3QBMA

Crystal structure of a tetr transcriptional regulator (caur_2221) from chloroflexus aurantiacus j-10-fl at 1.80 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
199
structure length
199
Chain Sequence
b'GMRKGQETRERVVAQAAALFNVSGYAGTAISDIMAATGLEKGGIYRHFESKEQLALAAFDYAAEKVRERFAVGLAGHKHTVDTIIAFLDVFRSYAERPPLVGGCPILNTAIESDDTNPMLRERVRAVIDEWRETIRTLVQTGIARGEIRPEVDADRLALLIIATMEGAVMLARILETATPLEHAYTHLATYITQQVRLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TetR transcriptional regulator
molecule tags Transcription regulator
source organism Chloroflexus aurantiacus
publication title Crystal structure of a TetR transcriptional regulator (Caur_2221) from CHLOROFLEXUS AURANTIACUS J-10-FL at 1.80 A resolution
rcsb
total genus 80
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16859 TetR_C_11 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3qbmA00
1SGMA 5FHPA 3HE0A 4HKUA 2XB5A 2XGCA 3HGGA 3RD3A 2OPTA 3BR6A 2V57A 5DAJA 5HAWA 4JL3A 2ZCNA 5FMPA 4X1EA 3S5RA 3CRJA 3F1BA 4AC0A 3O60A 3T6NA 3LJLA 2ID3A 3IH4A 2UXHA 5F08A 1JT0A 3G1LA 3ZQFA 2I10A 2D6YA 2W53A 1ZKGA 1ORKA 2QTQA 2FX0A 3QQAA 3COLA 2YVHA 2IAIA 3G1OA 3PPBA 5J1UA 5K58A 2NX4A 5IPAA 3FIWA 3BTCA 1QVUA 2GENA 3NPIA 3QKXA 3NNRA 4B1RA 3QBMA 5C4YA 3ANGA 3DPJA 2NS8A 5GPAA 2XPUA 2XGEA 2G0EA 3GEUA 3NRGA 5D19A 5HSZA 2GBYA 2XRLA 3IH2A 4M3BA 4W1UA 1JT6A 3IUVA 3VW2A 2OI8A 5IOYA 3FK6A 4I6ZA 3CCYA 2DTZA 3B6AA 4M3EA 2G7LA 3HTIA 3ON4A 2O7OA 5GPCA 4D5FA 4GFKA 2FJ1A 3KZ9A 5K7FA 2ZCXA 3DCFA 2OF7A 3Q0VA 4MK6A 1JTYA 3B6CA 4CGRA 5F27A 5FKLA 2FD5A 5EZGA 3LWJA 2G7SA 3AQSA 3VIBA 3VPRA 5J3LA 4M3FA 2UXIA 4ME9A 3BHQA 3B81A 3HTJA 2WGBA 2QWTA 2UXOA 2HXOA 3PASA 3TP3A 3BNIA 5EFYA 1U9NA 2XGDA 3ON2A 4I76A 2HXIA 2IBDA 4G12A 5CXIA 3VW0A 2TCTA 4M3GA 2PZ9A 3FK7A 1JUMA 3EGQA 3HGYA 3KKCA 5K7HA 2WV1A 3VOXA 3WHBA 2NS7A 2X6OA 3BCGA 1QPIA 5CXGA 5EYRA 4MO7A 1VI0A 2DG8A 3QPLA 5FGLA 3C2BA 2OERA 3AQTA 2QOPA 4D7NA 1QVTA 2HYTA 2Y2ZA 4M3DA 4D7MA 3CDLA 2FQ4A 4PXIA 1RPWA 3VP5A 4ACIA 3ZQIA 2HYJA 3HTAA 2Y30A 2WUIA 3KNWA 4JKZA 1RKTA 1T56A 2EH3A 4GFLA 5FKNA 2O7TA 2VKVA 3BQYA 5FKMA 3LSRA 3VW1A 1UI5A 3DEWA 3WHCA 2XPVA 3BJBA 3G1MA 5D1RA 3BR2A 3C07A 4JYKA 3ZQGA 3IH3A 5CW8A 1RKWA 3MVPA 3VVZA 5D18A 3VVXA 3V78A 5F0HA 3LHQA 2RASA 3BTLA 3CWRA 4KWAA 3V6GA 