3QBDA

3-dehydroquinate synthase (arob) from mycobacterium tuberculosis in complex with nad
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
356
structure length
344
Chain Sequence
APVTVQVAVDPPYPVVIGTGLLDELEDLLADRHKVAVVHQPGLAETAEEIRKRLAGKGVDAHRIEIPDAEAGKDLPVVGFIWEVLGRIGIGRKDALVSLGGGAATDVAGFAAATWLRGVSIVHLPTTLLGMVDAAVGGKTGINTDAGKNLVGAFHQPLAVLVDLATLQTLPRDEMICGMAEVVKAGFIADPVILDLIEADPQAALDPAGDVLPELIRRAITVKAEVVAAELREILNYGHTLGHAIERRERYRWRHGAAVSVGLVFAAELARLAGRLDDATAQRHRTILSSLGLPVSYDPDALPQLLEIMAGVLRFVVLDGLAKPGRMVGPDPGLLVTAYAGVCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3-Dehydroquinate Synthase (aroB) from Mycobacterium tuberculosis in complex with NAD
rcsb
molecule keywords 3-dehydroquinate synthase
molecule tags Lyase
source organism Mycobacterium tuberculosis
total genus 117
structure length 344
sequence length 356
chains with identical sequence B
ec nomenclature ec 4.2.3.4: 3-dehydroquinate synthase.
pdb deposition date 2011-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01761 DHQ_synthase 3-dehydroquinate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 3qbdA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qbdA01
1XAGA 3OX4A 1VLJA 1NVEA 4P53A 1NRXA 1NVBA 3ZOKA 1OJ7A 3ZDRA 2BI4A 1NVFA 5FB3A 2GRUA 3UHJA 1VHDA 4MCAA 4RGQA 5K8CA 3IV7A 3RF7A 1KQ3A 3CLHA 1JPUA 3CE9A 5HVNA 1NUAA 1UJNA 1RRMA 3OWOA 1NR5A 1SG6A 3QBEA 3W5SA 1DQSA 4FR2A 1XALA 1XAIA 1XAHA 3JZDA 2BL4A 1NVAA 2D2XA 1JQAA 1JQ5A 1NVDA 3OKFA 3BFJA 5EKSA 1XAJA 1O2DA 4RFLA 4QGSA 3HL0A 3QBDA 4RGVA 1TA9A 5BR4A
chains in the Genus database with same CATH superfamily
4ENTA 2O8BB 3OMXA 5CYOA 8MHTA 3TXAA 2MR5A 5C18A 1XHFA 2GN9A 2KB0A 4WCFB 5F7ZA 4REQB 2WSIA 4FIDA 3CX6A 3IJEB 4OK3A 1SBCA 1Z2CA 5AQEA 1GUFA 3L0CA 3NB0A 3QNMA 3RBZA 4HRAA 4Q7MB 4LF8B 4G85A 5F33A 4O4JA 2OAEA 3F6BX 4L72A 3V7YA 3D6FA 2PBLA 5I4KA 2G4CA 2B4KA 1TQ6A 2ZYSA 2IYNA 1E5DA 1SK8A 1NVWQ 4IOKA 2M6LA 2UYOA 1GG2A 3IOBA 1HDYA 4IGAA 4MV0A 4DA9A 5KOHB 2IX3A 1NZDA 2XQIA 1X8KA 2CL5A 4B43A 1NVDA 2ZIXB 4L16A 3U40A 3KFVA 5L4NA 2GAIA 2C59A 1OZGA 1YNSA 4TGLA 4Z2YA 2DOKA 2VL7A 1QIDA 3NAGA 4QBTA 2ZVPX 4X8MA 4QM6A 2VJAA 3C24A 1A4RA 1OXTA 3C5EA 3EW7A 4LOAA 4ZT4A 1TT7A 2XUPA 3PUWA 3Q72A 5FT9A 4E14A 1JXOA 2V6IA 3C3KA 4X45A 3AI7A 4DW8A 2ACEA 4INAA 3H84A 1XZMA 3BWDD 1UBUS 2BD0A 5FKJA 4D81A 1BW9A 4WAUA 4FJ2A 3R3XA 4OXXA 4A5SA 4MR8B 1SBTA 2NLOA 1X9GA 4UQLA 3DMDA 2JJYA 4WXYB 4KREA 3G1WA 2AR0A 3X1KA 4FINA 2C9CA 4IQ8A 5AHOA 3SHQA 2IY8A 3MWKA 2PT7A 3RFTA 1HDOA 1W47A 3VUEA 1W44A 4JYZA 2TMYA 3LQKA 4BKPA 3D6JA 4H3HB 1ODJA 2E5WA 3IKMB 3KEMA 3OFVA 2PZJA 5K6AA 3I04A 3CZ9A 4LE1A 1C50A 3QUBA 1NIJA 1U1DA 2CB9A 2HFJA 1H4VB 4IHJB 4NBTA 4X63A 5HKBA 1ZNQO 1D2MA 3NTXA 3FUXA 3A14A 3D59A 1IN4A 5DP2A 4EY6A 3JQCA 3LMKA 2QL9A 4QXPA 1YQUA 2BN4A 4WXEA 1BX1A 4U9IS 3NBYC 5BMVB 2W6NA 3LOQA 2FX3A 3CKKA 1SVKA 2JGAA 3QU7A 1Y5RA 821PA 1H93A 2ZRAA 5I7WA 1DUSA 2XNDD 1DJPA 4NABA 2VBIA 3SOPA 4DJFC 4UXJA 3KWLA 4HAIA 4F4JA 4N76A 4N7MA 1JLLB 4ZYXA 1O4WA 2PWBA 1GT6A 1R3UA 1H94A 2G8LA 1QG2A 2B7LA 5G0SA 1VXOA 2PKWA 3AL3A 3TBFA 3NBFA 3CB2A 3ID6C 4C0HA 1E6WA 4J7UA 2X42A 1BIFA 3RVQA 3SNKA 4OXIA 3GJ3A 4AZ0A 1C8BA 1MNQA 2Q6IA 3B5IA 5KQGA 5DMHA 1A9OA 2RD2A 1H8HA 5ARBA 4CEJB 2XA2A 3ACBA 3DP7A 2XRFA 4ZXFA 5J3JA 1PKEA 2DLCX 2DH6A 4G0PA 2GK6A 3GRCA 4UBIA 3TBHA 4EF6A 2BISA 3IMCA 4LISA 4FCWA 2EQ5A 3FI0A 4RVGA 4TUYA 3IEVA 3RYIA 1KXZA 4JS0A 1WZEA 4YJ2F 3NYRA 2YS6A 3FLAA 3PWTA 1PZEA 5SZIA 1ZWKA 3GVPA 3FTFA 2HSGA 3BA6A 1P6XA 3D2CA 3EA0A 3GGGA 3OE4A 5KSWB 4EUSA 2VH1A 3TZHA 4JA0A 1MA0A 3PEUA 4KGXA 3JQQA 1NLFA 4TMWA 1J7KA 1EP3B 4U7WA 5AOBA 4BE9A 1O6CA 2YMMA 2VHUA 1RPAA 2JKZA 4M8SA 4JR0A 1HSZA 1LUAA 2XF2A 2BR5A 3ET5A 3NBKA 4TSFA 4L6AA 4RPIA 5EEHA 3VNVA 4RZXA 1CX9B 3C1AA 4LJLA 3UV6A 1A9SA 4ETIA 2QROA 3M82A 1BJRE 4FXOA 1CY2A 2ACWA 3NWJA 4W5WA 2C2WA 3MVEA 2B8JA 4AZ3B 1YL6A 1B6RA 2EEPA 2VDPB 3G7SA 3HB4X 4N3BA 3ZZTA 1ST3A 2PXCA 1BMFD 1PQYA 1SD1A 1Y33E 3KEGA 4CMBA 5JI3E 2Z6AA 1YDHA 1S8NA 5C9ZA 1GM5A 1KDZA 3IT0A 1DARA 1K66A 1B8OA 5KYWA 1QDLB 3SDBA 4EG7A 5A4IS 1GR0A 4EVIA 1MEJA 1EUZA 5JH7F 4EDHA 2AJ8A 3IP6A 1L1RA 1LF5A 2XB6A 3OCJA 4ON9A 2W48A 3A7EA 2GTIA 3ADOA 5EJ9A 4I50B 3EISA 3B3FA 4KFRA 1WW3A 2F3QA 1PJZA 1Z36A 1AB5A 2VYND 3A0UA 3O73A 3TZCA 3V00A 2JCSA 3ZDEA 1CQPA 1IVSA 4K03A 3MS4A 1PNVA 4OB6A 3QHPA 5AKJA 3B89A 1W9HA 1KEEB 2WDZA 3G3EA 2QVYX 3HJGA 3QFSA 4HF7A 4ID3A 4QL3A 1OIVA 4WV3A 2HF9A 3GXBA 4DMHA 4ATNA 1ZVKA 2CZQA 4DABA 2JGKA 3A27A 3IAS1 4PFSA 1QM5A 2FSIA 4XOIA 5IH3A 1TPZA 5CYGA 4DV0B 2X8JB 4BMDA 3UG7A 1Z63A 4Z53A 5C4GB 1KVTA 1M1YB 3A6KA 3EZYA 2FZGA 4MVJA 1KJ8A 4DKJA 1XVLA 3JX9A 3RTCA 5LUAA 1L7BA 4UD2A 5A3RA 2D5BA 4WBNF 2WQZA 4OHKA 1DAPA 4RA9A 4EPXA 1BC5A 1UC8A 4HDRB 4L1KA 5FH9A 2Q4DA 2B83A 2QTRA 2P4SA 4HXFB 5KPDA 4FDVA 1KOGA 1XEWY 4OIFA 2VT6A 4MX8A 5BY2A 3STYA 1MHPA 4JKYA 3ROPA 3FUUA 4TV8A 5JWOA 2CLDX 4EMUA 4LV6A 1Z13A 4FVTA 2AUTA 1D9XA 5L45A 4OQYA 3FUVA 4IUBS 4QC2A 2BDEA 5F4ZA 4DCMA 4L07A 4QKQA 3E9CA 4UTXA 2FSVC 3F9CA 2XUZA 3TTUA 4CKBA 4BOYA 4E5NA 1NW4A 2B8NA 4J7CA 1K0FA 4M99A 3SR0A 3WB2A 1GL6A 3EVDA 3GAFA 3WLTA 3DE2X 3CGWA 1SOUA 1VG0B 2QN8A 5DYGA 1AHHA 