3QBOA

Crystal structure of phosphoserine aminotransferase from yersinia pestis co92
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
358
structure length
358
Chain Sequence
b'QVYNFSAGPAMLPVEVLRRAQQELRDWHGLGTSVMEVSHRSKEFMQVAEESEKDLRDLLNVPANYKVLFCHGGARAQFAAVPLNLLGDRNSADYVDGGYWAHSAIKEAQKYCTPNVIDVTTHDNGLTGIQPMKQWKLSDNAAYVHYCPNETIDGIAIDEQPDFGNKVVVADFSSSILSRPIDVSRYGVIYAGAQKNIGPAGLTLVIVREDLLGKAHTALPSILDYKILADNDSMFNTPPTFAWYLSGLVFKWLKEQGGLGEMEKRNQAKAELLYGAIDRTGFYRNDVAITNRSWMNVPFQMADASLDKLFLSEAEAQGLQALKGHRVAGGMRASIYNAMPIEGVKALTDFMADFERRH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoserine aminotransferase
publication title Crystal structure of phosphoserine aminotransferase from Yersinia pestis CO92
rcsb
source organism Yersinia pestis co92
molecule tags Transferase
total genus 112
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 2.6.1.52: Phosphoserine transaminase.
pdb deposition date 2011-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3qboA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3qboA02
3NYUA 4IXSA 4IXOA 1VEFA 1UKJA 1D7SA 3PPLA 3N75A 2FNUA 1M0QA 3W1JA 2HORA 5IWQA 1S07A 2ZSLA 3WGCA 2W8TA 2AY4A 3ELPA 5C6UA 2ZY2A 2VMTA 3GBXA 3AOVA 2D63A 4M2MA 4RM1A 2BWNA 4OMAA 1B5OA 3ZZJA 2HOXA 4PFNA 2OGEA 2YKYA 3QBOA 5EIGA 3BWNA 2E7IA 1V2DA 2VMXA 1O69A 2W8JA 4W91A 3AENA 3QM2A 3AV7A 1P3WA 3BN1A 1RV3A 4IYOA 1AJRA 5JAYA 4P3MA 3FZ8A 5TF5A 1W7NA 2GSAA 2VLFA 2O0RA 2YKUA 3AELA 4JF1A 2ZY5A 4F4EA 3AENB 1W7LA 2VGWA 3I5TA 4IYOB 2JISA 1M0OA 1I43A 4KYOA 2CINA 4ZASA 1M0PA 1U08A 3BCXA 1AY4A 3IHJA 3FFHA 4L0OA 1MDZA 1TPLA 5BJ3A 1BT4A 4GDYA 2VMZA 4WYFA 1C7OA 1OATA 2OKKA 4IX8A 5HXXA 2JJFA 2VGUA 3DYDA 2CB1A 1IX6A 4K2IA 1LC5A 4CBRA 1X29A 1SZKA 2R5EA 4Q31A 4XQ2A 4R2NA 3E2ZA 1DJ9A 2PB0A 5EAVA 4A00A 2Z1ZA 1YJZA 4JEZA 1AHYA 1S06A 2D7YA 2AY5A 2V0YA 3JWBA 3Q8NA 1RVUA 2E7JA 3WKSA 3ZZKA 4UHMA 4WBTA 2Z9VA 3E2ZB 3LG0A 3UE8A 2Z9WA 1GEYA 3EIAA 3NNKA 1YIZA 2JJGA 5HHYA 2Z9XA 4EB5A 3A8UX 4WD2A 4XJOA 3HLMA 1ARGA 2VMPA 3G0TA 2YRIA 4OC9A 3A2BA 3NUIA 1H1CA 1Y4IA 1UU2A 3RBLA 2ZYJA 1AMAA 4Y0DA 3AEOA 3RCHA 4Q76A 2BI5A 3P6KA 2CTZA 4JEXA 5LHAA 2Z9UA 3PDXA 3NU8A 4ZLVA 4F5HA 3HBXA 1H0CA 2JG2A 1QJ3A 1X2AA 3A9XA 4WP0A 4DQ6A 3FD0A 2D64A 3JZLA 1X0MA 2AATA 1GC2A 3NUBA 2AY6A 4F5JA 1AX4A 1G7XA 2VGTA 3QI6A 2CH2A 2VMQA 1MLZA 4MY5A 4WXFA 2W7MA 1CQ6A 1LK9A 3MC6C 3WLXA 4E3QA 1C4KA 2R5CB 4A6UA 2DKJA 3VK3A 2W8UA 1UU1A 4F5MA 2RFVA 1M32A 3FVXA 4W1VA 3WY7A 5F8VA 3ELEA 3ZRRA 1KKJA 4M2KA 3NDNA 5FT6A 4AH3A 4JE5A 2GMUA 2C7TA 4Y0HA 4JEWA 4GE9A 3EZSA 2CY8A 3KGXA 1BJOA 3NX3A 4AZKA 2W7EA 4WXGA 4M2JA 4JE5D 4RJYA 2VLHA 2AY7A 1TASA 3DR4A 1ASNA 2QBTA 4MKJA 4UQVA 8AATA 1WKGA 2Z20A 3FDDA 4IW7A 4E1OA 1ARIA 1ASEA 4ADEA 2YCTA 2W7IA 3JTXA 1G7WA 4BMKA 1JS6A 3E9KA 1T3IA 1MDXA 2PO3A 3MC6A 4LW2A 1LW4A 4OT8A 1UU0A 5M46A 4ZDOA 3PD6A 2DGMA 1I48A 4ZAHA 2FQ6A 2BI3A 1ZODA 2BHXA 1V2EA 1VP4A 1ZC9A 4CVQA 3COGA 1ASBA 1WYVB 3OP7A 1BW0A 1KL1A 4RIZA 3TCMA 4OBVA 1RV4A 1E5EA 3PJ0A 4WLJA 2BI2A 2YHKA 2BI1A 3TQXA 2VGZA 4ZM4A 4RJ0A 4U2HA 2AEUA 3DU4A 3OKSA 4RAEA 3HT4A 4K2BA 2HOYA 2YCNA 1D7VA 1QGNA 2BI9A 1O61A 2GB3A 4KAMA 4ADCA 2OGAA 2X8UA 2EZ1A 5BJ4A 4R8DA 1B4XA 3TFUA 4BHDA 9AATA 1G4XA 3I16A 4ADDA 5D5SA 4BA5A 2VGVA 3LY1A 4WYEA 3PGYA 3FDBA 1IBJA 2D61A 4R5FA 3JWAA 3CAIA 3MAUA 1AIAA 1X28A 3EIBA 3NU7A 4XJLA 3GSBA 5EIGB 1ARTA 3VAXA 3WKRA 3ISLA 1Z3ZA 2BYJA 2VI9A 3FVUA 1CL1A 1M4NA 2BIEA 3K40A 1M7YA 3NTJA 1DFOA 2OQXA 3A9YA 2R2NA 1AICA 3CQ4A 3KKIA 4HF8A 5E4ZA 4F5KA 3RUYA 2O7CA 3W1HA 4UHOA 5DJ9A 2W7HA 2BWOA 1GBNA 4PIWA 1TOJA 1YOOA 5E3KA 2EH6A 3HMUA 4WB0A 5M49A 1ASLA 1J32A 1DTYA 1I29A 2JJEA 2X3LA 3DXVA 4JEVA 1N31A 1VJOA 4H51A 2VI8A 1PG8A 1CQ7A 3EI6A 1AJSA 4WB0B 1AHEA 4LNJA 3NYTA 1TOIA 2GQNA 5HDMA 1GC3A 1AHGA 4CXQA 1ASDA 3E2YA 2E7UA 4F5IA 4NOGA 4ZM3A 4N0WA 2AY3A 2R0TA 2VMRA 3B46A 3FVSA 4GRXA 2QA3A 1RVYA 4RLGA 4PFFA 2YOBA 2BIAA 3ASBA 1BJWA 3ACZA 1YJYA 1M0NA 3MEBA 4MQPA 1KL2A 5G09A 4JEYA 2BKWA 2HUFA 1AY5A 3IF2A 1B9IA 1B5PA 1MLYA 2CH1A 3DODA 2JJHA 2WK7A 2W7GA 3JU7A 3MKJA 3FTBA 2HOZA 3B8XA 5DJ1A 2X5FA 2AEVA 5AX8A 4ZSWA 2QB2A 2DOUA 3BWOA 3N5MA 3VOMA 1WYTA 4WYDA 4A6RA 3BCAA 3NYSA 4CBSA 1BQAA 1GDEA 3CQ6A 3AOWA 4ZWMA 4LNLA 1O4SA 4ITGA 1BJ4A 2TPLA 2CJGA 3RCHB 3USFA 2GMSA 3GETA 3L8AA 1LW5A 2VYCA 1OXOA 1YJSA 2CJHA 3CQ5A 3PDBA 1LS3A 4FFCA 4RKDA 1SZUA 1QJ5A 1IX8A 4EMYA 3KGWA 4EU1A 4F5LA 4W1WA 1B9HA 2XH1A 4B9BA 2X5DA 3EI7A 3K7YA 3MAFA 4ZWVA 1ZOBA 3BCBA 3CBFA 2VIBA 4GE4A 1JS3A 4LW4A 1QIRA 5EUNA 1AKAA 1GD9A 3HDOA 3E6GA 3FSLA 3QGUA 3MBBA 1JF9A 5FT8A 5FT4A 1IVRA 3R4TA 1AHXA 3TFTA 1YIYA 1DJEA 4MSOA 1IAXA 2VMSA 4ITXA 2NMPA 3JW9A 4F5GA 4CXRA 2W7FA 1GCKA 3BC8A 1IAYA 1MGVA 2QMAA 3FQAA 3GWPA 5F9SA 2YRRA 5LH9A 1PMMA 1N8PA 1S0AA 5K8BA 3PAAA 4OTLA 4UHNA 3DZZA 3GR9A 1LC8A 3I4JA 3PA9A 1LC7A 1BJOB 3HVYA 4QGRA 2HUIA 4ADBA 2VMNA 3AEMC 4MKKA 5M4BA 1AMRA 3PIUA 1N2TA 3F0HA 1C7NA 1B8GA 4WYAA 3W1IA 1ASFA 4RKCA 4OCAA 1OHWA 1V2FA 1C9CA 3ATHA 1ASAA 3F9TA 3FKDA 1TOGA 2AY8A 1D2FA 1W3UA 2ZY4A 1CS1A 3G8MA 4FL0A 2QLRA 3PD6B 4MQQA 1AKCA 1QZ9A 2D65A 3DC1A 3LVLB 4WYGA 5G2QA 3DRDA 3QN6A 1TATA 1WYUA 2WK8A 5E5IA 2HUUA 4TV7A 1PMOA 4BA4A 2VMYA 4XJMA 1AIBA 1EJIA 1IX7A 5D95A 4AO9A 3UAKA 3AEMA 2VGSA 2DR1A 2VIAA 4PVFA 2DGLA 2OATA 3K28A 2ZSMA 3LVJA 1D7UA 4I8AA 4B98A 1AY8A 4U1TA 3BB8A 2W7DA 3FRKA 2BIGA 4WLHA 4WXBA 1I41A 1ORDA 1XEYA 2XBNA 3ASAA 3LWSA 3P1TA 4P7YA 3VK4A 2E54A 1BS0A 1MDOA 2YKVA 4XJPA 3WX9A 1SVVA 3FCRA 1CJ0A 2Z1YA 3B1EA 1E5FA 1GEWA 2FNIA 4AZJA 1M6SA 2VMOA 1D7RA 1DJUA 1GC4A 3H14A 3GZCA 5EUDA 2BYLA 1FG3A 2W8WA 3HL2A 4A0FA 1O62A 1S08A 1AAWA 1CZEA 2YKXA 1WKHA 2C81A 2YCPA 3HQTA 1OXPA 1ECXA 4DBCA 2BWPA 3KE3A 1ARSA 3RQ1A 1KKPA 4W5KA 2CFBA 4WYCA 2EPJA 4Q75A 3WCNA 4ATPA 3E2FA 4JF0A 1EQBA 3G7QA 1MAPA 1JG8A 2HZPA 3H7FA 1AJSB 3ZRQA 2VMUA 3LVKA 2DKBA 2Q7WA 2D7ZA 3ECDA 5DX5A 5EFSA 3B1CA 4OYTA 3BV0A 5G4IA 3VP6A 3EZ1A 1OHVA 1XI9A 4J5UA 1KMKA 2OKJA 1BQDA 4ATQA 4IXZA 7AATA 1CZCA 3FZ7A 3LV2A 4IY7A 3EI8A 3DR7A 1DGDA 