2JK3A 2Y31A 3VUQA 3BRUA 4ABZA 1U9OA 3LOCA 1Z77A 4ICHA 3BT9A 3FRQA 2ZB9A 5K7ZA 2F07A 2QIBA 5FKKA 3F0CA 3GZIA 2QKOA 1T33A 1ZK8A 2ZOYA 3BTJA 2NP5A 4AC6A 2UXPA 2YVEA 3SFIA 5F0CA 4XK4A 3LSPA 5EZHA 2G3BA 3NI7A 3TP0A 3CJDA 3BTIA 2HQ5A 4D5CA 3LSJA 1JUSA 4GCKA 3Q0WA 5H9TA 4JNNA 3HIMA 5AQCA 3Q0UA 4DW6A 2XPWA 3VVYA 1Z0XA 3Q3SA 5J1YA 5IP6A 3HTHA 4NELA 2REKA 5F1JA 2FBQA 3RH2A 1JUPA 5F0FA 3P9TA 5GP9A 2ID6A 3NXCA 4UDSA 1JTXA 5F04A 2GFNA 3ZQLA 3BR1A 4YZEA 2RAEA 4V2FA 4GCTA 3BR3A 1UI6A 3BQZA 2ZCMA 2XDNA 2VKEA 4NN1A 1A6IA 2Q24A 2ZOZA 2NP3A 4AUXA 3O8GA 2UXUA 4W97A 3ANPA 2HKUA 4AF5A 4V2GA 3G7RA 3QPSA 2TRTA 2JJ7A 3G56A 2IU5A 3E7QA 3PM1A 2IEKA 2X9DA 4L62A 4MXMA 5IOZA 4B3AA 3SDGA 2RHAA 3MNLA 3VOKA 3BR5A 2DG7A 5FKOA 3BR0A 2G7GA 5J1RA 1BJZA 3ZQHA 5HBUA 2QCOA 2VPRA 4GCLA 2GUHA 3KKDA 3EUPA 2PBXA 3JSJA 3O8HA
chains in the Genus database with same CATH superfamily
1SGMA 2R7UA 5FHPA 3HE0A 4HKUA 2XB5A 2R7QA 2XGCA 3HGGA 3RD3A 2OPTA 3BR6A 2V57A 5DAJA 5HAWA 4JL3A 2ZCNA 5FMPA 4X1EA 3VTIA 3S5RA 3CRJA 3F1BA 4AC0A 3O60A 3T6NA 3LJLA 2ID3A 3IH4A 2UXHA 5F08A 1JT0A 3G1LA 3ZQFA 2I10A 2D6YA 2W53A 1ZKGA 4C2MA 1ORKA 2QTQA 2FX0A 3QQAA 3COLA 2YVHA 2IAIA 3G1OA 3PPBA 5J1UA 5K58A 2NX4A 5IPAA 3FIWA 3BTCA 1QVUA 2GENA 3NPIA 2FJI1 3QKXA 3NNRA 4B1RA 3QBMA 5C4YA 3ANGA 3DPJA 2NS8A 5GPAA 2XPUA 2XGEA 2G0EA 3GEUA 4DVYP 3NRGA 5D19A 5HSZA 2GBYA 2XRLA 3IH2A 4M3BA 4W1UA 1JT6A 3IUVA 3VW2A 2OI8A 5IOYA 3FK6A 4I6ZA 3CCYA 2DTZA 3B6AA 4M3EA 2G7LA 3HTIA 3ON4A 2O7OA 5GPCA 4D5FA 4GFKA 2FJ1A 3KZ9A 5K7FA 2PFVA 2ZCXA 3DCFA 2OF7A 3KYLA 3Q0VA 4MK6A 4OD5A 1JTYA 3B6CA 4CGRA 5F27A 5FKLA 2FD5A 5EZGA 3LWJA 2G7SA 3AQSA 3FHNA 3VIBA 3VPRA 5J3LA 4M3FA 2UXIA 4ME9A 3BHQA 3B81A 3HTJA 2WGBA 2QWTA 2UXOA 2HXOA 3PASA 3TP3A 3BNIA 5EFYA 1U9NA 2XGDA 3ON2A 4I76A 2HXIA 2IBDA 4G12A 4U9NA 5CXIA 3VW0A 2TCTA 4M3GA 2PZ9A 3FK7A 1JUMA 3EGQA 3HGYA 3KKCA 5K7HA 2WV1A 3VOXA 3WHBA 2NS7A 2X6OA 3BCGA 1QPIA 5CXGA 5EYRA 4MO7A 1VI0A 2A2FX 2DG8A 3QPLA 5FGLA 3C2BA 2OERA 3AQTA 2QOPA 1QVTA 2HYTA 2Y2ZA 4D7NA 2R7WA 4M3DA 4D7MA 3CDLA 2FQ4A 4PXIA 1RPWA 3VP5A 4ACIA 3ZQIA 2HYJA 3HTAA 2Y30A 2WUIA 3KNWA 4JKZA 1RKTA 1T56A 2EH3A 4GFLA 5FKNA 2O7TA 2R7VA 2VKVA 3BQYA 5FKMA 3LSRA 3VW1A 1UI5A 4WIBA 3DEWA 2R7OA 3WHCA 2XPVA 3BJBA 3G1MA 5D1RA 3BR2A 3C07A 4JYKA 3ZQGA 2R7SA 3IH3A 5CW8A 