3QBDA

3-dehydroquinate synthase (arob) from mycobacterium tuberculosis in complex with nad
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
356
structure length
344
Chain Sequence
b'APVTVQVAVDPPYPVVIGTGLLDELEDLLADRHKVAVVHQPGLAETAEEIRKRLAGKGVDAHRIEIPDAEAGKDLPVVGFIWEVLGRIGIGRKDALVSLGGGAATDVAGFAAATWLRGVSIVHLPTTLLGMVDAAVGGKTGINTDAGKNLVGAFHQPLAVLVDLATLQTLPRDEMICGMAEVVKAGFIADPVILDLIEADPQAALDPAGDVLPELIRRAITVKAEVVAAELREILNYGHTLGHAIERRERYRWRHGAAVSVGLVFAAELARLAGRLDDATAQRHRTILSSLGLPVSYDPDALPQLLEIMAGVLRFVVLDGLAKPGRMVGPDPGLLVTAYAGVCA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate synthase
molecule tags Lyase
source organism Mycobacterium tuberculosis
publication title 3-Dehydroquinate Synthase (aroB) from Mycobacterium tuberculosis in complex with NAD
rcsb
total genus 117
structure length 344
sequence length 356
chains with identical sequence B
ec nomenclature ec 4.2.3.4: 3-dehydroquinate synthase.
pdb deposition date 2011-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01761 DHQ_synthase 3-dehydroquinate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 3qbdA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qbdA01
1NVAA 3IV7A 1XAGA 2BI4A 1XAJA 1JQAA 5BR4A 4MCAA 5K8CA 3OX4A 3QBDA 1SG6A 1DQSA 4P53A 1NVDA 4QGSA 5FB3A 1JPUA 1XALA 1UJNA 1NR5A 1XAHA 3OWOA 3UHJA 1RRMA 3W5SA 3RF7A 2GRUA 3ZOKA 1XAIA 1OJ7A 3HL0A 1NVBA 3CE9A 1NRXA 3OKFA 1VHDA 3JZDA 3QBEA 4RGQA 3ZDRA 1O2DA 1NVEA 1JQ5A 4RFLA 4RGVA 2D2XA 4FR2A 5HVNA 1NUAA 1KQ3A 2BL4A 5EKSA 1NVFA 1VLJA 1TA9A 3CLHA 3BFJA
chains in the Genus database with same CATH superfamily
2YC4C 3S3TA 1X92A 3GAFA 1N92A 3PC3A 1F9AA 3QTTA 2D1RA 4WOJA 2AOUB 1T8RA 4J3NA 3G7UA 3Q41A 5KVVA 4EX7A 2AJCA 1O87A 1V4NA 1II8B 3K0SA 3R0XA 5IJZA 3VR2D 3CA8A 1BCSA 1YB4A 1ORVA 2FW8A 4XB6B 4JXKA 4C0HA 3GCDA 4HGYA 3PJEA 3MOGA 3WZLA 3WK8A 1FFYA 3GRFA 3SFZA 2XY4A 5BR8B 4GYKA 3EOAI 3CCBA 2Q0SA 4RABA 4XI9A 3L4JA 4KR3A 4AK9A 4KHPB 2I6FA 2PMBA 2V7UA 3PPVA 3KOUA 4PZPA 5CAEB 3JYLA 4F4UA 3WMGA 4HWKA 1SQ5A 1TADA 4X1KB 3ICOA 3PUJA 4MUFA 3NOXA 4A23A 5DTMA 2O5VA 4NIMA 3Q0IA 3MTAA 1V1JA 1P1KA 2BEWA 4I9GA 3RU2A 1JU4A 4RYLA 4FYVA 1K6EA 1BHQ1 5DB4A 1ULZA 4D98A 3QEKA 2X2FA 3VZPA 1BE0A 2X40A 1ZH2A 3R7DA 1GL6A 1FFHA 1GYPA 1W75A 1XTSA 4V38A 3K20A 3F97A 4XUDA 4CMGA 1JSLA 2XWJI 5KPJA 3OJEA 3C3EA 1NFQA 3U31A 4BQNA 5GZ6A 1I4WA 1KYTA 3CONA 2G4CA 3FUTA 4UNNA 1WB6A 1DCTA 3ETHA 2POQX 2Y0CA 3UWPA 1EBUA 2P90A 1ZJJA 4PYOA 4KDEA 3ZD7A 1MB2A 1HQKA 1QIDA 2DUMA 1K75A 3GFGA 3QNUA 4G1BA 4PLTA 3R9WA 4IUDS 4PGFA 2ZSFA 1PUIA 2F1OA 2ZVQX 4GP9A 5DGHA 5GZ3A 3OFSA 3KQWA 5LXTF 1G8KA 1CR4A 2F3QA 1IHYA 2L17A 4NBTA 4X6LA 3VH1A 5KNCD 1LBQA 4HI0E 2JB9A 4H15A 3AY0A 4MUKA 2M2IA 1G0OA 3K0EA 4FE4A 5HUHA 4U3JA 1A0OA 4WE3A 5DFAA 1K8XB 2IVZA 4I1PA 5KINB 2CVHA 1GPNA 2HREA 1B74A 1IK6A 2ID4A 1SULA 5AJTA 5IC4A 4NHOA 1BMQA 5COAA 3C4VA 3E5RA 1MIOA 1WSAA 4PO8A 4MA5A 5CRIA 3VPFA 2TSYB 4BB9A 3RT1A 1BS1A 2IZ6A 4DW8A 5BWNA 4QGGA 4TMXA 2WIKA 3PKIA 3EVDA 3QVTA 5F3RA 3OMLA 1JEYB 4CCYB 3OEYA 1VSUA 1WLYA 1JR3E 5T5QA 4WVFA 2V5VA 1CU1A 2DFVA 4I55B 4EUHA 1BRMA 5JATA 1E3JA 2BCEA 2H59A 1T10A 4IQGA 3VX4A 1ZQ1A 3R5JA 2ST1A 1Z7YA 4ZXFA 4EPTA 3Q7RA 4PPGA 5SY4A 4DDTA 3H6HA 2Q6OA 1N4AA 5ADWA 2A0YA 4L0DA 2F9FA 4QL3A 4C07A 1EFCA 3AZOA 3VR5A 5AI0A 3ZWBA 2WIGA 3OZSA 1OI7A 3UJAA 3DOCA 2VPTA 1J9ZA 5FTWA 1H5QA 2P27A 4PYNA 2C4HA 4YB8A 3M4ZA 4ZVTA 4D0GA 3OQ1A 1M34B 1EDBA 3JATA 4H6WA 4F4JA 4NSNA 4J2TA 3COVA 3HRHA 4LRYA 3ZIAA 2I62A 1Z45A 2QVBA 2ZB4A 1XMIA 2O14A 3O94A 4CF5A 1AO3A 1J1UA 5CU7A 4QC2A 4OP1A 1XB2A 2FUG1 4LW8A 4A36A 1IN7A 1MOPA 1DWUA 2DLDA 2Q27A 1C81A 5JQGA 2R7LA 2B1RA 3BH6A 1P5FA 1OZ0A 5B58C 1J8FA 1PDOA 1I6MA 1UXOA 4M0MA 1JJBA 3RVMA 3EFEA 4TYNA 1SIUA 1OH7A 1SCIA 4C0QC 2W43A 1R0LA 3E53A 4MEAA 2AFIE 2PBRA 3ERCA 1R8QA 1SBHA 2JGAA 3L6CA 4NVRA 2MMGA 1RAEA 3KUDA 4BNHA 5IDXA 5EKXA 3R6TA 4M9XA 5EIBC 1C4WA 1LC0A 3ELBA 1QH8B 5JJKA 1A9XB 1TRKA 3HA3A 3KOXA 5MN6A 5EXDA 4AAYA 1TPYA 4WFQA 4Z9FA 1NW3A 5LMUB 4E3WA 1FJGB 1U8FO 3DMYA 1YRYE 2Q0QA 2HCFA 3UK2A 1G3RA 2YWCA 3LT4A 3AVUA 2IY8A 1G8JA 4RKQA 2MTBA 2C3OA 4GYWA 3TD9A 2ORIA 5MHTA 3EPHA 3KZVA 4CG2A 2ABWA 2F8LA 4HSEA 4DXAA 5JAHA 3PXBA 3A1TA 1E1QA 3S55A 1BSVA 2XADA 1GGHA 1NBIA 1ZCBA 2VPZA 1AKWA 4KRGA 1DRWA 4NHEA 3VR0A 4EYEA 3E8MA 4B9EA 1H2BA 5LMNB 3SC2B 4XJTA 2I71A 4G65A 2FDCA 4CG0A 3I23A 4RA6B 4UE2A 2A1TS 3MFQA 5H3HA 5IJ9B 3TR6A 3VYUB 3I3SR 1T6YA 5EIFA 3ZW9A 4G23A 3WXMA 4EYSA 3R3WA 1X0VA 1FF9A 3P7MA 3KSZO 3KYCA 2F8MA 3QXCA 1PQ4A 3DEIA 4Q6BA 1RZRA 2I7XA 3UK7A 4GPD1 2XTAA 3R24A 5C52B 2HU2A 2REXB 1VIAA 1C9EA 4HQNA 4N0PA 3MJHA 1WSWA 2MYTA 1PJRA 3ZXIA 3VVLA 3CUWA 1DAFA 1DBIA 1ZD5A 2FSPA 3R6LA 4YCAA 2BGIA 1NXXA 2YVQA 3X1YA 3CR7A 4NI5A 2AXEA 5L9AA 1VPWA 3AUUA 3G0BA 1X1AA 2AQ8A 1W93A 3FCUB 3VMFA 1R8YA 1LLFA 4EB6A 3FYTA 3CUEF 3O2JA 4HLDA 4FZJA 5E6SB 4FLMA 4HRAA 4E1AA 3O8RA 5FV7A 1IDOA 3R3HA 1N34B 4UM9D 3M2TA 3MOSA 4X7RA 3WO1A 1I3CA 1LDEA 4HRYA 4UE3S 3Q6NA 2V65A 2WWXA 3MGBA 1GKKA 4H7EA 2ODPA 5D1HA 2QROA 3U80A 4MWEA 5GIOE 2CV0A 1I9CA 3QPBA 4YV1A 1NP6A 4Z9AA 4KQIA 2UUAB 1JG6A 1XDZA 4D02A 1QHIA 2DERA 3PI7A 4MI3A 1E89A 3I1YA 3ZTYA 3AEYA 4JL5A 2X0NA 