA 2PJ7A 1JQGA 3ISZA 3FBUA 5AG7A 2JDCA 2ZELA 4OC3A 1YW4A 5DWNA 7CPAA 2HC9A 4E2AA 4II9A 1Q7LA 3PEIA 1QSNA 3IU2A 3WC6A 5F49A 4MHNA 3SXNA 1CPXA 1LANA 3W6XA 3WABA 4CRZB 1DE4C 2V8DA 4P44A 4JYWA 1L0CA 3HUVA 1CP7A 2Q7SA 4B10A 2ZW5A 1WWZA 3KL9A 4B13A 4C7HA 4EFDA 5IV0A 1LFWA 3TFYA 3PB6X 3BHXA 1S7LA 4NEXA 2CNMA 4J3GA 1F57A 5K8MA 3JRUA 2WUUA 2WPXA 4KVXA 4UWIA 1VHSA 1AMPA 2ZOGA 4L89A 1R57A 4R76A 2XEGA 2FCKA 3DNSA 1S7FA 2P6FA 3NA6A 1LRZA 4KOVA 2AFMA 4KSIA 1XIXA 2P6GA 3KI9A 4MBUA 4PXEA 1YLEA 4PXCA 4XNHC 3E0KA 4IAVA 4NGNA 1CM0A 3D66A 4XPDC 1BAVA 2PJ3A 4R87A 3T8WA 2FSRA 3PGPA 3N5FA 2EK8A 3BXMA 4NGMA 1WK4A 3GY9A 2EK9A 3PB9X 4FD5A 4OAEA 2VBQA 3K2KA 4QC6A 5J1QA 4P4IA 1Y0YA 2GE3A 3RZAA 1YMEA 4A32A 3D67A 5A27A 4CPAA 1XE4A 4R3LA 2XEJA 4YGOA 3S9MA 3VWEA 1I1DA 3H8EA 2WPWA 2G0BA 1ELMP 3FXTA 1AUGA 2A4NA 1IGBA 2J8NA 4FD6A 4X5KA 3VWDA 1FY7A 5F09A 1MJAA 2V8HA 4A31A 4R7MA 5LRKA 4ZX8A 4KOUA 3S6FA 1IB1E 2IQ6A 3D3SA 1ZO0A 2GFQA 2ZW7A 3HLPA 4HNXB 4MMOA 5LRJA 4B11A 2ODFA 2F7VA 4QUSA 1VIXA 3IWEA 1F2PA 4JZ0A 4MCRA 2VQYA 1Q2DA 3D7HA 3NE8A 4UWJA 2GLJA 4MXUA 1YSJA 4KUAA 4OC5A 4U5YA 5JM6A 2AFZA 1H8LA 4YRHA 5H86A 1RXTA 3PBBA 4OKOA 4M85A 4UA3A 2ZEMA 2PR1A 3KASA 1S7NA 2Z3NA 2PR8A 4HPSA 3TT2A 4KLVA 4JXRA 5G21A 2Z3PA 2VZZA 4R3KA 3QAHA 4B5OA 4P4EA 1Y9KA 2Q43A 2DPTA 3UY5A 2ZEGA 3PBEA 4MHZA 1B87A 2OU2A 3RNZA 4MFZA 4CYOA 4NFRA 5E96A 3JUWA 3ZJ0A 4PK3A 3SHPA 4CYPA 2GLFA 3S9LA 4FUUA 4CGNA 4CS0B 1YVOA 1X10A 3LODA 3SJFA 1YW6A 1PCAA 5AG6A 3PRTA 5C88A 4PXBA 4C68A 2ZEHA 2B4BA 1Y0RA 2ZEOA 4L8AA 4OADA 2HQYA 2BO9A 4MCSA 3EC4A 4PPZA 2FIWA 4ZYQA 3D7DA 3SI1A 4ZX9A 2EUIA 1S7KA 3A9LA 1BO4A 4OC2A 2O28A 1DTDA 5GCNA 2REEA 4Q7AA 1VKCA 1BLLE 2DXQA 3R96A 2B4DB 3B35A 4F9VA 4QBJA 2ABZA 4JWPA 3PFOA 3KHZA 4YWYA 1MJ9A 1ZG7A 3V8IA 3D7GA 3NFZA 3WT4A 2PIZA 2X7BA 3FJUA 3NE7A 2P6EA 2AE6A 2PJ8A 4YU9A 3D2MA 1M4GA 1IICA 1KUXA 1YR0A 4MY3A 5AGEA 1NE9A 5FVJA 3P2FA 1IYKA 2VEZA 2VI7A 1TKJA 4MFPA 4P4JA 5KTDA 1Z8XA 3D68A 1CP6A 3IGRA 3GLJA 4R9MA 3BI0A 2ZEFA 3KZWA 3T9YA 4NGRA 4BBHA 1NSAA 2PJBA 3EXNA 3ZZIA 1YGHA 1M4DA 4UEEA 2EBJA 2B58A 4ONWA 4PV6A 4ZY2A 2BUEA 2ZEEA 1BPMA 1J4JA 4OLLA 2QYVA 2B3UA 4UEZA 3FEDA 2G9DA 1I21A 1RTQA 1TIQA 4W9YA 2C27A 5AG5A 2OB0A 4U9YA 1YQEA 4ONUA 3S6HA 2I79A 2RC4A 2OZUA 4FBEA 4A94A 3B2YA 4JJXA 4UFXA 3GB0A 1PUAA 1K4JA 3WC7A 3BJ7A 2I3CA 3H8FA 3EO4A 1ARMA 3PB4X 4C7IA 1KUYA 3KHXA 4KVOE 3PFEA 2JEVA 4KOWA 4AVAA 4NJQA 2ANPA 4LQ6A 3S6GA 3PB7X 3LACA 3B3WA 5I0CA 3NH4A 4MJ8A 3EFAA 4QB9A 4B6ZA 2DF5A 1CJWA 1CPSA 3FB3A
chains in the Genus database with same CATH topology
4MHDA 2R8VA 2FL4A 2NMTA 1NMTA 2QECA 2F5IA 2DPSA 4DNCA 1GHEA 2R1IA 4YFJA 1S3ZA 3B8GA 4Y49C 3TO6A 4JD6A 4KS9A 3JVNA 5J8CA 1S60A 3TOAA 3GKRA 2Q04A 5KTCA 1Q2YA 5J8FA 4JXQA 2CY2A 4A33A 1M1DA 1U6MA 1M4IA 5CNPA 4B5PA 4E0AA 2Q44A 3WR7A 5DWMA 4UCNA 2ZW4A 1QSTA 3IWGA 2H5MA 3T90A 3EY5A 5EC4A 1BOBA 4E8OA 4CRYB 1Z4RA 1Y7RA 4XNHB 3W6SA 2YGWA 1Z4EA 2BL1A 2R7HA 3TOBA 4XPDB 2R98A 4ZGYB 4NSQA 4HNWB 1Y9WA 2P0WA 2REFA 1XMTA 2Z3MA 2PRBA 2Z3KA 5H84A 4UCPA 3KKWA 3LD2A 4KSAA 3SXOA 4H6ZA 3G3SA 3BJ8A 3D2PA 4Q38A 3GYAA 2OZGA 4PSXA 3PZJA 2B5GB 4KVME 2G3AA 3TE4A 2ZXVA 