3QBTB

Crystal structure of ocrl1 540-678 in complex with rab8a:gppnhp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
130
structure length
130
Chain Sequence
DSVRIMDRMENDFLPSLELSRREFVFENVKFRQLQKEKFQISNNGQVPCHFSFIPKLNDSQYCKPWLRAEPFEGYLEPNETVDISLDVYVSKDSVTILNSGEDKIEDILVLHLDRGKDYFLTISGNYLPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A structural basis for Lowe syndrome caused by mutations in the Rab-binding domain of OCRL1.
pubmed doi rcsb
molecule keywords Ras-related protein Rab-8A
molecule tags Protein transport/hydrolase
source organism Homo sapiens
total genus 25
structure length 130
sequence length 130
chains with identical sequence D, F, H
ec nomenclature ec 3.1.3.36: Phosphoinositide 5-phosphatase.
pdb deposition date 2011-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qbtB00
2GI7A 3O9WD 5J56B 3MA7B 3BYYA 3TNNA 1G7QB 1A4KA 1FZOB 4YQXH 1K3ZA 5C0RL 2DDQL 3QPQD 4RAUB 2X89D 3EZ8A 2VLLB 5DK0B 3FRUB 2X4PA 1I3RB 4PJDA 3NCFB 1MJ8H 4PJIF 3OGCA 3WFCH 3WJLA 3H42L 5HGAB 4X80H 2XOTA 4V1DD 4EEEA 3ARDA 4JDVA 4K8RD 1MJ7H 3C6SA 1NQBA 3FCTA 1A1OA 1IKFL 5D1XB 1A22B 1FGNL 4LLDB 3K2UH 4EBQL 1I4FB 4ODXA 4OIIL 2C1OA 4Z77B 1N7MH 4I0PB 2ADIA 3RQ3A 2A74A 4JPVH 4F2MB 2R0ZL 4KWUA 4XAWL 5C0GB 1AO7E 4GBXD 4KVNL 4Z7WF 4HKJB 2M1KA 3VGAB 4NNYA 4KZEH 3FRPG 4XNYH 5DA4A 4H25B 2VKWA 2NTFB 5I1CH 2R2EA 1W8OA 3O2WH 2FEDD 1TNMA 4UI2A 1IEBB 3REWB 3DBXA 1HDMA 4NO3B 3ZKND 1IM9B 1AD9B 1H3TA 3H9HA 5MP6H 3GSXA 5DK2A 1SJHB 2QQKH 1NKOA 3UBXI 2VDNH 2AW2A 4K71B 5CP3A 4ZFZA 3EOTL 1A7QL 5KVEL 3TJHC 1BGXH 3S37H 3GSNB 3ES6B 1I9EA 3MRCB 1KXTB 1U8MB 4LGRB 1AXTL 4NHCL 5ECJE 5TE7L 1LEIB 5DMIL 5HJ3A 3DO7B 1ONQA 4ZFOL 4WU7A 4HS3A 1F6AA 3FB6A 4Z7NF 3QEGL 5T1MA 1X5HA 5E00A 2IH3B 1AR1C 2D7NA 5D71H 3ULUH 2MSPA 4P49A 2QHRL 1JPTH 1FG2A 4JPWH 4LLYB 5KSAA 1T89A 1NC4A 5CJXA 3SJVE 3RY5A 2OLDA 4WFED 1IBGL 5INCA 1VSCA 1A9BA 3VG9B 2DI9A 3BP5A 3WO4C 4OZGB 4JRYA 