1SPAA 2CJDA 3BS8A 4R5ZA 1AMQA 5G2PA 3T32A 1ASMA 2Z67A 2FM1A 4W8IA 1C0NA 2HP2A 3EI9A 5G4JA 1ASGA 3AEJC 2C0RA 4XAUA 4EFFA 4LNMA 4A6TA 3II0A 4EB7A 4XEWA 1YNUA 2CSTA 4MGRA 1ELUA 1MAQA 1ELQA 1WYTB 1DGEA 5M4DA 3FFRA 4BQ0A 2O1BA 1BJNA 1QITA 1J04A 4DGTA 3VK2A 4A0RA 1EG5A 1ARHA 1GEXA 1BKGA 1V72A 4ZDPA 2ZY3A 2VMWA 3E77A 4A72A 5FT5A 2EGYA 4A0HA 1G4VA 2CANA 2ORDA 3EUCA 2W7LA 1QISA 2FN6A 2V1PA 2DGKA 1AMSA 1SZSA 1TOEA 2D66A 2WK9A 4E77A 4K2MA 3TATA 2Z61A 4LC3A 3PDBB 4J8LA 4TMRA 3QHXA 3GZDC 3FZ6A 2AY1A 3FQ8A 1CQ8A 4RITA 4ISYA 3MAFB 3AEJA 5EUEA 1W7MA 2VMVA 3AATA 4E3RA 2QB3A 2HP1A 1W23A 4KXKA 4F5FA 1TOKA 2ZC0A 2R5CA 3LVMA 1WSTA 3ZRPA 2G6WA 4Q6RA 3QPGA 1AKBA 1TARA 1IJIA 1SF2A 4O6ZA 4N0BA 3MADA 1YAAA 3N0LA 3D6KA 5EQCA 1C7GA 3L44A 4TN4A 5EAAA 3RI6A 1LKCA 4ZDLA 1AHFA 1FC4A 3AEPA 3GJUA 4Y0IA 1Z7DA 2AY9A 4MQRA 2ZJGA 1AAMA 4A0GA 3EI5A 4GEBA 4AO4A 3GZDA 3WCOA 2C44A 3WZFA 2AY2A 2D5YA 2EZ2A 2WKAA 1KMJA 1PFFA 4OBUA 5J8QA 2ZUKA 2ZP7A 4ZSYA 4W1XA 3NRAA 1DKAA 1ASCA 5I92A 3WGBA 2W7JA 5DB5A 1S09A 3B1DA 2W8VA 3R9AA 1FG7A 1OHYA 3F6TA 4HVKA 1IUGA 2FYFA 2PB2A 3BWNC 4GE7A 4XK1A 3A9ZA 1WYVA 2F8JA 2JGTA 5G0AA 1WYUB 3FQ7A 4AOAA 1SFFA 2EO5A 1CL2A 3RBFA 4UOYA 3DXWA 1GC0A 2W7KA 3UWCA 4GSAA 3M5UA
chains in the Genus database with same CATH superfamily
3NYUA 4IXSA 4IXOA 1VEFA 1UKJA 1D7SA 3PPLA 3N75A 2FNUA 1M0QA 3W1JA 2HORA 5IWQA 1S07A 2ZSLA 3WGCA 2W8TA 2AY4A 3ELPA 5C6UA 2ZY2A 2VMTA 3GBXA 3AOVA 2D63A 4M2MA 4RM1A 2BWNA 4OMAA 1B5OA 3ZZJA 2HOXA 4PFNA 2OGEA 2YKYA 3QBOA 5EIGA 3BWNA 2E7IA 2FKIA 1V2DA 2VMXA 1O69A 2W8JA 4W91A 3AENA 3QM2A 3AV7A 1P3WA 3BN1A 1RV3A 4IYOA 1AJRA 5JAYA 4P3MA 3FZ8A 5TF5A 1W7NA 2GSAA 2VLFA 2O0RA 2YKUA 3AELA 4JF1A 2ZY5A 4F4EA 3AENB 1W7LA 2VGWA 3I5TA 4IYOB 2JISA 1M0OA 1I43A 4KYOA 2CINA 4ZASA 1M0PA 1U08A 3BCXA 1AY4A 3IHJA 3FFHA 4L0OA 1MDZA 1TPLA 5BJ3A 1BT4A 4GDYA 2VMZA 4WYFA 1C7OA 5KTBA 1OATA 2OKKA 4IX8A 5HXXA 2JJFA 2VGUA 3DYDA 2CB1A 1IX6A 4K2IA 1LC5A 4CBRA 1X29A 1SZKA 2R5EA 4Q31A 4XQ2A 4R2NA 3E2ZA 1DJ9A 2PB0A 5EAVA 4A00A 2Z1ZA 1YJZA 4JEZA 1AHYA 1S06A 2D7YA 2AY5A 2V0YA 3JWBA 3Q8NA 1RVUA 2E7JA 3WKSA 3ZZKA 4UHMA 4WBTA 2Z9VA 3E2ZB 3LG0A 3UE8A 2Z9WA 1GEYA 3EIAA 3NNKA 1YIZA 2JJGA 5HHYA 2Z9XA 4EB5A 3A8UX 4WD2A 4XJOA 3HLMA 1ARGA 2VMPA 3G0TA 3N4XA 2YRIA 2KFPA 4OC9A 2G7JA 3A2BA 3NUIA 1H1CA 1Y4IA 1UU2A 3RBLA 2ZYJA 1AMAA 4Y0DA 3AEOA 3RCHA 4Q76A 2BI5A 3P6KA 2CTZA 4JEXA 5LHAA 2Z9UA 3PDXA 3NU8A 4ZLVA 4F5HA 3HBXA 1H0CA 2JG2A 1QJ3A 1X2AA 3A9XA 4WP0A 4DQ6A 3FD0A 2D64A 3JZLA 1X0MA 2AATA 1GC2A 3NUBA 2AY6A 4F5JA 1AX4A 1G7XA 2VGTA 3QI6A 2CH2A 2VMQA 1MLZA 4MY5A 4WXFA 2W7MA 1CQ6A 1LK9A 3MC6C 3WLXA 4E3QA 1C4KA 2R5CB 4A6UA 2DKJA 3VK3A 2W8UA 1UU1A 4F5MA 2RFVA 1M32A 3FVXA 4W1VA 3WY7A 5F8VA 3ELEA 3ZRRA 1KKJA 4M2KA 3NDNA 5FT6A 4AH3A 4JE5A 2GMUA 2C7TA 4Y0HA 4JEWA 4GE9A 3EZSA 2CY8A 3KGXA 1BJOA 3NX3A 4AZKA 2W7EA 4WXGA 4M2JA 4JE5D 4RJYA 2VLHA 2WB6A 2AY7A 1TASA 3DR4A 1ASNA 2QBTA 4MKJA 4UQVA 8AATA 1WKGA 2Z20A 3FDDA 4IW7A 4E1OA 1ARIA 1ASEA 4ADEA 2YCTA 2W7IA 3JTXA 1G7WA 4BMKA 1JS6A 3E9KA 1T3IA 1MDXA 2PO3A 3MC6A 4LW2A 1LW4A 4OT8A 1UU0A 5M46A 4ZDOA 3PD6A 2DGMA 1I48A 4ZAHA 2FQ6A 2BI3A 1ZODA 2BHXA 1V2EA 1VP4A 1ZC9A 4CVQA 3COGA 1ASBA 1WYVB 3OP7A 1BW0A 1KL1A 4RIZA 3TCMA 4OBVA 1RV4A 2EYQA 1E5EA 3PJ0A 4WLJA 2BI2A 2YHKA 2BI1A 3TQXA 2VGZA 4ZM4A 4RJ0A 4U2HA 3N7NA 2AEUA 3DU4A 3OKSA 4RAEA 3HT4A 4K2BA 2HOYA 2YCNA 1D7VA 1QGNA 2BI9A 1O61A 2GB3A 4KAMA 4ADCA 2OGAA 2X8UA 2EZ1A 5BJ4A 4R8DA 1B4XA 3TFUA 4BHDA 9AATA 1G4XA 3I16A 4ADDA 5D5SA 4BA5A 2VGVA 3LY1A 4WYEA 3PGYA 3FDBA 1IBJA 2D61A 4R5FA 3JWAA 3CAIA 3MAUA 1AIAA 1X28A 3EIBA 3NU7A 4XJLA 3GSBA 5EIGB 1ARTA 3VAXA 3WKRA 2QSRA 3ISLA 1Z3ZA 2BYJA 2VI9A 3FVUA 1CL1A 1M4NA 2BIEA 3K40A 1M7YA 3NTJA 1DFOA 2OQXA 3A9YA 2R2NA 1AICA 3CQ4A 3KKIA 4HF8A 5E4ZA 4F5KA 3RUYA 2O7CA 3W1HA 4UHOA 5DJ9A 2W7HA 2BWOA 1GBNA 4PIWA 1TOJA 1YOOA 5E3KA 2EH6A 3HMUA 4WB0A 5M49A 1ASLA 1J32A 1DTYA 1I29A 2JJEA 2X3LA 3DXVA 4JEVA 1N31A 1VJOA 4H51A 2VI8A 1PG8A 1CQ7A 3EI6A 1AJSA 4WB0B 1AHEA 4LNJA 3NYTA 1TOIA 2GQNA 5HDMA 1GC3A 1AHGA 4CXQA 1ASDA 3E2YA 2E7UA 4F5IA 4NOGA 4ZM3A 4N0WA 2AY3A 2R0TA 2VMRA 3B46A 3FVSA 4GRXA 2QA3A 1RVYA 4RLGA 4PFFA 2YOBA 2BIAA 3ASBA 1BJWA 3ACZA 1YJYA 1M0NA 3MEBA 4MQPA 1KL2A 5G09A 4JEYA 2BKWA 2HUFA 1AY5A 3IF2A 1B9IA 1B5PA 1MLYA 2CH1A 3DODA 2JJHA 2WK7A 2W7GA 3JU7A 3MKJA 3FTBA 2HOZA 3B8XA 5DJ1A 2X5FA 2AEVA 5AX8A 4ZSWA 2QB2A 2DOUA 3BWOA 3N5MA 3VOMA 1WYTA 4WYDA 4A6RA 3BCAA 3NYSA 4CBSA 1BQAA 1GDEA 3CQ6A 3AOWA 4ZWMA 4LNLA 1O4SA 4ITGA 1BJ4A 2TPLA 2CJGA 3RCHB 3USFA 2GMSA 3GETA 3L8AA 1LW5A 2VYCA 1OXOA 1YJSA 2CJHA 3CQ5A 3PDBA 1LS3A 4FFCA 4RKDA 1SZUA 1QJ5A 1IX8A 4EMYA 3KGWA 4EU1A 4F5LA 4W1WA 1B9HA 4K05A 2XH1A 4B9BA 2X5DA 3EI7A 3K7YA 3MAFA 4ZWVA 1ZOBA 3BCBA 3CBFA 2VIBA 4GE4A 1JS3A 4LW4A 1QIRA 5EUNA 1AKAA 1GD9A 3HDOA 3E6GA 3FSLA 3QGUA 3MBBA 1JF9A 5FT8A 5FT4A 1IVRA 3R4TA 1AHXA 3TFTA 1YIYA 1DJEA 4MSOA 1IAXA 2VMSA 4ITXA 2NMPA 3JW9A 4F5GA 4CXRA 2W7FA 1GCKA 3BC8A 1IAYA 1MGVA 2QMAA 3FQAA 3GWPA 5F9SA 2YRRA 5LH9A 1PMMA 1N8PA 1S0AA 5K8BA 3PAAA 4OTLA 4UHNA 3DZZA 3GR9A 1LC8A 3I4JA 3PA9A 1LC7A 1BJOB 3HVYA 4QGRA 2HUIA 4ADBA 2VMNA 3AEMC 4MKKA 5M4BA 1AMRA 3PIUA 1N2TA 3F0HA 1C7NA 1B8GA 4WYAA 3W1IA 1ASFA 4RKCA 4OCAA 1OHWA 1V2FA 1C9CA 3ATHA 1ASAA 3F9TA 3FKDA 1TOGA 2AY8A 1D2FA 1W3UA 2ZY4A 1CS1A 3G8MA 4FL0A 3N4RA 2QLRA 3PD6B 4MQQA 1KAFA 1AKCA 1QZ9A 2D65A 3DC1A 3LVLB 4WYGA 5G2QA 3DRDA 3QN6A 1TATA 1WYUA 2WK8A 5E5IA 2HUUA 4TV7A 1PMOA 4BA4A 2VMYA 4XJMA 1AIBA 1EJIA 1IX7A 5D95A 4AO9A 3UAKA 3AEMA 2VGSA 2DR1A 2VIAA 4PVFA 2DGLA 2OATA 3K28A 2ZSMA 3LVJA 1D7UA 4I8AA 4B98A 1AY8A 4U1TA 3BB8A 2W7DA 3FRKA 2BIGA 4WLHA 4WXBA 1I41A 1ORDA 1XEYA 2XBNA 3ASAA 3LWSA 3P1TA 4P7YA 3VK4A 2E54A 1BS0A 3N4SA 1MDOA 2YKVA 4XJPA 3WX9A 1SVVA 3FCRA 1CJ0A 2Z1YA 3B1EA 1E5FA 1GEWA 2FNIA 4AZJA 1M6SA 2VMOA 1D7RA 1DJUA 1GC4A 3H14A 3GZCA 5EUDA 2BYLA 1FG3A 2W8WA 3HL2A 4A0FA 1O62A 1S08A 1AAWA 1CZEA 2YKXA 1WKHA 2C81A 2YCPA 3HQTA 1OXPA 1ECXA 4DBCA 2BWPA 3KE3A 1ARSA 3RQ1A 1KKPA 4W5KA 2CFBA 4WYCA 