5KTAA 1XEBA 4FD4A 3TO7A 4CGOA 2FXFA 3C26A 2CXAA 2B3VA 4CAWA 2Q4YA 3H5ZA 2VXKA 5HMNA 1P0HA 3RYOA 5A28A 4NF1A 3OWCA 3W91A 4AVCA 2YNEA 2Z3LA 3R95A 3DR6A 2Q7BA 3TO9A 2QMLA 4QVTA 1CJWA 2JLMA 2OH1A 4MFKA 2PSWA 2BEIA 4IUSA 3DDDA 1M44A 1I12A 4H6UA 2FE7A 4MI4A 4AVBA 2PQ8A 4C2YA 1Z9UA 4UBRA 3G8WA 2Q4VA 2CNSA 4JLYA 4KZTA 2J8RA 5F47A 1QSOA 5ISVA 4KOYA 4B14A 4RI1A 4MFQA 4C2ZA 4GS4A 2QIRA 4AG9A 1N71A 3FIXA 3DR8A 4CAFA 3CXSA 1XF8A 4KOTA 4M3SA 2I00A 4NXYA 4MFJA 2GANA 3H4QA 3JTKA 2AJ6A 4Q36A 2JDDA 3IU1A 4CAVA 2FS5A 3FNCA 5C82A 3N7ZA 4PK2A 1SQHA 4MFLA 1UFHA 5IB0A 1MK4A 2VZYA 5EBVA 2Z0ZA 3QB8A 4HNYB 4KOSA 4LUAA 1IYLA 3R1KA 4NCZA 4LX9A 5F48A 5JQ4A 5F46A 2ZW6A 5JPHA 1YK3A 2CNTA 3D8PA 5HH1A 1PU9A 4UFWA 1P4NA 1IIDA 4UFVA 4B12A 2FIAA 3I9SA 4Y49B 1Q2CA 2WSAA 4HKFA 3F5BA 3FRMA 4KSFA 4ZBGA 2HUZA 3R9EA 4FD7A 4CYQA 1YVKA 4IF5A 1ON0A 4B5PB 2B5GA 2OZHA 5AG4A 4H89A 2G3TA 3PP9A 4A95A 3F0AA 1YX0A 2YNDA 4CAXA 4PSWA 4A2ZA 4AB7A 1S5KA 4BMHA 2B4DA 1B6BA 3DSBA 4ORFA 1V0CA 4CYNA 4R57A 4RS2A 1OZPA 3F8KA 3K9UA 4U9ZA 4KLWA 3S6KA 5G20A 1KUVA 2KCWA 3TTHA 5BWAB 4MY0A 4CGPA 3CXPA 3CXQA 2EVNA 2Z10A 4UCMA 2Z11A 2GIVA 4AG7A 2ATRA 3I3GA 5G1ZA 4XPKA 1RO5A 2IL4A 4KOXA 4F0XA 1KZFA 2D4PA 2YNCC 3BLNA 4KUBA 4CGLA 2YNCA 1NSLA 2J8MA 4F6AA 4CAEA 4EVYA 2BSWA 4KORA 3R9GA 4XPLA 3R9FA 2HV2A 3TCVA 2FT0A 2PC1A 2D4OA 2PDOA 2Y0MA 1YREA 1QSMA 2ARHA 3FYNA 2K5TA 4I49A 4C2XA 5IX3A 5G22A 3P2HA 1MJBA 4K30A 4A30A 3MGDA 2ZPAA 4CGMA 2Q0YA 2Z3OA 1QSRA 3FBUA 5AG7A 2JDCA 4II9A 5DWNA 4E2AA 1QSNA 3IU2A 5F49A 3SXNA 3W6XA 4CRZB 4B10A 1L0CA 4B13A 2ZW5A 1WWZA 5IV0A 4C7HA 3TFYA 1S7LA 4NEXA 2CNMA 4J3GA 2WUUA 2WPXA 4KVXA 4UWIA 1VHSA 4L89A 1R57A 2FCKA 3DNSA 1S7FA 2P6FA 4KOVA 1LRZA 4MBUA 1XIXA 2P6GA 1YLEA 4XNHC 3E0KA 1CM0A 4XPDC 4R87A 2FSRA 3PGPA 1WK4A 3GY9A 4QC6A 4FD5A 4OAEA 2VBQA 2GE3A 4A32A 5A27A 1XE4A 4R3LA 4YGOA 3VWEA 1I1DA 3FXTA 2G0BA 2WPWA 2A4NA 2J8NA 4FD6A 4X5KA 3VWDA 1FY7A 1MJAA 4A31A 4KOUA 3S6FA 1IB1E 3D3SA 1ZO0A 2ZW7A 4B11A 4QUSA 3IWEA 2VQYA 1Q2DA 4UWJA 4KUAA 4U5YA 4YRHA 5H86A 1RXTA 4M85A 4UA3A 2PR1A 1S7NA 2Z3NA 2PR8A 3TT2A 4KLVA 4JXRA 5G21A 2Z3PA 2VZZA 4R3KA 3QAHA 4B5OA 1Y9KA 2DPTA 3UY5A 1B87A 2OU2A 4CYOA 4MFZA 5E96A 3JUWA 3ZJ0A 4PK3A 3SHPA 4CYPA 4CGNA 4CS0B 1YVOA 3LODA 5AG6A 5C88A 4C68A 2B4BA 4L8AA 4OADA 2HQYA 3EC4A 2FIWA 2EUIA 1S7KA 3A9LA 1BO4A 2O28A 5GCNA 2REEA 1VKCA 2DXQA 3R96A 2B4DB 4QBJA 4JWPA 1MJ9A 3V8IA 2X7BA 3NE7A 2P6EA 2AE6A 3D2MA 1M4GA 1IICA 1KUXA 1YR0A 4MY3A 5AGEA 1NE9A 5FVJA 3P2FA 1IYKA 2VEZA 2VI7A 4MFPA 5KTDA 3IGRA 4R9MA 3T9YA 4BBHA 3EXNA 3ZZIA 1YGHA 1M4DA 2B58A 4PV6A 2BUEA 1J4JA 4OLLA 2B3UA 1I21A 1TIQA 2C27A 5AG5A 2OB0A 4U9YA 4ONUA 3S6HA 2I79A 2RC4A 2OZUA 4JJXA 4UFXA 1PUAA 1K4JA 4F0YA 3BJ7A 4C7IA 3EO4A 1KUYA 4KVOE 2JEVA 4KOWA 4AVAA 3S6GA 5I0CA 4MJ8A 3EFAA 4QB9A 4HNXB 3FB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MHD A;  2R8V A;  2FL4 A;  2NMT A;  1NMT A;  2QEC A;  2F5I A;  4DNC A;  1GHE A;  2R1I A;  4YFJ A;  1S3Z A;  3B8G A;  4Y49 C;  3TO6 A;  4JD6 A;  3JVN A;  5J8C A;  1S60 A;  3TOA A;  3GKR A;  2Q04 A;  5KTC A;  1Q2Y A;  5J8F A;  4JXQ A;  2CY2 A;  1M1D A;  1U6M A;  1M4I A;  