4EI6B 5L2KA 3OGOE 3IJHB 5FYKD 2V2TB 2OR9L 4GMSL 3V6BR 2OMBA 1MQKL 4YWGL 5I30H 1QRNA 5GRUL 1K3IA 4NQCB 1AI1L 2DLGA 3CZJA 1A6AA 3O4LA 3TP4A 5ACLA 4EI5C 2W0PA 1HE7A 4XI5C 1BIHA 4PRNA 2W9EL 1M6OA 3B6SB 3BKML 3MRIA 2OTUB 2CK0L 4NM8L 3SGEH 3L3JA 4Z9KB 4KK5C 1QR4A 3IF1A 1S7WA 1HI6A 4NRYB 3RNQA 1QKZL 2J6EH 3PWNA 5B3JF 2YRLA 4YDLC 2Q3AA 3DMMB 4F7MB 4PBVC 1X5AA 3RVVC 3R4DA 1T21B 3PDOA 3N1QC 3T4AB 2XN9B 1KC5H 2VMFA 3DRQB 1MREL 4WIQA 3VRJB 4QF1A 4F8QA 5F1IA 2CUMA 1RK0B 4TVPH 4RFOL 3NIFE 5GS2H 3ZT7A 1AKJA 3PQYA 4IDLA 3VXOA 1J8HB 4PRAA 5F1SA 5DJ2A 1I7ZA 2AJZA 4QRPD 1CDBA 5BZWB 3MRRA 1XF5A 3GSNH 3V5HB 4BH7A 1RVFL 3MLPA 5EC2A 2EXWD 2VLJE 3QUXB 4K3DL 4KROD 5J1AB 4XNUL 4JM2F 3VI4E 3U4EB 3ZE0E 4J23A 3FO9B 1YC7A 4S1SH 2G75A 4KZDH 3WLWC 1CXFA 1GOFA 2EZ0D 4FFZL 3RWGA 1FVCA 1N2RB 4FHBD 3L3IA 5CFHA 5K33A 3DJ9A 1BQHG 5T1LA 1RURH 2YWYA 5E56A 3R0MA 3GSQA 3QPXH 1A6ZB 3BSZL 5IT2L 5CLTA 4XBEL 1MWAA 1P4BL 2NZ9C 4JFDE 3Q1SL 3MFFA 1UJ3C 2WIIB 3C09C 1ZV5A 3QNXA 4ZXBC 5TF1L 4F7PA 2R2HA 3FB5B 1P7KA 4YHIB 4ELMA 1IAII 5FF6A 2XXMB 3LIZH 2BY2A 2Q20A 1ERNA 3DGGA 4LIQL 1ZT4B 3ZTNH 3MREB 4MJ6A 4DUWA 4HKZA 5F72S 1T7WA 4P48A 4PJEF 2N56A 5DWUL 4LNVA 2VISB 1MI5B 3U4BH 4G8GA 3MA9L 1JZ3A 1XR8B 5IW1B 4F7TB 5J6HA 3OR7B 3QFJB 3T0DA 1JYWA 5JLZA 1EEYB 4WI6A 4LAQH 3M8OH 3LSOA 3RFZC 1T7XA 3BQUA 4G43A 1SBBA 5D7JD 1LDPL 4FTVE 4L4JA 4YDIH 5DD6B 4J6RH 1OGAA 3MGTB 4JE4B 1A6UH 1OGTA 3MPCA 3T77B 5J8OA 1VFAB 3HA0A 2E9WA 5C09B 4YBLC 3RTQB 3EFDH 5DMKB 4P2RD 3VGGA 3QFDA 3HE7D 3K4DA 1VPOH 2VLRB 5C71A 1HEZA 5KAQG 4YFDB 5B39B 2D7OA 4YO0B 2EYSA 4X0KB 1NGWA 2R23B 4K3HA 3SE3A 2ARJB 2XPGA 3X12A 2JJUA 5HHOB 5KW9H 3T65A 2VNCA 1I1YA 4QCIB 5H8DA 3SDXA 5MEPA 1JGUL 1WFOA 2AI0H 5C08D 4XP6H 5L7XL 5E5MA 4PRPA 1G0YR 1T4KB 4FQLH 5ABDE 2JJVA 2YA0A 4OLWL 3DROA 6FABL 3BGFC 5CD3B 4WUUA 1S7XA 2CXKA 1REIA 4GH7B 4KK6C 4X6FB 3OJDA 4BZ1L 5IW6A 4QRUA 2ITDB 4Z76A 4OCNC 3T2NL 4MAYB 3MLSH 3G04B 3MR9A 1L9NA 