3QBMA

Crystal structure of a tetr transcriptional regulator (caur_2221) from chloroflexus aurantiacus j-10-fl at 1.80 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
199
structure length
199
Chain Sequence
GMRKGQETRERVVAQAAALFNVSGYAGTAISDIMAATGLEKGGIYRHFESKEQLALAAFDYAAEKVRERFAVGLAGHKHTVDTIIAFLDVFRSYAERPPLVGGCPILNTAIESDDTNPMLRERVRAVIDEWRETIRTLVQTGIARGEIRPEVDADRLALLIIATMEGAVMLARILETATPLEHAYTHLATYITQQVRLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a TetR transcriptional regulator (Caur_2221) from CHLOROFLEXUS AURANTIACUS J-10-FL at 1.80 A resolution
rcsb
source organism Chloroflexus aurantiacus
molecule tags Transcription regulator
molecule keywords TetR transcriptional regulator
total genus 80
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16859 TetR_C_11 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3qbmA00
2UXIA 3EUPA 1ZKGA 4JYKA 3KKDA 2ZCNA 1ZK8A 3KZ9A 5IOZA 2WV1A 5F0HA 2OPTA 2ID3A 2WUIA 3BR3A 2NS8A 4W97A 3VOKA 3MVPA 2G7GA 2ZB9A 5K7FA 3Q0UA 5CXGA 3VIBA 3AQTA 3WHBA 2ID6A 4MK6A 2G0EA 4PXIA 4UDSA 1Z0XA 3V78A 4L62A 5EYRA 2XB5A 5FKLA 1QVUA 3VUQA 5F04A 1JUSA 3QPLA 3DEWA 2V57A 2HYTA 4GCTA 2JJ7A 3P9TA 1JT6A 1VI0A 3COLA 5J1RA 5J3LA 4JNNA 5IPAA 2XPWA 1T56A 4AC0A 3SDGA 3VW2A 2YVHA 3F0CA 3ANPA 3HTAA 3AQSA 2GBYA 3G1LA 2TRTA 4D5CA 3LSPA 3PM1A 2VKEA 3IUVA 3MNLA 2UXHA 3BR2A 3LJLA 2FX0A 2ZCXA 3LSJA 4JL3A 4M3GA 3ON4A 3G1OA 4ICHA 2GFNA 2XGDA 2I10A 3PASA 1RKWA 2PZ9A 3IH4A 2FD5A 4G12A 4AUXA 1U9OA 4V2FA 4GCLA 5FMPA 3HTHA 3BR1A 2ZOZA 2UXOA 4GFKA 1BJZA 4JKZA 3DPJA 3NPIA 5FKNA 5HSZA 2XRLA 4B1RA 3B6AA 1U9NA 3E7QA 1JTXA 5FHPA 5K58A 2NX4A 3FRQA 3CWRA 2F07A 3CCYA 4XK4A 2W53A 2QCOA 5CXIA 1RPWA 3Q3SA 3NRGA 3HE0A 2PBXA 4YZEA 2XPVA 5DAJA 2QOPA 4ME9A 3VW1A 3NI7A 3BQYA 4M3BA 5FGLA 3O8GA 1Z77A 4B3AA 3ZQLA 4KWAA 2IAIA 3TP3A 2FBQA 2HQ5A 3BQZA 3SFIA 4M3EA 4D7MA 3BTJA 5F08A 4GCKA 2IBDA 5D19A 2NS7A 3CRJA 3DCFA 3QBMA 3ZQFA 3C07A 3VVXA 4AF5A 3G56A 2HXOA 2QTQA 2GUHA 3RH2A 3BTIA 2DG8A 3HGYA 3IH3A 2UXUA 2ZOYA 4W1UA 3F1BA 3O8HA 5FKMA 3FIWA 3RD3A 3HGGA 4X1EA 3BRUA 3NNRA 4M3FA 2RHAA 3B6CA 2Q24A 2Y2ZA 2IEKA 2HXIA 5HAWA 3Q0VA 5D1RA 4GFLA 3V6GA 4MXMA 5F1JA 2QWTA 3KKCA 3Q0WA 3JSJA 5CW8A 5EZHA 3HIMA 3ZQHA 3BR6A 4M3DA 2OF7A 2QKOA 3NXCA 2RASA 2FQ4A 3BJBA 5K7ZA 3BHQA 2DG7A 