5CNP A;  4B5P A;  4E0A A;  2Q44 A;  3WR7 A;  5DWM A;  2ZW4 A;  1QST A;  3IWG A;  2H5M A;  3T90 A;  3EY5 A;  5EC4 A;  1BOB A;  4E8O A;  4CRY B;  1Z4R A;  1Y7R A;  4XNH B;  3W6S A;  1Z4E A;  2BL1 A;  2R7H A;  3TOB A;  4XPD B;  2R98 A;  4NSQ A;  4HNW B;  1Y9W A;  2P0W A;  2REF A;  1XMT A;  2PRB A;  5H84 A;  3KKW A;  3LD2 A;  3SXO A;  4H6Z A;  3G3S A;  3BJ8 A;  3D2P A;  3GYA A;  2OZG A;  4PSX A;  3PZJ A;  2B5G B;  4KVM E;  2G3A A;  3TE4 A;  2ZXV A;  5KTA A;  1XEB A;  4FD4 A;  3TO7 A;  2FXF A;  3C26 A;  2B3V A;  4CAW A;  2Q4Y A;  2VXK A;  5HMN A;  1P0H A;  3RYO A;  4NF1 A;  3OWC A;  3W91 A;  4AVC A;  3R95 A;  3DR6 A;  2Q7B A;  3TO9 A;  2QML A;  4QVT A;  1CJW A;  2JLM A;  2OH1 A;  2PSW A;  2BEI A;  4IUS A;  3DDD A;  1M44 A;  1I12 A;  4H6U A;  2FE7 A;  4MI4 A;  4AVB A;  2PQ8 A;  1Z9U A;  4UBR A;  3G8W A;  2Q4V A;  2CNS A;  4JLY A;  4KZT A;  2J8R A;  5F47 A;  1QSO A;  5ISV A;  4KOY A;  4RI1 A;  4GS4 A;  2QIR A;  4AG9 A;  1N71 A;  3FIX A;  3DR8 A;  3CXS A;  1XF8 A;  4KOT A;  4M3S A;  2I00 A;  4NXY A;  2GAN A;  3H4Q A;  2AJ6 A;  2JDD A;  4CAV A;  2FS5 A;  3FNC A;  5C82 A;  3N7Z A;  4PK2 A;  1SQH A;  1UFH A;  5IB0 A;  1MK4 A;  2VZY A;  5EBV A;  2Z0Z A;  3QB8 A;  4HNY B;  4KOS A;  4LUA A;  1IYL A;  3R1K A;  4NCZ A;  4LX9 A;  5F48 A;  5JQ4 A;  5F46 A;  2ZW6 A;  5JPH A;  1YK3 A;  2CNT A;  3D8P A;  5HH1 A;  1PU9 A;  1P4N A;  1IID A;  2FIA A;  3I9S A;  4Y49 B;  1Q2C A;  4HKF A;  3F5B A;  3FRM A;  4ZBG A;  2HUZ A;  3R9E A;  4FD7 A;  1YVK A;  4IF5 A;  1ON0 A;  4B5P B;  2B5G A;  2OZH A;  4H89 A;  2G3T A;  3PP9 A;  3F0A A;  1YX0 A;  4CAX A;  4PSW A;  4AB7 A;  1S5K A;  4BMH A;  2B4D A;  1B6B A;  3DSB A;  4ORF A;  1V0C A;  4R57 A;  4RS2 A;  1OZP A;  3F8K A;  3K9U A;  4U9Z A;  4KLW A;  3S6K A;  1KUV A;  2KCW A;  3TTH A;  4MY0 A;  3CXP A;  3CXQ A;  2EVN A;  2Z10 A;  2Z11 A;  2GIV A;  4AG7 A;  2ATR A;  3I3G A;  4XPK A;  1RO5 A;  2IL4 A;  4KOX A;  1KZF A;  2D4P A;  3BLN A;  4KUB A;  1NSL A;  2J8M A;  4F6A A;  4EVY A;  2BSW A;  4KOR A;  3R9G A;  4XPL A;  3R9F A;  2HV2 A;  3TCV A;  2FT0 A;  2PC1 A;  2D4O A;  2PDO A;  2Y0M A;  1YRE A;  1QSM A;  2ARH A;  3FYN A;  2K5T A;  4I49 A;  5IX3 A;  3P2H A;  1MJB A;  4K30 A;  3MGD A;  2ZPA A;  2Q0Y A;  1QSR A;  3FBU A;  2JDC A;  4II9 A;  5DWN A;  4E2A A;  1QSN A;  5F49 A;  3SXN A;  3W6X A;  4CRZ B;  1L0C A;  2ZW5 A;  1WWZ A;  5IV0 A;  3TFY A;  1S7L A;  4NEX A;  2CNM A;  4J3G A;  2WPX A;  4KVX A;  4UWI A;  1VHS A;  4L89 A;  1R57 A;  2FCK A;  3DNS A;  1S7F A;  2P6F A;  4KOV A;  1LRZ A;  4MBU A;  1XIX A;  2P6G A;  1YLE A;  4XNH C;  3E0K A;  1CM0 A;  4XPD C;  4R87 A;  2FSR A;  3PGP A;  1WK4 A;  3GY9 A;  4QC6 A;  4FD5 A;  4OAE A;  2VBQ A;  2GE3 A;  1XE4 A;  4R3L A;  4YGO A;  3VWE A;  1I1D A;  3FXT A;  2G0B A;  2WPW A;  2A4N A;  2J8N A;  4FD6 A;  4X5K A;  3VWD A;  1FY7 A;  1MJA A;  4KOU A;  3S6F A;  1IB1 E;  3D3S A;  2ZW7 A;  4QUS A;  2VQY A;  1Q2D A;  4UWJ A;  4KUA A;  4U5Y A;  4YRH A;  5H86 A;  1RXT A;  4M85 A;  4UA3 A;  2PR1 A;  1S7N A;  2PR8 A;  3TT2 A;  4KLV A;  4JXR A;  2VZZ A;  4R3K A;  3QAH A;  4B5O A;  1Y9K A;  