4NQVA 4LU5L 5GGRY 5F96H 1WAAE 3AS3A 5GZOD 2PN5A 2NW3B 3NTCH 4HT1L 5EO9B 1U0QA 4OD2A 1A3LL 1ZANL 4WO4C 4Y16D 1F97A 5ICZA 1T5WA 3ALWA 4XCEB 2D03H 3E8UL 3ARGB 4LPCA 3IFNH 1UXSA 4CVXA 3T2OA 4NJAL 1FC1A 4JZJB 3S3PA 2COQA 4KXZI 4WEUD 2AJYL 3MV7D 2RHEA 5J06A 2IALA 3RP1A 1I8KB 3TIDB 4YXKL 3CSGA 4IBLT 2OSLA 4LSPH 3BRGC 1U91A 4Z7QF 4HWZB 5IESH 1TZHA 5EBWA 1YEGL 4H26B 5DJ0A 4RISH 1TVDA 2VOTA 4GAGL 5DJ6A 3DOSA 2J8UA 3EYOB 5E6IB 3ZMRA 1KN2L 1JF5A 5JHLH 4PJBF 5KSBB 3AS1A 3GSWB 1OP9A 1CL7H 4WI7A 1JI1A 2J3SA 1TCRB 5AZ2H 4U1LB 5J12B 4KRPC 4XCFL 1Y0LA 3P4MB 5EOTA 4O9HL 3SKMA 3PHOB 2P43B 3QIWC 4LNRA 3WE6A 1FVEA 4IEFB 1I8MA 1IQDA 4O4YH 1A4JA 5IV2B 3VJ6B 1H8SA 1QLRB 1PKOA 3QUZC 1MIEL 4OT1L 1MLCB 5E8OB 1U6AL 1DLHA 4KHXL 3OKKA 4OLEA 4S10A 5TE6L 3MV9B 1ORSB 1RJYB 2YKLH 3AY4C 1KPVB 2MCG1 4A6YL 1BIIA 2IANB 1F4HA 1DQJB 1T7ZA 5HDLA 3QHTC 4HWBL 1CICC 1YY9C 2ZOKA 4XHJD 2IAMB 3VWJC 4UILL 4JKKA 1E27B 4FFVC 4PRHE 1AE6H 1K6QH 3VFUA 2XQBL 2NY3D 4DOHE 4F9PC 4GG8A 1NFDB 2B5IB 4P2QE 3SE8H 1LK3L 5HHNA 4BH8A 4M7ZC 3U46A 4ZDHB 4HZAA 2CRIA 1FORL 3VGFA 3VXSD 2XA3A 2YRZA 5D7IE 5IP4A 4LLWB 1JPSH 5IHUH 4M48L 4DTGL 1H15A 5EIIA 1RZ7L 3WDIA 3C5ZD 3BEVB 2UV3A 4G8FB 5CSBA 3IETB 4Q74A 3M45A 4CBPA 4HJ0D 2P7TA 4RDQF 2GKIA 4PGBA 3LKSA 1O7SA 2Z31D 4RAHA 3BH9A 3BEWA 4NO0D 1Q0XH 3MJ7A 2VXQH 2VDOH 4DCQB 5BVPL 1Q8MA 3RGVC 1FBIL 2ILLA 1N59B 5CBEA 3QXAA 1W8NA 1WFUA 1S9WA 4Y4HA 2HT4D 3BGAA 4MDIA 4FQXC 4U3XA 5HDOA 3V5KA 4KI5F 3HMXA 1B88A 1DQMH 3FT2B 4PJ7B 3HPJA 4KJWC 4P5TA 3QBTB 2OX5A 4HUWB 4ZTOL 5BMFL 5JO5A 3L3HA 3IU4H 1UWGH 2VLME 4KPHH 3CDFA 4MNQE 1ZHKA 5D70H 2ATKB 3T3MF 4PV9B 4BSWA 5DJXB 1A7NL 1D9KD 4XP5H 1I9IH 4IJ3B 4RMRA 4HC1A 3FL7A 4FQPA 2NX5A 1IAOA 3BP4B 3N1MC 2IEPA 3RL2A 5E9DA 4LLVA 4P23B 3SE3C 3WYRA 4HBQA 4X8JB 4GRLB 4X8XA 3ZSSA 4ODTL 2UWEA 4HH9B 4P46D 4AK1A 2VXTL 4NZTH 5D72H 2DQIL 3O6KH 3FQXA 1JK8A 4MWFB 4JZOB 3RAJH 4Y2DB 1KLGB 4M5ZL 4JHWH 1QO3B 1CXEA 5IB1A 3G5ZA 