4OXYA 1NDUA 1RM0A 4ME6A 2Z9BA 3GA7A 5CTAA 1QYRA 4PZDA 1QHYA 3G02A 4YAIA 5KNCH 5J5VA 2F62A 2DKNA 3UOAB 1D6SA 3OZUA 1N5MA 5JUWA 1W73A 3EIHA 3MMPA 5HZGA 3KOWA 1AGYA 4LGCA 3H2HA 1M8KA 1V7ZA 2WPDD 1ODSA 2VYVA 1L5RA 3P9XA 1QJCA 2OXRA 2IXGA 1PSZA 1ZD9A 2A5FA 2C3MA 4U2FA 5E6UB 2HPZA 3I39X 2QMZA 1RQLA 3IIIA 4Q9IA 4N82A 4ND6A 4UTNA 3R5KA 3QXGA 3W3ZB 3KL4A 4G0OA 1M1YA 4NLLA 1I4TD 4EVQA 4QATA 3TRJA 3GRRA 1LPNA 1TF7A 4PZ9A 2FWBA 3OCXA 2QXUA 4HNGA 4B3TB 2GZ1A 4RFLA 4E7PA 1S3SA 4QPDA 1XE3A 5DJ5A 3NBMA 2I3ZA 1H9CA 2ZCVA 1E9CA 1G4UR 2OCIA 4Q3OA 3NWOA 4JLUA 1RRVA 3P45A 4QDZA 2FPKA 3A36A 1PHRA 1PR4A 4DBZA 3GG9A 2UUCB 2CMHA 3CNQS 1B0PA 4YASA 2ISSD 4KMMA 1IK4A 4UFPA 3GZJA 1THGA 2OLJA 3CH7A 3OJXA 4XD7D 3RSOA 2C7PA 1PX2A 3RC3A 4HPJB 4MGHA 4AJNA 1Z5ZA 2QMUA 1VE3A 2BDTA 2NU6A 3I0ZA 3UEOA 1NRIA 1P5JA 5TGDA 4ZVNA 2WM9B 3K9FC 3VA7A 3TL6A 5KOIA 4G0UA 1OI4A 4UOZA 5LA6B 4MW2A 3X44A 4Y6GB 5DT2A 3Q4GA 2ONJA 1XOIA 1CW2B 5IJXA 4YNBA 3ZTTA 3IQGX 3C1UA 5AI5A 1KFCB 2AN4A 2H7XA 4RBNA 4I1IA 2WUVA 3DWGA 1JIKA 3CXRA 1V4BA 1FCJA 2EJVA 2XUDA 3TTUA 4P4SA 4YP9A 4PG6A 2KE5A 3RSFA 2QN2A 4F12A 1FMCA 4MIEA 1S1CA 3IBSA 1P75A 2Z3WA 3LU1A 3OIWA 4LZWA 4QYIB 2VDUE 1OR8A 2H54A 3SLRA 3F2IA 4FNMA 5CBPA 3BCRA 4BO2A 4JI4B 3WNVA 1JLSA 3AXSA 3DEKA 1SO8A 3GJ4A 3V2UA 1N5JA 3ODPA 1I2CA 1N7GA 4OOEA 3U7QB 2EWMA 1UM9B 2F4NA 1W29A 3LWDA 4ZT6A 4E7OA 4XVCA 5J3JA 4RA6A 1E4VA 1V8PA 4PZAA 3SHWA 1J2UA 1N8SA 3NO4A 1IJKA 4RHFA 5AOCA 2E0IA 1A50B 3MLBA 2Z2ZA 1ZISA 4JUBA 5EHQA 3MNFA 3H4IA 2ZYGA 2CCJA 1V8OA 4QG7A 3AZQA 2JL1A 1PYDA 3VTAA 1LZLA 3ZHZA 2QR5A 3KNZA 2OD7A 1BX1A 5CW2A 2L82A 3VTKA 4BVKA 1A4XA 5HJEA 5KCMA 4CXMA 2DTEA 1FX0B 2YFYA 1H0RA 5KJ6A 4G0WA 3F3MA 1R66A 3DPIA 5CK4A 5KOJA 4J0DA 1KZ1A 4GOMD 4K6KA 1LVUA 2YDYA 2Z95A 4XFKA 3CF0A 2NAPA 2Y0DA 1ZA2A 4PHCA 5HA5A 4ZMRA 4KIGA 4Q9HA 1TA0A 1H0SA 3ZD8A 1G3MA 2IH5A 1E66A 3C14C 3ID6C 1VE1A 4QOHA 3N70A 1EHIA 2A33A 3UK1A 2ZBUA 3A26A 4AS3A 3ZCPA 4DIUA 4CM7A 1JIUA 5EJIA 4MMYB 4YRMA 3EYAA 3CWQA 2WPNA 2O1SA 3ZDQA 4MRRA 4QEDA 1CF2O 1YO6A 2W2VA 1WCIB 3H2ZA 3N0TA 1E2HA 2D1SA 4LZJA 3VYTB 4DA9A 4MAMA 3V1MA 4H0CA 4BKRA 1N3YA 5KDDA 2A5GA 2IV3A 3CE9A 5E8JA 5EYPA 5FNVF 3AEKA 4G8DA 2F2TA 1GJRA 2A5LA 1VMKA 4P4UA 4TV9B 2FVXA 5G0UA 5CVTA 1NV9A 4RL6A 4DBVO 1ZKMA 4PLCA 5DM2A 5H7XA 3S99A 5CFMA 3NT4A 3X1DA 1JQBA 1Z4KA 1Z6GA 2OR3A 3JATB 2XMQA 4GXRA 4UHHA 1NONA 2WTAA 1XRJA 2QW1A 4JH0A 4G0NA 5IAJA 5K7SA 4XVQA 4I0WB 1EM8B 1U8EA 1ISSA 3FIUA 3LGAA 3MF4A 4GZ5A 4DIKA 2V3VA 1SUDA 2BZSA 2JZNA 3IR7A 4UE6A 3UFXA 4AIIA 1GUAA 1VPDA 2DAPA 5HDBB 3QPCA 1FXSA 4D81A 2F3SA 4IDHA 4OGFA 2CC2A 1WO8A 1YZQA 2Q5QA 2W48A 5JVDF 5T4EA 3WKDA 1JAHA 1E2PA 4E46A 5HM8A 4W8GA 3PL5A 2H4XA 2G1UA 3H3XA 3HSYA 3NTRA 1V6CA 2FN3A 2IW1A 1PWZA 3D31A 3TBHA 1BWQA 2Y9PB 5DP2A 5IBCA 4P5EA 3AGPA 2JHAA 3LRXA 4YV0A 1NVXQ 2Y1GA 4C0AC 1TYBE 3H6GA 4RL4A 3IKLA 1YS7A 2BBTA 1XLWA 3ZGLA 4UQLA 1NW7A 1OQAA 1VSQA 4G25A 2X4LA 4R2WA 4DT1B 3ET5A 2G25A 3DZDA 2BR4A 1RFLA 3KDAA 1NAIA 3ZI4A 1V39A 4RPGA 3ASZA 4GPIB 1AH2A 3WWOA 1QGUB 2W37A 1VL6A 3MQ4A 4MYUA 4B46A 1R3UA 2Q4DA 3NBKA 4ZZ3A 2YKGA 1BG6A 1KU0A 3EPPA 3F6YA 1PEYA 5EZ6B 3JQPA 1EWVA 4XQEA 2IEGA 4W63A 4CIBA 4RDCA 3HRKA 1G63A 4A7PA 1PJLA 3I0MA 1SD2A 3GAZA 2JFBA 1YFKA 2CJYA 5K3BA 1TVEA 5B1HA 1VZ2A 5SYNA 4XWOA 4C01A 4YRZA 2DQYA 2OBFA 1JFRA 2HDNB 5J23A 3GFPA 4LF7B 1O95D 2VQFB 3KUCA 3BDIA 5LZ2A 2P2NA 1T5IA 1JH8A 3L06A 3QKTA 4JB2A 4JBNA 1VCIA 2ZETA 4HYTA 4QOFA 4TXLA 1DIAA 3Q3CA 5FTLA 1ZH4A 5K8IA 2W2KB 3TSZA 4B83A 4CMKA 3HKCB 5KBYA 1R3DA 4KAJA 1CK4A 1JTVA 5H1YA 2I03A 1MW8X 1GZHB 1MRSA 1XKTA 2E1PA 5IT9A 3W5BA 4YTEA 1CYEA 1HQYE 1V7PC 5CG2A 4MZXA 1SHTX 5DDIP 5M04A 3CNEA 2DF8A 4XD7A 1Y8RA 4JC8A 3MD9A 1HDYA 1VKHA 4XCQA 5KKCA 5JU6A 3ZLUA 2DQ4A 2PPVA 3EVNA 3LQQA 3BBPA 4URHA 4EH1A 1S01A 2XRZA 1N2SA 1LU9A 3BFKA 2BMDA 2H3EA 2B5VA 3ISVA 3BTUA 2GGSA 3D4PA 1OFUA 3L46A 4PSCA 5CUQA 3U49A 2X7JA 3PZRA 4OMFG 5FI3A 3F1LA 5DYTA 2VKQA 3G8CA 4QTTB 3VO8A 5CDUA 4HD8A 1DIOB 4W1PA 1N2XA 5ERXA 1EU1A 2GF2A 2ZAYA 1PEAA 1XCLA 3AEUA 3B6EA 3DBVO 2W2NA 1PJAA 4PW0A 2XUPA 2WVAA 1W0JD 1PLLA 1DBRA 4HXYA 1RPNA 3CF4G 2XMPA 4GECA 1ACMA 4YFYA 1AKEA 2D0OB 1V16B 1PKXA 2YHAA 3HDJA 3A1EA 4A6EA 4YAFA 4YVFA 3MTIA 3N76A 1YQTA 4QUKA 3H9JA 4F11A 2AFIB 4D9JA 1UZNA 4M49A 3I9LA 4D25A 4K0KB 1ZLYA 2EP8A 3SF8A 5C8XA 1ETUA 2CHVA 2QJRA 4JELA 1XVUA 4WZAB 3S2YA 3V7FA 2AMFA 3CLTD 3MELA 4UD2A 3W2HA 2VDWA 3ACBA 4EZBA 1QAMA 3A32A 2IITA 1PK9A 3DEHA 2CL7X 1EB9A 1EVEA 1PL7A 2QYTA 5C1PA 4AF8A 3G2PA 3L0OA 3OG9A 3IVCA 5HQ3B 3NHKA 3DVSX 4KR9A 1W6UA 3BPSA 3PFHA 4B74A 3GPDG 1UODA 2Y1OA 3QTBA 2PBLA 5AJXA 4JEIA 3CBQA 3ZWPA 5AW2A 3NBXX 4IP0A 3UWOA 5KC8A 1ACJA 2WAOA 3HB9A 4PO3X 3T99A 1CC1S 1NUSA 5CVDA 2ZS7A 5AKKA 3JR3A 3TE7A 1M0WA 3AFGA 4JR2A 1Z2DA 2A9VA 3SZLA 3V32A 1VBFA 3DBOB 2GD2A 4LVOA 3TXXA 4JD5A 3CMCO 3GT3A 3EG9B 2G9QA 1X3SA 2P11A 4RK6A 1NVKA 1ELOA 2O2IA 2Q49A 5LZ4A 3K3PA 4RF3A 4H7DA 3L1JA 4BE7B 1DJQA 1T29A 2PM8A 1SB9A 2A0KA 2BZGA 4JX8A 5I9LA 4C4YA 7ADHA 2FPIA 5KQMA 2QSYA 2PYIA 1E3WB 5AUNB 2YJ3A 3TAUA 5HRAA 1V9SA 1J99A 3I64A 2Q1UA 3S0JA 4YX9A 1HUQA 4JR0A 1VJTA 1U7UA 1UBTS 4DLBA 1Z28A 2XWBF 2PEZA 5CW1A 2QVXX 3IO3A 3RS9A 3GYGA 3MSCA 5E1DA 4BC1A 