1RKWA 3MVPA 3VVZA 5D18A 3VVXA 3V78A 5F0HA 3LHQA 2RASA 3BTLA 3CWRA 4KWAA 3V6GA 2JK3A 5CQGA 2Y31A 3NS4A 3VUQA 3BRUA 4ABZA 1U9OA 2R7XA 3LOCA 1Z77A 4ICHA 3BT9A 3FRQA 2ZB9A 5K7ZA 2F07A 2QIBA 5FKKA 3F0CA 3GZIA 2QKOA 1T33A 1ZK8A 2ZOYA 3BTJA 2NP5A 4AC6A 2UXPA 2YVEA 4OD4A 3SFIA 5F0CA 4XK4A 3LSPA 4IRVA 2ZY9A 5EZHA 2G3BA 3NI7A 3SWHA 3TP0A 3CJDA 3BTIA 2HQ5A 2B1EA 4D5CA 3LSJA 1JUSA 4GCKA 3Q0WA 5H9TA 4JNNA 3HIMA 5AQCA 3Q0UA 4DW6A 2XPWA 3VVYA 1Z0XA 3Q3SA 5J1YA 5IP6A 3HTHA 4NELA 2REKA 3DU5A 2R7RA 5F1JA 2FBQA 3RH2A 1JUPA 5F0FA 3P9TA 5GP9A 2ID6A 3NXCA 4UDSA 1JTXA 5F04A 2GFNA 3ZQLA 3BR1A 4YZEA 2RAEA 4V2FA 4GCTA 3BR3A 1UI6A 3BQZA 2ZCMA 2XDNA 2VKEA 4NN1A 1A6IA 2Q24A 2ZOZA 2B3WA 2NP3A 4AUXA 3O8GA 2UXUA 4W97A 3ANPA 2HKUA 4AF5A 4V2GA 2R7TA 3G7RA 3QPSA 2TRTA 2JJ7A 3G56A 2IU5A 3E7QA 3PM1A 2IEKA 2X9DA 2YVXA 4L62A 4MXMA 5IOZA 4B3AA 3SDGA 2RHAA 3MNLA 3K8PC 3VOKA 3BR5A 2DG7A 5FKOA 3DU6A 3BR0A 2G7GA 5J1RA 1BJZA 3ZQHA 5HBUA 2QCOA 2VPRA 4GCLA 2GUHA 3KKDA 3EUPA 2PBXA 3JSJA 3O8HA 4U9LA
chains in the Genus database with same CATH topology
1SGMA 5FHPA 3HE0A 4HKUA 2XB5A 2XGCA 3HGGA 3RD3A 2OPTA 3BR6A 2V57A 5DAJA 5HAWA 4JL3A 2ZCNA 5FMPA 4X1EA 3S5RA 3CRJA 3F1BA 4AC0A 3O60A 3T6NA 3LJLA 2ID3A 3IH4A 2UXHA 5F08A 1JT0A 3G1LA 3ZQFA 2I10A 2D6YA 2W53A 1ZKGA 1ORKA 2QTQA 2FX0A 3QQAA 3COLA 2YVHA 2IAIA 3G1OA 3PPBA 5J1UA 5K58A 2NX4A 5IPAA 3FIWA 3BTCA 1QVUA 2GENA 3NPIA 3QKXA 3NNRA 4B1RA 3QBMA 5C4YA 3ANGA 3DPJA 2NS8A 5GPAA 2XPUA 2XGEA 2G0EA 3GEUA 3NRGA 5D19A 5HSZA 2GBYA 2XRLA 3IH2A 4M3BA 4W1UA 1JT6A 3IUVA 3VW2A 2OI8A 5IOYA 3FK6A 4I6ZA 3CCYA 2DTZA 3B6AA 4M3EA 2G7LA 3HTIA 3ON4A 2O7OA 5GPCA 4D5FA 4GFKA 2FJ1A 3KZ9A 5K7FA 2ZCXA 3DCFA 2OF7A 3Q0VA 4MK6A 1JTYA 3B6CA 4CGRA 5F27A 5FKLA 2FD5A 5EZGA 3LWJA 2G7SA 3AQSA 3VIBA 3VPRA 5J3LA 4M3FA 2UXIA 4ME9A 3BHQA 3B81A 3HTJA 2WGBA 2QWTA 2UXOA 2HXOA 3PASA 3TP3A 3BNIA 5EFYA 1U9NA 2XGDA 3ON2A 4I76A 2HXIA 2IBDA 4G12A 5CXIA 3VW0A 2TCTA 4M3GA 2PZ9A 3FK7A 1JUMA 3EGQA 3HGYA 3KKCA 5K7HA 2WV1A 3VOXA 3WHBA 2NS7A 2X6OA 3BCGA 1QPIA 5CXGA 5EYRA 4MO7A 1VI0A 2DG8A 3QPLA 5FGLA 3C2BA 2OERA 3AQTA 2QOPA 4D7NA 1QVTA 2HYTA 2Y2ZA 4M3DA 4D7MA 3CDLA 2FQ4A 4PXIA 1RPWA 3VP5A 4ACIA 3ZQIA 2HYJA 3HTAA 2Y30A 2WUIA 3KNWA 4JKZA 1RKTA 1T56A 2EH3A 4GFLA 5FKNA 2O7TA 2VKVA 3BQYA 5FKMA 3LSRA 3VW1A 1UI5A 