3NGBB 4PRBA 4KK8C 3ULUE 4KRMB 3GIVB 1NCNA 4NUGL 3KJ6H 1TQBC 2WBJB 3GK8H 1B0GA 3LRSA 1ITBB 5JIPA 1IVLA 4X9IA 1WWBX 4APQB 1T0MB 5FYJH 4DN3H 4OI7A 2HKFL 4BZYA 2R4SH 3N85H 3U82B 3P4OB 3OSKA 5FCUH 1CWVA 3OL2A 4IRJC 4XP9H 5EULV 3QIBD 3GMQA 5D7LA 4HUNB 1XGRB 2YMXL 2MQ3A 3IDUA 4WHDA 3CDGA 1X44A 1EFQA 2NZIA 4RQQA 3H3KA 1U92B 4ESKA 1DBMH 4TNVF 4RAVA 2NW2A 2XY2A 4QRQB 3WO3B 4WEBH 4BQCA 4FZ8L 2EO9A 3KPMB 5ISZB 2VABB 4RBPH 4LARL 4LSTH 5L9DH 2D7MA 1FO0L 3EOAB 3IJYB 4MXWH 2O5ZL 1TETH 4R7NB 3FOLA 4M5YH 1AC0A 5EORH 3HAEA 2DTMH 3MV8A 3S88L 3V6OA 3DURA 1B4RA 4PJGA 3BWUC 4LGSB 5I1LA 3FO0L 4UT9H 1F3DJ 4FXGB 3SDCC 2N1KA 2G5RA 4QLRA 3EYVA 3IDGB 2C1PA 3MRGA 3NFPA 4CN6A 3U2SB 1U93B 3VE0B 3MBEC 2V2XB 4GOSA 4G7VH 3QB7C 3O6LH 4PY8J 4TVPE 2P8MA 4MJ5B 3KNBA 1WZ1H 4IMLB 4CRPA 5CJ8A 4OV6F 3MCKA 1W0VB 1UH4A 2EEDA 3O2VH 3NZHL 1BVKA 3OX8A 1Q1JL 1FHGA 5C0CA 2HFEB 3ELAT 4PRIB 3BZEA 5FUOL 1JI2A 3BXNA 1OVZA 4X5WB 3FFDB 5HI3C 2EYRA 2HT2C 2FGWL 5GGRA 3CFDB 3AMKA 1S5HA 2ESVD 3MZTA 4K7FA 3GJFK 1ACYH 2HRPL 3FTGB 3MOAH 3S36H 3IRZA 3MLXH 4F3FB 1FFRA 3TBTB 3FN0H 1BX2B 5F9WB 4F58L 4ISVA 4Y5VB 1HINH 5T3XL 3KPNB 5DA0B 1ADQA 4FQIH 4L29B 3IYLW 2VITA 2DQTL 2LAGB 4LVNC 1R3JA 1CZ8L 3SE9H 2BNQD 1A0QL 1P7QA 1EO7A 4QHLA 1MRDH 4OZGE 3RWEB 1HHKB 5DT1H 3OHXA 4J4PC 1R3HA 4BZ2L 2G5BB 2CMRH 4HX1A 3DV4A 5IF0A 2HVJB 4Q6IA 2W9DL 3C2AH 5FV2A 3H0TB 1ZMYA 4NQCE 4E5XA 2V17L 2DJ4A 2JCCA 3M17A 1LEKA 1R5WA 2QEJA 1ZWIB 4HCRA 5DQJB 4MA3A 1AGFB 4ZPVA 3U0PA 5DTFA 5DJ8B 3TWCL 1F6FB 1N8ZA 5A3IC 4Y8DC 5HI4C 4XAKD 2DM4A 1D3CA 4PJFF 4L9DA 1AD0A 1WZKA 3DUHA 1MPAH 2BRQA 2UUDK 4HFUL 3FO2A 3NA9L 3ARQA 2AK4B 1KLUB 5IQ7H 4NC2B 3TJHD 4OTXL 4EOWH 3GB7A 4NJ9H 3ALXA 1CIUA 4H8WC 3VXNB 4LHUG 3D69B 4XNQA 2IJ0C 3P30H 2NY7H 1F5WA 3IDXH 4X4MA 5I8EB 2DYPD 3GO1L 2APFA 3PJSB 4X7SL 1CK0L 3STBA 1J8HE 5KS9A 1FQ9C 2NY2B 2JTDA 3BDYL 1AR1D 5DDHA 3VRIB 3LDBC 2M2DA 3TN0A 1KJVA 3BT2L 1U8HA 4YHOH 2GT9B 5IMOA 3BIKA 1C16A 