3UY5 A;  1B87 A;  2OU2 A;  5E96 A;  3JUW A;  3ZJ0 A;  4PK3 A;  3SHP A;  4CS0 B;  1YVO A;  3LOD A;  5C88 A;  2B4B A;  4L8A A;  4OAD A;  2HQY A;  3EC4 A;  2FIW A;  2EUI A;  1S7K A;  1BO4 A;  2O28 A;  5GCN A;  2REE A;  1VKC A;  2DXQ A;  3R96 A;  2B4D B;  4QBJ A;  4JWP A;  1MJ9 A;  3V8I A;  2X7B A;  3NE7 A;  2P6E A;  2AE6 A;  3D2M A;  1M4G A;  1IIC A;  1KUX A;  1YR0 A;  4MY3 A;  5FVJ A;  1NE9 A;  3P2F A;  1IYK A;  2VEZ A;  2VI7 A;  5KTD A;  3IGR A;  4R9M A;  3T9Y A;  3EXN A;  3ZZI A;  1YGH A;  1M4D A;  2B58 A;  4PV6 A;  2BUE A;  1J4J A;  4OLL A;  2B3U A;  1I21 A;  1TIQ A;  2C27 A;  2OB0 A;  4U9Y A;  4ONU A;  3S6H A;  2I79 A;  2RC4 A;  2OZU A;  4JJX A;  1PUA A;  1K4J A;  4F0Y A;  3BJ7 A;  3EO4 A;  1KUY A;  4KVO E;  2JEV A;  4KOW A;  4AVA A;  3S6G A;  5I0C A;  4MJ8 A;  3EFA A;  4QB9 A;  4HNX B;  3FB3 A; 
#chains in the Genus database with same CATH topology
 4MHD A;  2R8V A;  2FL4 A;  1ELL P;  1XFO A;  2NMT A;  1F2O A;  1CG2 A;  1NMT A;  2QEC A;  3IJ3 A;  2F5I A;  4R8F A;  2DPS A;  4DNC A;  1GHE A;  2R1I A;  1FT7 A;  4YFJ A;  1S3Z A;  1TF9 A;  3B8G A;  4Y49 C;  3TO6 A;  2ZEN A;  3CZX A;  1IY7 A;  4JD6 A;  4KS9 A;  2ZEP A;  3FVL A;  3JVN A;  5THW A;  5J8C A;  1S60 A;  4O23 A;  3TOA A;  3GKR A;  2Q04 A;  4RN7 A;  5KTC A;  1Q2Y A;  5LRG A;  1PYT B;  3IIB A;  4JXQ A;  4P45 A;  5J8F A;  2AFO A;  2CY2 A;  4P6Y A;  4A33 A;  1M1D A;  1U6M A;  2PJC A;  2PVV A;  1M4I A;  5CNP A;  2PRQ A;  2ZOF A;  4B5P A;  4E0A A;  3B3S A;  5HVF A;  5JGF A;  4FAI A;  2C1C A;  2Q44 A;  3WR7 A;  5DWM A;  2GRE A;  4PXD A;  2F8H A;  1VHE A;  1FNO A;  2ZW4 A;  4UCN A;  3SJX A;  4OP4 A;  1QST A;  1VHO A;  1XBU A;  3IWG A;  2H5M A;  5EMI A;  3EY5 A;  3T90 A;  4IK2 A;  5EC4 A;  1BOB A;  4E8O A;  4P4D A;  4CRY B;  1Z4R A;  2XEF A;  2OOT A;  2CF4 A;  1Y7R A;  1JWQ A;  1Z2L A;  4XNH B;  3W6S A;  2YGW A;  1Z4E A;  2BL1 A;  2R7H A;  3TOB A;  2PCU A;  4XPD B;  2JEW A;  2PJ2 A;  4MHY A;  3VAT A;  2PJ0 A;  2R98 A;  3VAR A;  4A39 A;  3TC8 A;  2NYQ A;  4ZGY B;  4NSQ A;  4HNW B;  1Y9W A;  2BOA A;  2P0W A;  1XMT A;  2REF A;  4UIB A;  2Z3M A;  2PRB A;  2Z3K A;  5H84 A;  2AFU A;  4F0Y A;  4UCP A;  3CPX A;  3KKW A;  3LD2 A;  4KSA A;  2AFX A;  3SXO A;  4H6Z A;  3G3S A;  3BJ8 A;  3D2P A;  4M6I A;  4Q38 A;  3GYA A;  3KR4 A;  2OZG A;  1UWY A;  3I1U A;  4PSX A;  3PZJ A;  8CPA A;  2B5G B;  2POK A;  2QVP A;  4KVM E;  2G3A A;  3TE4 A;  2ZXV A;  5K8P A;  3KQZ A;  5KTA A;  1XEB A;  4FD4 A;  3TO7 A;  2PJ1 A;  4CGO A;  2FXF A;  3C26 A;  2CXA A;  4P10 A;  2B3V A;  4CAW A;  1M4L A;  2Q4Y A;  3H5Z A;  4WJB A;  2VXK A;  5HMN A;  1P0H A;  3RYO A;  5A28 A;  4NF1 A;  3SJE A;  2PVW A;  1HEE A;  3OWC A;  3W91 A;  3D7F A;  2YNE A;  3D4U A;  4AVC A;  2OR4 A;  2Z3L A;  2EO8 A;  1KWM A;  3R95 A;  3DR6 A;  2Q7B A;  3TO9 A;  5K8N A;  2QML A;  4QVT A;  2IMO A;  4F8Z A;  1X12 A;  2DEA A;  2JLM A;  2Q51 A;  2OH1 A;  4NGQ A;  3VH9 A;  4MFK A;  2PSW A;  4NJR A;  1GYT A;  3IWW A;  2BEI A;  5CBM A;  4IUS A;  3KGQ A;  4OC0 A;  3DDD A;  1M44 A;  3K9T A;  1XOV A;  1I12 A;  4H6U A;  5ELY A;  2FE7 A;  2EWB A;  4MI4 A;  