1VI2A 1Y1TA 1GL9B 3H1AA 3BSSA 2H59A 4UCWA 5ALNA 1BG6A 3UXMA 5BN5A 4WDQA 1CQIA 2A5LA 4NNPA 5EGNA 1GXSA 2ZANA 3PQFA 1GU7A 3H5VA 5AVXA 5E7QA 3GI1A 1ZI9A 2G25A 2IODA 1J00A 1RJFA 1STOA 4EGFA 4R2JA 2GO7A 2J59A 2XUOA 5FUVA 4B4UA 1AZSC 1G66A 3HCDA 1LQ2A 2BMWA 1Y34E 3IT2A 4O4JB 3WIEA 5C8DA 3CWCA 1N7JA 1TEZA 1CR0A 3VSCA 3EG5A 4Z9XA 2UYHA 4FYXA 4MQUA 4RS4A 1Z0ZA 2H1IA 4NYMR 1NGSA 3UM9A 3DKRA 3GUZA 1PS9A 4V0SA 3IPRA 5EJ2A 2CW5A 1MKYA 1EK6A 4ZQBA 3USCS 5AJVB 4DEYA 3J7AC 5DYTA 2W6OA 3OJFA 3V42A 4WI1A 1O8BA 3RFXA 3LPNA 2AV6A 3R5FA 3KJIA 2WZQA 4S1VA 1V6CA 2EBFX 2ZBDA 4A0GA 3H9EO 3WGOA 4M8IA 1SKAA 3V7FA 1LGYA 2PKXA 5JARA 1T6YA 1Z47A 4L51A 5CK5A 2I2BA 2NXEA 3IQEA 4KO2S 1BW9B 3DL7A 1RC0A 3VVBA 3LO5A 1PGOA 1U5CA 1Q16A 3E70C 1UBKS 1S8FA 5DNCA 4LYAA 2JRCA 2PMFA 2XA1A 3L01A 2VWPA 2XH8A 2AMJA 3TEJA 4TT3A 3ZGZA 1P45A 3A4IA 5EL0A 4Z7JA 4E7OA 1Q7RA 1HFWA 5IJXA 1BRMA 2HSEA 5DZSA 2IU3A 4GECA 3W2TA 3AUYA 4RKWA 1PUXA 3LKBA 5EXPA 4YNBA 3RUHA 4QEKA 5DLDA 3ZK9A 4HN9A 3C48A 2WWGA 2ZCUA 1XRNA 1XYYA 2W37A 4RSRA 4X1OA 3TEMA 4R0MA 1XEWX 3I5AA 4BP8A 3L5KA 1CNMA 4YXWA 3X2SA 1XA3A 4S1OA 1NRWA 2OO7A 3IE1A 3IOYA 1Z8HA 2BHNA 1XXLA 2JAHA 2WWTA 4HUQA 4OQPA 4CUJA 3L7LA 4BJ1A 1MB4A 2HN9A 5HM6A 1OMOA 1Z8FA 1TVCA 3D6NB 1QTRA 4R2XA 2Y0DA 3IP7A 2GD1O 3GG9A 2AUMA 2ET6A 4LRTB 1TT5A 3KV1A 4Y8VA 4YCCA 3UHJA 5IDXA 2QX4A 3I2GA 1BHJA 4A92A 4R6XA 1L4HA 2QYHA 2Q7XA 3ABRB 1GZSA 1I6LA 4NK5A 2YC4C 5JS6A 3M89A 4LI3X 2P2ZA 2ZP1A 4TKVB 5DHFA 2R7NA 4RCVA 1IN8A 1GT91 5K4AA 4E94A 4A36A 4D3SA 2ECPA 2XZDA 2ZWPA 2Q2WA 4ZVUA 1A4XA 2AQKA 2VNIA 5KWVA 5CM9C 4L5JA 3PC8A 1J8MF 2WJAA 3GMDA 3LT1A 5F3RA 1FFDA 3G6KA 3TSYA 4Q3AA 4TSFD 1EFKA 5AXCA 4KLZA 4NZOA 4QATA 2FB9A 3RYIB 4P98A 3G0GA 4CLHA 1QHGA 2W42A 3H18A 3VM6A 1PFVA 3BXGA 4RMHA 2EX4A 2VK1A 2ZDQA 3WK8A 2HW8A 2O5VA 4N65A 1UJ6A 1GPKA 1I6KA 1YRQA 2GFIA 2IRWA 5KEIA 1XNRB 2FX5A 4I99A 4DJJA 1JAZA 4W7IA 2LBPA 2OBFA 3PD7A 4O02B 2OB1A 3GMTA 4GMKA 4EUHA 3NV7A 3PRJA 2EHDA 2K4MA 1WABA 3QE0A 4KR6A 2Q5LA 3KL4A 2B1RA 4WZAE 4U7FA 1XXHB 4OV6B 1NVTA 1A95A 3LVBA 3ZGXA 2EZUA 2YV2A 3HHEA 3H11A 4B34A 1A8IA 1E5XA 1TUIA 2VYQA 2VNHA 1E7WA 3ZIDA 1NMZA 4DDMA 2NQ2C 1PR4A 4ZODA 2OOKA 5CYPA 2ASVA 1HLGA 2IW3A 2BHRA 2C94A 2QN9A 2XUHA 3DMTA 5DGXA 3G2MA 1MNAA 2P1DA 3KAPA 1D03A 2FUG1 5KYWB 3BG5A 3HHPA 4EUFA 4IX9A 1O9GA 1HORA 1DDGA 2RJOA 1JQJC 3R9WA 4AO8A 1DUIA 4EECA 4OBXA 1Y6ZA 4NCKA 2QX8A 1MD9A 3FPSA 5LMUB 3ANMA 2VRBA 3QXXA 3HYRA 3SJUA 4MVJD 2IH4A 4JGGA 2FWNA 2ZRGA 4FX2A 2Z6VA 3C14C 4QTTB 2K5UA 2C42A 3G9QA 1BMQA 1GV0A 4D3XA 4O8CA 1NM5A 4LDJA 5FNVA 4DV2B 4BX3A 1NVEA 5IYZB 2ZYHA 3GLHA 4KU4A 4LG1A 4NAHA 4P81A 5JYCA 3WGHA 3VPBA 3AEZA 5JO9A 1HTTA 2HHJA 3C5VA 3TZBA 4B7XA 2AMLA 2BZSA 3QSGA 5F9FA 4NBRA 3D4BA 5H4HA 2HEIA 2FUKA 3JQ8A 5JWHA 3WJ1A 4NOMA 1SCNE 4LJKA 3O0TA 1SVLA 3BXZA 2VPZA 3E82A 4NARA 1L4KA 5L7YA 1JECA 4DIUA 2HA7A 2FDCA 1PVVA 2ZJ2A 1XDZA 1SRQA 2ZG6A 3OLVA 4H1HA 3A9RA 4DANA 4CM9A 3CNHA 4HH4A 4NZPA 3OE7D 4RVNA 1RVDA 4Q1AA 3S6JA 4CI0B 1AS2A 3ZDRA 3DYIA 2IS6A 4RQBA 4RHCA 1XN4A 1PT6A 4UOQA 3IUSA 4I9GA 3LXUX 2WMNB 5DEIA 4UTPA 3FDIA 3WYGA 2MMCA 4M87A 5HE9A 4S0ZA 3FCEA 1OC2A 1ZW6A 3AHGA 1OIXA 5ALDA 2JF0A 4P2BA 1WZNA 3ER6A 3UOWA 1XD9A 2CBGA 4YAFA 3ZW9A 1J1ZA 1POXA 1ZIDA 2UZ1A 1EAYA 4C20A 2VF5X 1WG8A 1V95A 2AN5A 1Y4ZA 2G07A 2Y99A 2ZT7A 1GXSB 3IDAA 3K1YA 3WMGA 4I19A 4PG5A 3Q7PA 2QTAA 2OXIA 3ISTA 5KMGA 2GF0A 4Z9AA 1JIKA 3ZCXA 1N57A 4AN0A 5E6RA 4JIGA 3TJMA 3JAWA 3OZUA 4JC8A 3ANSA 2VCYA 2R1TB 3S68A 3T34A 1B8VA 1VIVA 1UBEA 2SKDA 3I34X 4A26A 4BNYA 4YV1A 4ZHQA 3QW2A 1CVRA 1N8TA 1JT9A 3IPCA 3KOOA 5DBGA 5EZ5A 1I2BA 3AGQA 1EBUA 3DR5A 5ADWA 1PS8A 5PNTA 2Q7DA 5KB3A 3ND9A 1W5BA 5AW8A 1N5OX 3F67A 3F8WA 3G9ZA 4UAUA 1C0LA 1DXOA 3LUJA 4Q0MA 3S5UA 3ZWYA 3U56A 4XD2A 1E62A 4AK9A 2AZMA 3K5PA 3M33A 2VHQA 2LPMA 5F21A 2DJ5A 3MD0A 2VP9A 4GSKA 5H59A 3PT9A 4TT3D 3H6KA 3B9BA 3CLSD 4PWZA 1CB0A 1KR2A 3PA6A 4H0FA 5HCUA 1T6BY 2GYYA 3IEIA 4ZKEA 3H5AA 4ZZ3A 2VUIB 2HY7A 4WCDA 2RH5A 3EQ7A 4H7IA 3IAXA 4CIXA 3X2FA 3AHHA 3ZD6A 4IM7A 2CV2A 3T7AA 1YFJA 1Z6XA 5KQLA 4L76A 4NCBA 2VSOA 3PHCA 5CX4A 4C2TA 3OQ6A 3R9KA 4A0RA 4YV7A 4KE8A 5EJ8A 4O0MA 1N7IA 3HM2A 3RPEA 3SVTA 3TJRA 2GZMA 2J3QA 1QH9A 1FRQA 4UM5A 2YXDA 1DIRA 4L8VA 4QUIA 4IKPA 1ZVJA 2H8GA 3ZWXA 3SI7A 3TGPA 2IGBA 2X4IA 2XWSA 1L4GA 2NTVA 3HBJA 1DIBA 5DWDA 4RJJA 1HKHA 3PGKA 4MYTA 4TMZA 4ES6A 5C1DA 1W4LA 2AG5A 4ZI7F 4K9PA 4K6GA 5FTJA 1B1AA 2ZRFA 4F5YA 4DQXA 3F96A 3GYBA 4JYMA 1SPBS 1KH1A 1YGPA 3ZU2A 4BKMA 1JBEA 1Z3CA 4HUQB 4DYVA 5B64A 4A8TA 1G4HA 2WWHA 4AP9A 1ZU5A 5BR1A 4EVQA 4KUGA 1ZIYA 2QSJA 4B3RB 5G41A 3WJ7A 4MPTA 3OOWA 2PL5A 4ZDKA 1A1VA 1TT5B 3E48A 1QFXA 3ZKWA 4I1SA 3RVSA 3FYSA 1UZAA 1NIPA 5DK4A 2PRYA 3PEWA 5ELMA 3AHCA 3HCBA 2VPTA 4FD2A 1JKJA 2L18A 4AJOA 3RNOA 1RQ7A 3DHYA 1WMBA 2PMEA 4DF3A 3LTEA 2XOKA 4M0LA 3UVEA 3E22B 3F3YA 2V8OA 4P4LA 5FL3A 4ZYTA 3REFA 1NQ5A 4OD0A 1SGWA 1U2PA 4IIUA 2HWXA 1KP9A 1F4VA 2A1UB 1X86B 3GRUA 4NVRA 4Z3DA 3VH3A 4WD3A 2X5XA 4MUMA 4IEFB 4D0LB 2IOQA 1T8WA 3AR2A 3R6DA 4GLFA 5ALLA 5LA6F 5G0TA 4BKQA 4EQ6A 4KQ2A 2FR1A 4G8DA 5LP6F 3H1BA 4GM1A 4AO7A 1R66A 2X41A 1FRNA 1VLMA 4YJ3F 1MEEA 4RZQA 3V4VB 2YV3A 1IPEA 1QKKA 1ZN8A 3R0XA 4YFVA 5D3KA 