2HYJA 3GZIA 5F27A 2ZCMA 2OERA 2X6OA 3BT9A 4D5FA 3VVZA 1QPIA 3BR5A 1JT0A 1A6IA 3B81A 5D18A 3CDLA 1JUMA 4ACIA 4V2GA 1ORKA 3WHCA 4NELA 3S5RA 2XGCA 2UXPA 2G7SA 3BTCA 4ABZA 3ANGA 2X9DA 1JTYA 1UI5A 3BTLA 3LOCA 3HTIA 4NN1A 3FK6A 5IOYA 5K7HA 4CGRA 3T6NA 2HKUA 2IU5A 2NP5A 5EFYA 2G3BA 2YVEA 3VPRA 3BCGA 2DTZA 2O7TA 3KNWA 2Y31A 5C4YA 3LSRA 2XGEA 3LWJA 2OI8A 4HKUA 3VW0A 3FK7A 2EH3A 3GEUA 5F0CA 2O7OA 3TP0A 3IH2A 5GP9A 5J1UA 2NP3A 2QIBA 1RKTA 2VPRA 2D6YA 2FJ1A 2TCTA 5GPCA 3EGQA 2XPUA 3C2BA 3LHQA 4DW6A 3ZQIA 4AC6A 3O60A 4D7NA 3G1MA 4I6ZA 3BNIA 3VOXA 1SGMA 5AQCA 1T33A 3G7RA 3ZQGA 2VKVA 5HBUA 3PPBA 2RAEA 5H9TA 1UI6A 2GENA 3QKXA 3VVYA 3CJDA 4MO7A 2JK3A 2Y30A 1JUPA 3BR0A 5IP6A 1QVTA 2XDNA 2G7LA 3VP5A 5FKKA 5GPAA 5F0FA 5J1YA 3ON2A 3QPSA 2WGBA 4I76A 2REKA 3QQAA 5FKOA 5EZGA 3HTJA
chains in the Genus database with same CATH superfamily
2UXIA 3EUPA 1ZKGA 4JYKA 2A2FX 3KKDA 2ZCNA 1ZK8A 3KZ9A 5IOZA 2R7XA 2WV1A 5F0HA 2OPTA 2ID3A 2WUIA 3BR3A 2NS8A 4W97A 3VOKA 3MVPA 2G7GA 2ZB9A 5K7FA 2R7UA 3Q0UA 5CXGA 3VIBA 3AQTA 3WHBA 2ID6A 2R7VA 4MK6A 2G0EA 4PXIA 4UDSA 1Z0XA 3V78A 4L62A 5EYRA 2XB5A 5FKLA 1QVUA 3VUQA 5F04A 1JUSA 3QPLA 3SWHA 3DEWA 2V57A 2HYTA 4GCTA 5CQGA 2JJ7A 3P9TA 1JT6A 1VI0A 3COLA 5J1RA 5J3LA 4JNNA 5IPAA 2XPWA 1T56A 4AC0A 3SDGA 3VW2A 2YVHA 3F0CA 3ANPA 3HTAA 3AQSA 2GBYA 3G1LA 2TRTA 4D5CA 3LSPA 3PM1A 2VKEA 3IUVA 3MNLA 2UXHA 4WIBA 3BR2A 3LJLA 2FX0A 2ZCXA 3LSJA 4JL3A 4M3GA 3ON4A 3G1OA 4ICHA 2GFNA 2XGDA 2I10A 2B1EA 3PASA 1RKWA 2PZ9A 3IH4A 4DVYP 2FD5A 4G12A 4AUXA 1U9OA 4V2FA 4GCLA 5FMPA 3HTHA 2ZY9A 3BR1A 2ZOZA 2UXOA 4GFKA 1BJZA 4JKZA 3DPJA 3NPIA 4U9NA 5FKNA 5HSZA 2XRLA 4B1RA 3B6AA 1U9NA 3KYLA 2R7RA 3E7QA 1JTXA 5FHPA 5K58A 2NX4A 3FRQA 3CWRA 2F07A 3CCYA 4XK4A 2W53A 2QCOA 5CXIA 1RPWA 3Q3SA 3NRGA 3HE0A 2R7QA 2PBXA 4YZEA 2XPVA 5DAJA 2QOPA 4ME9A 3VW1A 3NI7A 3BQYA 4M3BA 5FGLA 3O8GA 1Z77A 4B3AA 3ZQLA 4KWAA 2IAIA 3TP3A 2FBQA 2FJI1 2HQ5A 3BQZA 3SFIA 4M3EA 4OD5A 4D7MA 3BTJA 5F08A 4GCKA 2IBDA 5D19A 2NS7A 3CRJA 3DCFA 3QBMA 3ZQFA 3C07A 3VVXA 4AF5A 3G56A 2HXOA 2QTQA 2GUHA 3RH2A 3BTIA 4OD4A 2DG8A 3HGYA 3IH3A 2UXUA 2ZOYA 4W1UA 3F1BA 2R7OA 3O8HA 5FKMA 3K8PC 3FIWA 3RD3A 3HGGA 4X1EA 3BRUA 3NNRA 4M3FA 2RHAA 3B6CA 2Q24A 2Y2ZA 2IEKA 2HXIA 5HAWA 3Q0VA 2B3WA 5D1RA 4GFLA 3V6GA 4MXMA 5F1JA 2QWTA 3KKCA 