4OIW A;  4TWE A;  1TKF A;  5D8N A;  4AVB A;  3NH5 A;  1XMB A;  2PQ8 A;  1HDQ A;  4OC1 A;  4C2Y A;  1Z9U A;  4UBR A;  1QMU A;  4ZY1 A;  3G8W A;  2Q4V A;  2CNS A;  4JLY A;  4KZT A;  2J8R A;  4UF4 A;  5F47 A;  3RO0 A;  4Z65 A;  1QSO A;  5ISV A;  2HB6 A;  4KOY A;  4B14 A;  1TXR A;  5IB9 A;  4RI1 A;  4MFQ A;  4C2Z A;  1OBR A;  5D29 A;  3IC1 A;  1YLO A;  3LWU A;  1ARL A;  4GS4 A;  2PIY A;  2QIR A;  4AG9 A;  1N71 A;  3FIX A;  4EME A;  3DR8 A;  2PE3 A;  4CAF A;  2CIJ A;  3CXS A;  3IO1 A;  4UIA A;  4M6H A;  3SI2 A;  1LCP A;  1XF8 A;  4KOT A;  4M3S A;  2VL1 A;  4ZI6 A;  4DYO A;  4OME A;  2I00 A;  4NXY A;  4MFJ A;  2GAN A;  3H4Q A;  4FWU A;  1Y7E A;  3KQX A;  3JTK A;  4NGS A;  3QAY A;  2PJA A;  3RBU A;  3V7Z A;  2QJ8 A;  2AJ6 A;  1Z8T A;  4Q36 A;  2JDD A;  3IU1 A;  4MHP A;  5CPA A;  4CAV A;  2FS5 A;  3FNC A;  4P4F A;  3N7Z A;  1Z5R A;  5C82 A;  4PK2 A;  2C6C A;  4H2K A;  1A2Z A;  1SQH A;  4MRI A;  4MFL A;  1EE3 P;  3L2N A;  3CDX A;  1UFH A;  5IB0 A;  3FF3 A;  3KR5 A;  1MK4 A;  2WYR A;  3DLJ A;  2VZY A;  1LAP A;  4TNU A;  2FVG A;  5EBV A;  2Z0Z A;  3MRU A;  3QB8 A;  4HNY B;  2XEI A;  4KOS A;  3NH8 A;  4LUA A;  2C6P A;  1IYL A;  4MCP A;  2ZED A;  3R1K A;  4NGT A;  3LMS A;  4DUK A;  4NCZ A;  4GM5 A;  4LX9 A;  4M6G A;  5F48 A;  5F46 A;  5JQ4 A;  2ZW6 A;  5JPH A;  2CTB A;  1YK3 A;  2CNT A;  3D8P A;  5HH1 A;  1PU9 A;  1VGY A;  4UFW A;  3SJG A;  4AXV A;  1P4N A;  1IID A;  1TF8 A;  4P4B A;  4UFV A;  4B12 A;  2FIA A;  3I9S A;  2NSM A;  3FEE A;  4Y49 B;  1Q2C A;  2WSA A;  4HKF A;  5LYI A;  3FEC A;  4X8I A;  1IOI A;  3H8G A;  3F5B A;  3FRM A;  4KSF A;  3RAM A;  4EWT A;  4PQA A;  4ZBG A;  1ZG9 A;  2HUZ A;  3R9E A;  4FD7 A;  4CYQ A;  3DGV A;  2AFW A;  5I4M A;  3GIU A;  2AFS A;  1YVK A;  3CPA A;  1CBX A;  1CX8 A;  1Z8W A;  4IF5 A;  1ON0 A;  2GU2 A;  2B5G A;  4B5P B;  2OZH A;  4LQG A;  4H89 A;  5AG4 A;  2PJ4 A;  2G3T A;  6CPA A;  4OID A;  5HXD A;  3PP9 A;  2JBJ A;  4UEF A;  4DJL A;  4A95 A;  3F0A A;  3S9N A;  1HDU A;  3SI0 A;  2C6G A;  1YX0 A;  4A38 A;  1XRY A;  2YND A;  5JH9 A;  4CAX A;  4PSW A;  4A2Z A;  4AB7 A;  1S5K A;  3FH4 A;  4NGP A;  2B4D A;  1B6B A;  3DSB A;  3IFE A;  4BMH A;  4X3R A;  4ORF A;  2PJ5 A;  2V77 A;  1V0C A;  4CYN A;  3WC5 A;  4R57 A;  4RS2 A;  5HVH A;  2O4H A;  1OZP A;  2PJ9 A;  3F8K A;  3ISX A;  3K9U A;  4U9Z A;  4KLW A;  3PB8 X;  5K8O A;  3S6K A;  5G20 A;  4WWV A;  5DS0 A;  4R6T A;  1KUV A;  4GXH A;  4MCQ A;  2KCW A;  3TTH A;  5BWA B;  2JBK A;  4MY0 A;  3FMC A;  4CGP A;  3CXP A;  3CXQ A;  4RUH A;  2EVN A;  2Z10 A;  3B3V A;  2O53 A;  2PJ6 A;  2RB7 A;  3GUX A;  4UCM A;  2Z11 A;  2GIV A;  4AG7 A;  2ATR A;  2Q4Z A;  3I3G A;  5G1Z A;  1IOF A;  4XPK A;  3B3C A;  2WZN A;  1AYE A;  1RO5 A;  2IL4 A;  2RFH A;  4KOX A;  4F0X A;  4F9U A;  1KZF A;  2D4P A;  2YNC C;  3BLN A;  4KUB A;  3B7I A;  1ZLI A;  3IEH A;  3V38 A;  4CGL A;  1LAM A;  1QQ9 A;  2YNC A;  1NSL A;  2J8M A;  3TX8 A;  2V8V A;  5LYF A;  3B3T A;  4F6A A;  4CAE A;  4EVY A;  1TKH A;  3FX6 A;  2BSW A;  1IU8 A;  3QNV A;  4KOR A;  3R9G A;  5LYL A;  4XPL A;  3R9F A;  2HV2 A;  3TCV A;  