2EPJA 4Q75A 3WCNA 4ATPA 3E2FA 4JF0A 1EQBA 3G7QA 1MAPA 1JG8A 2HZPA 3H7FA 1AJSB 3ZRQA 2VMUA 3LVKA 2DKBA 2Q7WA 2D7ZA 3ECDA 5DX5A 5EFSA 3B1CA 4OYTA 3BV0A 5G4IA 3VP6A 3EZ1A 1OHVA 1XI9A 4J5UA 1KMKA 2OKJA 1BQDA 4ATQA 4IXZA 7AATA 1CZCA 3FZ7A 3LV2A 4IY7A 3EI8A 3DR7A 1DGDA 1SPAA 2CJDA 3BS8A 4R5ZA 1AMQA 5G2PA 3T32A 1ASMA 2Z67A 2FM1A 4W8IA 1C0NA 2HP2A 3EI9A 5G4JA 1ASGA 3AEJC 2C0RA 4XAUA 4EFFA 4LNMA 4A6TA 3II0A 4EB7A 4XEWA 1YNUA 2CSTA 4MGRA 1ELUA 1MAQA 1ELQA 1WYTB 1DGEA 5M4DA 3FFRA 4BQ0A 2O1BA 1BJNA 1QITA 1J04A 4DGTA 3VK2A 4A0RA 1EG5A 1ARHA 1GEXA 1BKGA 1V72A 4ZDPA 2ZY3A 2VMWA 3E77A 4A72A 5FT5A 2EGYA 4A0HA 1G4VA 2CANA 2ORDA 3EUCA 2W7LA 1QISA 2FN6A 2V1PA 2DGKA 1AMSA 1SZSA 1TOEA 2D66A 2WK9A 4E77A 4K2MA 3TATA 2Z61A 4LC3A 3PDBB 4J8LA 4TMRA 3QHXA 3GZDC 3FZ6A 2AY1A 3FQ8A 1CQ8A 4RITA 4ISYA 3MAFB 3AEJA 5EUEA 1W7MA 2VMVA 3AATA 4E3RA 3H9XA 2QB3A 2HP1A 1W23A 4KXKA 4F5FA 1TOKA 2ZC0A 2R5CA 3LVMA 1WSTA 3ZRPA 2G6WA 4Q6RA 3QPGA 1AKBA 1TARA 1IJIA 1SF2A 4O6ZA 4N0BA 3MADA 1YAAA 3N0LA 3D6KA 5EQCA 1C7GA 3L44A 4TN4A 5EAAA 3RI6A 1LKCA 4ZDLA 1AHFA 1FC4A 3AEPA 3GJUA 4Y0IA 1Z7DA 2AY9A 4MQRA 2ZJGA 1AAMA 4A0GA 3EI5A 4GEBA 4AO4A 3GZDA 3WCOA 2C44A 3WZFA 2AY2A 2D5YA 2EZ2A 2WKAA 1KMJA 1PFFA 4OBUA 5J8QA 2ZUKA 2ZP7A 4ZSYA 4W1XA 3NRAA 1DKAA 1ASCA 5I92A 2A1VA 3WGBA 4H63Q 2W7JA 5DB5A 1S09A 3B1DA 2W8VA 3R9AA 1FG7A 1OHYA 3F6TA 4HVKA 1IUGA 2FYFA 2PB2A 3BWNC 4GE7A 4XK1A 3A9ZA 1WYVA 2F8JA 2JGTA 5G0AA 1WYUB 3FQ7A 4AOAA 1SFFA 2EO5A 1CL2A 3RBFA 4UOYA 3DXWA 1GC0A 2W7KA 3UWCA 4GSAA 3M5UA
chains in the Genus database with same CATH topology
3NYUA 4IXSA 4IXOA 1VEFA 1UKJA 1D7SA 3PPLA 3N75A 2FNUA 1M0QA 3W1JA 2HORA 5IWQA 1S07A 2ZSLA 3WGCA 2W8TA 2AY4A 3ELPA 5C6UA 2ZY2A 2VMTA 3GBXA 3AOVA 2D63A 4M2MA 4RM1A 2BWNA 4OMAA 1B5OA 3ZZJA 2HOXA 4PFNA 2OGEA 2YKYA 3QBOA 5EIGA 3BWNA 2E7IA 2FKIA 1V2DA 2VMXA 1O69A 2W8JA 4W91A 3AENA 3QM2A 3AV7A 1P3WA 3BN1A 1RV3A 4IYOA 1AJRA 5JAYA 4P3MA 3FZ8A 5TF5A 1W7NA 2GSAA 2VLFA 2O0RA 2YKUA 3AELA 4JF1A 2ZY5A 4F4EA 3AENB 1W7LA 2VGWA 3I5TA 4IYOB 2JISA 1M0OA 1I43A 4KYOA 2CINA 4ZASA 1M0PA 1U08A 3BCXA 1AY4A 3IHJA 3FFHA 4L0OA 1MDZA 1TPLA 5BJ3A 1BT4A 4GDYA 2VMZA 4WYFA 1C7OA 5KTBA 1OATA 2OKKA 4IX8A 5HXXA 2JJFA 2VGUA 3DYDA 2CB1A 1IX6A 4K2IA 1LC5A 4CBRA 1X29A 1SZKA 2R5EA 4Q31A 4XQ2A 4R2NA 3E2ZA 1DJ9A 2PB0A 5EAVA 4A00A 2Z1ZA 1YJZA 4JEZA 1AHYA 1S06A 2D7YA 2AY5A 2V0YA 3JWBA 3Q8NA 1RVUA 2E7JA 3WKSA 3ZZKA 4UHMA 4WBTA 2Z9VA 3E2ZB 3LG0A 3UE8A 2Z9WA 1GEYA 3EIAA 3NNKA 1YIZA 2JJGA 5HHYA 2Z9XA 4EB5A 3A8UX 4WD2A 4XJOA 3HLMA 1ARGA 2VMPA 3G0TA 3N4XA 2YRIA 2KFPA 4OC9A 2G7JA 3A2BA 3NUIA 1H1CA 1Y4IA 1UU2A 3RBLA 2ZYJA 1AMAA 4Y0DA 3AEOA 3RCHA 4Q76A 2BI5A 3P6KA 2CTZA 4JEXA 5LHAA 2Z9UA 3PDXA 3NU8A 4ZLVA 4F5HA 3HBXA 1H0CA 2JG2A 1QJ3A 1X2AA 3A9XA 4WP0A 4DQ6A 3FD0A 2D64A 3JZLA 1X0MA 2AATA 1GC2A 3NUBA 2AY6A 4F5JA 1AX4A 1G7XA 2VGTA 3QI6A 2CH2A 2VMQA 1MLZA 4MY5A 4WXFA 2W7MA 1CQ6A 1LK9A 3MC6C 3WLXA 4E3QA 1C4KA 2R5CB 4A6UA 2DKJA 3VK3A 2W8UA 1UU1A 4F5MA 2RFVA 1M32A 3FVXA 4W1VA 3WY7A 5F8VA 3ELEA 3ZRRA 1KKJA 4M2KA 3NDNA 5FT6A 4AH3A 4JE5A 2GMUA 2C7TA 4Y0HA 4JEWA 4GE9A 3EZSA 2CY8A 3KGXA 1BJOA 3NX3A 4AZKA 2W7EA 4WXGA 4M2JA 4JE5D 4RJYA 2VLHA 2WB6A 2AY7A 1TASA 3DR4A 1ASNA 2QBTA 4MKJA 4UQVA 8AATA 1WKGA 2Z20A 3FDDA 4IW7A 4E1OA 1ARIA 1ASEA 4ADEA 2YCTA 2W7IA 3JTXA 1G7WA 4BMKA 1JS6A 3E9KA 1T3IA 1MDXA 2PO3A 3MC6A 4LW2A 1LW4A 4OT8A 1UU0A 5M46A 4ZDOA 3PD6A 2DGMA 1I48A 4ZAHA 2FQ6A 2BI3A 1ZODA 2BHXA 1V2EA 1VP4A 1ZC9A 4CVQA 3COGA 1ASBA 1WYVB 3OP7A 1BW0A 1KL1A 4RIZA 3TCMA 4OBVA 1RV4A 2EYQA 1E5EA 3PJ0A 4WLJA 2BI2A 2YHKA 2BI1A 3TQXA 2VGZA 4ZM4A 4RJ0A 4U2HA 3N7NA 2AEUA 3DU4A 3OKSA 4RAEA 3HT4A 4K2BA 2HOYA 2YCNA 1D7VA 1QGNA 2BI9A 1O61A 2GB3A 4KAMA 4ADCA 2OGAA 2X8UA 2EZ1A 5BJ4A 4R8DA 1B4XA 3TFUA 4BHDA 9AATA 1G4XA 3I16A 4ADDA 5D5SA 4BA5A 2VGVA 3LY1A 4WYEA 3PGYA 3FDBA 1IBJA 2D61A 4R5FA 3JWAA 3CAIA 3MAUA 1AIAA 1X28A 3EIBA 3NU7A 4XJLA 3GSBA 5EIGB 1ARTA 3VAXA 3WKRA 2QSRA 3ISLA 1Z3ZA 2BYJA 2VI9A 3FVUA 1CL1A 1M4NA 2BIEA 3K40A 1M7YA 3NTJA 1DFOA 2OQXA 3A9YA 2R2NA 1AICA 3CQ4A 3KKIA 4HF8A 5E4ZA 4F5KA 3RUYA 2O7CA 3W1HA 4UHOA 5DJ9A 2W7HA 2BWOA 1GBNA 4PIWA 1TOJA 1YOOA 5E3KA 2EH6A 3HMUA 4WB0A 5M49A 1ASLA 1J32A 1DTYA 1I29A 2JJEA 2X3LA 3DXVA 4JEVA 1N31A 1VJOA 4H51A 2VI8A 1PG8A 1CQ7A 3EI6A 1AJSA 4WB0B 1AHEA 4LNJA 3NYTA 1TOIA 2GQNA 5HDMA 1GC3A 1AHGA 4CXQA 1ASDA 3E2YA 2E7UA 4F5IA 4NOGA 4ZM3A 4N0WA 2AY3A 2R0TA 2VMRA 3B46A 3FVSA 4GRXA 2QA3A 1RVYA 4RLGA 4PFFA 2YOBA 2BIAA 3ASBA 1BJWA 3ACZA 1YJYA 1M0NA 3MEBA 4MQPA 1KL2A 5G09A 4JEYA 2BKWA 2HUFA 1AY5A 3IF2A 1B9IA 1B5PA 1MLYA 2CH1A 3DODA 2JJHA 2WK7A 2W7GA 3JU7A 3MKJA 3FTBA 2HOZA 3B8XA 5DJ1A 2X5FA 2AEVA 5AX8A 4ZSWA 2QB2A 2DOUA 3BWOA 3N5MA 3VOMA 1WYTA 4WYDA 4A6RA 3BCAA 3NYSA 4CBSA 1BQAA 1GDEA 3CQ6A 3AOWA 4ZWMA 4LNLA 1O4SA 4ITGA 1BJ4A 2TPLA 2CJGA 3RCHB 3USFA 2GMSA 3GETA 3L8AA 1LW5A 2VYCA 1OXOA 1YJSA 2CJHA 3CQ5A 3PDBA 1LS3A 4FFCA 4RKDA 1SZUA 1QJ5A 1IX8A 4EMYA 3KGWA 4EU1A 4F5LA 4W1WA 1B9HA 4K05A 2XH1A 4B9BA 2X5DA 3EI7A 3K7YA 3MAFA 4ZWVA 1ZOBA 3BCBA 3CBFA 2VIBA 4GE4A 1JS3A 4LW4A 1QIRA 5EUNA 1AKAA 1GD9A 3HDOA 3E6GA 3FSLA 3QGUA 3MBBA 1JF9A 5FT8A 5FT4A 1IVRA 3R4TA 1AHXA 3TFTA 1YIYA 1DJEA 4MSOA 1IAXA 2VMSA 4ITXA 2NMPA 3JW9A 4F5GA 4CXRA 2W7FA 1GCKA 3BC8A 1IAYA 1MGVA 2QMAA 3FQAA 3GWPA 5F9SA 2YRRA 5LH9A 1PMMA 1N8PA 1S0AA 5K8BA 3PAAA 4OTLA 4UHNA 3DZZA 3GR9A 1LC8A 3I4JA 3PA9A 1LC7A 1BJOB 3HVYA 4QGRA 2HUIA 4ADBA 2VMNA 3AEMC 4MKKA 5M4BA 1AMRA 3PIUA 1N2TA 3F0HA 1C7NA 1B8GA 4WYAA 3W1IA 1ASFA 4RKCA 4OCAA 1OHWA 1V2FA 1C9CA 3ATHA 1ASAA 3F9TA 3FKDA 1TOGA 2AY8A 1D2FA 1W3UA 2ZY4A 1CS1A 3G8MA 4FL0A 3N4RA 2QLRA 3PD6B 4MQQA 1AKCA 1QZ9A 2D65A 3DC1A 3LVLB 4WYGA 5G2QA 3DRDA 3QN6A 1TATA 1WYUA 2WK8A 5E5IA 2HUUA 4TV7A 1PMOA 4BA4A 2VMYA 4XJMA 1AIBA 1EJIA 1IX7A 5D95A 4AO9A 3UAKA 3AEMA 2VGSA 2DR1A 2VIAA 4PVFA 2DGLA 2OATA 3K28A 2ZSMA 3LVJA 1D7UA 4I8AA 4B98A 1AY8A 4U1TA 3BB8A 2W7DA 3FRKA 2BIGA 4WLHA 4WXBA 1I41A 1ORDA 1XEYA 2XBNA 3ASAA 3LWSA 3P1TA 4P7YA 3VK4A 2E54A 1BS0A 