2PDAA 4KXXA 3DGFC 4RANA 5EVJA 3ETDA 4A03A 1LDBA 1BVUA 1VBKA 4R7TA 2XGJA 3PJGA 3HCAA 2JIQA 2GCIA 3RVDA 3ZVKA 4NXNB 3BJIC 1G9SA 1S8OA 3HVIA 4LWPA 3BSYA 3E9RA 2W9XA 1YHYA 1NW6A 2YN4A 2Q8PA 4ZDJA 2JHPA 3U1TA 4WUVA 1P0FA 3LPLA 5T4BA 3H11B 3WAJA 5JRJA 3P2JA 2ZITA 3GEHA 4LRWA 3K1ZA 2GZRA 2P4QA 1G8GA 2ID8A 4JR1A 2DAPA 4LRXA 1I51A 3NZEA 4M1QA 4V02A 2XODA 3KO8A 3TD6A 3I8OA 2X5OA 2H9IA 2BE7A 5AKKA 3FH0A 2CL0X 2KPOA 3CW9A 4CQJA 3H6HA 1EE2A 3MLBA 1ELOA 1XLTC 1DZ3A 1T1EA 4GLJA 4LHSA 1OAAA 5AVJA 5K99A 4D3ZA 5A2QA 1S89A 3VHXA 2P7IA 3KUCA 4R3UC 4EIWA 3R7NA 3JWHA 2C8VA 1LLUA 4I4LA 3ETGA 4B71A 1X7ZA 1G0OA 4FQ5A 5CITA 1HY3A 2X1VA 5FNVB 2WYOA 3KBBA 4G5QA 5M5BA 1T4MA 4Q00A 1M1ZA 1RWPA 1WZIA 3GLHB 2BIFA 4CM9D 2RHCA 1QAMA 2HOQA 2A0YA 4A8JB 4EYKA 3HXTA 4GOOD 4PXSA 3OZCA 3ND6A 1LTQA 3A4LA 5ALMA 5A5DA 4FR2A 1LZKA 2GQ0A 2OR3A 5DTRA 4Q01A 4RLSA 1PEAA 3TX6A 4B6FA 3DAPA 4Q12A 1PK7A 3JQ8B 5CG2A 3ILHA 1MW8X 1UFOA 1G8AA 4WIAA 5FPTA 3C7CB 1T8YA 4HHEA 4B2PA 4RD4A 4ZT6A 4PO3X 3ZHBA 1D2NA 2EHJA 4J7AA 4YYEA 4Q6BA 2GO1A 5HQTA 1RMYA 3DNFA 4I4NA 5DNAA 4JASB 2IV7A 4BPRA 1CVIA 1KF0A 3GNSA 3I1YA 3HI4A 1PQPA 5HEKA 4QPCA 3E7WA 4HNAB 2OFWA 3LRPA 2Y1XA 3UMBA 1NMXA 4F45A 4FFNA 1KE1A 3WBJA 1KTIA 2ANCA 1G17A 2I1QA 1TK9A 2WJ3A 4GYYA 4KDRA 4LRSB 4YRAA 2GTPA 3JZMA 1Y7LA 1JJBA 4A23A 2X9VA 2A94A 1Z18A 1NTRA 1OY1A 4WPGA 3QMPA 4X00A 4DJ5X 1K4MA 4QDXA 3EQZA 3PCXA 4E6PA 4QUJA 1P9LA 4QG3A 2AK3A 3LLVA 3MERA 4BE7B 3E9YA 3AP2A 2Q3EA 3K9QO 4G84A 2O2GA 4PZUA 2UZ1B 1CUSA 2JJ8A 1RR6A 3NXKA 4INOA 4WY2A 2Q46A 2EJWA 4GSYA 3BRSA 3L4BC 5JFGA 4PF1A 4HNSA 3TYXA 3DBOB 5KMGB 3SZMA 4XWAA 4ARIA 3NT4A 5E6RB 5H02A 4TTQA 4I08A 3JAWB 4R9RA 1GYQA 5FUBA 2HYIC 1Y0BA 5JECA 4TYWA 3M7IA 1NC1A 2GKSA 1VJ0A 2D5AA 2H5EA 1JKMA 2JNWA 1CR6A 1H9AA 1SU8A 1U0TA 2ZRQA 4FNMA 5H5JA 5A0FA 1LWOA 3VOTA 3M9WA 3PNLA 5EQDA 1USUA 3UKJA 5C31A 5FWYB 3J81A 3BREA 3VAYA 5F7JA 3L82B 2CNBA 2G71A 1R5JA 1Z6AA 2XIJA 1UP4A 4RKFA 2QI9C 1DFGA 4K05A 3RWOA 1G9XA 2HADA 1AQUA 2JARA 2JFUA 5CDFA 5HP4A 3OJWA 5AOAA 4BVAA 5B4VA 3CTMA 4J0FA 4KK3A 3CEHA 2E9SA 4C3OB 4FM9A 3ZWBA 1QV6A 1YRBA 2VVTA 1JS1X 4YMLA 2P5YA 3P9SA 2W83A 1W5AA 2P6OA 3FPEA 3VJLA 3Q7IA 3WL3A 4YCAA 3N07A 1ULTA 2ZSKA 1W6RA 4OB8A 3KXLA 4GEGA 1YU6A 1Z25A 3FTNA 4EARA 5AVSA 5JMOA 5JAZA 4GAEA 2RKBA 2LW7A 1EWRA 2YJNA 2A5DA 4M83A 5CX1A 1SCIA 1YS2X 4KN8A 3F71A 4TL8A 3NS7A 4KE7A 2OE2A 5IBCA 1W36D 4ZC8A 1ECPA 3QU5A 1WF6A 2O1WA 3F97A 3R6TA 4ZCSA 1CB7A 2HJGA 4MUNA 3LQFA 4PFQA 4E5MA 1Z34A 3M4NA 4HZUA 4EGCB 2IEDA 4WLOA 4RK1A 1C7JA 3TKAA 1B8UA 4RHUA 4QYWA 4OI4A 1UKEA 1JPVA 3RVPA 4EI9A 2NXCA 1ZD1A 2YZGA 3IALA 2NP7A 1KEUA 4K9LA 1S4QA 5ILOA 3LXRA 3OA2A 4JI1B 2PS0A 3VR5A 1EUDA 3ZGVA 2ZIUB 4ZO9A 2VTDA 4N1AA 2XOKD 2OHJA 2VP4A 1UDAA 1G7SA 5DO9A 4UHBA 1UK8A 2RH8A 4HYEA 5CCXA 4LJ8A 4RTPA 3V1UA 2R8RA 3H0KA 1SA0A 4G09A 2OYCA 1NQAO 3WYDA 2OWDA 4BVFA 4C1NA 1KQGA 4YCDA 3Q3CA 4LVOA 1L4LA 1ORTA 4U2BA 1JKJB 1PTJA 2FLVA 5GP1A 1Q6ZA 3SLKA 4L6IA 2P8SA 4HDOB 4YUYA 3NHYA 1Z75A 1SXQA 2X86A 4M55A 3TB6A 1DLIA 1JDVA 3L40A 4FBMA 2BC9A 2Z5FA 4OH7A 2FQ1A 4RHEA 2I6XA 1GGVA 5BRAA 2P5SA 1PWYE 2PBFA 4AF6A 4C1BA 4UBLA 1CUDA 3KVVA 1L0BA 4ZQGA 1YT5A 3L8FA 3M3DA 4FKZA 4IIVA 4BV2A 3FGOA 1RXVA 2QGZA 1J09A 2FFBA 3WK7A 5CB0A 3OCUA 5EHIA 5FR2A 3JY6A 1D7AA 1CRZA 1R6BX 3ETLA 2ZI4A 1ZM9A 4WCFC 3VSAA 2IEGA 3HB5X 3IBGA 3DWGA 3ODPA 2C3MA 4G5FA 3TTSA 2CHEA 5JD4A 5KTTA 3QLVA 2VYFA 1OVMA 2M2IA 2DFLA 4W7HA 5AP9A 5AM5A 2A1IA 3OP4A 4PIPA 3EODA 4GPTA 5CT4A 1R6DA 4URZR 5EP1A 4KKXB 4AF8A 2VSNA 1NSFA 3P0HA 3CSDA 5IF9A 1UPCA 2D1TA 1XTRA 2Z2ZA 1LD3A 1G21E 4Y6SA 3TLBA 1RJWA 2IOHA 1AS0A 4ZV7A 5LYJA 4DPKA 5LPNA 3L0SA 3AUFA 3IJRA 1VIAA 1GNVA 3GFRA 4UHEA 2FPPA 2AI2A 4NTZA 1ESDA 1N8KA 2YQZA 3SDZA 2OT3B 1EWQA 1AKEA 1N0WA 5CVUA 2N47A 2BL4A 2D1YA 2YR0A 4RK0A 2JLZA 3KNZA 3L7JA 1XKQA 1GU0A 4NBLA 3R0QA 3FCSB 4F56A 4WZ6A 3PSHA 5AO9A 4DSUA 1C4KA 1BFDA 1PNQA 3OEED 3E81A 3V2GA 1B23P 3OBBA 3QF7A 2YHUA 2LDBA 2G9QA 1TD9A 4UNPA 1OZ0A 1P6QA 1E58A 2C95A 1E0SA 3S1AA 3VHXB 1GPH1 5DNEA 5IBQA 4HEA6 3RTGA 1PIWA 1W19A 1ZCJA 1WW2A 4HX9A 1UT6A 1TUGA 1X7ZB 3AJ8A 1GGMA 1GZ5A 1PT9A 1ZX1A 2VJKA 4EABA 4IG4A 5ITWA 4J0DA 4UATA 3OICA 1C81A 4ZVOA 3P4UA 5ITZB 4MV4A 1RPJA 4IV8A 2X1HA 1NNEA 3NKLA 3SHWA 3O8DA 3S0JA 4RU1A 3GL9A 1MORA 3AW8A 1FFXA 2JCBA 1D2AA 1PQUA 2KMLA 4KE9A 3DMGA 3SQMA 5K05A 1LSSA 1V2GA 5AJTA 4EJSA 1SZDA 1XD8A 3B6ZA 4C6TA 1BD4A 5DHAA 3ZXYA 2CUTA 1KEZA 1E1QD 1L3IA 2R68A 3GCXA 4TMYA 4NV3A 5FJIA 3B3JA 2WV9A 4XR4A 3B1FA 1W1WA 4GR9A 4I3HA 4MVJI 5T4FA 2TS1A 1KJWA 4ND5A 1P4AA 3IV9A 2D0OB 3R1IA 3C85A 2GDJA 1ZS9A 4C78A 1NI4B 4FONA 1PR2A 1YA8A 2HXYA 3BDAA 3M49A 1RRVA 2DWOA 3NU1A 3O3OB 2G6BA 3NANA 2XMSA 2LDXA 4BNXA 2VO1A 1WB9A 5AH0A 3WS7A 1DGQA 5TLSA 6LDHA 1ZR2A 4ZC1A 3EGCA 3F9RA 1ZESA 4N9QA 2BKUA 2F1HA 2FN8A 1WAMA 2VHTA 1VL0A 4OHMA 3ANNA 5IBRA 4A2PA 3K72B 2IHTA 3PGVA 3E27A 4JK3A 1WE2A 1D9ZA 1YQTA 5CRIA 3ZBTA 5NULA 2HMYB 1VCNA 2XD9A 4DHEA 5FV4A 1R0ZA 4EZBA 4R2LA 1IZYA 1OFVA 1IN6A 1T8PA 4P7GA 3DDWA 4H0CA 4RBNA 3FZYA 3T54A 2QN3A 2WF7A 2TRSB 2EFDB 4AKIA 4JDPA 4IWYA 2Z83A 1P31A 5AFSA 4EF5A 3ER8A 3ZV6A 4UW9A 5AICA 1MVOA 2AYYA 3KUXA 2HEGA 4TWRA 3BQ9A 4GBJA 1F0KA 2QPAA 3WTBA 3VZQA 5KTPA 