2FT0 A;  1XJO A;  4BIN A;  4IHM A;  2PC1 A;  2D4O A;  2PDO A;  2Y0M A;  1LOK A;  3BI1 A;  4OC4 A;  1ZG8 A;  1YRE A;  1QSM A;  1R3N A;  2ARH A;  2K5T A;  1ZLH A;  3FYN A;  4I49 A;  4C2X A;  5IX3 A;  5G22 A;  3P2H A;  1MJB A;  4K30 A;  4G1P A;  1BPN A;  4A30 A;  5HVG A;  2J9A A;  1Z8L A;  3CT9 A;  3MGD A;  1R43 A;  4BD9 A;  2ZPA A;  2BCO A;  4CGM A;  4K3N A;  2CTC A;  2Q0Y A;  4A37 A;  4ZY0 A;  4X2T A;  2IJZ A;  2V8G A;  2Z3O A;  3MN8 A;  5LYD A;  1QSR A;  2PJ7 A;  1JQG A;  3ISZ A;  3FBU A;  5AG7 A;  2JDC A;  2ZEL A;  4OC3 A;  1YW4 A;  5DWN A;  7CPA A;  2HC9 A;  4E2A A;  4II9 A;  1Q7L A;  3PEI A;  1QSN A;  3IU2 A;  3WC6 A;  5F49 A;  4MHN A;  3SXN A;  1CPX A;  1LAN A;  3W6X A;  3WAB A;  4CRZ B;  1DE4 C;  2V8D A;  4P44 A;  4JYW A;  1L0C A;  3HUV A;  1CP7 A;  2Q7S A;  4B10 A;  2ZW5 A;  1WWZ A;  3KL9 A;  4B13 A;  4C7H A;  4EFD A;  5IV0 A;  1LFW A;  3TFY A;  3PB6 X;  3BHX A;  1S7L A;  4NEX A;  2CNM A;  4J3G A;  1F57 A;  5K8M A;  3JRU A;  2WUU A;  2WPX A;  4KVX A;  4UWI A;  1VHS A;  1AMP A;  2ZOG A;  4L89 A;  1R57 A;  4R76 A;  2XEG A;  2FCK A;  3DNS A;  1S7F A;  2P6F A;  3NA6 A;  1LRZ A;  4KOV A;  2AFM A;  4KSI A;  1XIX A;  2P6G A;  3KI9 A;  4MBU A;  4PXE A;  1YLE A;  4PXC A;  4XNH C;  3E0K A;  4IAV A;  4NGN A;  1CM0 A;  3D66 A;  4XPD C;  1BAV A;  2PJ3 A;  4R87 A;  3T8W A;  2FSR A;  3PGP A;  3N5F A;  2EK8 A;  3BXM A;  4NGM A;  1WK4 A;  3GY9 A;  2EK9 A;  3PB9 X;  4FD5 A;  4OAE A;  2VBQ A;  3K2K A;  4QC6 A;  5J1Q A;  4P4I A;  1Y0Y A;  2GE3 A;  3RZA A;  1YME A;  4A32 A;  3D67 A;  5A27 A;  4CPA A;  1XE4 A;  4R3L A;  2XEJ A;  4YGO A;  3S9M A;  3VWE A;  1I1D A;  3H8E A;  2WPW A;  2G0B A;  1ELM P;  3FXT A;  1AUG A;  2A4N A;  1IGB A;  2J8N A;  4FD6 A;  4X5K A;  3VWD A;  1FY7 A;  5F09 A;  1MJA A;  2V8H A;  4A31 A;  4R7M A;  5LRK A;  4ZX8 A;  4KOU A;  3S6F A;  1IB1 E;  2IQ6 A;  3D3S A;  1ZO0 A;  2GFQ A;  2ZW7 A;  3HLP A;  4HNX B;  4MMO A;  5LRJ A;  4B11 A;  2ODF A;  2F7V A;  4QUS A;  1VIX A;  3IWE A;  1F2P A;  4JZ0 A;  4MCR A;  2VQY A;  1Q2D A;  3D7H A;  3NE8 A;  4UWJ A;  2GLJ A;  4MXU A;  1YSJ A;  4KUA A;  4OC5 A;  4U5Y A;  5JM6 A;  2AFZ A;  1H8L A;  4YRH A;  5H86 A;  1RXT A;  3PBB A;  4OKO A;  4M85 A;  4UA3 A;  2ZEM A;  2PR1 A;  3KAS A;  1S7N A;  2Z3N A;  2PR8 A;  4HPS A;  3TT2 A;  4KLV A;  4JXR A;  5G21 A;  2Z3P A;  2VZZ A;  4R3K A;  3QAH A;  4B5O A;  4P4E A;  1Y9K A;  2Q43 A;  2DPT A;  3UY5 A;  2ZEG A;  3PBE A;  4MHZ A;  1B87 A;  2OU2 A;  3RNZ A;  4MFZ A;  4CYO A;  4NFR A;  5E96 A;  3JUW A;  3ZJ0 A;  4PK3 A;  3SHP A;  4CYP A;  2GLF A;  3S9L A;  4FUU A;  4CGN A;  4CS0 B;  1YVO A;  1X10 A;  3LOD A;  3SJF A;  1YW6 A;  1PCA A;  5AG6 A;  3PRT A;  5C88 A;  4PXB A;  4C68 A;  2ZEH A;  2B4B A;  1Y0R A;  2ZEO A;  4L8A A;  4OAD A;  2HQY A;  2BO9 A;  4MCS A;  3EC4 A;  4PPZ A;  2FIW A;  4ZYQ A;  3D7D A;  3SI1 A;  4ZX9 A;  2EUI A;  1S7K A;  3A9L A;  1BO4 A;  4OC2 A;  2O28 A;  1DTD A;  5GCN A;  2REE A;  4Q7A A;  1VKC A;  1BLL E;  2DXQ A;  3R96 A;  2B4D B;  3B35 A;  4F9V A;  4QBJ A;  2ABZ A;  4JWP A;  3PFO A;  3KHZ A;  4YWY A;  1MJ9 A;  1ZG7 A;  3V8I A;  