4BFLA 2NXCA 3T5PA 2BTEA 1ZITA 3QQPA 2JLSA 3K4PA 2BEUB 4M8LA 3D4OA 2JK1A 3WLNA 3O47A 4KE8A 1GL9B 4MYHA 2TMGA 5FULA 4CKWB 5EN4A 3PI6A 1LFDB 4CTMA 4ERNA 2J3QA 1USGA 4RUKA 2AOWA 4DA4A 2AT1A 1IEXA 1QIJA 2BE9A 3UKDA 5TEWA 3GZ4A 4YV2A 5JXIA 2QU7A 5G0WA 3EJ6A 4I19A 4X61A 3JRWA 4N0MA 5EFOA 1KYQA 4CLOA 1YKSA 2VO1A 2WTMA 2QX7A 5D7NA 1YL7A 2JLCA 1KBQA 3L6OO 1XDBA 4JQZA 1E6CA 3L7JA 2Y8EA 5JAIA 3VOAA 1E3MA 2AG8A 1FXWA 4LRTB 1IHXA 1OAAA 1JXMA 2HK9A 2I33A 1RWWA 1KJYA 2JCYA 1HI9A 2E7ZA 2QJTA 3NGLA 4KMRA 4DDWA 4B4UA 4IH4A 1M6HA 5FPQA 4BMPB 1ZUNB 1BCRB 4WTOA 2X15A 4D0RA 3CRNA 4RV4A 5E7IA 4D1YA 4FB4A 5AVXA 2CLHB 1CY2A 4FNGA 2GH1A 3P9RA 1MC4A 3WIDA 3SBXA 5G41A 2FX2A 5CFRA 1M34E 4U00A 4BIMA 3C3JA 5D5QA 1LLCA 1G5QA 1Z29A 2HWKA 1WXIA 5DWQA 4C4XA 1F8GA 4OHYA 1ZX1A 3DAHA 3MYYA 4MQ4A 1SCAA 1C0PA 1BNCA 1CLUA 4WCFB 4KV7A 4ZT3A 3UMVA 1VYUA 4GLJA 1Q1QA 4RKWA 1AS2A 1T8UA 4XVHA 4A92A 4ZYVA 5JZMA 5G53C 2IBTA 4YV7A 1TAHA 2Q1WA 2A35A 1T8PA 3ND9A 1X7WA 3NCHA 4BJ6A 2VJMB 3IT2A 3K8OE 2QQGA 3KHTA 2ZU6A 1JI3A 1X19A 2BHSA 2HLDA 2QZZA 3GZNA 1JQJC 3JAKB 3SQNA 5M7EA 3HJHA 2DWCA 1OWPA 1HNNA 2FEOA 3WB0A 3GIDA 1XA3A 4MJLA 4L5YA 1FE8A 1Y9ZA 1XUOA 2D8AA 2EP5A 3IGFA 4H1VA 5BNZA 2J4FA 4BN0A 4IIHA 3EE6A 4U2DA 1SURA 2VH1A 2XYGA 3ANLA 1SK8A 4Q9AA 2O2EA 5C3MA 1O54A 3G8YA 5F9FA 4TYPA 1KI6A 4XGKA 1ODLA 1Y3DE 1YQEA 1SU7A 3BE6A 3RNOA 1AGNA 5FUYA 3RS0A 5CFZA 3HNOA 6REQA 1RDFA 3B5IA 5DH9A 3RVKA 2C9CA 1T3ZA 1Z2OX 1GNPA 2RJNA 3FMPB 3UWDA 3UTDA 1N6OA 2BEKA 1YHZA 4CF6A 2H63A 3RI3A 1OH6A 4TROA 5JV5A 3M34A 3QU9A 5EJ7A 4FC6A 4NK5A 1NVTA 4QICA 3QE2A 4W9RA 1SHZA 4MKGA 2XCRB 5J1SB 1MN6A 4FGLA 3WADA 3HCBA 2X0EA 2GN1A 2F3TA 2VUTA 4TTSA 1G66A 1O5TA 4QZVA 4C7OA 4TN5A 1XGKA 4JEHA 2IPMA 2O4CA 3DAGA 3LKVA 3MS4A 1SHJA 2O2DA 1VMIA 4N0EA 5ERYA 4DUPA 2H1CA 1RWMA 4BNYA 3Q9UA 4H77A 4E32A 4KVFA 4W9NC 5FHQA 4B32A 1X1SA 4ZK2A 4F1WA 3RLIA 3NFYA 4DN6A 3A14A 2FN8A 421PA 2RI6A 2I76A 1XAJA 1R4AA 1SC6A 1N2ZA 2OMKA 3F73A 2QB5A 4BVGA 2WYIA 1PNRA 1OCEA 4LGYA 1BYUA 1KY3A 4XOUA 4UU8A 4KREA 3LO5A 3PXAA 3G5UA 4L9RA 2JGMA 2VDJA 4MWSA 4R8SA 4FHFA 4B35A 3DBIA 2V9ZA 5CM9C 1QGZA 4AURA 3AVXA 2OENG 2WVGA 1YZHA 1PR6A 4J91A 2IYLD 1Z39A 1L5NA 4ANFA 4AXXA 1SEPA 1UFRA 3GFFA 4UTVA 4TWBA 5EXEA 1YZNA 1JMKC 2VQEB 3TW6A 4C14A 1JRLA 3PGJA 5ISMA 1NKSA 1A04A 1GGKA 4LFAB 3K32A 5ELMA 3MQ2A 4CQMA 3A31A 3G82C 3GQVA 3EXIA 4RJJA 1Z4LA 5AXDA 5DRTA 4IIXA 1IUPA 3DUWA 1JSXA 1RM5A 4XFDA 3UB3A 1ZJ6A 1CUCA 1Q12A 3UVEA 1RCFA 3HB5X 3CZ4A 2R6HA 5AVUA 4KSBA 6LDHA 2QG4A 4YMHA 1U28A 3RYIA 1O0SA 4ZJUA 2MSDB 4UPDA 3VOTA 4D99A 3OQIA 1JLLB 1ECJA 1U9JA 4G9BA 4QQ8A 1BEEA 1SCNE 4DMRA 1PR1A 1P81A 3OI7A 1R0RE 2WFAA 4YK7A 5ALVA 3JZDA 1VKZA 4NDAA 1UBJS 4V3BA 4GPEA 1UADA 4F86A 3RYHB 1L8XA 1DV2A 3OFKA 4C89A 1N9GB 4KOEC 2ZP1A 2PX0A 3W9YA 1M54A 1YQWA 1GUZA 4C3ZA 4UTOA 3OE4A 1GQYA 4URYR 2F1IA 5JRZA 1G5PA 3WMEA 4DSZA 2I1QA 3CURA 2H06A 5JOQA 1C8KA 3L1UA 5JNUA 1M2GA 2NO6A 4UOQA 2Y4NA 1RNLA 3KSRA 1HDGO 4GYYA 4M89A 2C8LA 2PSFA 4N39A 3OPMA 4JI6B 4V03A 2IA5A 5LA6A 3U1VA 2Q2OA 3NPAA 1JJAA 3MJ4A 1E4EA 4JZKA 1YZVA 1SCUA 4PIPA 5DTEA 1Z2NX 1R6UA 1XRPA 2P1RA 2VSOA 1YVEI 3V1TC 4EW2A 3DKPA 1FXWF 1G42A 1DELA 3EF3A 3LLMA 3TECE 2YHBA 1TQ4A 4IJMA 1G38A 1YAJA 2PS3A 5EL0A 1IBRA 3V1NA 4BTVA 1QG2A 1RYMA 2Q7XA 4M1QA 1Y89A 4L78A 1KEKA 4BVAA 5BYAA 4TKUB 3R6DA 3D3WA 2AK2A 3EZ7A 2BEJA 1VE7A 2R84A 2P41A 2RHLA 1KH2A 2C59A 4G36A 4KQGA 4Y2HA 1V4VA 4BRZA 5MGNA 1KWKA 3PBKA 1LNZA 4YXWD 5FPKA 1D1SA 3RHFA 1HH4A 1Q1NA 5LVAA 1TL7C 4G0MA 3LH5A 4MMZB 4RTJA 2FZVA 3KUXA 1I3NA 3GT7A 4LTMA 3KDSE 5DK6A 4K9PA 2MSWA 4MVYA 4QECA 1NURA 4FXPA 1KJWA 1EA7A 5ALRA 1E94E 4WNAA 4TVBA 1XQ1A 1ORTA 1RMQA 4QU9A 2B6NA 3V2GA 3PHCA 4IMIB 3W5HA 1U5BB 4MQFB 1T2CA 4JENA 1G8MA 3PVCA 4ZVSA 5JMPA 4A0RA 1GNSA 3WICA 5BR1A 1UT8A 3OPYI 1YVPA 3U9TA 1U3CA 1VLJA 1ABFA 2VTEA 4RHXA 4KDRA 3EEOA 1LTKA 5JD5A 5J4HA 1DEXA 1P1IA 4HWRA 4Y9TA 2QX8A 2OZKA 4MV4A 3QVVA 2B8TA 1FIUA 1KQOA 1RXEA 3LMKA 1CVIA 4AS2A 4INPA 1ECBA 2X42A 2B5OA 1KMHA 4LOIA 4R9NA 4B84A 4POOA 4W5OA 1KY5A 4GKVA 2HWUA 2QS9A 1KVRA 2E5LB 3LPDA 3GNSA 4Q7EA 3Q8KA 3Q7IA 5HHTA 4JXJA 5D86A 4IV8A 5IYZB 3AHDA 3J81k 2R751 2CEAA 2GN4A 4LXYA 5EESA 1TEXA 3DFKA 3I01M 3OLQA 2CLMB 4F06A 1ACLA 2DR0A 2X8WA 3MGKA 3TTVA 4RGVA 3VR5H 4EEKA 5KQGA 1GU1A 4MROA 3HUDA 4Q5IA 5HJ2A 3WK7A 1NXWA 2WZCA 1V1MA 3G8DA 4D46A 2NMVA 2P75A 3H17A 5F76A 5FO1A 4IPTA 1RZRD 5KPDA 2EW8A 3NHUA 4ZKEA 3AJRA 1AF7A 1DTSA 3T6KA 1S8OA 3CKLA 3PZBA 4X1IB 2AUMA 4WVLA 1MPTA 4EB6B 4ZCTA 5BW6B 3FWHA 1UEXC 4MVJF 4BWGA 2HTFA 1VKRA 2BJWA 2PAAA 4HYEA 4N3GA 3CHYA 1NN3A 2Q07A 4FBMA 2PRSA 2ADFA 3M70A 4LDZA 3V8MA 2FPXA 2FE1A 3D6AA 4FGWA 2H08A 3MT7A 5IWCA 3UCFA 3WXBA 1VA4A 2Q3DA 1J4AA 2YWGA 4E12A 4HR7A 1EVKA 1VPVA 3IQEA 3OTGA 1QVAA 2EIHA 5L6MB 1KXJA 4RVSA 1BMFD 1EGMB 4ZO4A 2IHJA 2H92A 2WSIA 4P7GA 4KOAA 1NVUQ 2B1QA 3HCNA 5EPEA 3G68A 3D8RA 1P4RA 1PS0A 3TH5A 4DSNA 1E69A 2O54A 4ZCRA 2RHMA 2VZEA 2W2OA 2VJNA 1HDEA 1XVLA 2HL6A 5LOVA 2FMTA 5TT1A 3I5AA 4L5AA 2ET6A 4NESA 4MB0A 5SYAA 4OUDA 5JE8A 1IVYA 1JBQA 1RAIA 1YB7A 1L7MA 1OLUB 2C82A 4K7JA 1GU7A 2B30A 2QX9A 3M1AA 3LK6A 2YJ5A 4FFBA 1UR5A 2ONCA 3IBFA 5LB4A 2WU3A 3T38A 5AVKA 3DZIA 2CUNA 3FMGA 1B93A 