3DEWA 3WHCA 2XPVA 3BJBA 3G1MA 5D1RA 3BR2A 3C07A 4JYKA 3ZQGA 3IH3A 5CW8A 1RKWA 3MVPA 3VVZA 5D18A 3VVXA 3V78A 5F0HA 3LHQA 2RASA 3BTLA 3CWRA 4KWAA 3V6GA 2JK3A 2Y31A 3VUQA 3BRUA 4ABZA 1U9OA 3LOCA 1Z77A 4ICHA 3BT9A 3FRQA 2ZB9A 5K7ZA 2F07A 2QIBA 5FKKA 3F0CA 3GZIA 2QKOA 1T33A 1ZK8A 2ZOYA 3BTJA 2NP5A 4AC6A 2UXPA 2YVEA 3SFIA 5F0CA 4XK4A 3LSPA 5EZHA 2G3BA 3NI7A 3TP0A 3CJDA 3BTIA 2HQ5A 4D5CA 3LSJA 1JUSA 4GCKA 3Q0WA 5H9TA 4JNNA 3HIMA 5AQCA 3Q0UA 4DW6A 2XPWA 3VVYA 1Z0XA 3Q3SA 5J1YA 5IP6A 3HTHA 4NELA 2REKA 5F1JA 2FBQA 3RH2A 1JUPA 5F0FA 3P9TA 5GP9A 2ID6A 3NXCA 4UDSA 1JTXA 5F04A 2GFNA 3ZQLA 3BR1A 4YZEA 2RAEA 4V2FA 4GCTA 3BR3A 1UI6A 3BQZA 2ZCMA 2XDNA 2VKEA 4NN1A 1A6IA 2Q24A 2ZOZA 2NP3A 4AUXA 3O8GA 2UXUA 4W97A 3ANPA 2HKUA 4AF5A 4V2GA 3G7RA 3QPSA 2TRTA 2JJ7A 3G56A 2IU5A 3E7QA 3PM1A 2IEKA 2X9DA 4L62A 4MXMA 5IOZA 4B3AA 3SDGA 2RHAA 3MNLA 3VOKA 3BR5A 2DG7A 5FKOA 3BR0A 2G7GA 5J1RA 1BJZA 3ZQHA 5HBUA 2QCOA 2VPRA 4GCLA 2GUHA 3KKDA 3EUPA 2PBXA 3JSJA 3O8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SGM A;  5FHP A;  3HE0 A;  4HKU A;  2XB5 A;  2XGC A;  3HGG A;  3RD3 A;  2OPT A;  3BR6 A;  2V57 A;  5DAJ A;  5HAW A;  4JL3 A;  2ZCN A;  5FMP A;  4X1E A;  3S5R A;  3CRJ A;  3F1B A;  4AC0 A;  3O60 A;  3T6N A;  3LJL A;  2ID3 A;  3IH4 A;  2UXH A;  5F08 A;  1JT0 A;  3G1L A;  3ZQF A;  2I10 A;  2D6Y A;  2W53 A;  1ZKG A;  1ORK A;  2QTQ A;  2FX0 A;  3QQA A;  3COL A;  2YVH A;  2IAI A;  3G1O A;  3PPB A;  5J1U A;  5K58 A;  2NX4 A;  5IPA A;  3FIW A;  3BTC A;  1QVU A;  2GEN A;  3NPI A;  3QKX A;  3NNR A;  4B1R A;  3QBM A;  5C4Y A;  3ANG A;  3DPJ A;  2NS8 A;  5GPA A;  2XPU A;  2XGE A;  2G0E A;  3GEU A;  3NRG A;  5D19 A;  5HSZ A;  2GBY A;  2XRL A;  3IH2 A;  4M3B A;  4W1U A;  1JT6 A;  3IUV A;  3VW2 A;  2OI8 A;  5IOY A;  3FK6 A;  4I6Z A;  3CCY A;  2DTZ A;  3B6A A;  4M3E A;  2G7L A;  3HTI A;  3ON4 A;  2O7O A;  5GPC A;  4D5F A;  4GFK A;  2FJ1 A;  3KZ9 A;  5K7F A;  2ZCX A;  3DCF A;  2OF7 A;  3Q0V A;  4MK6 A;  1JTY A;  3B6C A;  4CGR A;  5F27 A;  5FKL A;  2FD5 A;  5EZG A;  3LWJ A;  2G7S A;  3AQS A;  3VIB A;  3VPR A;  5J3L A;  4M3F A;  2UXI A;  4ME9 A;  3BHQ A;  3B81 A;  3HTJ A;  2WGB A;  2QWT A;  2UXO A;  2HXO A;  3PAS A;  3TP3 A;  3BNI A;  5EFY A;  1U9N A;  2XGD A;  3ON2 A;  4I76 A;  2HXI A;  2IBD A;  