3D7G A;  3NFZ A;  3WT4 A;  2PIZ A;  2X7B A;  3FJU A;  3NE7 A;  2P6E A;  2AE6 A;  2PJ8 A;  4YU9 A;  3D2M A;  1M4G A;  1IIC A;  1KUX A;  1YR0 A;  4MY3 A;  5AGE A;  1NE9 A;  5FVJ A;  3P2F A;  1IYK A;  2VEZ A;  2VI7 A;  1TKJ A;  4MFP A;  4P4J A;  5KTD A;  1Z8X A;  3D68 A;  1CP6 A;  3IGR A;  3GLJ A;  4R9M A;  3BI0 A;  2ZEF A;  3KZW A;  3T9Y A;  4NGR A;  4BBH A;  1NSA A;  2PJB A;  3EXN A;  3ZZI A;  1YGH A;  1M4D A;  4UEE A;  2EBJ A;  2B58 A;  4ONW A;  4PV6 A;  4ZY2 A;  2BUE A;  2ZEE A;  1BPM A;  1J4J A;  4OLL A;  2QYV A;  2B3U A;  4UEZ A;  3FED A;  2G9D A;  1I21 A;  1RTQ A;  1TIQ A;  4W9Y A;  2C27 A;  5AG5 A;  2OB0 A;  4U9Y A;  1YQE A;  4ONU A;  3S6H A;  2I79 A;  2RC4 A;  2OZU A;  4FBE A;  4A94 A;  3B2Y A;  4JJX A;  4UFX A;  3GB0 A;  1PUA A;  1K4J A;  3WC7 A;  3BJ7 A;  2I3C A;  3H8F A;  3EO4 A;  1ARM A;  3PB4 X;  4C7I A;  1KUY A;  3KHX A;  4KVO E;  3PFE A;  2JEV A;  4KOW A;  4AVA A;  4NJQ A;  2ANP A;  4LQ6 A;  3S6G A;  3PB7 X;  3LAC A;  3B3W A;  5I0C A;  3NH4 A;  4MJ8 A;  3EFA A;  4QB9 A;  4B6Z A;  2DF5 A;  1CJW A;  1CPS A;  3FB3 A; 
#chains in the Genus database with same CATH homology
 4MHD A;  2R8V A;  2FL4 A;  2NMT A;  1NMT A;  2QEC A;  2F5I A;  2DPS A;  4DNC A;  1GHE A;  2R1I A;  4YFJ A;  1S3Z A;  3B8G A;  4Y49 C;  3TO6 A;  4JD6 A;  4KS9 A;  3JVN A;  5J8C A;  1S60 A;  3TOA A;  3GKR A;  2Q04 A;  5KTC A;  1Q2Y A;  5J8F A;  4JXQ A;  2CY2 A;  4A33 A;  1M1D A;  1U6M A;  1M4I A;  5CNP A;  4B5P A;  4E0A A;  2Q44 A;  3WR7 A;  5DWM A;  4UCN A;  2ZW4 A;  1QST A;  3IWG A;  2H5M A;  3T90 A;  3EY5 A;  5EC4 A;  1BOB A;  4E8O A;  4CRY B;  1Z4R A;  1Y7R A;  4XNH B;  3W6S A;  2YGW A;  1Z4E A;  2BL1 A;  2R7H A;  3TOB A;  4XPD B;  2R98 A;  4ZGY B;  4NSQ A;  4HNW B;  1Y9W A;  2P0W A;  2REF A;  1XMT A;  2Z3M A;  2PRB A;  2Z3K A;  5H84 A;  4UCP A;  3KKW A;  3LD2 A;  4KSA A;  3SXO A;  4H6Z A;  3G3S A;  3BJ8 A;  3D2P A;  4Q38 A;  3GYA A;  2OZG A;  4PSX A;  3PZJ A;  2B5G B;  4KVM E;  2G3A A;  3TE4 A;  2ZXV A;  5KTA A;  1XEB A;  4FD4 A;  3TO7 A;  4CGO A;  2FXF A;  3C26 A;  2CXA A;  2B3V A;  4CAW A;  2Q4Y A;  3H5Z A;  2VXK A;  5HMN A;  1P0H A;  3RYO A;  5A28 A;  4NF1 A;  3OWC A;  3W91 A;  4AVC A;  2YNE A;  2Z3L A;  3R95 A;  3DR6 A;  2Q7B A;  3TO9 A;  2QML A;  4QVT A;  1CJW A;  2JLM A;  2OH1 A;  4MFK A;  2PSW A;  2BEI A;  4IUS A;  3DDD A;  1M44 A;  1I12 A;  4H6U A;  2FE7 A;  4MI4 A;  4AVB A;  2PQ8 A;  4C2Y A;  1Z9U A;  4UBR A;  3G8W A;  2Q4V A;  2CNS A;  4JLY A;  4KZT A;  2J8R A;  5F47 A;  1QSO A;  5ISV A;  4KOY A;  4B14 A;  4RI1 A;  4MFQ A;  4C2Z A;  4GS4 A;  2QIR A;  4AG9 A;  1N71 A;  3FIX A;  3DR8 A;  4CAF A;  3CXS A;  1XF8 A;  4KOT A;  4M3S A;  2I00 A;  4NXY A;  4MFJ A;  2GAN A;  3H4Q A;  3JTK A;  2AJ6 A;  4Q36 A;  2JDD A;  3IU1 A;  4CAV A;  2FS5 A;  3FNC A;  5C82 A;  3N7Z A;  4PK2 A;  1SQH A;  4MFL A;  1UFH A;  5IB0 A;  1MK4 A;  2VZY A;  5EBV A;  2Z0Z A;  3QB8 A;  4HNY B;  4KOS A;  4LUA A;  1IYL A;  3R1K A;  4NCZ A;  4LX9 A;  5F48 A;  5JQ4 A;  5F46 A;  2ZW6 A;  5JPH A;  1YK3 A;  2CNT A;  3D8P A;  5HH1 A;  1PU9 A;  4UFW A;  1P4N A;  1IID A;  4UFV