3Q0WA 3JSJA 5CW8A 5EZHA 3HIMA 3ZQHA 3BR6A 4M3DA 2OF7A 2QKOA 3NXCA 2YVXA 3FHNA 2RASA 2FQ4A 3BJBA 5K7ZA 3BHQA 2DG7A 2HYJA 3GZIA 5F27A 2ZCMA 2OERA 2X6OA 3BT9A 4D5FA 3VVZA 1QPIA 3BR5A 1JT0A 1A6IA 3B81A 5D18A 3CDLA 1JUMA 4U9LA 4ACIA 4V2GA 1ORKA 3WHCA 4NELA 3S5RA 2XGCA 3VTIA 2UXPA 2R7TA 2G7SA 3BTCA 4ABZA 3ANGA 2X9DA 1JTYA 1UI5A 3BTLA 3LOCA 3HTIA 4NN1A 3FK6A 5IOYA 5K7HA 4CGRA 3T6NA 2HKUA 2IU5A 2NP5A 5EFYA 2G3BA 2YVEA 3VPRA 3BCGA 2DTZA 2R7WA 2O7TA 3KNWA 2Y31A 5C4YA 3LSRA 2XGEA 3LWJA 2OI8A 4HKUA 3VW0A 3FK7A 2EH3A 3GEUA 5F0CA 2O7OA 3TP0A 3IH2A 5GP9A 2PFVA 5J1UA 2NP3A 2QIBA 1RKTA 2VPRA 2D6YA 2FJ1A 2TCTA 5GPCA 3EGQA 2XPUA 3C2BA 4C2MA 3LHQA 4DW6A 3ZQIA 4AC6A 3O60A 4D7NA 3G1MA 3DU6A 4IRVA 4I6ZA 2R7SA 3BNIA 3VOXA 1SGMA 5AQCA 1T33A 3DU5A 3G7RA 3ZQGA 2VKVA 3NS4A 5HBUA 3PPBA 2RAEA 5H9TA 1UI6A 2GENA 3QKXA 3VVYA 3CJDA 4MO7A 2JK3A 2Y30A 1JUPA 3BR0A 5IP6A 1QVTA 2XDNA 2G7LA 3VP5A 5FKKA 5GPAA 5F0FA 5J1YA 3ON2A 3QPSA 2WGBA 4I76A 2REKA 3QQAA 5FKOA 5EZGA 3HTJA
chains in the Genus database with same CATH topology
2UXIA 3EUPA 1ZKGA 4JYKA 3KKDA 2ZCNA 1ZK8A 3KZ9A 5IOZA 2WV1A 5F0HA 2OPTA 2ID3A 2WUIA 3BR3A 2NS8A 4W97A 3VOKA 3MVPA 2G7GA 2ZB9A 5K7FA 3Q0UA 5CXGA 3VIBA 3AQTA 3WHBA 2ID6A 4MK6A 2G0EA 4PXIA 4UDSA 1Z0XA 3V78A 4L62A 5EYRA 2XB5A 5FKLA 1QVUA 3VUQA 5F04A 1JUSA 3QPLA 3DEWA 2V57A 2HYTA 4GCTA 2JJ7A 3P9TA 1JT6A 1VI0A 3COLA 5J1RA 5J3LA 4JNNA 5IPAA 2XPWA 1T56A 4AC0A 3SDGA 3VW2A 2YVHA 3F0CA 3ANPA 3HTAA 3AQSA 2GBYA 3G1LA 2TRTA 4D5CA 3LSPA 3PM1A 2VKEA 3IUVA 3MNLA 2UXHA 3BR2A 3LJLA 2FX0A 2ZCXA 3LSJA 4JL3A 4M3GA 3ON4A 3G1OA 4ICHA 2GFNA 2XGDA 2I10A 3PASA 1RKWA 2PZ9A 3IH4A 2FD5A 4G12A 4AUXA 1U9OA 4V2FA 4GCLA 5FMPA 3HTHA 3BR1A 2ZOZA 2UXOA 4GFKA 1BJZA 4JKZA 3DPJA 3NPIA 5FKNA 5HSZA 2XRLA 4B1RA 3B6AA 1U9NA 3E7QA 1JTXA 5FHPA 5K58A 2NX4A 3FRQA 3CWRA 2F07A 3CCYA 4XK4A 2W53A 2QCOA 5CXIA 1RPWA 3Q3SA 3NRGA 3HE0A 2PBXA 4YZEA 2XPVA 5DAJA 2QOPA 4ME9A 3VW1A 3NI7A 3BQYA 4M3BA 5FGLA 3O8GA 1Z77A 4B3AA 3ZQLA 4KWAA 2IAIA 3TP3A 2FBQA 2HQ5A 3BQZA 3SFIA 4M3EA 4D7MA 3BTJA 5F08A 4GCKA 2IBDA 5D19A 2NS7A 3CRJA 3DCFA 3QBMA 3ZQFA 3C07A 3VVXA 4AF5A 3G56A 2HXOA 2QTQA 2GUHA 3RH2A 3BTIA 2DG8A 3HGYA 3IH3A 2UXUA 2ZOYA 4W1UA 3F1BA 3O8HA 5FKMA 3FIWA 3RD3A 3HGGA 4X1EA 3BRUA 3NNRA 4M3FA 2RHAA 3B6CA 2Q24A 2Y2ZA 2IEKA 2HXIA 