3N4SA 1MDOA 2YKVA 4XJPA 3WX9A 1SVVA 3FCRA 1CJ0A 2Z1YA 3B1EA 1E5FA 1GEWA 2FNIA 4AZJA 1M6SA 2VMOA 1D7RA 1DJUA 1GC4A 3H14A 3GZCA 5EUDA 2BYLA 1FG3A 2W8WA 3HL2A 4A0FA 1O62A 1S08A 1AAWA 1CZEA 2YKXA 1WKHA 2C81A 2YCPA 3HQTA 1OXPA 1ECXA 4DBCA 2BWPA 3KE3A 1ARSA 3RQ1A 1KKPA 4W5KA 2CFBA 4WYCA 2EPJA 4Q75A 3WCNA 4ATPA 3E2FA 4JF0A 1EQBA 3G7QA 1MAPA 1JG8A 2HZPA 3H7FA 1AJSB 3ZRQA 2VMUA 3LVKA 2DKBA 2Q7WA 2D7ZA 3ECDA 5DX5A 5EFSA 3B1CA 4OYTA 3BV0A 5G4IA 3VP6A 3EZ1A 1OHVA 1XI9A 4J5UA 1KMKA 2OKJA 1BQDA 4ATQA 4IXZA 7AATA 1CZCA 3FZ7A 3LV2A 4IY7A 3EI8A 3DR7A 1DGDA 1SPAA 2CJDA 3BS8A 4R5ZA 1AMQA 5G2PA 3T32A 1ASMA 2Z67A 2FM1A 4W8IA 1C0NA 2HP2A 3EI9A 5G4JA 1ASGA 3AEJC 2C0RA 4XAUA 4EFFA 4LNMA 4A6TA 3II0A 4EB7A 4XEWA 1YNUA 2CSTA 4MGRA 1ELUA 1MAQA 1ELQA 1WYTB 1DGEA 5M4DA 3FFRA 4BQ0A 2O1BA 1BJNA 1QITA 1J04A 4DGTA 3VK2A 4A0RA 1EG5A 1ARHA 1GEXA 1BKGA 1V72A 4ZDPA 2ZY3A 2VMWA 3E77A 4A72A 5FT5A 2EGYA 4A0HA 1G4VA 2CANA 2ORDA 3EUCA 2W7LA 1QISA 2FN6A 2V1PA 2DGKA 1AMSA 1SZSA 1TOEA 2D66A 2WK9A 4E77A 4K2MA 3TATA 2Z61A 4LC3A 3PDBB 4J8LA 4TMRA 3QHXA 3GZDC 3FZ6A 2AY1A 3FQ8A 1CQ8A 4RITA 4ISYA 3MAFB 3AEJA 5EUEA 1W7MA 2VMVA 3AATA 4E3RA 3H9XA 2QB3A 2HP1A 1W23A 4KXKA 4F5FA 1TOKA 2ZC0A 2R5CA 3LVMA 1WSTA 3ZRPA 2G6WA 4Q6RA 3QPGA 1AKBA 1TARA 1IJIA 1SF2A 4O6ZA 4N0BA 3MADA 1YAAA 3N0LA 3D6KA 5EQCA 1C7GA 3L44A 4TN4A 5EAAA 3RI6A 1LKCA 4ZDLA 1AHFA 1FC4A 3AEPA 3GJUA 4Y0IA 1Z7DA 2AY9A 4MQRA 2ZJGA 1AAMA 4A0GA 3EI5A 4GEBA 4AO4A 3GZDA 3WCOA 2C44A 3WZFA 2AY2A 2D5YA 2EZ2A 2WKAA 1KMJA 1PFFA 4OBUA 5J8QA 2ZUKA 2ZP7A 4ZSYA 4W1XA 3NRAA 1DKAA 1ASCA 5I92A 2A1VA 3WGBA 4H63Q 2W7JA 5DB5A 1S09A 3B1DA 2W8VA 3R9AA 1FG7A 1OHYA 3F6TA 4HVKA 1IUGA 2FYFA 2PB2A 3BWNC 4GE7A 4XK1A 3A9ZA 1WYVA 2F8JA 2JGTA 5G0AA 1WYUB 3FQ7A 4AOAA 1SFFA 2EO5A 1CL2A 3RBFA 4UOYA 3DXWA 1GC0A 2W7KA 3UWCA 4GSAA 3M5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NYU A;  4IXS A;  4IXO A;  1VEF A;  1UKJ A;  1D7S A;  3PPL A;  3N75 A;  2FNU A;  1M0Q A;  3W1J A;  2HOR A;  5IWQ A;  1S07 A;  2ZSL A;  3WGC A;  2W8T A;  2AY4 A;  3ELP A;  5C6U A;  2ZY2 A;  2VMT A;  3GBX A;  3AOV A;  2D63 A;  4M2M A;  4RM1 A;  2BWN A;  4OMA A;  1B5O A;  3ZZJ A;  2HOX A;  4PFN A;  2OGE A;  2YKY A;  3QBO A;  5EIG A;  3BWN A;  2E7I A;  1V2D A;  2VMX A;  1O69 A;  2W8J A;  4W91 A;  3AEN A;  3QM2 A;  3AV7 A;  1P3W A;  3BN1 A;  1RV3 A;  4IYO A;  1AJR A;  5JAY A;  4P3M A;  3FZ8 A;  5TF5 A;  1W7N A;  2GSA A;  2VLF A;  2O0R A;  2YKU A;  3AEL A;  4JF1 A;  2ZY5 A;  4F4E A;  3AEN B;  1W7L A;  2VGW A;  3I5T A;  4IYO B;  2JIS A;  1M0O A;  1I43 A;  4KYO A;  2CIN A;  4ZAS A;  1M0P A;  1U08 A;  3BCX A;  1AY4 A;  3IHJ A;  3FFH A;  4L0O A;  1MDZ A;  1TPL A;  5BJ3 A;  1BT4 A;  4GDY A;  2VMZ A;  4WYF A;  1C7O A;  1OAT A;  2OKK A;  4IX8 A;  5HXX A;  2JJF A;  2VGU A;  3DYD A;  2CB1 A;  1IX6 A;  4K2I A;  1LC5 A;  4CBR A;  1X29 A;  1SZK A;  2R5E A;  4Q31 A;  4XQ2 A;  4R2N A;  3E2Z A;  1DJ9 A;  2PB0 A;  5EAV A;  4A00 A;  2Z1Z A;  1YJZ A;  4JEZ A;  1AHY A;  1S06 A;  2D7Y A;  2AY5 A;  2V0Y A;  3JWB A;  3Q8N A;  1RVU A;  2E7J A;  3WKS A;  3ZZK A;  4UHM A;  4WBT A;  2Z9V A;  3E2Z B;  3LG0 A;  3UE8 A;  2Z9W A;  1GEY A;  3EIA A;  3NNK A;  1YIZ A;  2JJG A;  5HHY A;  2Z9X A;  4EB5 A;  3A8U X;  4WD2 A;  4XJO A;  3HLM A;  1ARG A;  2VMP A;  3G0T A;  2YRI A;  4OC9 A;  3A2B A;  3NUI A;  1H1C A;  1Y4I A;  1UU2 A;  3RBL A;  2ZYJ A;  1AMA A;  4Y0D A;  3AEO A;  3RCH A;  4Q76 A;  2BI5 A;  3P6K A;  2CTZ A;  4JEX A;  5LHA A;  2Z9U A;  3PDX A;  3NU8 A;  4ZLV A;  4F5H A;  3HBX A;  1H0C A;  2JG2 A;  1QJ3 A;  1X2A A;  3A9X A;  4WP0 A;  4DQ6 A;  3FD0 A;  2D64 A;  3JZL A;  1X0M A;  2AAT A;  1GC2 A;  3NUB A;  2AY6 A;  4F5J A;  1AX4 A;  1G7X A;  2VGT A;  3QI6 A;  2CH2 A;  2VMQ A;  1MLZ A;  4MY5 A;  4WXF A;  2W7M A;  1CQ6 A;  1LK9 A;  3MC6 C;  3WLX A;  4E3Q A;  1C4K A;  2R5C B;  4A6U A;  2DKJ A;  3VK3 A;  2W8U A;  1UU1 A;  4F5M A;  2RFV A;  1M32 A;  3FVX A;  4W1V A;  3WY7 A;  5F8V A;  3ELE A;  3ZRR A;  1KKJ A;  4M2K A;  3NDN A;  5FT6 A;  4AH3 A;  4JE5 A;  2GMU A;  2C7T A;  4Y0H A;  4JEW A;  4GE9 A;  3EZS A;  2CY8 A;  3KGX A;  1BJO A;  3NX3 A;  4AZK A;  2W7E A;  4WXG A;  4M2J A;  4JE5 D;  4RJY A;  2VLH A;  2AY7 A;  1TAS A;  3DR4 A;  1ASN A;  2QBT A;  4MKJ A;  4UQV A;  8AAT A;  1WKG A;  2Z20 A;  3FDD A;  4IW7 A;  4E1O A;  1ARI A;  1ASE A;  4ADE A;  2YCT A;  2W7I A;  3JTX A;  1G7W A;  4BMK A;  1JS6 A;  3E9K A;  1T3I A;  1MDX A;  2PO3 A;  3MC6 A;  4LW2 A;  1LW4 A;  4OT8 A;  1UU0 A;  5M46 A;  4ZDO A;  3PD6 A;  2DGM A;  1I48 A;  4ZAH A;  2FQ6 A;  2BI3 A;  1ZOD A;  2BHX A;  1V2E A;  1VP4 A;  1ZC9 A;  4CVQ A;  3COG A;  1ASB A;  1WYV B;  3OP7 A;  1BW0 A;  1KL1 A;  4RIZ A;  3TCM A;  4OBV A;  1RV4 A;  1E5E A;  3PJ0 A;  4WLJ A;  2BI2 A;  2YHK A;  2BI1 A;  3TQX A;  2VGZ A;  4ZM4 A;  4RJ0 A;  4U2H A;  2AEU A;  3DU4 A;  3OKS A;  4RAE A;  3HT4 A;  4K2B A;  2HOY A;  2YCN A;  1D7V A;  1QGN A;  2BI9 A;  1O61 A;  2GB3 A;  4KAM A;  4ADC A;  2OGA A;  2X8U A;  2EZ1 A;  5BJ4 A;  4R8D A;  1B4X A;  3TFU A;  4BHD A;  9AAT A;  1G4X A;  3I16 A;  4ADD A;  5D5S A;  4BA5 A;  2VGV A;  3LY1 A;  4WYE A;  3PGY A;  3FDB A;  1IBJ A;  2D61 A;  4R5F A;  3JWA A;  3CAI A;  3MAU A;  1AIA A;  1X28 A;  3EIB A;  3NU7 A;  4XJL A;  3GSB A;  5EIG B;  1ART A;  3VAX A;  3WKR A;  3ISL A;  1Z3Z A;  2BYJ A;  2VI9 A;  3FVU A;  1CL1 A;  1M4N A;  2BIE A;  3K40 A;  1M7Y A;  3NTJ A;  1DFO A;  2OQX A;  3A9Y A;  2R2N A;  1AIC A;  3CQ4 A;  3KKI A;  4HF8 A;  5E4Z A;  4F5K A;  3RUY A;  2O7C A;  3W1H A;  4UHO A;  5DJ9 A;  2W7H A;  2BWO A;  1GBN A;  4PIW A;  1TOJ A;  1YOO A;  5E3K A;  2EH6 A;  3HMU A;  4WB0 A;  5M49 A;  1ASL A;  1J32 A;  1DTY A;  1I29 A;  2JJE A;  2X3L A;  3DXV A;  4JEV A;  1N31 A;  1VJO A;  4H51 A;  2VI8 A;  1PG8 A;  1CQ7 A;  3EI6 A;  1AJS A;  4WB0 B;  1AHE A;  4LNJ A;  3NYT A;  1TOI A;  2GQN A;  5HDM A;  1GC3 A;  1AHG A;  4CXQ A;  1ASD A;  3E2Y A;  2E7U A;  4F5I A;  4NOG A;  4ZM3 A;  4N0W