1XQ1A 3ZVRA 4KQ9A 1AURA 1FSGA 5FADA 3QMVA 2CT8A 3COWA 3MWJA 3OUTA 2Y1CA 1UDWA 2XTNA 4NLLA 2ZB7A 3OC0A 1PV4A 1Y98A 4MUBA 4B3CA 1Z22A 3TZKA 5D6NA 3KETA 2YHBA 1AX9A 1YJ8A 2VIIA 2FMKA 2JPDA 3PGLA 2IVZA 4B3HA 1PDVA 1W4RA 3OZTA 2QJTA 4IKEA 3IDOA 4KTVE 3FPLA 3Q6MA 4AJLA 2GDZA 1EFVA 4XSVA 1KQNA 3C5WP 2EGGA 1D8AA 3V6MA 1F48A 1YNOA 3AL0C 1G3MA 2AFHE 2IF0A 3AW9A 1WB4A 3AEQA 4KHZA 4LJ7A 4WKNA 2UYGA 3LCCA 4O4IA 2V0CA 2VLBA 3IP8A 1QHNA 1WP9A 4UAJA 4NS1A 2NVUA 2WWFA 2AFIE 4NFYA 2I3BA 4LJ9A 3BQMB 1VLLA 2BZGA 4WNAB 1DTSA 4HLUC 4IVQA 1GRRA 3WDMA 4U39A 4JEMA 1H2BA 4NBWA 3N5KA 2YVUA 3VR5D 4ML3A 2CWDA 1M6WA 1N9GA 5JRZA 2HRBA 1CF2O 5CGZA 3BULA 1ORHA 3A9UA 2HT6A 4FMDB 3LRTA 5P21A 1E94E 4MYDA 4ZRMA 4AP6A 4GKKB 5FA6A 1UPUA 4HZUB 2D8AA 4OGKA 1GUYA 2BDUA 2FOLA 2VJNA 3WVNA 1PBNA 2PT5A 3GIDA 1QWSA 3O2QB 4GPEA 3OFJA 4ZHSA 1VPLA 4HTAA 1G98A 2FZEA 1JLKA 2P0AA 3ZXUB 4N5HX 1S96A 1RAGA 5FNZA 1I01A 1JJ7A 2O7QA 1EUDB 4QUKA 2P4UA 3IOMA 1K2VN 3A1VA 3R3VA 4DJEC 2G08A 1T4DA 1QE3A 2F1KA 4DXAA 5JJKA 2ES4A 3UJDA 2FR8A 4G5YA 4F6RA 4JX9A 3G0OA 2P3OA 3T6KA 5HFAA 3UBMA 2P6RA 2VXYA 4XJXA 2WMOB 2IH5A 1BKYA 4BFTA 1DC6A 2BEJA 1JHYA 1K5DA 1N2BA 3LHDA 1N34B 2OCAA 2QJFA 1ND5A 5CNKA 1FP4A 1KKUA 1ZSNA 2CLOB 3MTAA 4YUWA 4B3FX 3IEMA 3CZAA 3QBEA 1YDEA 4HPXB 3TDMA 2IPAB 2FWIA 4UC0A 5IKMA 2GLXA 4EX6A 4WNYA 4KWCA 1X14A 4OOEA 1FRFS 4KAXA 5EIEA 5IU6A 3MJSA 3U7QB 1GSOA 1TECE 4FE4A 4YH1A 1A69A 5KTSA 5JFTA 2PQ0A 2ZYVX 4CDGA 3KOUA 2ZB3A 2NN3C 3KHUA 1C1XA 3VC2A 2YWBA 1R0XA 1Y7IA 5IEBA 4NH0A 1TQDA 1YS7A 1C41A 3PIIA 4H15A 1N2SA 4OEHA 4BVBA 5L3VA 2PXAA 1GO2A 5E1MA 1EWYA 1G6OA 1XZCA 2W8BA 4PC7A 4BRZA 5LP1A 5LU8A 5AI8A 3WWZA 3ZY2A 5A4FS 3LTNC 4MRPA 1MHTA 1GVHA 3SY8A 2V4UA 3BWVA 2G63A 3SR3A 2J31A 4GM0A 1FDTA 3EXIA 1BXRA 3E7PA 2Z04A 4Y6RA 5JXHA 4ODIA 1NVVQ 3IYLW 3D1JA 3DZBA 3ORYA 3U5TA 4PC2A 4M0EA 4CL3A 5KVCA 1EDOA 4Y2UA 1PO7A 3R3ZA 4W63A 5C8XA 3QVKA 3N8HA 2ZVDA 4YY3B 2FPPB 1GVNB 1IYZA 1I36A 4F0JA 1WTAA 5JE8A 5IHXA 1D2CA 1TFRA 3PEFA 2Q9AA 3IHKA 1UC4B 2AE1A 1Y8ZA 1ISPA 1M72A 1WPGA 4AU1A 5KOJB 1NVXQ 1X1TA 3PTLA 1OROA 1P2GA 1WVMA 2I62A 1C3OA 2V1UA 1FVFA 4UEKA 5EIBC 3QXSA 1MJ5A 1NFRA 4W8OA 3VR2A 4H17A 4XA8A 1KO5A 1Z62A 3S1AB 4ZXPA 1M6YA 3EIEA 4J0IA 4HRYA 5EIAA 2A4MA 4Z3OA 2NU9A 2E49A 3NWPA 5AVVA 2R65A 5FI5A 4QGGA 3ICCA 4R5MA 2QP9X 3B6KA 5K3SA 1DEAA 3K4QA 3VYUB 9ATCA 5JQGF 1R2QA 3AB3A 1VG9B 1ODLA 3B7PA 4EYGA 3QPUA 1HG1A 3PPXA 1DDOA 1FFXB 3TR0A 3V34A 4ALLA 4IJKA 1RWKA 1VHDA 2TMKA 1AKVA 4ZA2A 4IY1A 4NE9A 1KMNA 4P92A 3OBIA 4L78A 4DC1A 4GMDA 4C6TB 4EJSB 3F5MA 4J94A 5IXSA 1P5RA 3VFDA 1IM8A 2VWGA 4NDAA 4S04A 4H1TA 4OUKX 3UW3A 1A71A 1PFQA 5DBFA 2XB9A 4TS9A 1BVHA 5FO0A 4I2VA 1Q84A 1YR2A 4QT4A 3NALA 4PEVA 5B6PA 1WMDA 4R8VA 1IUOA 4NEGA 1E2PA 3IUQA 4IIYA 4IP0A 4YP7A 2YIJA 2GN4A 5ALSA 1I3KA 3RHZA 1G16A 4MI1A 4CF5A 2FG7C 3SFZA 4D9KA 1N75A 2GRUA 1W9MA 2J9FB 1YB7A 4MW4A 4ZO8A 4B40A 5JSFA 3LBIA 1RAFA 2D2EA 2VF4X 2FETA 4XASA 3M3PA 3HBAA 2FOXA 3DE4X 3RASA 4C0SA 2GSWA 2KS6A 4P33A 2J46A 4PU0A 1Y7HA 4A1FA 2HU8A 5FQNA 1BGXT 1JG2A 3R0VA 1AHNA 3F2VA 4HX5A 3GEBA 4ZAYA 3HCCA 5DN9A 5FUWA 1HX7A 1SQFA 3ZGLA 1NC3A 2I3DA 3Q3JB 1QO7A 3FNHA 4QSMA 1RKQA 2FHPA 1GA4A 2P11A 2A92A 1Q57A 4GZ6A 3UB2A 3ES9A 2QTFA 1Z5VA 4QU9A 5A1JA 3MN1A 1U2ZA 3ROXA 2FEPA 3EWIA 3FW1A 3I9V6 3MCAA 5JDIC 4RCZA 5LBIA 5BWBA 4UTNA 3JWEA 3CSSA 3W7BA 4NI5A 4B3JA 2FZ4A 1S6YA 5LQRA 1H2AS 3RSLA 1SUEA 1B1CA 5IN5A 1CULC 1EX7A 1QJCA 1UINA 3D0QA 4YEDA 3H7AA 3SYMA 4E21A 4ZTUB 4MMXB 1PWXA 3AVQA 3G2KA 3B3AA 4BO7A 4HGYA 1IM5A 4X5OA 4YCSA 2H29A 3UMCA 3VDRA 2F6RA 2JFYA 4WA7A 3ZNNA 3ZDZB 3RVMA 5F7XA 2NU6B 4KIUA 3N8DA 1A76A 2M1XA 3SBDA 3W4KA 3JPWA 1LY1A 5I3CA 4KR7A 1DB3A 1XYVA 1EFVB 1T2FA 3LCJA 1C7RA 2N42A 2VSYA 1NBIA 3EPPA 3MJ4A 3GO4A 4V0QA 5D5PA 5KDOA 2B5VA 3STXA 1BMDA 2JAPA 5K3FB 3AEQB 3OY2A 4O4IB 3AHJA 3BDVA 1SHKA 4GR4A 4WKPA 4AC9A 4UCXA 3GQBA 5KNDH 2NVUB 2GPNA 3ZPXA 1ZGCA 2PR2A 2XDQB 4A6PA 1KFJB 1QG6A 1QO0A 3ULKA 5LQSA 3K4HA 2R4TA 3W3AH 2O8DA 3NTLA 3WKDA 1N9GB 1MABA 4DYHA 3MBIA 4MAFA 4RV5A 2NO4A 1S7GA 1XALA 1IIRA 1REQA 4MIOA 1Z0KA 5B57C 1G3IA 4OP2A 1GPMA 4UZFA 3OHMA 4LSMA 3H5IA 4CUZA 2EZTA 1DV2A 4AKHA 1GEGA 4PYOA 1AO0A 3ZDDA 4XB1A 3EVEA 3FCYA 5J47A 1QCCA 1M34E 3AKYA 2BMAA 1H05A 3D4LA 3K15A 2RK3A 2MWMA 2F3UA 5K0GA 1KPIA 5AIBA 5AW5A 2OESA 3GBVA 1NXWA 3ZHUA 3SSAA 3ASYA 1KY4A 1CJBA 3LZ6A 3F4BA 2X14A 4YMTA 4MKZA 4MV6A 5C3UA 4KLNA 4D4GA 2CNLA 1DINA 3UTCA 4CM4A 3PWSA 4FFSA 4D9IA 3ND7A 2HQ1A 3P5SA 5AI6A 4KQKA 2PAFA 1LDYA 4DCVA 1DAOA 1WXGA 2OVFA 4K3UA 1FP4B 1JPNA 3R5XA 4FHDA 4I1UA 4P6VF 3LECA 3RT7A 4ALJA 1BWSA 1RBMA 4R7GA 1YZQA 6YASA 3E35A 5GGYA 2D1SA 3O8OA 3LFTA 3TQOA 1TL7C 4BLUA 1MX9A 4N41A 1A2OA 1O6BA 3DXXA 1ZSVA 2ZYWX 3GMSA 5ILGA 4QBIA 5TV2A 1TGVA 4BQRA 3KKZA 4E6EA 1SUPA 2RGAA 1U6JA 2OHOA 4AY5A 4DC0A 1YRWA 3ZLJA 4OHWA 1X7XB 3COVA 4GKJB 1ZWLA 2CVPA 4HX2A 2IXFA 3KSMA 3O4HA 3ZHYA 2ZKLA 3KLPX 4IJWA 4ENPA 5KNCH 1X80A 4FEGA 4ZT5A 1J5PA 3Q9LA 2YV1A 4U5QA 3T41A 5F2KA 4YJ2A 2HLNA 2YICA 5IJAA 3KTDA 1HE5A 3HA2A 4KPUB 4YECA 1XP8A 2UKDA 3AWDA 3I58A 1XR3A 4E5PA 2EJBA 3A11A 3EXIB 1BXRB 2C92A 2JFPA 3N58A 3PQ2A 4RETA 4HB0A 4TLEA 3NTUA 4YUVA 2NV2B 5HR5A 4R2IA 3FR7A 1E2UA 3UICA 