3CKKA 3C16C 3DOJA 5JNWA 1NPDA 3TLGA 4UVHA 3FTEA 2XH8A 2L42A 4WY5A 2DBVO 1WABA 3ZY3A 3GJ3A 3JRXA 1F3OA 1UK9A 1NF2A 1XDGA 4GW3A 5ALWA 2GKGA 1BXRA 4OQMA 3NHSA 4QU8A 1ZVJA 2X58A 1VECA 4R68A 3AWDA 3E3NA 4NV1A 2OC9A 3E9NA 1OLOA 2OA0A 4R1OA 2I3BA 2BMFA 5CVUA 5FB3A 3PSAA 1ND5A 2W4IA 3DD5A 1L4LA 1BU8A 3HG7A 3PGKA 4PYQA 4EA9A 3QX3A 1T8SA 5JLJA 2RHJA 2ZANA 3JW8A 1NBMA 3N0VA 4QG3A 3WHPA 5J4LA 4PXAA 1GZ5A 4QSMA 5B2FA 5A2QA 1LF5A 3TQQA 1LY1A 3RRFA 1ZM9A 4N5IX 2AWOA 2ZYUX 1M1ZA 4C2BA 4RQBA 4PR3A 4MS4B 5IXSA 2PKWA 1IHPA 4M1YA 4TRRA 3FUUA 5C0OE 4F9FA 3N53A 1E58A 2JFGA 2XT0A 3M6IA 3RS8A 2IZZA 2X9GA 4C0LA 2B34A 2GDJA 4PYRA 2NVUA 2YZMA 3EARA 2XRFA 2PGOA 3NTXA 4GQBA 1JHRA 5GVRA 2BKXA 3BHJA 3LCUA 4D8UA 4YRAA 1N6HA 3UXHA 4AG3A 4CUZA 4EY4A 4ZCIA 5HIAA 1IXYA 4BYGA 1U1EA 4RIHA 1FNMA 3OD5A 2X0JA 3PE4A 3AQIA 4OYRA 4MMXB 2ZJOA 3WL6A 3GVPA 4HWSA 4WACA 3H1AA 2C5HA 3T5MA 1ST2A 3FYCA 1CP3A 5B7QA 5D8DA 3UAGA 1T6XA 3G9QA 2CJWB 4Y6OA 1RC8A 1W0KA 1F38A 4F4HA 3N1UA 5E38A 3QFRA 3H1GA 2RB4A 1RHQA 5BSRA 1N8TA 2KHZA 2XNDA 3LHFA 3CR3C 4PCAA 3VHRA 4ZV7A 3IL2A 2CUKA 2M98A 1JA0A 2XB9A 3QV1A 2WG0A 2G76A 3I09A 1H2FA 4B2LA 1C9MA 3UT0A 4IVRA 1LI5A 2B4KA 2NZ2A 2OWEA 4WJLA 4PSDA 5FPYA 1KYYA 1R4NA 2GXSA 4TS9A 3DVQX 2V7BA 3VNRA 3ZOZA 1X14A 2PZJA 3J81A 4P0PB 1NLYA 1PZXA 2XTNA 2VXBA 2MYNA 1UIMA 4MDYA 4TZTA 2FSIA 5B6IA 5AJWA 4WLVA 4OG2A 3VM6A 4Q18A 1N57A 2OK8A 2BFCB 2VSNA 3A1DA 4YJGB 3V4VB 2P9GA 3EH2A 3X43A 3D0OA 1KDTA 2CMGA 5EWLA 1ISHA 4JJEA 3U19A 1N0HA 1GTRA 3RC8A 4N7JA 3FTPA 3ZJUA 2YHUA 4PNHA 1V3TA 2JEYA 3II6X 4L27A 5ILOA 2BHNA 1L7OA 1CS4C 1L7PA 4HFJA 3P0FA 4OUKX 1F8YA 1COWA 1Z56C 2SICE 2ZBEA 4A8TA 1Z4QA 4O29A 1OX4B 5FNVA 2CNLA 4FX5A 4AZVA 3JTEA 1TEZA 1RWPA 3MCWA 4GU5A 2A0FA 3VDQA 3ROEA 5T67A 3SJUA 2OECA 2RG7A 3WKCA 3ZDEA 3NNSA 4KPUB 1JEQB 4I46A 3W7VA 2XCTB 5P8WA 1N75A 5TQVA 1MXFA 1UBSB 1Z9BA 4QDKA 2CBXA 4ER5A 2I1VB 3WL5A 1WIWA 1YU6A 2V8BA 2JJ1D 3OTIA 4HNAB 3E9CA 3DLPX 1NJ5A 1TEHA 4NS1A 5FFMA 3DOUA 4E6EA 2FPMA 1L1RA 3HI4A 4M0UA 5AKJA 1WULS 5KTPA 4TMKA 3SBEA 3V7WA 1HURA 1Q17A 1V6AA 1CUUA 2V6MA 1RC1A 4KVGA 1QHEA 2ZEJA 2HIHA 3KLOA 3ASVA 1MJGM 2WM8A 4CGYA 4ZEMA 3JWJA 1PWHA 5A4AA 1U7ZA 4OL9A 2IS1A 1JSCA 1UWCA 1NZDA 2NUPB 4YRLA 3RWBA 4LISA 4DCOA 4R01A 3OT1A 4TM7A 3FBGA 2O7NA 2GD0A 4ZQIA 2P78A 3K96A 3PGMA 3ZX4A 1UBHS 3H1PA 4URWR 4C7MA 2BGWA 3R3JA 2GN6A 2Z58A 4FDTA 4FS3A 3BGOS 4YAOA 4E6PA 3ZE1B 1J9EA 3BD6A 1F2UB 1QQTA 3G17A 5CH5A 5HRUA 4HL6A 2C2MA 1QS0B 4PHGA 4QNNA 4CIAA 1R27A 3QVGA 2VC2B 1WUTA 2GXQA 2I2CA 2RC6A 4M0PA 4X7MA 5LNK6 1K3FA 1S7GA 3CZCA 3IVXA 1BCSB 4LRUA 4ERXA 2OO5C 1N0WA 5F7ZA 5CFPA 4KGZA 1Z07A 2QTCA 4CLDA 5KU7A 4G1UC 2H1FA 3M82A 2QN9A 4HH3C 5ES3A 3TE6A 4HZIA 4HGQA 4J94A 5JNVA 4PO9A 4ARUA 3B3GA 1C14A 2GZHA 2UDPA 2N1BA 4DQ0A 3NHAA 1DHRA 1EP3B 4JC5A 1CB0A 1E8NA 4LC9A 1P74A 2ODAA 4Q9KA 1L7DA 1JHPA 1K88A 4F72A 3GJXC 2UUBB 2XUAA 1G2QA 4MS1B 4I3HA 1CUYA 1DEAA 4UUBA 4IJVA 4FMCF 3D2CA 4OB8A 1N5RA 5KREA 4CV3A 3ZY5A 1Y3IA 1SBNE 3R2JA 3IA7A 3RUEA 5C4IA 3O3NB 2HKIA 1LV7A 1HDOA 2B69A 1UBNA 1YZLA 1YIAA 2CHGA 1CVLA 2P91A 3NT5A 2XTZA 4MRAA 1ADGA 1IN4A 1KZYC 2TMYA 1TM4E 3PGA1 5TJ9A 4DREA 1C0IA 1JDJA 2R6R1 3TOXA 1CHNA 4RK1A 3U4CA 1C1XA 3ZHYA 5JS7A 3VYSB 3FR7A 1JR2A 4J1QA 4Z51A 4LCEA 3A1CA 1RCTE 4QDTA 2XE7A 4ALKA 4YCLA 1CEXA 1ENPA 4N5DA 1G6OA 1YJ5A 2CXXA 3H16A 2I67A 4LHEA 2ZT8A 2WP0A 4M21A 3N8NA 5IDYA 4QUJA 5LB2A 4WZAE 4YJHB 5AXAA 2GBFA 5CPBA 3VR4H 4XYLA 4GS5A 1DKNA 2HCTA 2IIPA 1EZZA 2I65A 2NSLA 4A1FA 1E7SA 3F8SA 3N86A 3KD3A 1QZZA 3A0UA 3FA2A 4GLFA 4QQNA 4NRDA 2HMVA 4TM8A 4DC0A 3MINB 4P80A 4DSAA 3CZRA 3EFBA 5AJZA 2CFSA 5L7YA 4O2LA 4KWEA 1I5RA 1GTL1 3SXJA 3TBKA 4RULA 1V41E 1R9GA 1OU0A 2J6CA 2JEZA 4M1OA 1E59A 4OHBA 3SBOA 3KLNA 4KQ1A 2ZUCA 1BQ3A 5CCXA 2QT1A 3P9PA 3BTVA 5AKLA 1TVKA 3PLNA 3WFZA 4BY9E 3I9MA 2WZDA 4MQMA 1ANKA 3OQJA 2FW1A 3ZKWA 4B7UA 1GM5A 1RXYA 3FVTA 4QLAA 1S2OA 1O8BA 3M5CA 1JHMA 3ZE2B 3TG8A 2A59A 5A9TA 3AV3A 1PYOA 3MWYW 2CGEA 3O3MB 1WS6A 2QP9X 3BGIA 4BMVA 5HK9A 2V3WA 1I4LD 1KY2A 2Q5IA 1G6Q1 4BX8A 1KVUA 5DWVA 5KTSA 1ID8A 3NNDA 3MLEA 4A2QA 4AYWA 5DNUA 3PX7A 4JP5A 4OKSA 4L5BA 3LM8A 4RM3A 2PUJA 4EP1A 1E6MA 1SXHA 3JQ7A 3TIFA 4WIAA 2JH9A 2NO0A 2Y1WA 3B2EA 2AEJA 2Y99A 4FBGA 3R8XA 3UMCA 1IWPB 2CXUA 4ETWA 2AJLI 1NBME 1MQAA 3VHXA 3ME5A 4S12A 3AILA 5F73A 2FFQA 3JARA 2BE7A 4QFDA 3CQ9A 3AIOA 2IZ5A 2YV1A 1NHGA 3MT9A 4MYDA 2FZKA 2XDYA 2PHZA 2R87A 5LBTA 5FADA 4BHTA 1CJMA 3WLIA 5L95A 4Q1FA 1ZN8A 4W5RA 3TEMA 4BATA 4MI6A 2AG6A 2NTVA 3MMZA 1K4YA 4NMWA 5SV2A 1AXGA 1YE8A 2XUOA 5CFOA 2FZWA 2AL7A 1SWVA 1YVRA 3FOWA 2NUTB 4MX8A 3I05A 1LSJA 2H2WA 1UJ4A 3KELA 3AJEA 1R0XA 1VMEA 1YL6A 2Y05A 4Q3NA 5EQTA 2RHWA 1XPJA 3Q3GE 3L7NA 4HHEA 4PLZA 8LDHA 2CJXA 3ETNA 1S02A 2BKAA 3L0BA 3NC1C 4MOWA 3EVGA 1C7RA 3H5WA 3ENVA 2NU8A 4ESOA 3OTWA 3DOFA 4XSVA 3E81A 3VNVA 5IJAA 4GOKA 3HH8A 5ECWA 3ZCXA 3L43A 4RMNA 2BFDB 2QG9A 3DBHB 5E4JA 1VB5A 1OBCA 2YMPA 3N6RA 3STUA 4ZI5A 3AUSA 5E6RA 3SPXA 5JVDB 3ZDBA 1DINA 2IYRA 1QS0A 2VBIA 5BN5B 2SKEA 2JIQA 1TF2A 1FSPA 3IVAA 2DLNA 2OUIA 2XLBA 3QU5A 4KRXA 5B1DA 4HGZA 2CXHA 1J0AA 2VJYA 4EDFA 8ABPA 1K6XA 1D4OA 1U0EA 3IVRA 4AX8A 4L51A 5J5AA 3U0VA 3AESB 3LDGA 3ER8A 2VWHA 1GL7A 