A;  2AY3 A;  2R0T A;  2VMR A;  3B46 A;  3FVS A;  4GRX A;  2QA3 A;  1RVY A;  4RLG A;  4PFF A;  2YOB A;  2BIA A;  3ASB A;  1BJW A;  3ACZ A;  1YJY A;  1M0N A;  3MEB A;  4MQP A;  1KL2 A;  5G09 A;  4JEY A;  2BKW A;  2HUF A;  1AY5 A;  3IF2 A;  1B9I A;  1B5P A;  1MLY A;  2CH1 A;  3DOD A;  2JJH A;  2WK7 A;  2W7G A;  3JU7 A;  3MKJ A;  3FTB A;  2HOZ A;  3B8X A;  5DJ1 A;  2X5F A;  2AEV A;  5AX8 A;  4ZSW A;  2QB2 A;  2DOU A;  3BWO A;  3N5M A;  3VOM A;  1WYT A;  4WYD A;  4A6R A;  3BCA A;  3NYS A;  4CBS A;  1BQA A;  1GDE A;  3CQ6 A;  3AOW A;  4ZWM A;  4LNL A;  1O4S A;  4ITG A;  1BJ4 A;  2TPL A;  2CJG A;  3RCH B;  3USF A;  2GMS A;  3GET A;  3L8A A;  1LW5 A;  2VYC A;  1OXO A;  1YJS A;  2CJH A;  3CQ5 A;  3PDB A;  1LS3 A;  4FFC A;  4RKD A;  1SZU A;  1QJ5 A;  1IX8 A;  4EMY A;  3KGW A;  4EU1 A;  4F5L A;  4W1W A;  1B9H A;  2XH1 A;  4B9B A;  2X5D A;  3EI7 A;  3K7Y A;  3MAF A;  4ZWV A;  1ZOB A;  3BCB A;  3CBF A;  2VIB A;  4GE4 A;  1JS3 A;  4LW4 A;  1QIR A;  5EUN A;  1AKA A;  1GD9 A;  3HDO A;  3E6G A;  3FSL A;  3QGU A;  3MBB A;  1JF9 A;  5FT8 A;  5FT4 A;  1IVR A;  3R4T A;  1AHX A;  3TFT A;  1YIY A;  1DJE A;  4MSO A;  1IAX A;  2VMS A;  4ITX A;  2NMP A;  3JW9 A;  4F5G A;  4CXR A;  2W7F A;  1GCK A;  3BC8 A;  1IAY A;  1MGV A;  2QMA A;  3FQA A;  3GWP A;  5F9S A;  2YRR A;  5LH9 A;  1PMM A;  1N8P A;  1S0A A;  5K8B A;  3PAA A;  4OTL A;  4UHN A;  3DZZ A;  3GR9 A;  1LC8 A;  3I4J A;  3PA9 A;  1LC7 A;  1BJO B;  3HVY A;  4QGR A;  2HUI A;  4ADB A;  2VMN A;  3AEM C;  4MKK A;  5M4B A;  1AMR A;  3PIU A;  1N2T A;  3F0H A;  1C7N A;  1B8G A;  4WYA A;  3W1I A;  1ASF A;  4RKC A;  4OCA A;  1OHW A;  1V2F A;  1C9C A;  3ATH A;  1ASA A;  3F9T A;  3FKD A;  1TOG A;  2AY8 A;  1D2F A;  1W3U A;  2ZY4 A;  1CS1 A;  3G8M A;  4FL0 A;  2QLR A;  3PD6 B;  4MQQ A;  1AKC A;  1QZ9 A;  2D65 A;  3DC1 A;  3LVL B;  4WYG A;  5G2Q A;  3DRD A;  3QN6 A;  1TAT A;  1WYU A;  2WK8 A;  5E5I A;  2HUU A;  4TV7 A;  1PMO A;  4BA4 A;  2VMY A;  4XJM A;  1AIB A;  1EJI A;  1IX7 A;  5D95 A;  4AO9 A;  3UAK A;  3AEM A;  2VGS A;  2DR1 A;  2VIA A;  4PVF A;  2DGL A;  2OAT A;  3K28 A;  2ZSM A;  3LVJ A;  1D7U A;  4I8A A;  4B98 A;  1AY8 A;  4U1T A;  3BB8 A;  2W7D A;  3FRK A;  2BIG A;  4WLH A;  4WXB A;  1I41 A;  1ORD A;  1XEY A;  2XBN A;  3ASA A;  3LWS A;  3P1T A;  4P7Y A;  3VK4 A;  2E54 A;  1BS0 A;  1MDO A;  2YKV A;  4XJP A;  3WX9 A;  1SVV A;  3FCR A;  1CJ0 A;  2Z1Y A;  3B1E A;  1E5F A;  1GEW A;  2FNI A;  4AZJ A;  1M6S A;  2VMO A;  1D7R A;  1DJU A;  1GC4 A;  3H14 A;  3GZC A;  5EUD A;  2BYL A;  1FG3 A;  2W8W A;  3HL2 A;  4A0F A;  1O62 A;  1S08 A;  1AAW A;  1CZE A;  2YKX A;  1WKH A;  2C81 A;  2YCP A;  3HQT A;  1OXP A;  1ECX A;  4DBC A;  2BWP A;  3KE3 A;  1ARS A;  3RQ1 A;  1KKP A;  4W5K A;  2CFB A;  4WYC A;  2EPJ A;  4Q75 A;  3WCN A;  4ATP A;  3E2F A;  4JF0 A;  1EQB A;  3G7Q A;  1MAP A;  1JG8 A;  2HZP A;  3H7F A;  1AJS B;  3ZRQ A;  2VMU A;  3LVK A;  2DKB A;  2Q7W A;  2D7Z A;  3ECD A;  5DX5 A;  5EFS A;  3B1C A;  4OYT A;  3BV0 A;  5G4I A;  3VP6 A;  3EZ1 A;  1OHV A;  1XI9 A;  4J5U A;  1KMK A;  2OKJ A;  1BQD A;  4ATQ A;  4IXZ A;  7AAT A;  1CZC A;  3FZ7 A;  3LV2 A;  4IY7 A;  3EI8 A;  3DR7 A;  1DGD A;  1SPA A;  2CJD A;  3BS8 A;  4R5Z A;  1AMQ A;  5G2P A;  3T32 A;  1ASM A;  2Z67 A;  2FM1 A;  4W8I A;  1C0N A;  2HP2 A;  3EI9 A;  5G4J A;  1ASG A;  3AEJ C;  2C0R A;  4XAU A;  4EFF A;  4LNM A;  4A6T A;  3II0 A;  4EB7 A;  4XEW A;  1YNU A;  2CST A;  4MGR A;  1ELU A;  1MAQ A;  1ELQ A;  1WYT B;  1DGE A;  5M4D A;  3FFR A;  4BQ0 A;  2O1B A;  1BJN A;  1QIT A;  1J04 A;  4DGT A;  3VK2 A;  4A0R A;  1EG5 A;  1ARH A;  1GEX A;  1BKG A;  1V72 A;  4ZDP A;  2ZY3 A;  2VMW A;  3E77 A;  4A72 A;  5FT5 A;  2EGY A;  4A0H A;  1G4V A;  2CAN A;  2ORD A;  3EUC A;  2W7L A;  1QIS A;  2FN6 A;  2V1P A;  2DGK A;  1AMS A;  1SZS A;  1TOE A;  2D66 A;  2WK9 A;  4E77 A;  4K2M A;  3TAT A;  2Z61 A;  4LC3 A;  3PDB B;  4J8L A;  4TMR A;  3QHX A;  3GZD C;  3FZ6 A;  2AY1 A;  3FQ8 A;  1CQ8 A;  4RIT A;  4ISY A;  3MAF B;  3AEJ A;  5EUE A;  1W7M A;  2VMV A;  3AAT A;  4E3R A;  2QB3 A;  2HP1 A;  1W23 A;  4KXK A;  4F5F A;  1TOK A;  2ZC0 A;  2R5C A;  3LVM A;  1WST A;  3ZRP A;  2G6W A;  4Q6R A;  3QPG A;  1AKB A;  1TAR A;  1IJI A;  1SF2 A;  4O6Z A;  4N0B A;  3MAD A;  1YAA A;  3N0L A;  3D6K A;  5EQC A;  1C7G A;  3L44 A;  4TN4 A;  5EAA A;  3RI6 A;  1LKC A;  4ZDL A;  1AHF A;  1FC4 A;  3AEP A;  3GJU A;  4Y0I A;  1Z7D A;  2AY9 A;  4MQR A;  2ZJG A;  1AAM A;  4A0G A;  3EI5 A;  4GEB A;  4AO4 A;  3GZD A;  3WCO A;  2C44 A;  3WZF A;  2AY2 A;  2D5Y A;  2EZ2 A;  2WKA A;  1KMJ A;  1PFF A;  4OBU A;  5J8Q A;  2ZUK A;  2ZP7 A;  4ZSY A;  4W1X A;  3NRA A;  1DKA A;  1ASC A;  5I92 A;  3WGB A;  2W7J A;  5DB5 A;  1S09 A;  3B1D A;  2W8V A;  3R9A A;  1FG7 A;  1OHY A;  3F6T A;  4HVK A;  1IUG A;  2FYF A;  2PB2 A;  3BWN C;  4GE7 A;  4XK1 A;  3A9Z A;  1WYV A;  2F8J A;  2JGT A;  5G0A A;  1WYU B;  3FQ7 A;  4AOA A;  1SFF A;  2EO5 A;  1CL2 A;  3RBF A;  4UOY A;  3DXW A;  1GC0 A;  2W7K A;  3UWC A;  4GSA A;  3M5U A; 
#chains in the Genus database with same CATH topology