5HAWA 3Q0VA 5D1RA 4GFLA 3V6GA 4MXMA 5F1JA 2QWTA 3KKCA 3Q0WA 3JSJA 5CW8A 5EZHA 3HIMA 3ZQHA 3BR6A 4M3DA 2OF7A 2QKOA 3NXCA 2RASA 2FQ4A 3BJBA 5K7ZA 3BHQA 2DG7A 2HYJA 3GZIA 5F27A 2ZCMA 2OERA 2X6OA 3BT9A 4D5FA 3VVZA 1QPIA 3BR5A 1JT0A 1A6IA 3B81A 5D18A 3CDLA 1JUMA 4ACIA 4V2GA 1ORKA 3WHCA 4NELA 3S5RA 2XGCA 2UXPA 2G7SA 3BTCA 4ABZA 3ANGA 2X9DA 1JTYA 1UI5A 3BTLA 3LOCA 3HTIA 4NN1A 3FK6A 5IOYA 5K7HA 4CGRA 3T6NA 2HKUA 2IU5A 2NP5A 5EFYA 2G3BA 2YVEA 3VPRA 3BCGA 2DTZA 2O7TA 3KNWA 2Y31A 5C4YA 3LSRA 2XGEA 3LWJA 2OI8A 4HKUA 3VW0A 3FK7A 2EH3A 3GEUA 5F0CA 2O7OA 3TP0A 3IH2A 5GP9A 5J1UA 2NP3A 2QIBA 1RKTA 2VPRA 2D6YA 2FJ1A 2TCTA 5GPCA 3EGQA 2XPUA 3C2BA 3LHQA 4DW6A 3ZQIA 4AC6A 3O60A 4D7NA 3G1MA 4I6ZA 3BNIA 3VOXA 1SGMA 5AQCA 1T33A 3G7RA 3ZQGA 2VKVA 5HBUA 3PPBA 2RAEA 5H9TA 1UI6A 2GENA 3QKXA 3VVYA 3CJDA 4MO7A 2JK3A 2Y30A 1JUPA 3BR0A 5IP6A 1QVTA 2XDNA 2G7LA 3VP5A 5FKKA 5GPAA 5F0FA 5J1YA 3ON2A 3QPSA 2WGBA 4I76A 2REKA 3QQAA 5FKOA 5EZGA 3HTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXI A;  3EUP A;  1ZKG A;  4JYK A;  3KKD A;  2ZCN A;  1ZK8 A;  3KZ9 A;  5IOZ A;  2WV1 A;  5F0H A;  2OPT A;  2ID3 A;  2WUI A;  3BR3 A;  2NS8 A;  4W97 A;  3VOK A;  3MVP A;  2G7G A;  2ZB9 A;  5K7F A;  3Q0U A;  5CXG A;  3VIB A;  3AQT A;  3WHB A;  2ID6 A;  4MK6 A;  2G0E A;  4PXI A;  4UDS A;  1Z0X A;  3V78 A;  4L62 A;  5EYR A;  2XB5 A;  5FKL A;  1QVU A;  3VUQ A;  5F04 A;  1JUS A;  3QPL A;  3DEW A;  2V57 A;  2HYT A;  4GCT A;  2JJ7 A;  3P9T A;  1JT6 A;  1VI0 A;  3COL A;  5J1R A;  5J3L A;  4JNN A;  5IPA A;  2XPW A;  1T56 A;  4AC0 A;  3SDG A;  3VW2 A;  2YVH A;  3F0C A;  3ANP A;  3HTA A;  3AQS A;  2GBY A;  3G1L A;  2TRT A;  4D5C A;  3LSP A;  3PM1 A;  2VKE A;  3IUV A;  3MNL A;  2UXH A;  3BR2 A;  3LJL A;  2FX0 A;  2ZCX A;  3LSJ A;  4JL3 A;  4M3G A;  3ON4 A;  3G1O A;  4ICH A;  2GFN A;  2XGD A;  2I10 A;  3PAS A;  1RKW A;  2PZ9 A;  3IH4 A;  2FD5 A;  4G12 A;  4AUX A;  1U9O A;  4V2F A;  4GCL A;  5FMP A;  3HTH A;  3BR1 A;  2ZOZ A;  2UXO A;  4GFK A;  1BJZ A;  4JKZ A;  3DPJ A;  3NPI A;  5FKN A;  5HSZ A;  2XRL A;  4B1R A;  3B6A A;  1U9N A;  3E7Q A;  1JTX A;  5FHP A;  5K58 A;  2NX4 A;  3FRQ A;  3CWR A;  2F07 A;  3CCY A;  4XK4 A;  2W53 A;  2QCO A;  5CXI A;  1RPW A;  3Q3S A;  3NRG A;  3HE0 A;  2PBX A;  4YZE A;  