3VR2D 1H22A 3I4FA 3LWNA 4ZP1A 3X1DA 3NTOA 5HTKA 2YUTA 4CE6A 2DBQA 1JFFB 2EX0A 2QIPA 3EIUA 4W9NA 1Y1LA 2FWPA 3COSA 3LYUA 2VUHB 4IIGA 4DV1B 1XZHA 4JEIA 4V38A 2YFKA 4GRDA 1VRWA 4WCVA 3TZLA 5INTA 1DHRA 3AHIA 1CFJA 1JIJA 1WULS 5KIAA 1XAHA 1C3OB 1QPBA 3FA2A 4HYTA 2JI6A 1WHSA 3AU9A 3CW8X 3NRJA 1II0A 1S7CA 3ABOB 3QLTA 3ICOA 4FI3C 3G5AA 5JH7A 4N49A 2BLNA 3V6LA 3WC4A 1JXAA 4Z3KA 4DR5B 4WASA 1Q11A 3HY6A 1GQYA 3MW8A 1CQJB 2YJTD 2RC6A 2XVAA 2HMWA 3WR5A 4BO0A 1BHQ1 1R4AA 3MAGA 3WIDA 5FOQA 1UMKA 5JPCA 1Z56C 4QWWA 3W8NA 4EYQA 2QBYA 1A5BB 3D8TA 3E23A 5AM3A 3FMPB 2YIVX 1ZH4A 4LZOA 1J0DA 4QPZA 5CDUA 4C05A 1C9JA 2PH7A 4H1WA 4WLFA 3K9CA 1QZXA 3HLTA 3Q9NA 4MGIR 4PIMA 1U0HC 4QQNA 4BE4A 4D0NA 2NT4A 2XYVA 4PYJA 1BZYA 3HH8A 4OLHA 4ALNA 4AXBA 5KUTA 2I7XA 2NUPA 4CHGA 2QTLA 3PUHA 2ZTMA 3I1IA 4JLBA 4GS5A 1Q0SA 3EEYA 3GARA 3J80A 2X0RA 2VDKB 1Y9DA 3C7AA 2CXUA 2ZAMA 2IZ0A 1AK1A 3IRVA 1GPNA 4PQYA 2LZ0A 3QEJA 1RRFA 4UPVA 4MA5A 4Y1EA 1D0IA 4LV5B 4A9AA 4RNDB 4E1BA 5CLFA 3BX1A 1EWTA 4LGYA 3I5YA 1ZMBA 2WFZA 1Q2XA 1Z4PX 1D7OA 1HXHA 3EG9A 1CHNA 1TO6A 4YCBA 5BVHA 2IIQA 4UVHA 3TVYA 1EQAA 1JW9B 3C6YA 3DO5A 4FYPA 3WK4A 1XQVA 5ALZA 1Z33A 3W4JA 3PLRA 3QUAA 3FTEA 2HB6A 4TZ0A 1FJHA 3ND8A 3HFRA 2RC5A 4NICA 3GAAA 3K0FA 4M89A 3WMFA 4Q7EA 1SHUX 3QXGA 4XPIB 1W581 2WI8A 4IAOA 2BGLA 1J56A 4Y67A 5EHNA 2QX7A 3KXIA 2W8ZA 3A6HA 4RD3A 1KQOA 4WTOA 1QUFA 1TUBB 1J24A 4PLPA 3H99A 4V3BA 5KSOA 4X66B 3T7DA 2PH5A 5D5QA 1TMYA 4WZAA 5I9IA 4Q5IA 4MICA 3VBCA 3GLFE 3DS8A 4YS6A 4OMDA 4XJSA 4GOND 5AK3A 1HOTA 1RLIA 4QYXA 1XCLA 4TS4A 3ROMA 1KAOA 2GHIA 2CNNA 2B2XA 1QGAA 1ITZA 2E82A 3B6MA 4F1WA 3DKPA 4U8HA 5BWMA 1DBQA 2P0YA 5M29A 1RYDA 3DB2A 1E2EA 3Q7EA 1IY0A 2R86A 2VK2A 2X8LA 4P5DA 2JFQA 3KSZO 3B1XA 4PAWA 5G0VA 4FK8A 4UTRA 1RHJA 2CXSA 1D6MA 1T25A 2O0LA 1SM4A 1LJ8A 3MUEA 3ZCTA 1KO8A 2FGKA 1YAJA 1QRUA 3AQIA 4YO7A 4JQYA 3TQTA 4O3MA 5ICGA 3DMTC 3RFVA 1KFCB 4M53A 4N12A 1EIZA 1WRBA 2OB2A 4GXNA 5FEMA 5HMMA 6REQB 1F6DA 3ZGYA 4DR6B 3BD7A 4OHRA 1QLJA 4B31A 1T3TA 4MWOA 5C51B 2DR2A 4E4YA 1CIJA 4TQAA 1FNDA 3LAWA 4HAYA 2GPSA 3S27A 5KJ6A 1MA3A 4OSOA 1QVZA 3EPKA 3C6QA 4TVSA 3HN6A 3PUYA 1K88A 2COUA 3OURA 5DOVA 1M8JA 1IZ0A 1QHXA 4C0JA 4MEBA 4JI7B 2VQ3A 4W5HA 4EITA 1XZQA 1KRHA 1T43A 3GLQA 4CV3A 4LDRA 4HYYA 3KU4A 4JEHA 2AZ4A 5FHQA 4IDGA 4MS1A 1GYPA 4Y2SA 5CDGA 2XUIA 1T3HA 5JSYA 1W85B 1G1AA 2MJLA 3GDFA 3EXG1 3ZXXA 4A8JC 4RFSB 2FEOA 3IMKA 1NKTA 3C87A 3OESA 2SECE 4L2IA 4PZDA 4F3NA 1CERA 1GNTA 1U1GA 2VG8A 4HWKA 3T7JA 5C4MA 2I76A 4GMXA 1NG1A 4I36A 2H1RA 3WK6A 2NO9A 1GL7A 3A05A 4FT4A 4RF4A 1YSCA 3GGDA 4XVHA 1FMJA 2AI3A 4GLLA 3ELDA 1EXDA 1NWCA 4PM4A 5HX7A 3ZWDA 2RG1A 5BT8A 3IR5A 1VKZA 3K1JA 5C4IA 1WB6A 2YOFA 4ZN6A 3MHTA 1GZ3A 1KAGA 1WTCA 2JI8A 5BQ3A 1PJTA 3A70A 3N70A 2WU8A 4FHGA 2Q28A 4HAOA 2MSCB 2WD9A 4KXQA 4XIJA 2DPGA 4LPKA 3TN7A 2EIHA 3KTAA 4XGRA 3W5AA 4OX9Y 1PG5A 4FLMA 4I1OA 1CUBA 1XIVA 1U94A 3E9MA 3IDQA 3LBYA 2HLHA 1BE1A 1NUTA 2ZSUA 3LGXA 2QSZA 1QZTA 1MOSA 5GVSA 1OX5A 4N18A 4JI2B 2NX2A 4RIFA 4JHLA 3CJRA 5ESXA 1Z07A 4II2A 4EPWA 2PQ6A 5CBPB 3JZDA 1T10A 5ICSA 1IB0A 1E0KA 4ERXA 5FPKA 3OWXA 4YJ2B 1Y3AA 4G1EB 1VI5A 1YCFA 4HPWA 4AFNA 2A4KA 1PDOA 1DX6A 1QYDA 2GAAA 2RBGA 2FUEA 3UENA 1M1NB 3R76A 4U7DA 2WFLB 1YJQA 3AHFA 4QDUA 3ENWA 2QP4A 1YIOA 1J2YA 1GUZA 3PFBA 2D2VA 1MFPA 2IYSA 2RHMA 1P2SA 2VHEA 3AJEA 3A7DA 3TNYA 1Y1PA 2ONZA 1NN5A 3AR7A 5AXBA 4BFLA 5C0OE 3WYCA 4G0UA 1XPJA 3DBVO 4IGFA 2J6IA 3QH4A 4JBHA 2Q45A 1QVWA 4QYTA 2UXDB 4KYVA 4XFDA 2WQ6A 3UGQA 2Y0EA 2Z2XA 4FFPA 2QG4A 2HD4A 2P90A 3RQIA 5A06A 1QANA 3TMYA 5BORA 1DOAA 2DYKA 1ZBQA 3NQ41 3R5HA 3ERCA 4LMPA 4OGGA 2ZRJA 3CXRA 4IICA 5IVIA 3T61A 5FULA 3LY5A 4RUKA 1CY4A 1Y9ZA 3TRKA 2JZNA 4OQFA 3ITEA 1EVJA 1WHSB 3KU1A 5KSZA 5CD1A 2CHGA 3HDVA 1J49A 4O8ZA 3B2EA 3KT0A 3OQBA 5C1OA 2QD1A 5JH7B 3FB4A 3VSEA 4YT4A 1T4BA 4NY1A 1DBSA 4I46A 1DPFA 3PZBA 4QU0A 4TOIA 2V03A 1N6RA 2I7TA 3QYJA 3U9LA 4HYQA 1I5EA 1L7XA 2AJBA 1R18A 2IXGA 3CCCA 2BTEA 1OQAA 3EF1A 1FTQA 3GEMA 4DL9A 2TSYB 1ZJ6A 4OM7A 3HK2A 2VR1A 2R5NA 4MYCA 1G2QA 1OILA 1UBFA 1BDJA 4O2BF 3LL4A 4JL6A 4PPNA 4EHFA 2QB5A 2Z1MA 4GF5A 2XV1A 3IURA 4PZ0A 1VIYA 2GYWA 1Y9EA 3DOCA 4OM8A 5HZKA 3LX8A 1OPXA 3KL2A 5FA5A 4TKZA 4FR5A 4QG7A 4YREA 3T0GA 4IJ6A 4GVLA 1SBYA 3UMSA 5AVWA 3G8YA 4ESHA 3K96A 4MGYR 4XOUA 1O0CA 1WEKA 4ME6A 3BKXA 5ALWA 4JNKA 5JC8A 4WBNB 1IOVA 3STTA 2AOXA 1IVNA 1ZCAA 4EHHA 4F71A 4BMVA 2AKAB 2IW1A 3WNBA 4WXMA 1YS9A 3KZCA 5EEGA 1CS0A 1FYXA 2J3MA 3TH5A 4H59A 5IJZA 3HP7A 2ZYRA 5AQ1A 1LK5A 2PD3A 5EIOA 5A5VA 4QARA 1KI9A 3JQDA 4NBUA 2FV8A 4FDLA 4PO1A 3QVUA 1U8YA 3EG9B 2EF1A 4HVAA 5DNYB 3NHSA 1J7JA 4DCJA 4DJTA 1COWA 1VHWA 4X61A 3T15A 1NVMB 3OM8A 2X6RA 1W0JA 2PMKA 1E3MA 1IDN1 3K0FB 4NU5A 3BERA 1W2WB 4RGQA 3K6JA 3QXCA 4EFMA 5BR7A 3V4RA 4DJDC 4DDHA 5L6LB 4QXOA 3QFFA 3TR6A 1ZOSA 2WG2A 3MRSA 1IMOA 2WW8A 3ZH2A 4QNRA 4W5QA 4LNAA 1HBJA 3ZU5A 2PZ8A 1LSUA 1OLSA 1SC1A 5ENDA 1IBSA 3PIDA 1YDWA 3JYQA 1VLVA 5DOZA 1GGNA 3ONVA 2GETA 2WKWA 1JDJA 4JOSA 2XB4A 4DQVA 4CXMA 3AFHA 4RVHA 1QGDA 1XYGA 3VU8A 1W46A 1UJ5A 2DH5A 3WRVA 1U2GC 2WVHA 4TS1A 2X0DA 3VXKA 4BO1A 4I14A 1H2ZA 2UU9B 4ENUA 4IVRA 4BEBA 4FPXA 1IXRC 3KUDA 2MCFA 2JB9A 3NEJA 2Q6VA 4PZEA 3A1UA 