 3NYU A;  4IXS A;  4IXO A;  1VEF A;  1UKJ A;  1D7S A;  3PPL A;  3N75 A;  2FNU A;  1M0Q A;  3W1J A;  2HOR A;  5IWQ A;  1S07 A;  2ZSL A;  3WGC A;  2W8T A;  2AY4 A;  3ELP A;  5C6U A;  2ZY2 A;  2VMT A;  3GBX A;  3AOV A;  2D63 A;  4M2M A;  4RM1 A;  2BWN A;  4OMA A;  1B5O A;  3ZZJ A;  2HOX A;  4PFN A;  2OGE A;  2YKY A;  3QBO A;  5EIG A;  3BWN A;  2E7I A;  2FKI A;  1V2D A;  2VMX A;  1O69 A;  2W8J A;  4W91 A;  3AEN A;  3QM2 A;  3AV7 A;  1P3W A;  3BN1 A;  1RV3 A;  4IYO A;  1AJR A;  5JAY A;  4P3M A;  3FZ8 A;  5TF5 A;  1W7N A;  2GSA A;  2VLF A;  2O0R A;  2YKU A;  3AEL A;  4JF1 A;  2ZY5 A;  4F4E A;  3AEN B;  1W7L A;  2VGW A;  3I5T A;  4IYO B;  2JIS A;  1M0O A;  1I43 A;  4KYO A;  2CIN A;  4ZAS A;  1M0P A;  1U08 A;  3BCX A;  1AY4 A;  3IHJ A;  3FFH A;  4L0O A;  1MDZ A;  1TPL A;  5BJ3 A;  1BT4 A;  4GDY A;  2VMZ A;  4WYF A;  1C7O A;  5KTB A;  1OAT A;  2OKK A;  4IX8 A;  5HXX A;  2JJF A;  2VGU A;  3DYD A;  2CB1 A;  1IX6 A;  4K2I A;  1LC5 A;  4CBR A;  1X29 A;  1SZK A;  2R5E A;  4Q31 A;  4XQ2 A;  4R2N A;  3E2Z A;  1DJ9 A;  2PB0 A;  5EAV A;  4A00 A;  2Z1Z A;  1YJZ A;  4JEZ A;  1AHY A;  1S06 A;  2D7Y A;  2AY5 A;  2V0Y A;  3JWB A;  3Q8N A;  1RVU A;  2E7J A;  3WKS A;  3ZZK A;  4UHM A;  4WBT A;  2Z9V A;  3E2Z B;  3LG0 A;  3UE8 A;  2Z9W A;  1GEY A;  3EIA A;  3NNK A;  1YIZ A;  2JJG A;  5HHY A;  2Z9X A;  4EB5 A;  3A8U X;  4WD2 A;  4XJO A;  3HLM A;  1ARG A;  2VMP A;  3G0T A;  3N4X A;  2YRI A;  2KFP A;  4OC9 A;  2G7J A;  3A2B A;  3NUI A;  1H1C A;  1Y4I A;  1UU2 A;  3RBL A;  2ZYJ A;  1AMA A;  4Y0D A;  3AEO A;  3RCH A;  4Q76 A;  2BI5 A;  3P6K A;  2CTZ A;  4JEX A;  5LHA A;  2Z9U A;  3PDX A;  3NU8 A;  4ZLV A;  4F5H A;  3HBX A;  1H0C A;  2JG2 A;  1QJ3 A;  1X2A A;  3A9X A;  4WP0 A;  4DQ6 A;  3FD0 A;  2D64 A;  3JZL A;  1X0M A;  2AAT A;  1GC2 A;  3NUB A;  2AY6 A;  4F5J A;  1AX4 A;  1G7X A;  2VGT A;  3QI6 A;  2CH2 A;  2VMQ A;  1MLZ A;  4MY5 A;  4WXF A;  2W7M A;  1CQ6 A;  1LK9 A;  3MC6 C;  3WLX A;  4E3Q A;  1C4K A;  2R5C B;  4A6U A;  2DKJ A;  3VK3 A;  2W8U A;  1UU1 A;  4F5M A;  2RFV A;  1M32 A;  3FVX A;  4W1V A;  3WY7 A;  5F8V A;  3ELE A;  3ZRR A;  1KKJ A;  4M2K A;  3NDN A;  5FT6 A;  4AH3 A;  4JE5 A;  2GMU A;  2C7T A;  4Y0H A;  4JEW A;  4GE9 A;  3EZS A;  2CY8 A;  3KGX A;  1BJO A;  3NX3 A;  4AZK A;  2W7E A;  4WXG A;  4M2J A;  4JE5 D;  4RJY A;  2VLH A;  2WB6 A;  2AY7 A;  1TAS A;  3DR4 A;  1ASN A;  2QBT A;  4MKJ A;  4UQV A;  8AAT A;  1WKG A;  2Z20 A;  3FDD A;  4IW7 A;  4E1O A;  1ARI A;  1ASE A;  4ADE A;  2YCT A;  2W7I A;  3JTX A;  1G7W A;  4BMK A;  1JS6 A;  3E9K A;  1T3I A;  1MDX A;  2PO3 A;  3MC6 A;  4LW2 A;  1LW4 A;  4OT8 A;  1UU0 A;  5M46 A;  4ZDO A;  3PD6 A;  2DGM A;  1I48 A;  4ZAH A;  2FQ6 A;  2BI3 A;  1ZOD A;  2BHX A;  1V2E A;  1VP4 A;  1ZC9 A;  4CVQ A;  3COG A;  1ASB A;  1WYV B;  3OP7 A;  1BW0 A;  1KL1 A;  4RIZ A;  3TCM A;  4OBV A;  1RV4 A;  2EYQ A;  1E5E A;  3PJ0 A;  4WLJ A;  2BI2 A;  2YHK A;  2BI1 A;  3TQX A;  2VGZ A;  4ZM4 A;  4RJ0 A;  4U2H A;  3N7N A;  2AEU A;  3DU4 A;  3OKS A;  4RAE A;  3HT4 A;  4K2B A;  2HOY A;  2YCN A;  1D7V A;  1QGN A;  2BI9 A;  1O61 A;  2GB3 A;  4KAM A;  4ADC A;  2OGA A;  2X8U A;  2EZ1 A;  5BJ4 A;  4R8D A;  1B4X A;  3TFU A;  4BHD A;  9AAT A;  1G4X A;  3I16 A;  4ADD A;  5D5S A;  4BA5 A;  2VGV A;  3LY1 A;  4WYE A;  3PGY A;  3FDB A;  1IBJ A;  2D61 A;  4R5F A;  3JWA A;  3CAI A;  3MAU A;  1AIA A;  1X28 A;  3EIB A;  3NU7 A;  4XJL A;  3GSB A;  5EIG B;  1ART A;  3VAX A;  3WKR A;  2QSR A;  3ISL A;  1Z3Z A;  2BYJ A;  2VI9 A;  3FVU A;  1CL1 A;  1M4N A;  2BIE A;  3K40 A;  1M7Y A;  3NTJ A;  1DFO A;  2OQX A;  3A9Y A;  2R2N A;  1AIC A;  3CQ4 A;  3KKI A;  4HF8 A;  5E4Z A;  4F5K A;  3RUY A;  2O7C A;  3W1H A;  4UHO A;  5DJ9 A;  2W7H A;  2BWO A;  1GBN A;  4PIW A;  1TOJ A;  1YOO A;  5E3K A;  2EH6 A;  3HMU A;  4WB0 A;  5M49 A;  1ASL A;  1J32 A;  1DTY A;  1I29 A;  2JJE A;  2X3L A;  3DXV A;  4JEV A;  1N31 A;  1VJO A;  4H51 A;  2VI8 A;  1PG8 A;  1CQ7 A;  3EI6 A;  1AJS A;  4WB0 B;  1AHE A;  4LNJ A;  3NYT A;  1TOI A;  2GQN A;  5HDM A;  1GC3 A;  1AHG A;  4CXQ A;  1ASD A;  3E2Y A;  2E7U A;  4F5I A;  4NOG A;  4ZM3 A;  4N0W A;  2AY3 A;  2R0T A;  2VMR A;  3B46 A;  3FVS A;  4GRX A;  2QA3 A;  1RVY A;  4RLG A;  4PFF A;  2YOB A;  2BIA A;  3ASB A;  1BJW A;  3ACZ A;  1YJY A;  1M0N A;  3MEB A;  4MQP A;  1KL2 A;  5G09 A;  4JEY A;  2BKW A;  2HUF A;  1AY5 A;  3IF2 A;  1B9I A;  1B5P A;  1MLY A;  2CH1 A;  3DOD A;  2JJH A;  2WK7 A;  2W7G A;  3JU7 A;  3MKJ A;  3FTB A;  2HOZ A;  3B8X A;  5DJ1 A;  2X5F A;  2AEV A;  5AX8 A;  4ZSW A;  2QB2 A;  2DOU A;  3BWO A;  3N5M A;  3VOM A;  1WYT A;  4WYD A;  4A6R A;  3BCA A;  3NYS A;  4CBS A;  1BQA A;  1GDE A;  3CQ6 A;  3AOW A;  4ZWM A;  4LNL A;  1O4S A;  4ITG A;  1BJ4 A;  2TPL A;  2CJG A;  3RCH B;  3USF A;  2GMS A;  3GET A;  3L8A A;  1LW5 A;  2VYC A;  1OXO A;  1YJS A;  2CJH A;  3CQ5 A;  3PDB A;  1LS3 A;  4FFC A;  4RKD A;  1SZU A;  1QJ5 A;  1IX8 A;  4EMY A;  3KGW A;  4EU1 A;  4F5L A;  4W1W A;  1B9H A;  4K05 A;  2XH1 A;  4B9B A;  2X5D A;  3EI7 A;  3K7Y A;  3MAF A;  4ZWV A;  1ZOB A;  3BCB A;  3CBF A;  2VIB A;  4GE4 A;  1JS3 A;  4LW4 A;  1QIR A;  5EUN A;  1AKA A;  1GD9 A;  3HDO A;  3E6G A;  3FSL A;  3QGU A;  3MBB A;  1JF9 A;  5FT8 A;  5FT4 A;  1IVR A;  3R4T A;  1AHX A;  3TFT A;  1YIY A;  1DJE A;  4MSO A;  1IAX A;  2VMS A;  4ITX A;  2NMP A;  3JW9 A;  4F5G A;  4CXR A;  2W7F A;  1GCK A;  3BC8 A;  1IAY A;  1MGV A;  2QMA A;  3FQA A;  3GWP A;  5F9S A;  2YRR A;  5LH9 A;  1PMM A;  1N8P A;  1S0A A;  5K8B A;  3PAA A;  4OTL A;  4UHN A;  3DZZ A;  3GR9 A;  1LC8 A;  3I4J A;  3PA9 A;  1LC7 A;  1BJO B;  3HVY A;  4QGR A;  2HUI A;  4ADB A;  2VMN A;  3AEM C;  4MKK A;  5M4B A;  1AMR A;  3PIU A;  1N2T A;  3F0H A;  1C7N A;  1B8G A;  4WYA A;  3W1I A;  1ASF A;  4RKC A;  4OCA A;  1OHW A;  1V2F A;  1C9C A;  3ATH A;  1ASA A;  3F9T A;  3FKD A;  1TOG A;  2AY8 A;  1D2F A;  1W3U A;  2ZY4 A;  1CS1 A;  3G8M A;  4FL0 A;  3N4R A;  2QLR A;  3PD6 B;  4MQQ A;  1KAF A;  1AKC A;  1QZ9 A;  2D65 A;  3DC1 A;  3LVL B;  4WYG A;  5G2Q A;  3DRD A;  3QN6 A;  1TAT A;  1WYU A;  2WK8 A;  5E5I A;  2HUU A;  4TV7 A;  1PMO A;  4BA4 A;  2VMY A;  4XJM A;  1AIB A;  1EJI A;  1IX7 A;  5D95 A;  4AO9 A;  3UAK A;  3AEM A;  2VGS A;  2DR1 A;  2VIA A;  4PVF A;  2DGL A;  2OAT A;  3K28 A;  2ZSM A;  3LVJ A;  1D7U A;  4I8A A;  4B98 A;  1AY8 A;  4U1T A;  3BB8 A;  2W7D A;  3FRK A;  2BIG A;  4WLH A;  4WXB A;  1I41 A;  1ORD A;  1XEY A;  2XBN A;  3ASA A;  3LWS A;  3P1T A;  4P7Y A;  3VK4 A;  2E54 A;  1BS0 A;  3N4S A;  1MDO A;  2YKV A;  4XJP A;  3WX9 A;  1SVV A;  3FCR A;  1CJ0 A;  2Z1Y A;  3B1E A;  1E5F A;  1GEW A;  2FNI A;  4AZJ A;  1M6S A;  2VMO A;  1D7R A;  1DJU A;  1GC4 A;  3H14 A;  3GZC A;  5EUD A;  2BYL A;  1FG3 A;  