2XPV A;  5DAJ A;  2QOP A;  4ME9 A;  3VW1 A;  3NI7 A;  3BQY A;  4M3B A;  5FGL A;  3O8G A;  1Z77 A;  4B3A A;  3ZQL A;  4KWA A;  2IAI A;  3TP3 A;  2FBQ A;  2HQ5 A;  3BQZ A;  3SFI A;  4M3E A;  4D7M A;  3BTJ A;  5F08 A;  4GCK A;  2IBD A;  5D19 A;  2NS7 A;  3CRJ A;  3DCF A;  3QBM A;  3ZQF A;  3C07 A;  3VVX A;  4AF5 A;  3G56 A;  2HXO A;  2QTQ A;  2GUH A;  3RH2 A;  3BTI A;  2DG8 A;  3HGY A;  3IH3 A;  2UXU A;  2ZOY A;  4W1U A;  3F1B A;  3O8H A;  5FKM A;  3FIW A;  3RD3 A;  3HGG A;  4X1E A;  3BRU A;  3NNR A;  4M3F A;  2RHA A;  3B6C A;  2Q24 A;  2Y2Z A;  2IEK A;  2HXI A;  5HAW A;  3Q0V A;  5D1R A;  4GFL A;  3V6G A;  4MXM A;  5F1J A;  2QWT A;  3KKC A;  3Q0W A;  3JSJ A;  5CW8 A;  5EZH A;  3HIM A;  3ZQH A;  3BR6 A;  4M3D A;  2OF7 A;  2QKO A;  3NXC A;  2RAS A;  2FQ4 A;  3BJB A;  5K7Z A;  3BHQ A;  2DG7 A;  2HYJ A;  3GZI A;  5F27 A;  2ZCM A;  2OER A;  2X6O A;  3BT9 A;  4D5F A;  3VVZ A;  1QPI A;  3BR5 A;  1JT0 A;  1A6I A;  3B81 A;  5D18 A;  3CDL A;  1JUM A;  4ACI A;  4V2G A;  1ORK A;  3WHC A;  4NEL A;  3S5R A;  2XGC A;  2UXP A;  2G7S A;  3BTC A;  4ABZ A;  3ANG A;  2X9D A;  1JTY A;  1UI5 A;  3BTL A;  3LOC A;  3HTI A;  4NN1 A;  3FK6 A;  5IOY A;  5K7H A;  4CGR A;  3T6N A;  2HKU A;  2IU5 A;  2NP5 A;  5EFY A;  2G3B A;  2YVE A;  3VPR A;  3BCG A;  2DTZ A;  2O7T A;  3KNW A;  2Y31 A;  5C4Y A;  3LSR A;  2XGE A;  3LWJ A;  2OI8 A;  4HKU A;  3VW0 A;  3FK7 A;  2EH3 A;  3GEU A;  5F0C A;  2O7O A;  3TP0 A;  3IH2 A;  5GP9 A;  5J1U A;  2NP3 A;  2QIB A;  1RKT A;  2VPR A;  2D6Y A;  2FJ1 A;  2TCT A;  5GPC A;  3EGQ A;  2XPU A;  3C2B A;  3LHQ A;  4DW6 A;  3ZQI A;  4AC6 A;  3O60 A;  4D7N A;  3G1M A;  4I6Z A;  3BNI A;  3VOX A;  1SGM A;  5AQC A;  1T33 A;  3G7R A;  3ZQG A;  2VKV A;  5HBU A;  3PPB A;  2RAE A;  5H9T A;  1UI6 A;  2GEN A;  3QKX A;  3VVY A;  3CJD A;  4MO7 A;  2JK3 A;  2Y30 A;  1JUP A;  3BR0 A;  5IP6 A;  1QVT A;  2XDN A;  2G7L A;  3VP5 A;  5FKK A;  5GPA A;  5F0F A;  5J1Y A;  3ON2 A;  3QPS A;  2WGB A;  4I76 A;  2REK A;  3QQA A;  5FKO A;  5EZG A;  3HTJ A; 
#chains in the Genus database with same CATH topology