4G12 A;  5CXI A;  3VW0 A;  2TCT A;  4M3G A;  2PZ9 A;  3FK7 A;  1JUM A;  3EGQ A;  3HGY A;  3KKC A;  5K7H A;  2WV1 A;  3VOX A;  3WHB A;  2NS7 A;  2X6O A;  3BCG A;  1QPI A;  5CXG A;  5EYR A;  4MO7 A;  1VI0 A;  2DG8 A;  3QPL A;  5FGL A;  3C2B A;  2OER A;  3AQT A;  2QOP A;  4D7N A;  1QVT A;  2HYT A;  2Y2Z A;  4M3D A;  4D7M A;  3CDL A;  2FQ4 A;  4PXI A;  1RPW A;  3VP5 A;  4ACI A;  3ZQI A;  2HYJ A;  3HTA A;  2Y30 A;  2WUI A;  3KNW A;  4JKZ A;  1RKT A;  1T56 A;  2EH3 A;  4GFL A;  5FKN A;  2O7T A;  2VKV A;  3BQY A;  5FKM A;  3LSR A;  3VW1 A;  1UI5 A;  3DEW A;  3WHC A;  2XPV A;  3BJB A;  3G1M A;  5D1R A;  3BR2 A;  3C07 A;  4JYK A;  3ZQG A;  3IH3 A;  5CW8 A;  1RKW A;  3MVP A;  3VVZ A;  5D18 A;  3VVX A;  3V78 A;  5F0H A;  3LHQ A;  2RAS A;  3BTL A;  3CWR A;  4KWA A;  3V6G A;  2JK3 A;  2Y31 A;  3VUQ A;  3BRU A;  4ABZ A;  1U9O A;  3LOC A;  1Z77 A;  4ICH A;  3BT9 A;  3FRQ A;  2ZB9 A;  5K7Z A;  2F07 A;  2QIB A;  5FKK A;  3F0C A;  3GZI A;  2QKO A;  1T33 A;  1ZK8 A;  2ZOY A;  3BTJ A;  2NP5 A;  4AC6 A;  2UXP A;  2YVE A;  3SFI A;  5F0C A;  4XK4 A;  3LSP A;  5EZH A;  2G3B A;  3NI7 A;  3TP0 A;  3CJD A;  3BTI A;  2HQ5 A;  4D5C A;  3LSJ A;  1JUS A;  4GCK A;  3Q0W A;  5H9T A;  4JNN A;  3HIM A;  5AQC A;  3Q0U A;  4DW6 A;  2XPW A;  3VVY A;  1Z0X A;  3Q3S A;  5J1Y A;  5IP6 A;  3HTH A;  4NEL A;  2REK A;  5F1J A;  2FBQ A;  3RH2 A;  1JUP A;  5F0F A;  3P9T A;  5GP9 A;  2ID6 A;  3NXC A;  4UDS A;  1JTX A;  5F04 A;  2GFN A;  3ZQL A;  3BR1 A;  4YZE A;  2RAE A;  4V2F A;  4GCT A;  3BR3 A;  1UI6 A;  3BQZ A;  2ZCM A;  2XDN A;  2VKE A;  4NN1 A;  1A6I A;  2Q24 A;  2ZOZ A;  2NP3 A;  4AUX A;  3O8G A;  2UXU A;  4W97 A;  3ANP A;  2HKU A;  4AF5 A;  4V2G A;  3G7R A;  3QPS A;  2TRT A;  2JJ7 A;  3G56 A;  2IU5 A;  3E7Q A;  3PM1 A;  2IEK A;  2X9D A;  4L62 A;  4MXM A;  5IOZ A;  4B3A A;  3SDG A;  2RHA A;  3MNL A;  3VOK A;  3BR5 A;  2DG7 A;  5FKO A;  3BR0 A;  2G7G A;  5J1R A;  1BJZ A;  3ZQH A;  5HBU A;  2QCO A;  2VPR A;  4GCL A;  2GUH A;  3KKD A;  3EUP A;  2PBX A;  3JSJ A;  3O8H A; 
#chains in the Genus database with same CATH topology