2W8W A;  3HL2 A;  4A0F A;  1O62 A;  1S08 A;  1AAW A;  1CZE A;  2YKX A;  1WKH A;  2C81 A;  2YCP A;  3HQT A;  1OXP A;  1ECX A;  4DBC A;  2BWP A;  3KE3 A;  1ARS A;  3RQ1 A;  1KKP A;  4W5K A;  2CFB A;  4WYC A;  2EPJ A;  4Q75 A;  3WCN A;  4ATP A;  3E2F A;  4JF0 A;  1EQB A;  3G7Q A;  1MAP A;  1JG8 A;  2HZP A;  3H7F A;  1AJS B;  3ZRQ A;  2VMU A;  3LVK A;  2DKB A;  2Q7W A;  2D7Z A;  3ECD A;  5DX5 A;  5EFS A;  3B1C A;  4OYT A;  3BV0 A;  5G4I A;  3VP6 A;  3EZ1 A;  1OHV A;  1XI9 A;  4J5U A;  1KMK A;  2OKJ A;  1BQD A;  4ATQ A;  4IXZ A;  7AAT A;  1CZC A;  3FZ7 A;  3LV2 A;  4IY7 A;  3EI8 A;  3DR7 A;  1DGD A;  1SPA A;  2CJD A;  3BS8 A;  4R5Z A;  1AMQ A;  5G2P A;  3T32 A;  1ASM A;  2Z67 A;  2FM1 A;  4W8I A;  1C0N A;  2HP2 A;  3EI9 A;  5G4J A;  1ASG A;  3AEJ C;  2C0R A;  4XAU A;  4EFF A;  4LNM A;  4A6T A;  3II0 A;  4EB7 A;  4XEW A;  1YNU A;  2CST A;  4MGR A;  1ELU A;  1MAQ A;  1ELQ A;  1WYT B;  1DGE A;  5M4D A;  3FFR A;  4BQ0 A;  2O1B A;  1BJN A;  1QIT A;  1J04 A;  4DGT A;  3VK2 A;  4A0R A;  1EG5 A;  1ARH A;  1GEX A;  1BKG A;  1V72 A;  4ZDP A;  2ZY3 A;  2VMW A;  3E77 A;  4A72 A;  5FT5 A;  2EGY A;  4A0H A;  1G4V A;  2CAN A;  2ORD A;  3EUC A;  2W7L A;  1QIS A;  2FN6 A;  2V1P A;  2DGK A;  1AMS A;  1SZS A;  1TOE A;  2D66 A;  2WK9 A;  4E77 A;  4K2M A;  3TAT A;  2Z61 A;  4LC3 A;  3PDB B;  4J8L A;  4TMR A;  3QHX A;  3GZD C;  3FZ6 A;  2AY1 A;  3FQ8 A;  1CQ8 A;  4RIT A;  4ISY A;  3MAF B;  3AEJ A;  5EUE A;  1W7M A;  2VMV A;  3AAT A;  4E3R A;  3H9X A;  2QB3 A;  2HP1 A;  1W23 A;  4KXK A;  4F5F A;  1TOK A;  2ZC0 A;  2R5C A;  3LVM A;  1WST A;  3ZRP A;  2G6W A;  4Q6R A;  3QPG A;  1AKB A;  1TAR A;  1IJI A;  1SF2 A;  4O6Z A;  4N0B A;  3MAD A;  1YAA A;  3N0L A;  3D6K A;  5EQC A;  1C7G A;  3L44 A;  4TN4 A;  5EAA A;  3RI6 A;  1LKC A;  4ZDL A;  1AHF A;  1FC4 A;  3AEP A;  3GJU A;  4Y0I A;  1Z7D A;  2AY9 A;  4MQR A;  2ZJG A;  1AAM A;  4A0G A;  3EI5 A;  4GEB A;  4AO4 A;  3GZD A;  3WCO A;  2C44 A;  3WZF A;  2AY2 A;  2D5Y A;  2EZ2 A;  2WKA A;  1KMJ A;  1PFF A;  4OBU A;  5J8Q A;  2ZUK A;  2ZP7 A;  4ZSY A;  4W1X A;  3NRA A;  1DKA A;  1ASC A;  5I92 A;  2A1V A;  3WGB A;  4H63 Q;  2W7J A;  5DB5 A;  1S09 A;  3B1D A;  2W8V A;  3R9A A;  1FG7 A;  1OHY A;  3F6T A;  4HVK A;  1IUG A;  2FYF A;  2PB2 A;  3BWN C;  4GE7 A;  4XK1 A;  3A9Z A;  1WYV A;  2F8J A;  2JGT A;  5G0A A;  1WYU B;  3FQ7 A;  4AOA A;  1SFF A;  2EO5 A;  1CL2 A;  3RBF A;  4UOY A;  3DXW A;  1GC0 A;  2W7K A;  3UWC A;  4GSA A;  3M5U A; 
#chains in the Genus database with same CATH homology
 3NYU A;  4IXS A;  4IXO A;  1VEF A;  1UKJ A;  1D7S A;  3PPL A;  3N75 A;  2FNU A;  1M0Q A;  3W1J A;  2HOR A;  5IWQ A;  1S07 A;  2ZSL A;  3WGC A;  2W8T A;  2AY4 A;  3ELP A;  5C6U A;  2ZY2 A;  2VMT A;  3GBX A;  3AOV A;  2D63 A;  4M2M A;  4RM1 A;  2BWN A;  4OMA A;  1B5O A;  3ZZJ A;  2HOX A;  4PFN A;  2OGE A;  2YKY A;  3QBO A;  5EIG A;  3BWN A;  2E7I A;  2FKI A;  1V2D A;  2VMX A;  1O69 A;  2W8J A;  4W91 A;  3AEN A;  3QM2 A;  3AV7 A;  1P3W A;  3BN1 A;  1RV3 A;  4IYO A;  1AJR A;  5JAY A;  4P3M A;  3FZ8 A;  5TF5 A;  1W7N A;  2GSA A;  2VLF A;  2O0R A;  2YKU A;  3AEL A;  4JF1 A;  2ZY5 A;  4F4E A;  3AEN B;  1W7L A;  2VGW A;  3I5T A;  4IYO B;  2JIS A;  1M0O A;  1I43 A;  4KYO A;  2CIN A;  4ZAS A;  1M0P A;  1U08 A;  3BCX A;  1AY4 A;  3IHJ A;  3FFH A;  4L0O A;  1MDZ A;  1TPL A;  5BJ3 A;  1BT4 A;  4GDY A;  2VMZ A;  4WYF A;  1C7O A;  5KTB A;  1OAT A;  2OKK A;  4IX8 A;  5HXX A;  2JJF A;  2VGU A;  3DYD A;  2CB1 A;  1IX6 A;  4K2I A;  1LC5 A;  4CBR A;  1X29 A;  1SZK A;  2R5E A;  4Q31 A;  4XQ2 A;  4R2N A;  3E2Z A;  1DJ9 A;  2PB0 A;  5EAV A;  4A00 A;  2Z1Z A;  1YJZ A;  4JEZ A;  1AHY A;  1S06 A;  2D7Y A;  2AY5 A;  2V0Y A;  3JWB A;  3Q8N A;  1RVU A;  2E7J A;  3WKS A;  3ZZK A;  4UHM A;  4WBT A;  2Z9V A;  3E2Z B;  3LG0 A;  3UE8 A;  2Z9W A;  1GEY A;  3EIA A;  3NNK A;  1YIZ A;  2JJG A;  5HHY A;  2Z9X A;  4EB5 A;  3A8U X;  4WD2 A;  4XJO A;  3HLM A;  1ARG A;  2VMP A;  3G0T A;  3N4X A;  2YRI A;  2KFP A;  4OC9 A;  2G7J A;  3A2B A;  3NUI A;  1H1C A;  1Y4I A;  1UU2 A;  3RBL A;  2ZYJ A;  1AMA A;  4Y0D A;  3AEO A;  3RCH A;  4Q76 A;  2BI5 A;  3P6K A;  2CTZ A;  4JEX A;  5LHA A;  2Z9U A;  3PDX A;  3NU8 A;  4ZLV A;  4F5H A;  3HBX A;  1H0C A;  2JG2 A;  1QJ3 A;  1X2A A;  3A9X A;  4WP0 A;  4DQ6 A;  3FD0 A;  2D64 A;  3JZL A;  1X0M A;  2AAT A;  1GC2 A;  3NUB A;  2AY6 A;  4F5J A;  1AX4 A;  1G7X A;  2VGT A;  3QI6 A;  2CH2 A;  2VMQ A;  1MLZ A;  4MY5 A;  4WXF A;  2W7M A;  1CQ6 A;  1LK9 A;  3MC6 C;  3WLX A;  4E3Q A;  1C4K A;  2R5C B;  4A6U A;  2DKJ A;  3VK3 A;  2W8U A;  1UU1 A;  4F5M A;  2RFV A;  1M32 A;  3FVX A;  4W1V A;  3WY7 A;  5F8V A;  3ELE A;  3ZRR A;  1KKJ A;  4M2K A;  3NDN A;  5FT6 A;  4AH3 A;  4JE5 A;  2GMU A;  2C7T A;  4Y0H A;  4JEW A;  4GE9 A;  3EZS A;  2CY8 A;  3KGX A;  1BJO A;  3NX3 A;  4AZK A;  2W7E A;  4WXG A;  4M2J A;  4JE5 D;  4RJY A;  2VLH A;  2WB6 A;  2AY7 A;  1TAS A;  3DR4 A;  1ASN A;  2QBT A;  4MKJ A;  4UQV A;  8AAT A;  1WKG A;  2Z20 A;  3FDD A;  4IW7 A;  4E1O A;  1ARI A;  1ASE A;  4ADE A;  2YCT A;  2W7I A;  3JTX A;  1G7W A;  4BMK A;  1JS6 A;  3E9K A;  1T3I A;  1MDX A;  2PO3 A;  3MC6 A;  4LW2 A;  1LW4 A;  4OT8 A;  1UU0 A;  5M46 A;  4ZDO A;  3PD6 A;  2DGM A;  1I48 A;  4ZAH A;  2FQ6 A;  2BI3 A;  1ZOD A;  2BHX A;  1V2E A;  1VP4 A;  1ZC9 A;  4CVQ A;  3COG A;  1ASB A;  1WYV B;  3OP7 A;  1BW0 A;  1KL1 A;  4RIZ A;  3TCM A;  4OBV A;  1RV4 A;  2EYQ A;  1E5E A;  3PJ0 A;  4WLJ A;  2BI2 A;  2YHK A;  2BI1 A;  3TQX A;  2VGZ A;  4ZM4 A;  4RJ0 A;  4U2H A;  3N7N A;  2AEU A;  3DU4 A;  3OKS A;  4RAE A;  3HT4 A;  4K2B A;  2HOY A;  2YCN A;  1D7V A;  1QGN A;  2BI9 A;  1O61 A;  2GB3 A;  4KAM A;  4ADC A;  2OGA A;  2X8U A;  2EZ1 A;  5BJ4 A;  4R8D A;  1B4X A;  3TFU A;  4BHD A;  9AAT A;  1G4X A;  3I16 A;  4ADD A;  5D5S A;  4BA5 A;  2VGV A;  3LY1 A;  4WYE A;  3PGY A;  3FDB A;  1IBJ A;  2D61 A;  4R5F A;  3JWA A;  