 2UXI A;  3EUP A;  1ZKG A;  4JYK A;  2A2F X;  3KKD A;  2ZCN A;  1ZK8 A;  3KZ9 A;  5IOZ A;  2R7X A;  2WV1 A;  5F0H A;  2OPT A;  2ID3 A;  2WUI A;  3BR3 A;  2NS8 A;  4W97 A;  3VOK A;  3MVP A;  2G7G A;  2ZB9 A;  5K7F A;  2R7U A;  3Q0U A;  5CXG A;  3VIB A;  3AQT A;  3WHB A;  2ID6 A;  2R7V A;  4MK6 A;  2G0E A;  4PXI A;  4UDS A;  1Z0X A;  3V78 A;  4L62 A;  5EYR A;  2XB5 A;  5FKL A;  1QVU A;  3VUQ A;  5F04 A;  1JUS A;  3QPL A;  3SWH A;  3DEW A;  2V57 A;  2HYT A;  4GCT A;  5CQG A;  2JJ7 A;  3P9T A;  1JT6 A;  1VI0 A;  3COL A;  5J1R A;  5J3L A;  4JNN A;  5IPA A;  2XPW A;  1T56 A;  4AC0 A;  3SDG A;  3VW2 A;  2YVH A;  3F0C A;  3ANP A;  3HTA A;  3AQS A;  2GBY A;  3G1L A;  2TRT A;  4D5C A;  3LSP A;  3PM1 A;  2VKE A;  3IUV A;  3MNL A;  2UXH A;  4WIB A;  3BR2 A;  3LJL A;  2FX0 A;  2ZCX A;  3LSJ A;  4JL3 A;  4M3G A;  3ON4 A;  3G1O A;  4ICH A;  2GFN A;  2XGD A;  2I10 A;  2B1E A;  3PAS A;  1RKW A;  2PZ9 A;  3IH4 A;  4DVY P;  2FD5 A;  4G12 A;  4AUX A;  1U9O A;  4V2F A;  4GCL A;  5FMP A;  3HTH A;  2ZY9 A;  3BR1 A;  2ZOZ A;  2UXO A;  4GFK A;  1BJZ A;  4JKZ A;  3DPJ A;  3NPI A;  4U9N A;  5FKN A;  5HSZ A;  2XRL A;  4B1R A;  3B6A A;  1U9N A;  3KYL A;  2R7R A;  3E7Q A;  1JTX A;  5FHP A;  5K58 A;  2NX4 A;  3FRQ A;  3CWR A;  2F07 A;  3CCY A;  4XK4 A;  2W53 A;  2QCO A;  5CXI A;  1RPW A;  3Q3S A;  3NRG A;  3HE0 A;  2R7Q A;  2PBX A;  4YZE A;  2XPV A;  5DAJ A;  2QOP A;  4ME9 A;  3VW1 A;  3NI7 A;  3BQY A;  4M3B A;  5FGL A;  3O8G A;  1Z77 A;  4B3A A;  3ZQL A;  4KWA A;  2IAI A;  3TP3 A;  2FBQ A;  2FJI 1;  2HQ5 A;  3BQZ A;  3SFI A;  4M3E A;  4OD5 A;  4D7M A;  3BTJ A;  5F08 A;  4GCK A;  2IBD A;  5D19 A;  2NS7 A;  3CRJ A;  3DCF A;  3QBM A;  3ZQF A;  3C07 A;  3VVX A;  4AF5 A;  3G56 A;  2HXO A;  2QTQ A;  2GUH A;  3RH2 A;  3BTI A;  4OD4 A;  2DG8 A;  3HGY A;  3IH3 A;  2UXU A;  2ZOY A;  4W1U A;  3F1B A;  2R7O A;  3O8H A;  5FKM A;  3K8P C;  3FIW A;  3RD3 A;  3HGG A;  4X1E A;  3BRU A;  3NNR A;  4M3F A;  2RHA A;  3B6C A;  2Q24 A;  2Y2Z A;  2IEK A;  2HXI A;  5HAW A;  3Q0V A;  2B3W A;  5D1R A;  4GFL A;  3V6G A;  4MXM A;  5F1J A;  2QWT A;  3KKC A;  3Q0W A;  3JSJ A;  5CW8 A;  5EZH A;  3HIM A;  3ZQH A;  3BR6 A;  4M3D A;  2OF7 A;  2QKO A;  3NXC A;  2YVX A;  3FHN A;  2RAS A;  2FQ4 A;  3BJB A;  5K7Z A;  3BHQ A;  2DG7 A;  2HYJ A;  3GZI A;  5F27 A;  2ZCM A;  2OER A;  2X6O A;  3BT9 A;  4D5F A;  3VVZ A;  1QPI A;  3BR5 A;  1JT0 A;  1A6I A;  3B81 A;  5D18 A;  3CDL A;  1JUM A;  