 1SGM A;  2R7U A;  5FHP A;  3HE0 A;  4HKU A;  2XB5 A;  2R7Q A;  2XGC A;  3HGG A;  3RD3 A;  2OPT A;  3BR6 A;  2V57 A;  5DAJ A;  5HAW A;  4JL3 A;  2ZCN A;  5FMP A;  4X1E A;  3VTI A;  3S5R A;  3CRJ A;  3F1B A;  4AC0 A;  3O60 A;  3T6N A;  3LJL A;  2ID3 A;  3IH4 A;  2UXH A;  5F08 A;  1JT0 A;  3G1L A;  3ZQF A;  2I10 A;  2D6Y A;  2W53 A;  1ZKG A;  4C2M A;  1ORK A;  2QTQ A;  2FX0 A;  3QQA A;  3COL A;  2YVH A;  2IAI A;  3G1O A;  3PPB A;  5J1U A;  5K58 A;  2NX4 A;  5IPA A;  3FIW A;  3BTC A;  1QVU A;  2GEN A;  3NPI A;  2FJI 1;  3QKX A;  3NNR A;  4B1R A;  3QBM A;  5C4Y A;  3ANG A;  3DPJ A;  2NS8 A;  5GPA A;  2XPU A;  2XGE A;  2G0E A;  3GEU A;  4DVY P;  3NRG A;  5D19 A;  5HSZ A;  2GBY A;  2XRL A;  3IH2 A;  4M3B A;  4W1U A;  1JT6 A;  3IUV A;  3VW2 A;  2OI8 A;  5IOY A;  3FK6 A;  4I6Z A;  3CCY A;  2DTZ A;  3B6A A;  4M3E A;  2G7L A;  3HTI A;  3ON4 A;  2O7O A;  5GPC A;  4D5F A;  4GFK A;  2FJ1 A;  3KZ9 A;  5K7F A;  2PFV A;  2ZCX A;  3DCF A;  2OF7 A;  3KYL A;  3Q0V A;  4MK6 A;  4OD5 A;  1JTY A;  3B6C A;  4CGR A;  5F27 A;  5FKL A;  2FD5 A;  5EZG A;  3LWJ A;  2G7S A;  3AQS A;  3FHN A;  3VIB A;  3VPR A;  5J3L A;  4M3F A;  2UXI A;  4ME9 A;  3BHQ A;  3B81 A;  3HTJ A;  2WGB A;  2QWT A;  2UXO A;  2HXO A;  3PAS A;  3TP3 A;  3BNI A;  5EFY A;  1U9N A;  2XGD A;  3ON2 A;  4I76 A;  2HXI A;  2IBD A;  4G12 A;  4U9N A;  5CXI A;  3VW0 A;  2TCT A;  4M3G A;  2PZ9 A;  3FK7 A;  1JUM A;  3EGQ A;  3HGY A;  3KKC A;  5K7H A;  2WV1 A;  3VOX A;  3WHB A;  2NS7 A;  2X6O A;  3BCG A;  1QPI A;  5CXG A;  5EYR A;  4MO7 A;  1VI0 A;  2A2F X;  2DG8 A;  3QPL A;  5FGL A;  3C2B A;  2OER A;  3AQT A;  2QOP A;  1QVT A;  2HYT A;  2Y2Z A;  4D7N A;  2R7W A;  4M3D A;  4D7M A;  3CDL A;  2FQ4 A;  4PXI A;  1RPW A;  3VP5 A;  4ACI A;  3ZQI A;  2HYJ A;  3HTA A;  2Y30 A;  2WUI A;  3KNW A;  4JKZ A;  1RKT A;  1T56 A;  2EH3 A;  4GFL A;  5FKN A;  2O7T A;  2R7V A;  2VKV A;  3BQY A;  5FKM A;  3LSR A;  3VW1 A;  1UI5 A;  4WIB A;  3DEW A;  2R7O A;  3WHC A;  2XPV A;  3BJB A;  3G1M A;  5D1R A;  3BR2 A;  3C07 A;  4JYK A;  3ZQG A;  2R7S A;  3IH3 A;  5CW8 A;  1RKW A;  3MVP A;  3VVZ A;  5D18 A;  3VVX A;  3V78 A;  5F0H A;  3LHQ A;  2RAS A;  3BTL A;  3CWR A;  4KWA A;  3V6G A;  2JK3 A;  5CQG A;  2Y31 A;  3NS4 A;  3VUQ A;  3BRU A;  4ABZ A;  1U9O A;  2R7X A;  3LOC A;  1Z77 A;  4ICH A;  3BT9 A;  3FRQ A;  2ZB9 A;  5K7Z A;  2F07 A;  2QIB A;  5FKK A;  3F0C A;  3GZI A;  2QKO A;  1T33 A;  1ZK8 A;  2ZOY A;  