3CAI A;  3MAU A;  1AIA A;  1X28 A;  3EIB A;  3NU7 A;  4XJL A;  3GSB A;  5EIG B;  1ART A;  3VAX A;  3WKR A;  2QSR A;  3ISL A;  1Z3Z A;  2BYJ A;  2VI9 A;  3FVU A;  1CL1 A;  1M4N A;  2BIE A;  3K40 A;  1M7Y A;  3NTJ A;  1DFO A;  2OQX A;  3A9Y A;  2R2N A;  1AIC A;  3CQ4 A;  3KKI A;  4HF8 A;  5E4Z A;  4F5K A;  3RUY A;  2O7C A;  3W1H A;  4UHO A;  5DJ9 A;  2W7H A;  2BWO A;  1GBN A;  4PIW A;  1TOJ A;  1YOO A;  5E3K A;  2EH6 A;  3HMU A;  4WB0 A;  5M49 A;  1ASL A;  1J32 A;  1DTY A;  1I29 A;  2JJE A;  2X3L A;  3DXV A;  4JEV A;  1N31 A;  1VJO A;  4H51 A;  2VI8 A;  1PG8 A;  1CQ7 A;  3EI6 A;  1AJS A;  4WB0 B;  1AHE A;  4LNJ A;  3NYT A;  1TOI A;  2GQN A;  5HDM A;  1GC3 A;  1AHG A;  4CXQ A;  1ASD A;  3E2Y A;  2E7U A;  4F5I A;  4NOG A;  4ZM3 A;  4N0W A;  2AY3 A;  2R0T A;  2VMR A;  3B46 A;  3FVS A;  4GRX A;  2QA3 A;  1RVY A;  4RLG A;  4PFF A;  2YOB A;  2BIA A;  3ASB A;  1BJW A;  3ACZ A;  1YJY A;  1M0N A;  3MEB A;  4MQP A;  1KL2 A;  5G09 A;  4JEY A;  2BKW A;  2HUF A;  1AY5 A;  3IF2 A;  1B9I A;  1B5P A;  1MLY A;  2CH1 A;  3DOD A;  2JJH A;  2WK7 A;  2W7G A;  3JU7 A;  3MKJ A;  3FTB A;  2HOZ A;  3B8X A;  5DJ1 A;  2X5F A;  2AEV A;  5AX8 A;  4ZSW A;  2QB2 A;  2DOU A;  3BWO A;  3N5M A;  3VOM A;  1WYT A;  4WYD A;  4A6R A;  3BCA A;  3NYS A;  4CBS A;  1BQA A;  1GDE A;  3CQ6 A;  3AOW A;  4ZWM A;  4LNL A;  1O4S A;  4ITG A;  1BJ4 A;  2TPL A;  2CJG A;  3RCH B;  3USF A;  2GMS A;  3GET A;  3L8A A;  1LW5 A;  2VYC A;  1OXO A;  1YJS A;  2CJH A;  3CQ5 A;  3PDB A;  1LS3 A;  4FFC A;  4RKD A;  1SZU A;  1QJ5 A;  1IX8 A;  4EMY A;  3KGW A;  4EU1 A;  4F5L A;  4W1W A;  1B9H A;  4K05 A;  2XH1 A;  4B9B A;  2X5D A;  3EI7 A;  3K7Y A;  3MAF A;  4ZWV A;  1ZOB A;  3BCB A;  3CBF A;  2VIB A;  4GE4 A;  1JS3 A;  4LW4 A;  1QIR A;  5EUN A;  1AKA A;  1GD9 A;  3HDO A;  3E6G A;  3FSL A;  3QGU A;  3MBB A;  1JF9 A;  5FT8 A;  5FT4 A;  1IVR A;  3R4T A;  1AHX A;  3TFT A;  1YIY A;  1DJE A;  4MSO A;  1IAX A;  2VMS A;  4ITX A;  2NMP A;  3JW9 A;  4F5G A;  4CXR A;  2W7F A;  1GCK A;  3BC8 A;  1IAY A;  1MGV A;  2QMA A;  3FQA A;  3GWP A;  5F9S A;  2YRR A;  5LH9 A;  1PMM A;  1N8P A;  1S0A A;  5K8B A;  3PAA A;  4OTL A;  4UHN A;  3DZZ A;  3GR9 A;  1LC8 A;  3I4J A;  3PA9 A;  1LC7 A;  1BJO B;  3HVY A;  4QGR A;  2HUI A;  4ADB A;  2VMN A;  3AEM C;  4MKK A;  5M4B A;  1AMR A;  3PIU A;  1N2T A;  3F0H A;  1C7N A;  1B8G A;  4WYA A;  3W1I A;  1ASF A;  4RKC A;  4OCA A;  1OHW A;  1V2F A;  1C9C A;  3ATH A;  1ASA A;  3F9T A;  3FKD A;  1TOG A;  2AY8 A;  1D2F A;  1W3U A;  2ZY4 A;  1CS1 A;  3G8M A;  4FL0 A;  3N4R A;  2QLR A;  3PD6 B;  4MQQ A;  1AKC A;  1QZ9 A;  2D65 A;  3DC1 A;  3LVL B;  4WYG A;  5G2Q A;  3DRD A;  3QN6 A;  1TAT A;  1WYU A;  2WK8 A;  5E5I A;  2HUU A;  4TV7 A;  1PMO A;  4BA4 A;  2VMY A;  4XJM A;  1AIB A;  1EJI A;  1IX7 A;  5D95 A;  4AO9 A;  3UAK A;  3AEM A;  2VGS A;  2DR1 A;  2VIA A;  4PVF A;  2DGL A;  2OAT A;  3K28 A;  2ZSM A;  3LVJ A;  1D7U A;  4I8A A;  4B98 A;  1AY8 A;  4U1T A;  3BB8 A;  2W7D A;  3FRK A;  2BIG A;  4WLH A;  4WXB A;  1I41 A;  1ORD A;  1XEY A;  2XBN A;  3ASA A;  3LWS A;  3P1T A;  4P7Y A;  3VK4 A;  2E54 A;  1BS0 A;  3N4S A;  1MDO A;  2YKV A;  4XJP A;  3WX9 A;  1SVV A;  3FCR A;  1CJ0 A;  2Z1Y A;  3B1E A;  1E5F A;  1GEW A;  2FNI A;  4AZJ A;  1M6S A;  2VMO A;  1D7R A;  1DJU A;  1GC4 A;  3H14 A;  3GZC A;  5EUD A;  2BYL A;  1FG3 A;  2W8W A;  3HL2 A;  4A0F A;  1O62 A;  1S08 A;  1AAW A;  1CZE A;  2YKX A;  1WKH A;  2C81 A;  2YCP A;  3HQT A;  1OXP A;  1ECX A;  4DBC A;  2BWP A;  3KE3 A;  1ARS A;  3RQ1 A;  1KKP A;  4W5K A;  2CFB A;  4WYC A;  2EPJ A;  4Q75 A;  3WCN A;  4ATP A;  3E2F A;  4JF0 A;  1EQB A;  3G7Q A;  1MAP A;  1JG8 A;  2HZP A;  3H7F A;  1AJS B;  3ZRQ A;  2VMU A;  3LVK A;  2DKB A;  2Q7W A;  2D7Z A;  3ECD A;  5DX5 A;  5EFS A;  3B1C A;  4OYT A;  3BV0 A;  5G4I A;  3VP6 A;  3EZ1 A;  1OHV A;  1XI9 A;  4J5U A;  1KMK A;  2OKJ A;  1BQD A;  4ATQ A;  4IXZ A;  7AAT A;  1CZC A;  3FZ7 A;  3LV2 A;  4IY7 A;  3EI8 A;  3DR7 A;  1DGD A;  1SPA A;  2CJD A;  3BS8 A;  4R5Z A;  1AMQ A;  5G2P A;  3T32 A;  1ASM A;  2Z67 A;  2FM1 A;  4W8I A;  1C0N A;  2HP2 A;  3EI9 A;  5G4J A;  1ASG A;  3AEJ C;  2C0R A;  4XAU A;  4EFF A;  4LNM A;  4A6T A;  3II0 A;  4EB7 A;  4XEW A;  1YNU A;  2CST A;  4MGR A;  1ELU A;  1MAQ A;  1ELQ A;  1WYT B;  1DGE A;  5M4D A;  3FFR A;  4BQ0 A;  2O1B A;  1BJN A;  1QIT A;  1J04 A;  4DGT A;  3VK2 A;  4A0R A;  1EG5 A;  1ARH A;  1GEX A;  1BKG A;  1V72 A;  4ZDP A;  2ZY3 A;  2VMW A;  3E77 A;  4A72 A;  5FT5 A;  2EGY A;  4A0H A;  1G4V A;  2CAN A;  2ORD A;  3EUC A;  2W7L A;  1QIS A;  2FN6 A;  2V1P A;  2DGK A;  1AMS A;  1SZS A;  1TOE A;  2D66 A;  2WK9 A;  4E77 A;  4K2M A;  3TAT A;  2Z61 A;  4LC3 A;  3PDB B;  4J8L A;  4TMR A;  3QHX A;  3GZD C;  3FZ6 A;  2AY1 A;  3FQ8 A;  1CQ8 A;  4RIT A;  4ISY A;  3MAF B;  3AEJ A;  5EUE A;  1W7M A;  2VMV A;  3AAT A;  4E3R A;  3H9X A;  2QB3 A;  2HP1 A;  1W23 A;  4KXK A;  4F5F A;  1TOK A;  2ZC0 A;  2R5C A;  3LVM A;  1WST A;  3ZRP A;  2G6W A;  4Q6R A;  3QPG A;  1AKB A;  1TAR A;  1IJI A;  1SF2 A;  4O6Z A;  4N0B A;  3MAD A;  1YAA A;  3N0L A;  3D6K A;  5EQC A;  1C7G A;  3L44 A;  4TN4 A;  5EAA A;  3RI6 A;  1LKC A;  4ZDL A;  1AHF A;  1FC4 A;  3AEP A;  3GJU A;  4Y0I A;  1Z7D A;  2AY9 A;  4MQR A;  2ZJG A;  1AAM A;  4A0G A;  3EI5 A;  4GEB A;  4AO4 A;  3GZD A;  3WCO A;  2C44 A;  3WZF A;  2AY2 A;  2D5Y A;  2EZ2 A;  2WKA A;  1KMJ A;  1PFF A;  4OBU A;  5J8Q A;  2ZUK A;  2ZP7 A;  4ZSY A;  4W1X A;  3NRA A;  1DKA A;  1ASC A;  5I92 A;  2A1V A;  3WGB A;  4H63 Q;  2W7J A;  5DB5 A;  1S09 A;  3B1D A;  2W8V A;  3R9A A;  1FG7 A;  1OHY A;  3F6T A;  4HVK A;  1IUG A;  2FYF A;  2PB2 A;  3BWN C;  4GE7 A;  4XK1 A;  3A9Z A;  1WYV A;  2F8J A;  2JGT A;  5G0A A;  1WYU B;  3FQ7 A;  4AOA A;  1SFF A;  2EO5 A;  1CL2 A;  3RBF A;  4UOY A;  3DXW A;  1GC0 A;  2W7K A;  3UWC A;  4GSA A;  3M5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...