5KWVA 5HJ7A 1QG0A 1M7BA 1N2OA 1ORHA 1LNSA 1USIA 1E1CA 1KI4A 4RPHA 3TW8A 5KOJB 3U81A 3W8NA 1OC2A 2EF0A 1JWLA 1FQWA 2VXCA 4JSRA 3WSTA 1V37A 3GMSA 4GRAA 4L3VA 4WKCA 1MZVA 3TZEA 3CH4B 4MRMB 3P20A 2NVWA 1CIPA 1Z4NA 1J9GA 2IELA 1CY8A 3D54D 4MLDA 1S8NA 4WKBA 4L2IA 2JI6A 1FJXA 1R0BA 3IBCA 3ETJA 2AJDA 1GGEA 1R12A 1YRBA 3EDRA 3MGGA 3JQ9C 3Q88A 2X3FA 3TZBA 1TUGA 4ASUA 4HWTA 2JVJA 1AN0A 1GRRA 4XWAA 2O52A 5KYNA 1YC5A 4LNHA 5CD1A 2GFQA 3B89A 1ZD1A 2F1JA 3I04A 5LA6F 4B7ZA 4MPTA 2PWPA 5T64A 1DIHA 4FYWA 4UCXA 1NQUA 4J16C 1U04A 3FLEA 2DKFA 1L4GA 2VYVD 3ZVMA 1K4KA 1U0LA 3B36A 4RD2A 2DSTA 4G4SO 2YVAA 4RANA 1JYEA 1A8PA 1O0BA 3QE4A 2OSBA 3MG9A 3CB4A 4MUYA 4Y7CA 5F51A 4HMOA 2P8SA 2DCUA 3GVHA 1QR2A 3HN2A 2OORC 4Y2QA 5K8JB 1EKXA 1JFLA 4BV8A 4NU0A 2QYSA 3VR4D 3GLFB 1N2CA 1GA1A 1N1DA 1PSWA 1XDSA 3IO5A 4G07A 1KJZA 2WJIA 2WJ6A 3LHSA 5KWEA 2VTBA 1HPLA 4EG1A 4CM9D 3FPKA 1PFQA 3UN1A 1WPRA 1JFVA 4LI3X 2XMGA 1EFVA 3DGEC 3JARB 4C7XA 3OIVA 4QHYA 4F3NA 1C0EA 5IXYA 1LK7A 3BRCA 3MJFA 2LE0A 1AVTA 3N39C 4BLSA 4BNGA 4KR7A 1KI7A 3HA7A 1IY2A 1JHZA 4QOGA 4RMJA 2H11A 3H99A 5B4VA 2AEEA 2GD6A 1Q5PA 1GNRA 1ZW6A 5GAJA 1GVNB 4FHZA 3CR8A 3PC2A 5BN4A 5IZ4A 3LLUA 4IXMA 2BHLA 3GEEA 1KBZA 2X8LA 4IRUB 1MA3A 3WJ1A 1ZL0A 3ZJ5A 1SFRA 1DBQA 3V8PA 2PUFA 1Z2PX 4J07A 2VHJA 4CG3A 1ZNWA 1J24A 3FPGA 4PINA 4DRYA 1VBMA 3SXPA 3L7AA 3P27A 4L6CA 1H8HA 3RUIA 2ID7A 2R65A 3P32A 4U1RA 2G7ZA 2OVFA 3D6VA 2ODBA 3RODA 5DHAA 1MO3A 1XMSA 2F6RA 3WGJA 3D8BA 1GNLA 4XTRA 3ABIA 3EF0A 4NENB 3OCVA 3WQRA 3KWFA 4HAYA 4R9UC 1T2FA 5F23A 1TJNA 3NM5A 1R0WA 5AJHA 1QVRA 3I1FA 1W36B 2QZ4A 1EIZA 4OKNA 4G1EB 1Z22A 2XYVA 2YIDA 4QJ3A 4UQOA 1Z0ZA 2QRHA 3FHCB 4IY1A 1AKYA 4RDHA 1VCNA 4XJVA 5LIPA 1PGQA 3CGWA 3QMPA 5CG1A 3N2IA 2CKMA 4NYIQ 4WSOA 1P0IA 4JUIA 4R1SA 5E7QA 3ZCQA 4ALNA 2ZUSA 4TT3D 4YXWA 2CVPA 3U48A 5AVYA 4QREA 2GQ0A 3OF5A 4WLFA 2GO7A 1G8PA 2AW5A 3SYLA 3ZGYA 1YBAA 2AN3A 1S8FA 3P2IA 1DC3A 2FB9A 1OTYA 1C1XB 3AVQA 3DXZA 4FFVA 4M1SA 1GTSA 3R23A 4NZ9A 4E30A 4ALIA 2PL9A 9MHTA 5HKKD 3FVRA 4FFBB 3RC2A 2V7TA 2ZBDA 3EZYA 2C9YA 3W3AD 4HMPA 4OUDB 4BB0A 4JP1A 3DO5A 4H3HB 1OZFA 3BWXA 5AM4A 4DOMA 3COZA 1UDRA 1AZWA 1A9TA 4HS9A 1O97C 2VP3A 4MS1A 1YBMA 2R1ZA 1X86B 4E15A 1NT4A 2E89A 1R15A 2BSQA 1MOZA 3FTQA 4J16A 3W3AH 3TIVA 2QUIA 1SQGA 3B12A 1ADYA 1JQ5A 1XLTC 2HFJA 3C3KA 1ENOA 3WJ7A 3GG2A 4RESA 1X3LA 2FOIA 1IY1A 3N2LA 4KB5A 4XJXA 1QYDA 3VNBA 4X90A 2A78A 2V5UA 3T3NA 1KWGA 2QPTA 5GM1A 2ZJ0A 3SOZA 5DF1A 3UK6A 5CT5A 4NAVA 3BXGA 3KEQA 4XB1A 1TPZA 2VK4A 4CF3A 2QTRA 3IMGA 2LKCA 5AOVA 2P65A 4QGSA 2PQ0A 1QIEA 3NHJA 5FO0A 4RIGA 3KB2A 5FOXA 1SQFA 1T8TA 3VH4A 2GSDA 2AG1A 1LB1B 3LXRA 4Q9NA 4Z8YA 3V9AA 5JJBA 3OWHA 2HK6A 3OPYB 1GWNA 4NCHA 4WK4B 2I2XB 4G6ZA 3C8MA 1MG5A 1D4AA 3ZV6A 1HV8A 1Q16A 1RWOA 4M8IA 4OK6A 3DW1X 4REOA 2JVIA 2AD1A 5EE9A 2WKQA 1W46A 3NALA 4EY3A 2D7DA 3FHTA 3P5SA 5JS2A 2QM8A 2II6A 4OAPA 2F43A 2JFNA 2Q9UA 3DFIA 4X64B 4JJAA 2PZGA 3ETEA 4RPLA 1VXOA 1F6DA 4ZDKA 3NPMA 4Q03A 2FP4A 4ZQHA 4RDIA 3IIJA 2QD2A 4MQ5A 1ONNA 6NULA 3DE3X 2K87A 3OE1A 1FSSA 2VL7A 4LWOA 4PX2A 1YBHA 1GRNA 1Z75A 2B7CA 2WNSA 3RFCA 3ADCA 1GG9A 3MBOA 4KPUA 3WYGA 3HGTA 3HZZA 1JIJA 4JKIA 5EG5A 3A6PC 5L3QB 3LL4A 3VAAA 1DNPA 4UDOA 4DMKA 2TECE 3SIRA 3O7MA 1ZPDA 4IF4A 4PC2A 5B1YA 2R6AA 4P8RA 2QVZX 4MR9B 5IU6A 1ISRA 4S1PA 4UNIA 1KO5A 3LYUA 2VP0A 4HDAA 5AESA 5MFPA 2FR0A 1B0ZA 5AK6A 3CSUA 4MUGA 1TDJA 4K5QA 1BIFA 2I9PA 5AHRA 3IV7A 2VAWA 3BD8A 4ZODA 3C45A 3P4UA 3CH5A 4OQEA 1CZOA 2HBZA 2HMSA 1U5BA 5COBA 2DJ5A 1TUEA 2C31A 2I7TA 2YVUA 3FPFA 2YW2A 3AUYA 1KI3A 3KDPA 1NSFA 3ANYB 2D6FA 5IN5A 1C9NA 1Y4UA 4F56A 1JR6A 2F59A 4ZZ0A 4FINA 2XGMA 1RQRA 2NADA 2ZJ8A 1J0BA 2D2EA 2HD4A 2QLTA 1VYVA 1Y9DA 3JVEA 1Z6PA 3QLTA 5K3FB 4B40A 1R4NB 4TT3A 1NVEA 1RJ9B 2IUEA 4JK3A 2AOVA 3GUYA 1RI5A 1GADO 1NBAA 2YFQA 4I8IA 4PFQA 4DBLC 3K1AA 5JDIC 1F1JA 1RKQA 1C4KA 2UZAA 1WRBA 3D3WB 4LKRA 2OD9A 1AGXA 3ORYA 4A8JA 1WEHA 4RV5A 3I5YA 3ZVKA 2M1ZA 3TNLA 2XUFA 2HT6A 4HDCA 3P9YA 3C7KA 4P4GA 3OSZA 1WHSB 2XZLA 1KPIA 1ZA1A 3ESRA 1PZGA 5LXTB 1HMPA 2RI0A 2QRJA 1IBKB 4QXPA 2P6NA 3QVKA 2BIFA 5EVJA 2ZIFA 4ILKA 1L4BA 5DLEA 4I1YA 2R5FA 4EO4A 2R7AA 3S1LA 2IYOA 4PXSA 2DPHA 4R0MA 2O7SA 4NXMB 2D7JA 2C7BA 3LNCA 3FNRA 2C4UA 1P29A 3NIBA 4LKOA 1NV8A 4EHAA 3M3DA 4G01B 5DLPA 2IIVA 2ZRNA 1N9GA 5I5GA 2HWYA 3O8BA 1KTVA 2C42A 4K2AA 2ZJAA 4UVGA 2TRSB 4YUVA 3V97A 5CD9A 1KZ4A 2O8EB 1BGVA 1OGIA 4YQZA 5K3SA 1HTTA 4MPJA 2J0SA 5IFLA 1X1QA 3I01A 5F35A 1D2AA 4EEZA 1JLLA 2HXSA 4DM7A 3PDWA 4Q6WA 2GA9A 4TZKA 1NQXA 3WGYA 2Y1EA 1Z8FA 2W58A 5HZMA 4P3OA 4EBBA 2YRFA 4RACA 4EBFA 2W6JA 2NPIA 2J33A 2XAAA 4E08A 3S4YA 3QLVA 1IWOA 3RSQA 1FYVA 3TD2A 3HM9A 1GFIA 1SXJA 4N5MA 4PVCA 4BV3A 1I2BA 2GZAA 3BF8A 1LSOA 4P33A 4W5TA 2CXNA 1BWPA 2EJUA 3EXIB 5EMHA 1EE9A 2BOVA 3DDUA 1JHDA 1K7SN 1SEVA 2WBLC 4I66A 4KWIA 4POAA 5EWJA 3GWZA 5G2OA 1H4VB 1JEDA 1WZUA 2V74B 5CT9A 5AVSA 2ZXEA 4KN5A 2PS1A 4E2ZA 5FHRA 3NTQA 5GIPE 1O6CA 5EP1A 4GXTA 3IJ5A 4TVOA 5T4HA 2NT4A 4O33A 2IYAA 5KQPA 1J25A 4ARVA 3RFFA 4OLFA 4EELA 3E35A 3EGIA 4YDRA 3KJNA 4BVEA 4BVFA 1K86A 3BVPA 2YUTA 2IBMA 3FHOA 2EQAA 1XJCA 5ICMA 1WKVA 3TQIA 4NCBA 1C7ZA 1KP3A 1OLUA 2QRKA 3DE1X 1UAGA 1ST3A 3Q7EA 4MR9A 4C1BA 