2CXOA 3MWFA 1SVNA 4XTRA 4ZCQA 3ZVMA 3A3PA 4YJDA 1E7SA 1YE3A 1I10A 3OMWA 4QEZA 4JIMA 2BKVA 3OTIA 4MUHA 3M3HA 4R1OA 4OFWA 2VTBA 3TW6A 2RAFA 2I4RA 5GJCA 1T6XA 1ZUWA 3IV6A 4MR9A 4QFCA 1RLJA 2B1GA 3UXHA 2FF7A 2GESA 1FU7A 4HT3B 3IQGX 2ID9A 2A5YB 3FHCB 1EGAA 1OT3A 3VV3A 2WHXA 1XTUA 2HJRA 1G7CA 4CBVA 3ITKA 4TYQA 5L3RA 4NH4A 1YQEA 1ZZEA 4CLEA 3CZ5A 4W1QA 5FLYA 4C14A 2WF6A 3G8CA 3GVXA 4AUNA 2J0SA 3SEQA 4PTLA 4MS1B 2QUKA 2MIIA 2CYBA 2NTNA 3Q1KA 3ZWQA 1Y7TA 2DULA 1OHHD 2ZSFA 3NCHA 3D3JA 3OZFA 3TVDA 5KWSA 5K09A 1MT3A 4KO8A 1Q0UA 4GVPA 1Z74A 4L2IB 1N2HA 3OJEA 4MPRA 3FNEA 3A10A 1MOPA 3UT5A 3EQ2A 4AMYA 4LWOA 4BTEA 3LC7O 4RVCA 2AZXA 1W1IA 5EY5B 8LDHA 3AUUA 3F8SA 4JBIA 5EINA 5K8LA 2O8EB 1RTKA 1Y42X 1Q14A 4HGPA 4ZARA 3SFTA 1YVRA 5JJBA 3N74A 3R6LA 4ZMSA 2VQSA 3LA8A 3A0RB 1NTOA 1KIAA 2P65A 1T9KA 3QX7A 5E6SA 4C0AC 3GQVA 4TTRA 4Y9RA 2O20A 3KQYA 2N75A 3LJKA 3W78A 4PQGA 2H7XA 5LNK6 1MF7A 3QF4A 1LRJA 4KXYA 4ZVTA 1LS6A 3GA0A 1I4EB 4YCJA 1EK2A 1H1LA 2DLDA 5IABA 1X7WA 4OHZA 4ZK2A 3R8CA 3KQPA 3IA2A 4TN5A 4ECAA 4YCLA 4ZPXA 2L2QA 3DDUA 3KZVA 3JQEA 3FUTA 4URWR 4NMXB 2IYPA 3F6SA 3I01M 5EXTA 5CB4F 2D7CA 2I3AA 1CR4A 4Y6PA 1W4BA 2ZATA 3A2LA 5D85A 4J1SA 1CP2A 1KP2A 3TTTA 4BAZA 4QWMA 3GLVA 4H4CA 4X90A 2ZWOA 1NJSA 2H9AA 1PJBA 2ETVA 2I33A 5AK6A 3M9XA 3OZSA 3S2SA 2OAGA 4UMVA 1TTHA 1ZGHA 4YJ3A 4OA8A 2O52A 3LC1O 4BO4A 3VU1A 3BIWA 2B61A 3GGPA 5HKKD 3I61A 2Y92A 1VHTA 2OV4A 3OLXA 4HEA1 4KNWA 3VU9A 3KV3O 1YJ5A 1LVUA 2AZTA 3HEBA 1U8CB 1YMQA 1ZJ4A 4NAUA 3WLKX 3HUDA 1ZC3A 4KV9A 1H6CA 4ONEA 2DWQA 3LY8A 5DGDA 3RFCA 4NNOA 3UC9A 5A0TA 3UF0A 5DSTA 4YRKA 1OH8A 4YRTA 1ABEA 2PN1A 1J6UA 5FLKA 3ESQA 2YASA 1WUTA 2VTVA 1OAOA 3OVMA 2CDBA 1UPAA 4LK3A 5K5EA 4MDEA 3SJCA 4TMVA 1V39A 1JFVA 1PL0A 1GCUA 2CSUA 3N2GA 2R6JA 1U7ZA 4IRMA 2HGZA 4IPTA 2EAUA 4LY9A 5DHUA 3IH5A 4BLTA 1XDSA 2NXNA 1GZVA 4L22A 4J1TA 2JGEA 2VCHA 3FPGA 4XVCA 1Z2NX 3LQ2A 3HCPA 4YB8A 1SCUA 1N1MA 4BFVA 2IP1A 3OX3A 3MGGA 1ZC4A 1SEPA 5I4BA 3E4CA 1M0TA 1W88A 2DX7A 2X15A 5DYIA 1FVHA 3MJRA 2QXUA 3QI7A 4JEUA 3AMVA 4J8PA 5AW0A 5KQPA 1ZKDA 1D1SA 4N39A 4EP1A 2RCYA 1NOJA 3PI6A 3EDMA 4R68A 4EUEA 7MDHA 3STWA 1XL1A 4J0JA 4LTNA 5DH9A 3PR3A 1RVV1 3PX3A 2Q1TA 3N2ZB 5ALTA 4FD3A 3SZOA 3VX4A 3OKPA 3WGKA 5DXJA 3LGSA 5U9CA 3VZDA 1I1NA 2IYZA 1FDRA 2MYTA 1Y3FE 3N8KA 1XG5A 3Q6NA 4G3XA 4O4LF 5CVEA 4X93A 1FX1A 5F9MA 4DT1A 3R9XA 2I8CA 4Q7KA 2W7TA 1D5WA 5F3DA 4GQAA 3L7CA 1L1QA 5E2IA 2MT9A 1OYOA 5LDDC 2XYRA 1W0JD 4JWKA 1E32A 3IPXA 5LKAA 3TEFA 3FMFA 3I53A 1AKQA 5E1DA 1NBOA 1UBOS 3EQ8A 4LA4A 3RV3A 1PTJC 1OOEA 1W94A 2V5UA 2AZDA 1IBLB 2PUGA 4YA6A 5BUQA 1G0NA 1EUCA 4ARSA 1KAQA 2O3SA 3EXG2 2C29D 4I1RA 2CFIA 5I7OA 1OGIA 4A7PA 1F1JA 1JDNA 3M6LA 3OOYA 3H5WA 1UL1X 1RRMA 2GS9A 3NTRA 1TAQA 4UXIA 5BSFA 5JXWA 5K0SA 2Y1GA 7REQA 2VZLA 3DDCA 1LBSA 3AVUA 3FOCA 3R8XA 2V4ZA 4B3IA 4UNRA 5HS4A 3D2AA 5HKAA 3DT6A 1SVWA 3CZ4A 1AK2A 1JT2A 2FP3A 2FPIA 1DQPA 1TMOA 3UT0A 3KSAC 5JEDA 4YP5A 4OYHA 1ONNA 5D00A 2AG8A 1JLMA 1G21A 1BA3A 4LMBA 3JQFA 1OFUX 1OLSB 2G9ZA 4OXYA 1CYEA 4RXMA 2IZ6A 3B6EA 3EIFA 3QLVC 4GVXA 4KJZA 4OMUA 5EI5A 5REQA 3S2FA 3KJGA 3ZI4A 1GTL1 5ED4A 4CL8A 1EK1A 4AW9A 2W00A 3A3YA 2CFCA 4YRSA 2FMIA 5CURA 1JEOA 4MWCA 3AKZA 3LSTA 2YWRA 5KQMA 3VPAA 4TX1A 5I7AA 3MRXA 1YACA 1R0WA 3QELA 5FF9A 2DWPA 1CIVA 4DIEA 4EZEA 2GLTA 2A9JA 3K6KA 4EW2A 1N5KA 2F1OA 1G5QA 3CX4A 2GASA 2GT1A 3WGTA 4L75A 1DAGA 5B12A 3HBFA 4Y6OA 5FPYA 5DULA 3VKUA 4OX9B 3EEFA 4AYTA 3NDPA 1T13A 3WKBA 1WMAA 1T9HA 3X3HA 4DLWA 4XQ9A 3BD9A 5IZCA 3RQSA 2UAGA 2VTBB 3CH5A 1RZRD 1U7WA 4QU8A 2Y1FA 5JALA 5DT9A 1ZJZA 3T9AA 2QMHA 1JALA 1Z7WA 4LV8B 1VJDA 3G2PA 1OZHA 4N0DA 3PF8A 3L9XA 1L8AA 2ANBA 1E8NA 4PQEA 4XAQA 5CHYA 1QGUA 2HIMA 1LDGA 1M6EX 1EZ4A 1N5JA 1YB1A 3IIMA 4KNVA 3VMMA 3RI3A 4DNXA 2PJUA 1U65A 4PG4A 1W25A 5JASA 5DTIA 2J07A 3C3XA 3AR9A 4KSBA 2D2XA 5DLEA 5FTNA 3HA3A 3I5XA 3GUVA 4NWIA 1N3YA 1PS0A 1E59A 2RBEA 2DECA 1VBFA 4ZI7B 2JBAA 2CN1A 4LZWA 4BMYA 4EJSC 3DBRA 2QX9A 3UT5B 4PAOA 1QHHA 3KC2A 3PD0A 2WTAA 4MWDA 5I51A 3KS9A 4GI1A 4MUYA 4MVJG 3DNPA 4Q6WA 5CU7A 5TGZA 3W05A 2JDIA 1VCOA 2BM0A 4EPRA 4OCZA 1K7CA 1OJLA 1UMCA 3L0DA 4U7GA 4B17A 4B7UA 1E20A 4C3VA 2VKTA 3LUFA 4EI2A 4YJFA 2OECA 4M0FA 4NDNE 4CCWA 4B6OA 4CFSA 3S81A 1J0EA 2HXGA 2J4CA 1AT1A 1AD2A 4Q39A 1HFEL 3LFUA 5GINE 1M54A 2FEAA 3MOGA 5A3VA 2C20A 1FP6A 4BVEA 4M60A 1K8RA 3QF4B 5EWJA 2TYSB 3DOIA 4RY0A 2I8AA 1IJKA 1QPGA 1H1LB 3DUFA 3HKEA 3PEEA 3AF2A 1X7WB 1V1MA 1JB1A 3AP1A 2C2XA 1VJGA 1DG3A 2X3YA 4CFYA 3R24A 3IA7A 3MA0A 3RSZA 2A9QA 1WETA 5JNUA 2VK8A 1K9SA 3PRHA 4BMZA 2I80A 3KKKA 1DI0A 1PEYA 1WQ3A 1X77A 2PWZA 1FXWF 5LA6B 1EFTA 3EGOA 3HLKA 4ILEA 2AW5A 1CUXA 2YTZA 1J33A 2IA5A 4NL4H 4R54A 5LP6B 2HIHA 3NFYA 1ACLA 4YJ3B 6Q21A 4MB6A 4EYSA 1RJGA 4KE6A 1IMJA 1YHZA 2V4MA 1GNRA 2FK8A 2J7PA 4MQFA 2DBRA 3DQQA 4HN2A 3E18A 3P2KA 1U7PA 3RK4A 1UK6A 3H9QA 4NPAA 1CRLA 1LK7A 3QGMA 1RQRA 4HGQA 1U4NA 2PKEA 4KXWA 5U1PA 1RI5A 2O1SA 3BBPA 5AUNB 2RARA 2BJWA 3W6UA 2AFHA 3K2QA 3FROA 2O7NA 2NVOA 4PW0A 3W5IA 5EWMA 4A6DA 3QTLA 1EH5A 1T5DX 2AFIA 5J1SB 3EULA 2JATA 3O8QA 2IDMA 3MTJA 4RABA 4Y2VA 5A4JA 4KQXA 1S1CA 1YRLA 2FKNA 3N2GB 1ZISA 4WH0A 1QVRA 1R5NA 3PQ7A 3DAFA 5G53C 3WAGA 1FEZA 3ECCA 