A;  4B12 A;  2FIA A;  3I9S A;  4Y49 B;  1Q2C A;  2WSA A;  4HKF A;  3F5B A;  3FRM A;  4KSF A;  4ZBG A;  2HUZ A;  3R9E A;  4FD7 A;  4CYQ A;  1YVK A;  4IF5 A;  1ON0 A;  4B5P B;  2B5G A;  2OZH A;  5AG4 A;  4H89 A;  2G3T A;  3PP9 A;  4A95 A;  3F0A A;  1YX0 A;  2YND A;  4CAX A;  4PSW A;  4A2Z A;  4AB7 A;  1S5K A;  4BMH A;  2B4D A;  1B6B A;  3DSB A;  4ORF A;  1V0C A;  4CYN A;  4R57 A;  4RS2 A;  1OZP A;  3F8K A;  3K9U A;  4U9Z A;  4KLW A;  3S6K A;  5G20 A;  1KUV A;  2KCW A;  3TTH A;  5BWA B;  4MY0 A;  4CGP A;  3CXP A;  3CXQ A;  2EVN A;  2Z10 A;  4UCM A;  2Z11 A;  2GIV A;  4AG7 A;  2ATR A;  3I3G A;  5G1Z A;  4XPK A;  1RO5 A;  2IL4 A;  4KOX A;  4F0X A;  1KZF A;  2D4P A;  2YNC C;  3BLN A;  4KUB A;  4CGL A;  2YNC A;  1NSL A;  2J8M A;  4F6A A;  4CAE A;  4EVY A;  2BSW A;  4KOR A;  3R9G A;  4XPL A;  3R9F A;  2HV2 A;  3TCV A;  2FT0 A;  2PC1 A;  2D4O A;  2PDO A;  2Y0M A;  1YRE A;  1QSM A;  2ARH A;  3FYN A;  2K5T A;  4I49 A;  4C2X A;  5IX3 A;  5G22 A;  3P2H A;  1MJB A;  4K30 A;  4A30 A;  3MGD A;  2ZPA A;  4CGM A;  2Q0Y A;  2Z3O A;  1QSR A;  3FBU A;  5AG7 A;  2JDC A;  4II9 A;  5DWN A;  4E2A A;  1QSN A;  3IU2 A;  5F49 A;  3SXN A;  3W6X A;  4CRZ B;  4B10 A;  1L0C A;  4B13 A;  2ZW5 A;  1WWZ A;  5IV0 A;  4C7H A;  3TFY A;  1S7L A;  4NEX A;  2CNM A;  4J3G A;  2WUU A;  2WPX A;  4KVX A;  4UWI A;  1VHS A;  4L89 A;  1R57 A;  2FCK A;  3DNS A;  1S7F A;  2P6F A;  4KOV A;  1LRZ A;  4MBU A;  1XIX A;  2P6G A;  1YLE A;  4XNH C;  3E0K A;  1CM0 A;  4XPD C;  4R87 A;  2FSR A;  3PGP A;  1WK4 A;  3GY9 A;  4QC6 A;  4FD5 A;  4OAE A;  2VBQ A;  2GE3 A;  4A32 A;  5A27 A;  1XE4 A;  4R3L A;  4YGO A;  3VWE A;  1I1D A;  3FXT A;  2G0B A;  2WPW A;  2A4N A;  2J8N A;  4FD6 A;  4X5K A;  3VWD A;  1FY7 A;  1MJA A;  4A31 A;  4KOU A;  3S6F A;  1IB1 E;  3D3S A;  1ZO0 A;  2ZW7 A;  4B11 A;  4QUS A;  3IWE A;  2VQY A;  1Q2D A;  4UWJ A;  4KUA A;  4U5Y A;  4YRH A;  5H86 A;  1RXT A;  4M85 A;  4UA3 A;  2PR1 A;  1S7N A;  2Z3N A;  2PR8 A;  3TT2 A;  4KLV A;  4JXR A;  5G21 A;  2Z3P A;  2VZZ A;  4R3K A;  3QAH A;  4B5O A;  1Y9K A;  2DPT A;  3UY5 A;  1B87 A;  2OU2 A;  4CYO A;  4MFZ A;  5E96 A;  3JUW A;  3ZJ0 A;  4PK3 A;  3SHP A;  4CYP A;  4CGN A;  4CS0 B;  1YVO A;  3LOD A;  5AG6 A;  5C88 A;  4C68 A;  2B4B A;  4L8A A;  4OAD A;  2HQY A;  3EC4 A;  2FIW A;  2EUI A;  1S7K A;  3A9L A;  1BO4 A;  2O28 A;  5GCN A;  2REE A;  1VKC A;  2DXQ A;  3R96 A;  2B4D B;  4QBJ A;  4JWP A;  1MJ9 A;  3V8I A;  2X7B A;  3NE7 A;  2P6E A;  2AE6 A;  3D2M A;  1M4G A;  1IIC A;  1KUX A;  1YR0 A;  4MY3 A;  5AGE A;  1NE9 A;  5FVJ A;  3P2F A;  1IYK A;  2VEZ A;  2VI7 A;  4MFP A;  5KTD A;  3IGR A;  4R9M A;  3T9Y A;  4BBH A;  3EXN A;  3ZZI A;  1YGH A;  1M4D A;  2B58 A;  4PV6 A;  2BUE A;  1J4J A;  4OLL A;  2B3U A;  1I21 A;  1TIQ A;  2C27 A;  5AG5 A;  2OB0 A;  4U9Y A;  4ONU A;  3S6H A;  2I79 A;  2RC4 A;  2OZU A;  4JJX A;  4UFX A;  1PUA A;  1K4J A;  4F0Y A;  3BJ7 A;  4C7I A;  3EO4 A;  1KUY A;  4KVO E;  2JEV A;  4KOW A;  4AVA A;  3S6G A;  5I0C A;  4MJ8 A;  3EFA A;  4QB9 A;  4HNX B;  3FB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...