4U9L A;  4ACI A;  4V2G A;  1ORK A;  3WHC A;  4NEL A;  3S5R A;  2XGC A;  3VTI A;  2UXP A;  2R7T A;  2G7S A;  3BTC A;  4ABZ A;  3ANG A;  2X9D A;  1JTY A;  1UI5 A;  3BTL A;  3LOC A;  3HTI A;  4NN1 A;  3FK6 A;  5IOY A;  5K7H A;  4CGR A;  3T6N A;  2HKU A;  2IU5 A;  2NP5 A;  5EFY A;  2G3B A;  2YVE A;  3VPR A;  3BCG A;  2DTZ A;  2R7W A;  2O7T A;  3KNW A;  2Y31 A;  5C4Y A;  3LSR A;  2XGE A;  3LWJ A;  2OI8 A;  4HKU A;  3VW0 A;  3FK7 A;  2EH3 A;  3GEU A;  5F0C A;  2O7O A;  3TP0 A;  3IH2 A;  5GP9 A;  2PFV A;  5J1U A;  2NP3 A;  2QIB A;  1RKT A;  2VPR A;  2D6Y A;  2FJ1 A;  2TCT A;  5GPC A;  3EGQ A;  2XPU A;  3C2B A;  4C2M A;  3LHQ A;  4DW6 A;  3ZQI A;  4AC6 A;  3O60 A;  4D7N A;  3G1M A;  3DU6 A;  4IRV A;  4I6Z A;  2R7S A;  3BNI A;  3VOX A;  1SGM A;  5AQC A;  1T33 A;  3DU5 A;  3G7R A;  3ZQG A;  2VKV A;  3NS4 A;  5HBU A;  3PPB A;  2RAE A;  5H9T A;  1UI6 A;  2GEN A;  3QKX A;  3VVY A;  3CJD A;  4MO7 A;  2JK3 A;  2Y30 A;  1JUP A;  3BR0 A;  5IP6 A;  1QVT A;  2XDN A;  2G7L A;  3VP5 A;  5FKK A;  5GPA A;  5F0F A;  5J1Y A;  3ON2 A;  3QPS A;  2WGB A;  4I76 A;  2REK A;  3QQA A;  5FKO A;  5EZG A;  3HTJ A; 
#chains in the Genus database with same CATH homology
 2UXI A;  3EUP A;  1ZKG A;  4JYK A;  3KKD A;  2ZCN A;  1ZK8 A;  3KZ9 A;  5IOZ A;  2WV1 A;  5F0H A;  2OPT A;  2ID3 A;  2WUI A;  3BR3 A;  2NS8 A;  4W97 A;  3VOK A;  3MVP A;  2G7G A;  2ZB9 A;  5K7F A;  3Q0U A;  5CXG A;  3VIB A;  3AQT A;  3WHB A;  2ID6 A;  4MK6 A;  2G0E A;  4PXI A;  4UDS A;  1Z0X A;  3V78 A;  4L62 A;  5EYR A;  2XB5 A;  5FKL A;  1QVU A;  3VUQ A;  5F04 A;  1JUS A;  3QPL A;  3DEW A;  2V57 A;  2HYT A;  4GCT A;  2JJ7 A;  3P9T A;  1JT6 A;  1VI0 A;  3COL A;  5J1R A;  5J3L A;  4JNN A;  5IPA A;  2XPW A;  1T56 A;  4AC0 A;  3SDG A;  3VW2 A;  2YVH A;  3F0C A;  3ANP A;  3HTA A;  3AQS A;  2GBY A;  3G1L A;  2TRT A;  4D5C A;  3LSP A;  3PM1 A;  2VKE A;  3IUV A;  3MNL A;  2UXH A;  3BR2 A;  3LJL A;  2FX0 A;  2ZCX A;  3LSJ A;  4JL3 A;  4M3G A;  3ON4 A;  3G1O A;  4ICH A;  2GFN A;  2XGD A;  2I10 A;  3PAS A;  1RKW A;  2PZ9 A;  3IH4 A;  2FD5 A;  4G12 A;  4AUX A;  1U9O A;  4V2F A;  4GCL A;  5FMP A;  3HTH A;  3BR1 A;  2ZOZ A;  2UXO A;  4GFK A;  1BJZ A;  4JKZ A;  3DPJ A;  3NPI A;  5FKN A;  5HSZ A;  2XRL A;  4B1R A;  3B6A A;  