4D8VA 4EZIA 4CPDA 1NQVA 4AICA 4PSUA 1IQ0A 4HLCA 2WNIA 3DAFA 3KS9A 4RZIA 2O6HA 3P8ZA 1TT7A 3PFCA 4IDGA 4UUOA 1LJUA 4ES6A 4YP0A 3PXCX 1DQRA 1FDRA 1E9AA 4WZZA 2G80A 4O59O 1T9BA 1X42A 3L0YA 3RVSA 3CO5A 1SU6A 2RKBA 5DNWA 3AVWA 2ISQA 2JC3A 2QLLA 1C9KA 1CWUA 3ESDA 4IXTA 1PD0A 2XB6A 1Z6YA 3DCIA 5K4GA 4Q9LA 3BCUA 5CXQA 1MZPA 1PD1A 4I1VA 4YT5A 3TLJA 2QTHA 5JH7B 2FSSA 4B8WA 1QP4A 5DNVA 2HLNA 1SOWA 4IVNA 4ZVKA 2H4ZA 3W34A 2B1JA 2FUNB 4CFZA 3Q5GA 5CB4F 1KA9H 4Z6KA 1E1CB 3TW8B 2C88A 3H05A 4F6RA 1VM6A 3HDHA 2IXDA 4NFSA 3DOOA 4OJKA 1AIPA 3RF6A 3WJ2A 1HDCA 1Y3CE 2OGTA 3FKJA 4O4HF 2QRZA 4LECA 4EKNB 4OQQA 1PLJA 2C3PA 2GJSA 3BIXA 1UKZA 1E8MA 3I6QA 1PT6A 3AHCA 3EXFA 3HNRA 1NYQA 3TNFA 5BOSB 1TC2A 5K4AA 3OKPA 1EH5A 5A3VA 3TJRA 4B45A 3NDBB 1T9DA 3FFWA 2GVZC 5ADHA 3TK1A 4IQ0A 1TU4A 2E82A 4QAJA 5AW0A 2AC4A 4P2GA 1I51A 2VJMA 1W25A 3DTYA 4WCFA 4C5CA 1U94A 1XTTA 1SIWA 3REFA 4RELA 2NUBA 5HOEA 2PD3A 1FUEA 1WAMA 2PT5A 3P0IA 4TSFA 4QXRA 5E1MA 4DQUA 4E5PA 3L7MA 4IGEA 2XBLA 1RHUA 1S8AA 1HORA 3U4HA 3W8RA 4DL9A 3ESYA 2CNDA 4Y9SA 3MRVA 5KVCA 5LQAA 3NDIA 2NU7B 1GD1O 1KEZA 4NJEA 4JLMA 3GEMA 3I61A 3B82A 4CT0A 1F2VA 2NTNA 3QVMA 4HDNA 1NDQA 1JDUA 1N6LA 3DJFA 1SG6A 2VQDA 1BCRA 3UCEA 1DAOA 1RXIA 3PSHA 1MMFB 4ZRNA 2O0MA 3COYA 3EFHA 3FSGD 3IH5A 4L57A 3ZKAA 4WN3A 4RCVA 3UFBA 2HIAA 5ALKA 2O2CA 4YGYA 4IWYA 3RRJA 1UCFA 2WJWA 3E15A 3DDNA 5AHWA 3IHTA 2O0JA 3KQTA 2PXAA 3U7JA 2D13A 4ZHQF 4EUNA 4B3FX 3LYHA 4H6XA 3H19A 2ZRKA 3TIGA 1SZDA 2XNKA 2PR7A 2HHHB 3E9EA 4GQIA 1IMOA 1OVMA 3OA0A 1XRRA 1Y3FE 1LK5A 1ODJA 3CB2A 3PD0A 4GT1A 5I7VA 2NSDA 2VP2A 1GG2A 2BISA 2WOJA 3B9PA 4EX6A 2EHJA 3ZJVA 4GGMX 1FOEB 3A6ZA 1A9YA 3BWYA 3VDMA 3VHXB 2AR9A 4J0HA 2BGGA 3E3AA 1WXHA 3JYPA 4CMIB 4I4TB 1EP2B 3IUJA 2JLQA 4EA8A 1Z5UA 2G08A 2ADOA 2QZPA 1Z6QA 3TLZA 1Y6GA 1F51E 4YAGA 1DUVG 3CLRC 1H6CA 3ENNA 2JJ1A 3NTUA 5ELLA 4JDPA 3HL0A 2REBA 4LEIA 4ZI7B 1U8UA 1E1RD 4PAGA 1ZCJA 4Y1GA 4KAAA 4Q3LA 1YK1A 1U8YA 2Y0PA 1II8A 1CDOA 2VOJA 4KYUA 3ESCA 1G8GA 4R2IA 4L6IA 1G17A 3R7WB 1U3FA 1F9EA 1NMSA 2GPJA 4IIUA 3K6RA 5K6AA 4S0ZA 2XZPA 3AOEA 2AB0A 2OZVA 1ZJ5A 3QNMA 4TOIA 3WLKX 3KYDB 5EJEA 2CXRA 3WRXA 2RKWA 5AIBA 1K8QA 4E2FA 2DFLA 4UEQA 1GPAA 2BTQB 2R1VB 1UPTA 5BUQA 1OAKA 2DUUA 1G5TA 3EVFA 4TTTS 2I4OA 4YHHB 5DLYA 2WT9A 4Z8XA 1PT7A 4P08A 4XRRA 5FR1A 5ECDA 3ZU6A 5I48A 4RS4A 3S29A 4R8RA 3I5XA 4FWBA 5FT9A 2P68A 4UNQA 1I4DD 5DX1A 5IAOA 5BSEA 3LC0A 1MJNA 3NKFA 3T7AA 3K4QA 5BNWA 2PBZA 4QOSA 3OFJA 4BQQA 4WBNA 1GOTA 3GAAA 3ZV4A 5J2TF 1V5WA 3ZHTA 4H9GA 2FJUA 1N2CB 3E5MA 1J2JA 1Y81A 5DYNA 3ADBA 3GK3A 5CXXA 3LRPA 1NQOA 2AVDA 4NZZA 3ELWA 4HNVA 2W8BA 2PRIA 4JI0B 4V24A 1FYWA 1ZGGA 5K03A 1PCXA 4OL0A 3VJMA 4KQKA 1FRFS 4ZEVA 3GZTB 1A9ZA 1TLTA 2B9VA 1X2EA 1M1UA 3N2KA 3VU1A 4E33A 2Q3EA 1Y4ZA 3E1KA 1ZK1A 5MN5A 4KLRA 4V0OA 1XCPA 4TMVA 3TLKA 3X2EA 3A3KA 4N7RA 1DFIA 3FUCA 4QBGB 3MQFA 4AJ9A 4UMEA 1KI8A 1OX5A 4E70A 3MN1A 3SIWA 1EFUA 3HXQA 1M2OA 4TTVA 1V16A 4IJWA 3R7WA 2R97A 1X7GA 4QUIA 4N5NA 1SVMA 3H83A 4LTDA 3QF4B 1CUVA 2B4YA 1X7ZA 2FZCA 1P7ZA 1CUXA 1YFZA 2O7QA 4JBGA 3U3DA 3ZQKA 3ACDA 3L7DA 5LBIA 3LSYA 5AH0A 4ITRC 3V4ZA 1RT9A 1SXGA 5HK8A 2PWAA 1NR1A 4JMLA 4N03A 3VSEA 4TL7A 2NLOA 2NM0A 2VWQA 3DE4X 1RHMA 4P38A 3KSDO 3JD0A 3TDMA 4NCKA 1RQNA 4D3DA 4L0CA 3JQQA 1UEIA 4LVNA 4QX6A 4I4TA 4ZVLA 4OLAA 2Q3BA 2PYDA 5IHPA 1RXVA 2CFRA 2QGZA 3WOHA 3BSSA 2JLXA 1NTOA 1Y7HA 1EK5A 1J21A 2AVNA 2A5YB 3IE1A 2WWRA 4GLLA 3GLQA 1T36A 1NMEA 2QMYA 2WIAA 1NW4A 2ZAGA 3BL6A 5CMLA 3GLIB 3IHLA 5AM1A 1C2YA 2XNHA 2V7WA 3PF9A 2ZU0C 3HDTA 2RGEA 3KZXA 3DBHA 2H1HA 1GSIA 4PS0A 3L84A 1GQFA 4R0NA 3S7ZA 1BJRE 4IEFB 3T35A 3VPXA 1G98A 3T3OA 1J23A 3GZNB 3KKEA 4O4LB 1V9LA 4D92A 1BVRA 5B3JA 1V3UA 4TXJA 5CP8A 3K73O 2V6FA 1PV2A 4B3BA 1OFIA 5EMMA 3L8FA 1M5TA 2DKOA 2RI1A 2FLKA 3NEPX 3QI2A 2ZS9A 4KITB 1JHAA 3OIUA 2NPOA 3LUDA 1PFVA 2IVFA 4JLPA 1TU3A 3FWNA 3STXA 1DDIA 1ORIA 3ILYA 2YMLA 2WEKA 1D09A 1OX4A 1M0SA 2EGHA 2GPNA 4RETA 4CM9A 2OYSA 3CWCA 1IYZA 2OPHA 2NP7A 3H5VA 5G1NA 4PZLA 4RKRA 2C5FA 2OE2A 1U0RA 1Y7IA 4ASUD 2YWJA 3ICWA 4PM4A 1O58A 2Q4RA 2Z8YM 4O4LA 3UAXA 3MCTA 4H16A 4ALMA 4KQXA 4V0QA 1FNCA 4OX9B 2G3YA 3VR4A 3KT0A 3NKVA 3OMWA 3F9IA 1OXMA 1DWPA 2XGGA 3BAFA 3OFNA 1FMTA 3AB3A 3TS1A 1GHTA 4LJ9A 3RSZA 4R5HA 4BP8A 1UAYA 5I9BA 1T6ZA 2HIMA 3K35A 2ZYDA 1NN1A 1RC0A 4DG5A 4X6UA 3BFJA 2Y6UA 4IRXA 2GCNA 1BZYA 3F3KA 1T6NA 4IGFA 3WNQA 3C24A 1WP4A 2PH1A 3O3CA 4RTOA 5AUPB 3NVKI 4MYRA 1X1DA 2N46A 3S27A 4L02A 4M37A 4LSGA 4JLWA 4OGGA 3LPMA 3EJWA 1OLXA 4B6PA 3KVRA 1ZSNA 3SS8A 2EFCB 3I4FA 1XV5A 1ZIDA 1NN5A 3T5GA 3STYA 4CTJA 2HUPA 3N75A 2IYWA 2IFTA 3L77A 2HV8A 4GI3A 4TX1A 5E2AA 3NIGB 2PRJA 3DZCA 2W98A 3HUUA 4KMOA 3WRWA 3QUTA 2Y1DA 2TS1A 3IC5A 3H2YA 1R88A 2FGJA 1DBWA 4C7BA 1TYZA 4D9KA 2UYQA 1XLTA 3C7DB 4X95A 3SZRA 4PAOA 1XCMA 2F48A 3PFIA 2IC5A 2YZGA 1ID1A 5AI6A 1KQFA 2PANA 1UKVY 2P4HX 3FPBA 2C77A 3K1YA 4HPXB 3CZAA 3BXFA 2QJOA 4ICIA 4D42A 4ENRA 1QIHA 3CS3A 1XA0A 5U1PA 2WDPA 3VUFA 1FVHA 3AEKB 4GYJA 5FUQA 1MAVA 1QF7A 4MVCA 6YASA 1ODFA 3U7GA 2WTEA 3HGMA 2R48A 5C2JB 2VTVA 1I24A 5AUOB 1DKOA 3DMDA 2CNWD 1A4UA 1ZJZA 3KXKA 4O0MA 1E2QA 1K8ZB 4BRWA 4GVPA 2C4TA 3D7NA 5JZBA 1D07A 2PX6A 2ZCJA 1CZNA 1UMDB 1WUHS 