3BTJ A;  2NP5 A;  4AC6 A;  2UXP A;  2YVE A;  4OD4 A;  3SFI A;  5F0C A;  4XK4 A;  3LSP A;  4IRV A;  2ZY9 A;  5EZH A;  2G3B A;  3NI7 A;  3SWH A;  3TP0 A;  3CJD A;  3BTI A;  2HQ5 A;  2B1E A;  4D5C A;  3LSJ A;  1JUS A;  4GCK A;  3Q0W A;  5H9T A;  4JNN A;  3HIM A;  5AQC A;  3Q0U A;  4DW6 A;  2XPW A;  3VVY A;  1Z0X A;  3Q3S A;  5J1Y A;  5IP6 A;  3HTH A;  4NEL A;  2REK A;  3DU5 A;  2R7R A;  5F1J A;  2FBQ A;  3RH2 A;  1JUP A;  5F0F A;  3P9T A;  5GP9 A;  2ID6 A;  3NXC A;  4UDS A;  1JTX A;  5F04 A;  2GFN A;  3ZQL A;  3BR1 A;  4YZE A;  2RAE A;  4V2F A;  4GCT A;  3BR3 A;  1UI6 A;  3BQZ A;  2ZCM A;  2XDN A;  2VKE A;  4NN1 A;  1A6I A;  2Q24 A;  2ZOZ A;  2B3W A;  2NP3 A;  4AUX A;  3O8G A;  2UXU A;  4W97 A;  3ANP A;  2HKU A;  4AF5 A;  4V2G A;  2R7T A;  3G7R A;  3QPS A;  2TRT A;  2JJ7 A;  3G56 A;  2IU5 A;  3E7Q A;  3PM1 A;  2IEK A;  2X9D A;  2YVX A;  4L62 A;  4MXM A;  5IOZ A;  4B3A A;  3SDG A;  2RHA A;  3MNL A;  3K8P C;  3VOK A;  3BR5 A;  2DG7 A;  5FKO A;  3DU6 A;  3BR0 A;  2G7G A;  5J1R A;  1BJZ A;  3ZQH A;  5HBU A;  2QCO A;  2VPR A;  4GCL A;  2GUH A;  3KKD A;  3EUP A;  2PBX A;  3JSJ A;  3O8H A;  4U9L A; 
#chains in the Genus database with same CATH homology
 1SGM A;  5FHP A;  3HE0 A;  4HKU A;  2XB5 A;  2XGC A;  3HGG A;  3RD3 A;  2OPT A;  3BR6 A;  2V57 A;  5DAJ A;  5HAW A;  4JL3 A;  2ZCN A;  5FMP A;  4X1E A;  3S5R A;  3CRJ A;  3F1B A;  4AC0 A;  3O60 A;  3T6N A;  3LJL A;  2ID3 A;  3IH4 A;  2UXH A;  5F08 A;  1JT0 A;  3G1L A;  3ZQF A;  2I10 A;  2D6Y A;  2W53 A;  1ZKG A;  1ORK A;  2QTQ A;  2FX0 A;  3QQA A;  3COL A;  2YVH A;  2IAI A;  3G1O A;  3PPB A;  5J1U A;  5K58 A;  2NX4 A;  5IPA A;  3FIW A;  3BTC A;  1QVU A;  2GEN A;  3NPI A;  3QKX A;  3NNR A;  4B1R A;  3QBM A;  5C4Y A;  3ANG A;  3DPJ A;  2NS8 A;  5GPA A;  2XPU A;  2XGE A;  2G0E A;  3GEU A;  3NRG A;  5D19 A;  5HSZ A;  2GBY A;  2XRL A;  3IH2 A;  4M3B A;  4W1U A;  1JT6 A;  3IUV A;  3VW2 A;  2OI8 A;  5IOY A;  3FK6 A;  4I6Z A;  3CCY A;  2DTZ A;  3B6A A;  4M3E A;  2G7L A;  3HTI A;  3ON4 A;  2O7O A;  5GPC A;  4D5F A;  4GFK A;  2FJ1 A;  3KZ9 A;  5K7F A;  2ZCX A;  3DCF A;  2OF7 A;  3Q0V A;  4MK6 A;  1JTY A;  3B6C A;  4CGR A;  5F27 A;  5FKL A;  2FD5 A;  5EZG A;  3LWJ A;  2G7S A;  3AQS A;  3VIB A;  3VPR A;  5J3L A;  4M3F A;  