1U9N A;  3E7Q A;  1JTX A;  5FHP A;  5K58 A;  2NX4 A;  3FRQ A;  3CWR A;  2F07 A;  3CCY A;  4XK4 A;  2W53 A;  2QCO A;  5CXI A;  1RPW A;  3Q3S A;  3NRG A;  3HE0 A;  2PBX A;  4YZE A;  2XPV A;  5DAJ A;  2QOP A;  4ME9 A;  3VW1 A;  3NI7 A;  3BQY A;  4M3B A;  5FGL A;  3O8G A;  1Z77 A;  4B3A A;  3ZQL A;  4KWA A;  2IAI A;  3TP3 A;  2FBQ A;  2HQ5 A;  3BQZ A;  3SFI A;  4M3E A;  4D7M A;  3BTJ A;  5F08 A;  4GCK A;  2IBD A;  5D19 A;  2NS7 A;  3CRJ A;  3DCF A;  3QBM A;  3ZQF A;  3C07 A;  3VVX A;  4AF5 A;  3G56 A;  2HXO A;  2QTQ A;  2GUH A;  3RH2 A;  3BTI A;  2DG8 A;  3HGY A;  3IH3 A;  2UXU A;  2ZOY A;  4W1U A;  3F1B A;  3O8H A;  5FKM A;  3FIW A;  3RD3 A;  3HGG A;  4X1E A;  3BRU A;  3NNR A;  4M3F A;  2RHA A;  3B6C A;  2Q24 A;  2Y2Z A;  2IEK A;  2HXI A;  5HAW A;  3Q0V A;  5D1R A;  4GFL A;  3V6G A;  4MXM A;  5F1J A;  2QWT A;  3KKC A;  3Q0W A;  3JSJ A;  5CW8 A;  5EZH A;  3HIM A;  3ZQH A;  3BR6 A;  4M3D A;  2OF7 A;  2QKO A;  3NXC A;  2RAS A;  2FQ4 A;  3BJB A;  5K7Z A;  3BHQ A;  2DG7 A;  2HYJ A;  3GZI A;  5F27 A;  2ZCM A;  2OER A;  2X6O A;  3BT9 A;  4D5F A;  3VVZ A;  1QPI A;  3BR5 A;  1JT0 A;  1A6I A;  3B81 A;  5D18 A;  3CDL A;  1JUM A;  4ACI A;  4V2G A;  1ORK A;  3WHC A;  4NEL A;  3S5R A;  2XGC A;  2UXP A;  2G7S A;  3BTC A;  4ABZ A;  3ANG A;  2X9D A;  1JTY A;  1UI5 A;  3BTL A;  3LOC A;  3HTI A;  4NN1 A;  3FK6 A;  5IOY A;  5K7H A;  4CGR A;  3T6N A;  2HKU A;  2IU5 A;  2NP5 A;  5EFY A;  2G3B A;  2YVE A;  3VPR A;  3BCG A;  2DTZ A;  2O7T A;  3KNW A;  2Y31 A;  5C4Y A;  3LSR A;  2XGE A;  3LWJ A;  2OI8 A;  4HKU A;  3VW0 A;  3FK7 A;  2EH3 A;  3GEU A;  5F0C A;  2O7O A;  3TP0 A;  3IH2 A;  5GP9 A;  5J1U A;  2NP3 A;  2QIB A;  1RKT A;  2VPR A;  2D6Y A;  2FJ1 A;  2TCT A;  5GPC A;  3EGQ A;  2XPU A;  3C2B A;  3LHQ A;  4DW6 A;  3ZQI A;  4AC6 A;  3O60 A;  4D7N A;  3G1M A;  4I6Z A;  3BNI A;  3VOX A;  1SGM A;  5AQC A;  1T33 A;  3G7R A;  3ZQG A;  2VKV A;  5HBU A;  3PPB A;  2RAE A;  5H9T A;  1UI6 A;  2GEN A;  3QKX A;  3VVY A;  3CJD A;  4MO7 A;  2JK3 A;  2Y30 A;  1JUP A;  3BR0 A;  5IP6 A;  1QVT A;  2XDN A;  2G7L A;  3VP5 A;  5FKK A;  5GPA A;  5F0F A;  5J1Y A;  3ON2 A;  3QPS A;  2WGB A;  4I76 A;  2REK A;  3QQA A;  5FKO A;  5EZG A;  3HTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...