3OZWA 3HJUA 2P7HA 5A7FA 5IK2D 3ZUGA 1N25A 3U9SA 3WFJA 1R5OA 1GAQA 1SCUB 4DLUA 5EVCA 4NMLA 3HS3A 3U19A 4EY8A 1J0CA 1JTVA 1TO1E 2HBZA 4N6OA 2YMLA 5DX0A 8AT1A 1US8A 2JGMA 4Y6LA 3WI7A 2E1PA 4MCIA 3M81A 4MARA 4JC0A 3W5JA 4XWKA 1U8XX 5GIPE 1WLYA 3BWMA 4Q82A 3OTOB 3BE4A 2VQEB 4TKUA 1MOQA 2YL2A 4TVKA 1O96A 3JATA 3A1TA 3MPUA 2JFWA 1MO2A 4DNOA 2JGJA 5K3CA 1NDUA 5B5SA 3FDFA 3H5TA 3A26A 1NUPA 3PKZA 1P1HA 4M0MA 3K0AA 2AQ8A 4EKIA 2DR3A 2IYLD 1NHWA 3N0WA 1Z6QA 5LL6P 3NJRA 3ZVLA 4DT1B 2CXNA 4WOPA 2QRLA 4IHJF 5HYVA 1ZKMA 4F86A 1XDWA 1XRJA 1PR1A 4EZIA 5IC6A 2VAPA 4M88A 4EVSA 1ABFA 3EDRA 1G20E 2Z8XA 3CT4A 3V2UA 2R7AA 2XGMA 3F2IA 5ALPA 3I9V1 1Z4MA 4FCTA 1GNSA 1JKXA 1LJUA 1JQKA 3QXHA 1E2JA 1EU1A 2F9FA 3A6FA 1U98A 3V8VA 2IPOA 2D8MA 4IUYA 3NHJA 1M5TA 1XVUA 2GD0A 1W4CA 1XJCA 2OTCA 3EAGA 1L5GB 1SHTX 3OT4A 1AH2A 4B79A 1EUCB 1VCHA 1XRQA 1FC0A 3F6EX 3Q2IA 5BSVA 3TIGA 4DMLA 5FORA 4RYLA 1P1CA 1G3QA 3PYMA 1TTQB 2O3UA 4AVYA 4YT8A 6ADHA 5DMXA 1Z12A 5BYBA 1P33A 4KFSA 1O2DA 7REQB 1DX4A 1E3LA 3ONWA 4KYUA 3L7OA 4BLQA 2Z6UA 4YROA 3N1UA 4KAFA 4GZ3A 2FPIB 2BZ1A 3PUIA 2NU7B 1XZPA 3MRVA 3U3MA 1TJ3A 2HUPA 1M2WA 4TQ9A 2DQZA 4O4HF 2XMQA 3LK7A 3T1VA 1G21B 4DCOA 1TK3A 2O1XA 5MGNA 4BATA 1ZGJA 2C31A 1O5IA 3TX2A 5BNIA 1DO8A 2NUAA 2CK3A 4G8CA 4QOEA 5REQB 2ZUTA 5LLDA 1Q6YA 1T5SA 1GEEA 2X76A 5ALRA 4LFAB 1A9QA 5AKHA 4WK6A 3GT7A 3C7KA 3GA7A 1KGDA 1AXEA 2BGNA 2QLTA 1DTWA 2C2MA 2W11A 3Q5DA 1BKDR 4GE3A 2FRDC 3ZWKA 4AZSA 4JROA 3R5JA 4O2LA 5HKKA 2NPIA 1E3SA 5DBHX 2X5JO 3OQIA 5AW9A 1VL1A 3GJ5A 1HOXA 2FN9A 4BC1A 4CQNA 2FGJA 3BHJA 3R20A 4GYWA 4BB9A 5F1PA 2R8BA 1KS2A 1U1IA 4WN9B 1AGPA 4MUGA 4N4AA 1XZBA 3U4MA 4A0QA 3WOHA 3IVCA 2ZOSA 1Q1ZA 3CR7A 4OYYA 5ALFA 5BSKA 4XQ0A 4HAXA 3GJ0A 1ZIPA 3PFCA 1M7HA 1H66A 1XVTA 1PBTA 2DY1A 3CN7A 3CPHA 4OOFA 1WB5A 2X8AA 4HUJA 4KITB 3ZZNA 3NUQA 1QU2A 2N1BA 3DTTA 5D5HA 2O5CA 4X41A 5CB8A 4HGRA 3B1ZA 3RU3A 1YCHA 2A58A 2A5JA 1QGUB 1KEWA 1XRPA 4NU0A 3RAPR 3S29A 4ZIRB 3SQDA 5BMOA 2XYPA 1QOPB 4JJGA 1DEHA 1N2EA 2JDID 4JI3B 2AKEA 5CDHA 3C3CA 2X8BA 3A6PC 1SH7A 1BOFA 1JMKC 1L7OA 4JLJA 3AUXA 1A04A 5JBQA 5LD2B 1IBKB 5B1IA 4FHCA 1XX6A 3SEFA 4D9GA 3GPIA 3RJ5A 2WMDA 3C4JA 2JFZA 5G1PA 2V98A 2R8EA 5K0EA 4EYEA 2FVXA 1N6KA 1XV5A 3DCYA 3N3AC 4X1YA 2BCJQ 3HABA 1PEKE 3HYLA 4M36A 3PJRA 1QHHB 2BEVB 2OM2A 3WO0A 3TQHA 4B3DA 2H3EA 2H2FA 3KKQA 3LA6A 4EKYA 1C9KA 1XNQB 1P8JA 2LCIA 3W6OA 2V7BA 1UMCB 2V5AA 1UFQA 4QBHA 1V4NA 4FFBA 2P77A 2CV1A 3TNFA 4CCYB 4REOA 2QP3A 3E5RA 3WAKA 3MWEB 3K0BA 3V8EA 4KR0A 4EB8A 2FW6A 5JV5A 4ROSA 3W8EA 5IT5A 2WDPA 2ODQA 2F59A 1HEIA 1Y3BE 3MGBA 1E99A 3W3AA 4KQJA 4EY7A 3FGZA 3KZ1E 2O3QA 4OU5A 1VSUA 1KHTA 1TA4A 4BP9A 4D99A 1K6JA 5AYVA 3Q6IA 1SB9A 3DUFB 3IBYA 1B16A 3MTDA 4AZWA 5F9HA 1V43A 1V1MB 4OFBA 1GTVA 2IX9A 1EG7A 4L3OA 3RVKA 3ZTTA 2FH5B 1BXKA 1PJ2A 2ON6A 3FRIA 1L5ZA 3I9NA 3EGIA 2FPSA 1XVVA 2J7PD 4IZOA 2Q99A 4LI0A 1L5HA 1C0EA 4IGKA 1ORIA 1RRKA 2AJCA 3EXFB 1U1EA 4N03A 5DCWA 3WP0A 1WBDA 4M2LA 2QZJA 4RTOA 4IW3B 3DCIA 4MAMA 2GZHA 3TO5A 4NZMA 3HNPA 3U7JA 1TIBA 4LZAA 3BTUA 4CR6A 1QF6A 4NJOA 5HOEA 3ZHZA 1TKAA 1FFCA 4NKRA 2I2DA 3H1TA 4MO2A 3V8MA 1IHDA 3DYVA 3OJOA 3QTTA 4CQMA 2BGGA 2DB3A 3HP1A 4L0DA 1QFZA 1YAHA 1XKXA 2R00A 1TKRA 2H85A 1KQ3A 4Z6KA 3UYKA 1V16A 1QP8A 4PQFA 3CPSA 4XX0A 2ISCA 5COQA 2WABA 1ECFA 4QYSA 1MTZA 5T64A 3ZV4A 4DCSA 2Z8YM 4BQPA 2Q4RA 3WWCA 3AF0A 5ADVA 5KYYA 2C2BA 3UMVA 2AFHB 2UYCA 4L02A 3TXXA 4FW9A 3UJNA 4XFJA 5BYJA 3IP3A 2PD4A 1XUOA 3AM1A 4GC9A 2AFIB 3W3ZB 3C6KA 5KNCA 2ZEJA 3DD5A 3O8QB 1T0IA 4WK0B 2EGHA 2D3WA 1KIMA 3CPJB 3O8LA 2RAVA 1GQFA 3GT0A 1PYGA 1JAHA 4LQDA 1PI3A 4GXRA 3X44A 1FQWA 2HK6A 4X20A 3QE9Y 1W2HA 5LLSA 1AQJA 2EYUA 1FDIA 3FRJA 4U7JA 4LSGA 4RK7A 2PKCA 2UXBB 1HNNA 2K7FA 1KMCA 2ZPAA 3AETA 3GGOA 4JI8B 2FW0A 2Q50A 4L9RA 4IDFA 1UAAA 1M34A 1L5NA 4EHAA 1WU8A 4CYMA 4F4CA 3IKJA 1NBHA 4OHOA 1U0JA 3BOSA 2C00A 5LIRA 5MF6A 1CLEA 4DLRA 3Q8LA 1U2DC 3VUFA 2XMPA 2QHXA 1M2NA 3DCNA 2QX6A 4GKBA 3Q7SA 1O58A 2H92A 4LDQA 2QQ5A 1RHKA 2ZSEA 4XXHA 4D98A 2XB2A 1C1HA 1VKNA 4JYBA 4L74A 1FFBA 4E33A 2NIPA 4JLMA 5T3YA 5A03A 5B7GA 3EGDA 3F3KA 4ZT2A 5IKXA 1JHPA 4YBRA 4D46A 5KTKA 4BVJA 2NSHA 4WDRA 1RMQA 1LDMA 1WD7A 2AHOA 4FGUA 5DP1A 1NAHA 5KYUB 4LF4B 1BXZA 1MXHA 1D04A 1OI7A 1ULUA 3LG2A 3RWMB 1CRPA 5E7IA 1L7PA 2J85A 3FWYA 1E77A 2PNJA 4TWAA 3N2EA 3LVRE 4C4AA 1B42A 1K63A 3KE9A 3LT2A 1DJQA 4IDCA 4X6XA 3L0PA 4AKSA 2IIVA 3FOEC 1NXOA 4PAMA 4NZNA 1GUDA 1Y1RA 2ILVA 2M6SA 3OEYA 3ORRA 4OBWA 2IYQA 2XT9A 2VP0A 1YR8A 1XDDA 3GRFA 2CJXA 2OSBA 1LSOA 4M9ZA 3L4KA 1YHNA 2YX1A 4KN9S 1VKRA 2ZAOA 3NBZC 5H83A 1IG0A 4C4XA 4CIYA 4C7OB 2EFGA 2WQ7A 1ISRA 1BWPA 1T24A 4A6XA 2X3FA 1NVVR 2IHVA 1YU9A 1OSNA 2X77A 4Q9HA 3ETHA 2QM0A 1COZA 3EVGA 4UMEA 4OXNA 5EP2A 5FUXA 3TSAA 2O7VA 2NUAB 3AVTA 2H5IA 4MK4A 1YZGA 3KYBA 3I2YX 1VIDA 3JYOA 4TUYF 5DNWA 121PA 4DLKA 1Z2AA 2IF2A 1HE8B 2KE5A 4M37A 5IN4A 3HWWA 4N5DA 2H31A 4PYMA 2PRZA 4L8LA 1RKXA 2QVLA 3ZE0B 2C8LA 3S40A 4FEEA 4CMIB 3IVGA 1AUOA 1RWXA 5GONA 4XB6B 2BVNA 2HNAA 1W73A 3OQIB 1L7QA 3LI2A 5I9MA 1C30A 4RQUA 1IXSB 2AOUA 2GZDA 2JIBA 4ZOAA 1G59A 2O14A 3O94A 1QWOA 3LUPA 3QY0A 4RY8A 5EJMA 3BE8A 4UM7A 4J76A 2LCQA 2IKSA 4W9NC 3TPCA 4X97A 1GDDA 3M6AA 4IWXA 