2UXI A;  4ME9 A;  3BHQ A;  3B81 A;  3HTJ A;  2WGB A;  2QWT A;  2UXO A;  2HXO A;  3PAS A;  3TP3 A;  3BNI A;  5EFY A;  1U9N A;  2XGD A;  3ON2 A;  4I76 A;  2HXI A;  2IBD A;  4G12 A;  5CXI A;  3VW0 A;  2TCT A;  4M3G A;  2PZ9 A;  3FK7 A;  1JUM A;  3EGQ A;  3HGY A;  3KKC A;  5K7H A;  2WV1 A;  3VOX A;  3WHB A;  2NS7 A;  2X6O A;  3BCG A;  1QPI A;  5CXG A;  5EYR A;  4MO7 A;  1VI0 A;  2DG8 A;  3QPL A;  5FGL A;  3C2B A;  2OER A;  3AQT A;  2QOP A;  4D7N A;  1QVT A;  2HYT A;  2Y2Z A;  4M3D A;  4D7M A;  3CDL A;  2FQ4 A;  4PXI A;  1RPW A;  3VP5 A;  4ACI A;  3ZQI A;  2HYJ A;  3HTA A;  2Y30 A;  2WUI A;  3KNW A;  4JKZ A;  1RKT A;  1T56 A;  2EH3 A;  4GFL A;  5FKN A;  2O7T A;  2VKV A;  3BQY A;  5FKM A;  3LSR A;  3VW1 A;  1UI5 A;  3DEW A;  3WHC A;  2XPV A;  3BJB A;  3G1M A;  5D1R A;  3BR2 A;  3C07 A;  4JYK A;  3ZQG A;  3IH3 A;  5CW8 A;  1RKW A;  3MVP A;  3VVZ A;  5D18 A;  3VVX A;  3V78 A;  5F0H A;  3LHQ A;  2RAS A;  3BTL A;  3CWR A;  4KWA A;  3V6G A;  2JK3 A;  2Y31 A;  3VUQ A;  3BRU A;  4ABZ A;  1U9O A;  3LOC A;  1Z77 A;  4ICH A;  3BT9 A;  3FRQ A;  2ZB9 A;  5K7Z A;  2F07 A;  2QIB A;  5FKK A;  3F0C A;  3GZI A;  2QKO A;  1T33 A;  1ZK8 A;  2ZOY A;  3BTJ A;  2NP5 A;  4AC6 A;  2UXP A;  2YVE A;  3SFI A;  5F0C A;  4XK4 A;  3LSP A;  5EZH A;  2G3B A;  3NI7 A;  3TP0 A;  3CJD A;  3BTI A;  2HQ5 A;  4D5C A;  3LSJ A;  1JUS A;  4GCK A;  3Q0W A;  5H9T A;  4JNN A;  3HIM A;  5AQC A;  3Q0U A;  4DW6 A;  2XPW A;  3VVY A;  1Z0X A;  3Q3S A;  5J1Y A;  5IP6 A;  3HTH A;  4NEL A;  2REK A;  5F1J A;  2FBQ A;  3RH2 A;  1JUP A;  5F0F A;  3P9T A;  5GP9 A;  2ID6 A;  3NXC A;  4UDS A;  1JTX A;  5F04 A;  2GFN A;  3ZQL A;  3BR1 A;  4YZE A;  2RAE A;  4V2F A;  4GCT A;  3BR3 A;  1UI6 A;  3BQZ A;  2ZCM A;  2XDN A;  2VKE A;  4NN1 A;  1A6I A;  2Q24 A;  2ZOZ A;  2NP3 A;  4AUX A;  3O8G A;  2UXU A;  4W97 A;  3ANP A;  2HKU A;  4AF5 A;  4V2G A;  3G7R A;  3QPS A;  2TRT A;  2JJ7 A;  3G56 A;  2IU5 A;  3E7Q A;  3PM1 A;  2IEK A;  2X9D A;  4L62 A;  4MXM A;  5IOZ A;  4B3A A;  3SDG A;  2RHA A;  3MNL A;  3VOK A;  3BR5 A;  2DG7 A;  5FKO A;  3BR0 A;  2G7G A;  5J1R A;  1BJZ A;  3ZQH A;  5HBU A;  2QCO A;  2VPR A;  4GCL A;  2GUH A;  3KKD A;  3EUP A;  2PBX A;  3JSJ A;  3O8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...