4N3BA 1PV4A 4DY4A 2NYUA 4JJ6A 1MAUA 5F5LA 3RUAA 2C2OA 4MW4A 1L4NA 5EKTA 3TLBA 3WWYA 1QJ4A 3I2FA 4XSHA 2FLVA 2LUOA 3I52A 1KR2A 2R8ZA 2H1LA 1T91A 4LDQA 1GN8A 2YWBA 2ZYHA 3GR6A 1K08A 4NCIA 2QV0A 4M1KA 2UVPA 1OIXA 2P5YA 1P4GA 3A3YA 3BD9A 1K7EB 2AQKA 4JI5B 1BN6A 4D4LA 2IX3A 4UZEA 4LXTA 2WVHA 4OH7A 4J4TA 5KSPA 2Q21A 1OE0A 1KU6A 2BBWA 3E5HA 1EWQA 4Q4DA 1N8KA 2GR9A 2ZJ5A 2IKQA 3PK0A 1N2CE 1OBHA 4G2NA 4H60A 4ZZ2A 3TAHA 1KDZA 2FVYA 1LZKA 3ZCTA 4C9BA 3TW0A 3CF2A 2FZGA 1EDEA 1FP6A 2FWRA 2AXQA 3D3KA 3D6UA 3C7AA 3OCYA 5EHZA 1OT3A 2G72A 1YACA 3BK7A 3F7NA 3IUBA 3I04M 2FJ0A 3K72B 5CCEA 4IILA 2GBLA 2H29A 3SLGA 2IEYA 2WMYA 1UKCA 5I7HA 4V0LA 2AFIA 4FKMA 5I9SA 5CFNA 3FDFA 4KFCA 3DGFC 4CDRA 3H5IA 2WG2A 4PZZA 2A9FA 4G81A 4D26A 2QL9A 4ROTA 1JGTA 4DLAA 1H8HD 4FUQA 4K03A 5DHSA 1W6RA 5AIAA 2VHZA 4M0LA 1WWKA 4MLCA 4ZQFA 3SJ7A 1TTTA 4NCAA 4QM6A 1HFEL 3BRSA 3RTEA 4EG8A 4OJNA 3H8WA 2QE7D 1W96A 4RH0A 4RVDA 4XEHA 5A9SB 3GPCA 3CUVA 4B09A 1PGOA 3N3AC 1E1NA 4QBKA 4ZI7A 5NLLA 6PFKA 1GPLA 4TL9A 5C80A 3M83A 1K6MA 1V8BA 4QBFA 1YDWA 3HY4A 1DKMA 2SBTA 2JJYA 3B51X 3C1TA 3DP9A 3K6JA 4RK4A 1EXDA 1Y98A 1M6NA 2H4JA 1HA3A 2BL4A 3HJTA 2FFBA 3L0SA 3OT1B 4J90A 3O91A 4L9SA 1C4XA 3LGXA 4KX5A 1N6IA 5BSUA 3TVTA 3VQTA 4Z7OB 3HXOA 1P9OA 4L8WB 1MT0A 4DJEC 1G9TA 2YXPX 3I53A 1ZESA 4EYGA 3BF7A 2QAIA 3M6MD 3GX1A 4WNYA 1FU7A 1DC4A 1G5HA 4MYSA 2BJVA 2UUOA 1TMGE 1V3VA 2H2IA 4G5QA 3OE5A 3OIYA 4OYYA 5GQSA 1X1RA 2WMDA 3I2IA 4WNCA 1XN1A 3O8QB 4FIDA 5DXAA 3BE4A 3FXAA 1X1TA 2VJCA 2VWGA 1GZ4A 5HMLA 5SZJA 2XITA 2WAAA 2XVZA 3ABOB 4WW0A 3U7RA 5EC8A 1HMYA 1Z13A 1U2RA 1XMXA 4C08A 4U6QA 1G59A 2P6OA 13PKA 1VHJA 1Y9AA 5FTJA 4G3XA 5LM3A 5DYIA 1RXSA 1GTMA 1U9CA 1U0FA 2F9LA 1W5TA 3H84A 4M99A 4NH0A 3U6BA 1TJPB 4OPMA 1T9KA 2IYPA 1XL1A 3D6FA 4JBXA 3C8ZA 3JD4A 2VOEA 1ZR4A 2B36A 3AK4A 1LCIA 2VNIA 2KLBA 4UBNA 1E60A 2ZJ3A 3SKYA 4S04A 2NTYC 1J07A 3LZ6A 1O3YA 2FPLA 1KF0A 3NBQA 2H31A 5CLJA 1NAHA 4FGKA 4QIHA 1YA6A 4JJGA 2ZIAA 3QLJA 4WHMA 7GPBA 3BL8A 1U98A 5EWLB 3VISA 4D97A 2IW3A 2BFCA 1IUKA 4DLPA 2GJ4A 2A2ZA 3AH8A 3TLEA 4WNAB 5L53A 4JT4A 1L6IA 3UICA 4BMNA 3ZXUB 3U13A 3H2IA 2V96A 3R5TA 4JVLA 3V8QA 5JEEA 4HXEB 2EX1A 3LVRE 2POCA 2KWIA 4V0ME 1PV1A 4CQJA 1D9ZA 1Y1KE 2PX4A 2BN4A 4CCWA 4U0JA 1FDIA 1JG4A 2KBEA 2ZSHA 5A5FA 1Z4JA 2JBHA 1XK6A 3LT2A 5H0IA 3QE3A 2WVJA 4TKUA 3ELYA 4XVRA 1ZUWA 2OBNA 3LUBA 4F4DA 4BQEA 3P26A 3PJFA 5DBEX 4BAUA 4NX2A 1ZVMA 2CYBA 4R0VA 3WGVA 2IDKA 1EM8A 1U6JA 3EUEA 3UANA 4KACA 1FFSA 2PN1A 4MB6A 5IULC 3T5CA 4NTZA 5TE9A 4G1FA 4U7FA 3PRYA 1C3LA 4WFKA 4AU1A 4F4CA 3R5XA 3G0CA 1ZU5A 1W47A 4ZVUA 1XAGA 2VT3A 2W0MA 4XDGA 2VF4X 3TQSA 3UATA 2DWQA 1FEZA 1OXXK 2RJ3A 3AP1A 3DEJA 4QYSA 5IC5A 3UHAA 2Q62A 4G24A 1J0EA 4WESB 4KWCA 1A69A 1T5TA 1VBKA 2ZRQA 4RJIA 3TRIA 5DNAA 5IASA 4F2WA 1QNFA 1UK7A 3BB1A 4QGAA 1SD5A 5FOVA 5TPZD 1NF3A 4C21A 2RGNC 2ZKIA 3FUVA 4N1AA 2WD9A 5BPHA 3PT5A 3HCDA 4ZI2A 3S2FA 1DHTA 1E3TA 4FQ8A 3KYCB 2GKOA 1P39A 4L50A 5E3IA 2VCEA 3EQ6A 2O3JA 4PX9A 4OV6B 1AB6A 4S24A 3QI7A 2FY8A 1Y5MA 3K0CC 1WHTB 5DMXA 3UMSA 3SC2A 1QF9A 5AW7A 9ATCA 3VU8A 2AXNA 4IIJB 2HV9A 4ZAYA 1O94D 1VMAA 4YP7A 3V1KA 4EGCB 1G1AA 4GICA 4LF4B 3G7SA 2CUTA 4TSRA 4JHLA 4QTXA 1D0IA 4XM2A 3A06A 3N5KA 2GTHA 1SBQA 2HQRA 1CFZA 3WRVA 4F97A 2ORWA 4NZYA 1YS6A 2E6KA 4A82A 2BFMA 1CZLA 1NBOA 2JLRA 1DQYA 1XQWA 2W2LA 4OREX 2R7NA 1RIFA 2NZJA 3C43A 4ZHQA 3FDZB 1LVHA 2DY1A 3EA5A 3HU1A 1LS6A 1MC8A 2I2AA 3DZBA 1UXKA 2XBUA 3PD1A 4GMHA 2OHOA 2ACEA 3L07A 4FEGA 4OK3A 4QUGA 5F7OA 5U4QA 3FWPA 3PL1A 3JPWA 4GOXA 3NUGA 4QJIA 3JQ9A 1A9XA 1QH8A 1NLUA 1SVLA 2AIRA 1WHTA 3ANNA 1P2DA 3DTTA 4PNZA 1XU9A 4YFVA 1GV1A 1R9MA 3DW3X 3S7TA 3UUGA 2VZ0A 3HB4X 2ZZMA 5K0EA 2F3UA 4L4UA 5YASA 5FA8A 1I30A 3OT4A 3VR5D 1O7JA 3UGQA 3DFMA 3QHAA 3VBCA 1VI5A 3WGGA 4CIYA 3S68A 1S6YA 4LYFA 4EI7A 3L5OA 3U3OA 1X7HA 3PNMA 4NENA 1BE6A 5JANA 5HCUA 4AMGA 1KARA 4GM1A 3ZWAA 4EENA 3LVFO 3W5SA 5HKBA 4WESA 4Q1VA 3U09A 3LOUA 2X6TA 2GEBA 5BV1A 1CQIB 1U0NA 1QO0D 2WFLB 5JZ9A 1XF9A 3NX4A 5AVZA 1NC1A 2F64A 2TYSB 3DMFA 3WHLA 2O0HA 3I34X 4LYYA 3K5IA 2CJPA 3WLSA 2GPTA 3WYDA 1I0LA 5F9MA 4QD3A 5BN4B 2XW6A 3OHSX 3LUAA 5GM2A 3GO4A 4A8JB 4EHKA 4GGPA 5JRDS 3C6YA 4NOKA 3IAM6 1UDWA 1XZKA 3LL7A 3GI1A 4MV3A 1ZM7A 5EZ5A 3MIZA 3OQNA 4C7KA 1KMNA 1SPXA 1JMYA 2NTJA 3SEAA 3IT0A 1KHHA 1DLIA 3EDOA 2P40A 4LOAA 5CM8B 3TPZA 2N42A 4WH0A 4IBOA 3NHFA 3P2MA 4AG5A 4BKQA 2IH2A 4G84A 2B4AA 3RUDA 2X6QA 4HGOA 1XQ9A 4NE9A 5IYZA 1IQUA 1I7NA 2VRWA 4GMGA 5GJVC 4B4WA 1A7AA 4N9QA 3K9WA 3PHBE 1TCAA 3HFRA 4FCVA 4DLWA 9LDBA 1J42A 5IHXA 1E1YA 1CRZA 4ZPXA 2COUA 1CXZA 4GLOA 3SHVA 3NEYA 1X7WB 1ZAYA 2PSHA 2AX3A 4QOIA 1M2HA 4BLQA 2D2IA 1GT6A 4NOMA 2FWPA 3B7GA 3IPXA 4RE5A 3FMIA 4U6SA 5DCWA 1H1TA 3S2EA 4XX1A 3FYUA 1L7EA 3SYTA 4D8YA 5IF9A 1V8ZA 2Q4BA 4AP9A 3GGOA 3E8XA 2DQSA 1EUZA 4F60A 4EUEA 1C3XA 1OBOA 2NSJA 2REQA 3BBLA 4PCLA 5HEKA 3ZBUA 4AWAA 4URVR 3SKVA 4K6FA 1E20A 1YZYA 2G1KA 2NXWA 1I1OA 1MA0A 2X5JO 3BMOB 3QUQA 1US8B 2QIOA 4FYPA 4ZO8A 3IS3A 4TS4A 3ZZTA 4D9NA 3WRXC 1E5VA 3ZWKA 4B6JA 5IANA 3H9QA 5LP6B 2GVNA 4Y3UA 2QL5A 1A2BA 4QOEA 3LKDA 4LHYA 3SVLA 2DR3A 2VPQA 3KOZA 2GVDC 3WLRA 5A0VA 2CEKA 1O6ZA 4LTNA 2Q4EA 4K8RB 1RPAA 2VRBA 4DM4A 1QP8A 