4Y1RA 3VO2A 1FOEB 1A2QA 2QZSA 4LYDA 4DJAA 4WOBA 5EJIA 2O2JA 2P62A 1E0AA 3CV3A 2D1FA 3ZLUA 2OHIA 2OORA 2Q62A 5A9SA 4NOKA 4RPJA 1OIWA 2XPCA 3KSRA 1JQ5A 4K8RB 2VEDA 1APBA 3UMFA 2P78A 1I7SB 4YJGB 4FR0A 2YBDA 5KHOC 3UQYS 3MB5A 2QT1A 2WBLC 4JH0A 4XGKA 3NOQA 1HLFA 3HXKA 4MQ5A 4N7BA 1GTG1 3HV2A 3IB3A 2H08A 3ESBA 2R44A 1U3GA 2DTDA 1ESZA 2D62A 2PLFA 3FFXA 3IIJA 4J3FA 5C8YA 4J1QA 2XVZA 4H18A 3ROTA 2ZR8A 3HCWA 5JAQA 2AN4A 3U4HA 1U7XA 2ODPA 2AUNA 3TRDA 3H4MA 2PS9A 1PX0A 2YS7A 4KLAA 1DE0A 3DZJA 4MYSA 5HF9A 1CJKC 3W3AD 4BB0A 1Y4SA 4BV8A 5K0FA 2UZ4A 1OWNA 1YFZA 3A9CA 4MO9A 1B0AA 4Q3CA 4C0BA 1QYIA 4C0WA 2D6FA 4OYLA 4PLHA 3I6YA 1EEXB 4L5BA 5ES3A 1XHEA 3F90A 2GBGA 5KZMB 1U2RA 4XYLA 3DHVA 4CF3A 13PKA 1XZAA 1UBRS 4UXHA 5DM4A 4FFBB 4CM5A 3H7IA 5CXQA 9MHTA 4BUZA 3G2NA 4MIEA 3SIRA 5CA1A 1KJZA 1QIFA 1RT9A 2LNDA 2QMYA 1YZUA 1A9TA 1TJNA 2JGIA 2JHCA 2ZRDA 3F5FA 2NUTB 1KK1A 2QYOA 1HE4A 1ATZA 2X19A 5BNFA 3GLGA 2PD6A 2XAAA 3ORHA 4YRCA 1OGYA 4C0QC 3QENA 2G88A 4X7RA 3T7KA 5FOSA 1LLDA 2PWAA 3QVVA 4IOLA 1G5HA 4N01A 3W2HA 1MU0A 1LPSA 2CKDA 4A27A 4A3SA 4YAKA 1FNCA 1IEXA 4TV8F 3S5JA 4CUKA 3ZU6A 4EH1A 3JQ6A 4CQMD 2HRRA 1L5HB 3DT8A 1H5UA 4HWTA 4ESEA 3GLFA 4KO1S 1GSIA 1Q7CA 3DV0B 1XLVA 1GPYA 1AVTA 4I3FA 3GEIA 4EG5A 3AR6A 1RWQA 3G7NA 2H0QA 1VYHA 5K0TA 5TS2A 1HH4A 5BWNA 4E1AA 3U2QA 4DM7A 1WCYA 1ANKA 1N2XA 5HRCA 1SG6A 3BBLA 1KZ9A 4I5GA 4LHXA 5BV1A 9LDTA 5KNCD 1IEVA 1PJQA 2BEWA 2CEKA 3I9FA 3IL2A 1ADFA 3ILYA 2CJPA 1UMDB 1ZLYA 3L8DA 1V16B 1PGJA 4G0ZA 1XT6A 2CJFA 4NOJA 3M4XA 4XX0B 4BFUA 1MVLA 3Q5GA 4FE7A 3AF6A 3ZZ0A 4UHCA 4BRWA 1PTKA 5KYYB 2B36A 2BFDA 4U1RA 3TJZA 1IFXA 1EQ2A 2QTVB 3EJWA 1L7DA 3DMYA 5KQRA 3ILSA 4PSKA 3VH4A 3KSBC 2PUBA 2B99A 1U0EA 3PEVA 4FGSA 3RJTA 1G6KA 1NWHA 4MV5A 3W9BA 1KI1A 4HGNA 1MN6A 2I2AA 4XVRA 2YIDA 3RFFA 3K9GA 1Q20A 1UXJA 3KDAA 4HVTA 2I55A 3VISA 3VPCA 2C4WA 2J4DA 5A04A 5JNLA 3QLUA 3S7TA 1RZVA 1Z6TA 2R96A 2ZIZA 4UMFA 3Q4GA 2PU5A 3MMNA 4MQLA 5C7LO 1N3LA 1Y4AE 2QAJA 2QRJA 3R0JA 2RGNC 2VBGA 1T8SA 4I5FA 3CR3C 3PQCA 1TYZA 4XGIA 3HKBA 2X4LA 1CY8A 2GBFA 4PNHA 2DR0A 1AM4D 3AETB 4P34A 2XDYA 1UQRA 4M0UA 3V3KA 1M34B 2E7ZA 5B58T 4FLEA 2VJPA 3ZE8A 3U6BA 4ECEA 4XM0A 1TLFA 1TO2E 2V59A 1ZD3A 3IUJA 3TMAA 5JQGB 5C52B 1CW2B 2IITA 5K8VA 2M98A 3O3CA 5CXSA 1E0JA 2ZXEA 2ZIGA 3ESRA 4M1EA 5CLLA 3T3EA 4L73A 1R4ZA 4DRZA 1R0YA 1S1MA 1K9VF 1ADCA 1AA9A 2H1CA 4LBZA 3FCUB 4ZGBA 3O1LA 3OZEA 4Q05A 3CCBA 3Q10A 4JC4A 3TLCA 3WA7A 2C5FA 2CMHA 1LU9A 3GFBA 4KACA 4LOKA 2B69A 1EYZA 4B7ZA 2RGCA 3B51X 1RD4A 4LFCB 1MRSA 4BNJA 1O87A 5BQXA 5CCEA 1PQWA 1DS6A 2R4QA 3WLRA 3CW2A 4TYMA 5KQSA 1P2TA 3UQZA 2IPLA 4YRFA 1OB5A 3N2LA 1KJNA 1MJNA 4QODA 3CIFA 3L77A 4EELA 2Z30A 5ENVA 2WNHA 4L4ZA 4KR3A 2DUWA 4XDZA 5LR6A 1X8XA 2ODTX 3LDAA 2FW7A 4TL6A 4DS3A 5BN4B 2CEAA 4YUZA 1FTYA 1J42A 1MAHA 4PVCA 1KA9H 4KQ1A 1PT5A 2VH5R 3LXXA 3BMQA 3TL2A 2I4NA 3BXPA 1C3VA 1Y63A 4DNFA 1W8DA 1CQWA 2ERXA 2WJHA 2PQ2A 2P4HX 1CJVC 3BMOA 3W5UA 1DX9A 1QRSA 3MMSA 4EQZA 3TPFA 4GLOA 5CLHA 1I4LD 1DOZA 2ZCVA 4Z9YA 4MRSA 1W1UA 1A5SB 1TF5A 3E58A 4JLVA 4G1CA 4RE5A 3OLZA 4EEKA 3KLNA 1N77A 3KWFA 4AWAA 1E1CB 1LBEA 1Y4DE 3KZOA 1W8IA 4FGKA 1QKIA 1T1IA 3QFTA 4F91B 4Z0HO 1RJEA 4ZD6A 3JVEA 4P38A 3GCWA 5AUQA 1MZVA 2AWOA 5KVVA 4PSUA 1IZ7A 3L41A 2RB5A 4R8LA 2C7GA 1DBWA 1HFKA 4BYMA 1LX7A 2QQEA 1NXSA 2HMTA 2V45A 4BQFA 1CE8A 4LNUA 4ZO4A 5G02A 3VR0A 2V5VA 3V97A 4IDNA 1RRGA 5A5GA 1QKJA 2PY6A 3C16C 2VQ6A 4HDNB 3F1KA 4K9NA 1UEJA 1K3TA 1XROA 3W7VA 2IYEA 1C30B 3BJZA 5F78A 3ZXSA 1TU0A 5DSXA 1M2JA 3LLCA 1CLUA 2E4VA 4FU0A 2TECE 2XQJA 5JNRA 1Q3TA 4Y1RB 2D1QA 4X0EA 4AJ1A 2PZEA 3EGXA 1XZNA 4K81B 4JQCA 4Q4HB 1QQTA 1CUFA 2C04A 2BSQA 4EKGA 2PX4A 1X92A 1KKMA 3CRNA 2XE6A 3OTHA 1B74A 4Y2PA 3RG2A 4F12A 1Z4QA 2PR7A 3S8YA 4ZZ1A 5L6MB 1CEEA 2ZRKA 1T6ZA 5E8JA 3I9JA 4K9SA 3IJ5A 3LIPA 4EW6A 3ILVA 2H16A 3AF5A 4HAZA 1OH7A 4XWOA 1T15A 1MB3A 2UVPA 4FS3A 1CUJA 3RRBA 1I4WA 4EQ6B 3I52A 1OBVA 2ZSHA 4GP7A 1NNUA 4JBLA 1KH3A 2XEXA 4KG7A 1ZMXA 3SZLA 1V35A 3LDGA 3VDXA 1K86A 1OBOA 3I1FA 3ORFA 4DMCA 5LNK1 3SSMA 3ZV5A 4Z9BA 1RLTA 4DSNA 1PFGA 2X0JA 5JJLA 4B3SB 3WNVA 1WY7A 1XPRA 4FT2A 1O95C 5HWSA 3FBGA 3ML1A 4JYCA 3CF2A 5DHPA 3RADC 2PVCA 5HMLA 5H7XA 1H42A 3P71T 2ODBA 3QNWA 4K6OA 4MI6A 5EFZA 4WK4B 1DJLA 1UKAA 5EOVA 4ACAA 2ZSAA 2AEJA 3B3GA 4XVQA 3EBPA 1T5TA 1UBLS 2KBEA 1SCBA 3GNQA 2ORVA 5IDVA 5LBUA 1P39A 1Y5MA 3AM3A 5FAKA 4EG1A 4LFBB 4KXUA 5CA1B 2XQGA 3HXMA 1H69A 4M7RA 2H1WA 2J6CA 3LC0A 4DCUA 1K8ZB 1KI3A 4R9NA 1XNJA 4G2NA 4MW5A 3IE2A 1NW5A 1I1OA 4WLVA 5HIJA 4AICA 5IDWA 5LKRA 3ZQUA 4HAVA 2AX3A 1Y5IA 4LTDA 2ZIWB 4JUDX 3VZBA 2IEAA 5AVOA 1NW8A 2ZSDA 2C7PA 2O50A 6PFKA 2B78A 3H3XA 3AIOA 3P2EA 3PUKA 4GXTA 4JENA 3IESA 3ZGOA 3B48A 4K1LA 1RACA 5TPWB 3DEKA 1CY6A 5AKIA 1E96A 2Q0SA 1SQ0A 4ENRA 2PYIA 4CIAA 1W87A 4U63A 1A5ZA 1PNOA 3VJMA 3UMYA 1S0UA 3RT1A 4E32A 3GLFB 4PPYA 1LC0A 1JAIA 2P2LA 4G5SA 4WW0A 4UPEA 1E69A 3BTOA 1P44A 4JP5A 3FR8A 1JKIA 1YZYA 4FSXA 2YCLA 3BWXA 3EVAA 3RANA 2JJ1A 1USGA 2OQRA 1AQLA 1Q17A 1FJXA 3HC7A 1R0KA 3PB3A 1HRDA 1XCOA 3KXDA 5BVGB 2WUEA 4LYJA 5K1ZA 4D2IA 2AGVA 3LIIA 2BEWB 2O3TA 4GL2A 3ZW7A 5LZ4A 1U0RA 5TQVA 3RVOA 3BKWA 1R74A 3OHPA 4Y3UA 4AUMA 2D3TA 3S28A 4DXDA 2ZAGA