1KFEB 4P7JA 3GLRA 3U26A 1UK6A 5ARBA 3B38A 2BT4A 2H4YA 2YXBA 3O4FA 1VBNA 3EPKA 3OQMA 4FFRA 4C6TB 1K6JA 4KXYA 4KQWA 3V8RA 4E88A 4GWGA 2PXCA 2F8SA 4NNOA 5J2TB 2JD0A 2VDLB 4NCJA 2XCUA 2FWJA 3PXEA 1CX9B 1NPYA 2GMWA 3AHGA 1T0JB 5KMGA 2YN4A 4B73A 2QVCA 5CDSA 2IZOA 4MKIA 3UUEA 3U3ZA 3GJ0A 2EL9A 1OYVA 3GLGB 3IPCA 1NDHA 1M33A 3WWEA 3ORRA 1JL3A 2EJCA 2IKSA 1KNXA 4O4JF 3VPGA 3CMMA 4E5YA 5ITVA 3IQXA 1ZVQA 2WIJA 4IIEA 1B4DA 1HOXA 1CKEA 1UP7A 5CNIA 3GXOA 4LOKA 3SOPA 4B2PA 1P4SA 1LBTA 3SR3A 4F1JA 3FRIA 1UQUA 4S0XA 1GUFA 4G4IA 1ZKDA 1Z3CA 2DTXA 3HVIA 1NVBA 4BJHB 4DV4B 3BHIA 2ODWA 3ZI7A 1P0PA 3H0KA 4OGWA 5C5EA 1V96A 4LZOA 5AM2A 2Z98A 1NF8A 2I2WA 2ZDQA 3GHYA 4KH0A 4B9AA 4CIDA 4G4JA 4KQJA 4M1EA 1CEQA 2HJRA 2ECPA 1II9A 2FTKE 1P7WA 5KYUB 4E5NA 2C84A 1FNDA 4I4CA 3BK1A 4UBMA 1DKLA 1WU8A 2Z5GA 2OM2A 1ZDMA 1NVMB 4GEGA 1XFAA 2NACA 3CRW1 2X41A 1ORRA 3EIUA 4G0YA 3OQOA 1YS9A 4YS6A 2ZIWB 1SG0A 4BX2A 5FWYA 1GCOA 1TIPA 2JNWA 4JIMA 4CQMB 2G5PA 3KZNA 1ZOLA 4L5JA 1KYWA 3O1JC 1AQYA 1CY4A 1NXOA 1TECE 3TDKA 3VNSA 2G9VA 2R62A 3G1WA 3A1NA 2JATA 4QARA 5C9ZA 4FT2A 2JAUA 5L40A 4M46A 3JQGA 1IHOA 2P79A 1UOOA 1UDCA 4DLNA 1TB4A 5HX7A 1N2JA 5B64A 1YT5A 5G02A 7ABPA 3H3JA 2JLBA 4IGAA 1N33B 3C6KA 2OOSA 4UJ3A 3MTEA 1BVHA 2C98A 2JS7A 3C8HA 2O5CA 3RTGA 4HGNA 4ZT5A 2VDWB 5TEVA 4X44A 4E13A 4LC0A 3DLCA 2JVKA 3KQHA 4WZAA 4YLGA 2RG1A 2D1TA 5IH3A 4CE6A 3EWNA 2OFOA 1N2HA 3DWFA 2DH5A 4RVGA 1JQLB 2R00A 3ORHA 2UYGA 4G5XA 4KR0A 4MQUA 1XAHA 1B0AA 2CD7A 1E2JA 1MABA 2B4TO 3BQ9A 3CLSC 3ISJA 1XNHA 2RGXA 3OQVA 1H69A 4EGSA 2P5TB 4G1VA 1NKTA 3KFVA 5DYGA 2XIQA 1HETA 2PBFA 2QRNA 5DXJA 2PGXA 2VF5X 1KDYA 621PA 4EMUA 1Z6ZA 3LUPA 4EG0A 2QD3A 3DZ8A 3VV3A 2IHVA 2VSFA 3HO8A 3SS9X 2BFFB 4BFSA 4IFTA 4MUIA 3TF5A 1TVKB 1BDJA 1M2KA 3IURA 3OQ6A 5EEGA 5BYJA 1M6EX 1V7CA 4NBKA 3S6JA 3AUJB 4N4AA 4NFHA 3W7AA 5BSKA 4XX0A 4XPIA 3ZR4B 3UWSA 4EPVA 4R1TA 3VKFA 2G77B 2XV1A 4OAQA 1OLXB 3IQWA 1AKMA 4QDXA 3GJSA 4ZC1A 5FPSA 3S81A 4EG5A 1Q44A 5FTMA 3V7NA 2IEZA 5EZYB 2OAEA 1WKBA 2YICA 3TOSA 3FCYA 4YT4A 1TJ4A 1LUAA 2JLUA 3DAYA 3L5KA 5C7LO 2XXBA 4G5YA 3USCS 3OESA 1T4GA 4RF5A 3WTCA 1TQHA 1EJ0A 1FUYB 4FMPA 4KEAA 3WDKA 4LJAA 1U2GC 1XP8A 3KEFA 1PQWA 4MUAA 1HLGA 4X45A 3Q1KA 1XR3A 3GQBB 5B4UA 3UXYA 4IGIA 4TT8A 2ZT6A 3JU3A 1T9ZA 3GT0A 4GOJA 5TB5A 4IJKA 4RY9A 1NG9A 1CSEE 1MIOB 3LLCA 1GLNA 3L18A 3PFGA 5DTIA 2YXEA 2RGNA 1P18A 1GQRA 3PNBA 1GV0A 3UKOA 3PYLA 3HUFA 2BGNA 4DDHA 4EA6A 5EJMA 1AKUA 1C9DB 3BIOA 5HNKA 2PT6A 4RV9A 4UNRA 1SOMA 2EOAA 2WIDA 4QWMA 3UQYS 3RTCA 4Y2XA 4RTLA 1GNQA 1JEEA 1SOAA 4UFOA 1YB1A 4GL2A 1MB0A 4LXUA 1CZRA 3BSWA 5FBKA 4FN5A 2XUGA 4OMUA 5CDYA 1FLDA 1Y6ZA 4O2BA 1AS3A 4MR7B 4D4IA 4K9OA 1QRDA 1J2TA 1P0QA 5DBIA 3WP1B 4EKEA 3L05A 1B8VA 1JZQA 3AQ4A 2H9IA 1QG4A 3AM3A 3G2NA 4WGFA 3KQYA 4YMVA 2XA1A 3S5JA 4BJ3A 3X1JA 4V1CA 2UYOA 4CW7A 3GFVA 3HACA 4F93B 5ALPA 1VLZA 3HYNA 3EIQA 5LP6C 1QFMA 4CMEA 3GHHA 5DX8A 5LZ8A 3FHLA 4MH0R 4ENTA 1J5XA 2WMNB 1MNAA 2I80A 5EKDA 3B6IA 2XVXA 3O2QB 3S2UA 2EARA 4LNUA 3K6KA 1SCDA 3COJA 3KXLA 4BFWA 2AQHA 1NUHA 3L93A 1NRXA 2MSEB 3NVAA 4L5CA 1TMKA 2BEWB 4KYIB 4HRVA 2HF9A 2IHUA 2QSUA 3G9TA 4M54A 4OO3A 3T7CA 2JI4A 1C8BA 2A9PA 4BP1A 2YMMA 4CM4A 1E92A 1YQDA 3WC4A 1MBZA 2HSZA 3A1VA 5IP5A 5JCJA 3CV3A 3PCTA 3O93A 5NULA 4EARA 1QRSA 2PIAA 3AI2A 5FIUA 5JCZA 1YA4A 1ZW1A 2I99A 2RGBA 1LBHA 3AFOA 4EWLA 3CVYA 4OFBA 2PRYA 1TK3A 1QFYA 2EZTA 4J7XA 1ZRMA 4MWBA 5AVOA 5LKAA 2ODQA 1MJ5A 3HXTA 2R9VA 4G8BA 4PNEA 4LGMA 1E2KA 2C7OA 1Q0LA 4GVLA 3GLIA 3ZQ6A 5IBPA 1N2IA 1YRHA 2ZTLA 1CVRA 1ODCA 1TJYA 1CJKC 1RI4A 2NSYA 3FX2A 1CF9A 4JQOA 5DEOA 5BVGB 3MUEA 3RVLA 3T3DA 3QY9A 4ZZ1A 2PFGA 4MW0A 1UJ2A 5HOQA 1FQOA 2EQ5A 1YOVA 2FH5B 2PD4A 3E22B 4JC0A 4KAFA 5FNVB 1XU4A 3M6XA 5C3UA 4CLRB 4BPBA 3VYVA 3T3IA 2J9XB 3DT9A 5TMDA 1QHNA 1KIMA 4U2CA 4EJMA 3OOEA 2OD2A 2C7RA 4LCBA 1V3QE 3FKSA 3RIMA 3MWEB 2A67A 2RHGB 2ZWVA 4X6YA 5C8YB 1V35A 3KIPA 2VQSA 3FE2A 1Y80A 2GM4A 1HRDA 1ZWKA 5G0VA 4MWZA 1FZTA 1PTKA 1XA4A 1XZPA 5AM0A 3OC6A 1OV6A 3T3MB 1U9IA 2Q7OE 1KPHA 1PEDA 2AFRA 4G97A 2W4MA 5K3EA 1FMLA 5ALGA 3TLCA 8MHTA 4ZAWA 4X71A 3ZY2A 4UMFA 1F4LA 2A57A 2GPSA 2YS6A 3BJEA 4HEA6 1Q20A 4F21A 2W93A 5FLYA 1T5BA 1H4QA 3CX3A 1A76A 1YOBA 1FX0A 1JSRA 1MO5A 1Y3HA 4K6HA 3HCCA 3DE5X 5DXFA 1CUAA 3HSKA 4TTRA 1XHFA 1VCMA 4IZOA 1P33A 4JN6B 5KOHB 3FAZA 2BFWA 1L7RA 1P1CA 4H2DA 1NBWB 2H2AA 3VSDA 1P2TA 3KQPA 1YCFA 4RW0A 2R44A 2JI9A 2P7IA 5G3ZA 1Z0IA 3ULKA 4CYMA 3MZ0A 3NT2A 4MHOA 5LQNA 5J47A 4HLQB 2DFTA 3BXHA 1QUEA 1GZ6A 3H1TA 3PUXA 2BP7A 3C3WA 3DDSA 1F60A 1XDDA 3HKEA 3EVBA 3W0LB 3K30A 1SHLA 1RE0A 4BUJA 4JMPA 3UMBA 5K0FA 2EEPA 2RAPA 4PCVA 2NVUB 3CVUA 1NJSA 1U0JA 4AUEA 4MV1A 1QH1B 3HBMA 3PRHA 2Z5VA 1Z0SA 3DVRX 1V0JA 2IDMA 2OB2A 4M0FA 1IATA 3QSYA 1XELA 2FA9A 2P0YA 4O63O 2OBMA 5C31A 2VYFA 1TF5A 3MINA 3OJLA 3V7YA 3ZZUA 4B4KA 2DHQA 1H2AS 1V1RA 1XD2B 2Z4RA 2ZREA 5FFFA 2QPOA 1A2KC 3QH4A 3A4TA 3NG1A 1WBBA 1D5CA 1K7XB 2OBXA 1U11A 4CMIA 1ZUHA 2JIPA 1GA6A 1TI7A 4HZGA 3ZY6A 4YR9A 2FLWA 2DRIA 3G7NA 4K40A 4WLEA 1NUAA 3RABA 3V7UA 3IPAA 3V9PA 2ZPTX 3NTOA 1CUGA 1H6AA 3G2JA 1QCCA 1AK1A 4UVEA 2HHJA 4EKYA 3D6MA 1CNFA 7MDHA 1CEEA 4PY2A 2CHUA 1MO2A 3L41A 5B2ZA 4RJ2A 3LF2A 1ILEA 3PVZA