1FNFA 5KVDL 4C59B 4ZUTA 1GGIL 2Y5TB 4PB9H 4PYGA 2HA1A 3WMSA 1B0RB 2OXHA 4JO3H 3W0WD 4XMLH 4AENA 1KULA 1C08A 1I3UA 1TVHA 5F3BA 4GRMA 4Z18A 2C5DC 3X17A 5EU5B 2AXFA 1A7PL 2AQ3A 4I2XB 1OL0A 3C8KA 5DZNA 4Z78B 1LDSA 4LLMB 4LEOA 1EAPB 4AH2B 1JCKA 1N6QL 2NY6B 1ZHBB 2V5YA 2P48B 4EI5D 4XI5D 3PWLA 1NGXA 4FQCH 4QOKB 2HMIC 1FV1B 1GAFL 4XMPH 3V2AR 1Z9OA 1JGDA 4KK5D 2QLVB 3F6IA 5GGQL 3MRNB 1CFBA 1OAYL 2DQCL 2NY1C 4OI8A 4KUCD 1RK1B 3OKNA 4JFED 4RIRB 3H9SD 1PG7H 1BD2B 1BQHB 2V7HB 1X5IA 3RVVD 1CFTA 4G6FD 1T66C 4P57A 1NANI 4J3OC 1MI5E 3B8YA 5D2LE 4NFCA 2EIZB 4PBXA 1EHXA 2ICWA 5A16A 4D0DA 2MPAL 1LP9F 4PJEA 3JWOH 1EJ6A 2ZCHL 5I19H 1EZVX 4Q2ZB 3QUML 3CLEL 5CBAB 2APWA 4U6TA 4Q0XL 5I2IB 4O2CA 2F54D 1WT5C 3CUPA 3C08H 2AXGB 3QQ9C 4PJHF 4XP1H 4P2YA 1G0XA 4GS7B 1A5FH 1YDPA 2PYFB 2VLKD 4P4KA 1U8KA 5IM7A 4G5ZH 3LS4L 4IOFC 3WLWD 1FN4A 3O3BB 2KKQA 2Q7YA 5JQ6L 4HAGA 5C09E 1DUZA 3K80A 3MJ9A 2X10A 4P9ML 4NQUA 1J87A 3QDGD 1BQLH 3G08B 5ESQB 1GCFA 1E0OB 2AERT 2VLRE 5M7QA 2NZ9D 2HVKB 2R29H 4EKXA 3QCUH 3Q5YA 3QP3A 2Z91A 2XNAB 4LP5A 4F57H 2Q8BL 4ZXBD 4M1GH 1Z0MA 4FOMA 3RNKB 3VXPB 3QCVL 1CGSL 4TNVK 1ZGLM 2QQLL 5BO1L 2W65A 1DANT 5C0DB 2I27N 1NGYB 4PBWD 1Y18B 3KYKL 5HHOE 1RMFH 1ZVHA 2R0WL 3LKPA 1CVSC 3AREA 3CFCH 3BZFA 1N64H 2PO6A 3KPSB 2WAHA 2X70A 3REVA 4LHJB 3ZKXB 1TTUA 2AJUH 3RWIB 3JWDC 3PNWA 3KS0J 3PABA 2DBJA 1VADA 4ZSOA 3VFGH 4W4OA 1WTGT 2O93L 1KBGL 1KPRB 5D9SA 1A47A 5EH1A 1NDGA 1J11A 2MHAA 3P9WB 5JZ7C 5E99L 1MFEL 1CXLA 2XWBB 1JWUA 2GYSA 3EO9L 4HIIB 1SJXA 5IOPB 3OXRB 1OARH 4JDTH 4NC1E 2ZKHH 3UJJL 1ZTXH 1Q72L 3O9WB 4JZNB 3ROLA 4W68A 3VFWA 4GMTL 1SYVB 4NC0B 5GZNC 2VRAA 4I77H 4XXDA 4Q58C 3MLRL 3JTSA 4OZ4B 4AG4L 1QNZH 4WHTB 1QHOA 5F88B 2RBLA 5D7SH 3UTSE 3LY6A 4NKDA 1OAQL 4V1DB 1PX3A 3P73B 1M05B 2CD0A 4LCWA 5HDBE 1IGJB 5IFAH 2CIKA 4POUB 5DLMH 1IGTB 4N8PA 1UB5B 2IPTL 1TVBA 2AABL 1FPTH 3STZA 5ESVA 5JA9A 1JBJA 1JHKL 5IR1B 2R1WB 1CF8L 2FATL 4OCWH 2WLZA 3JTTB 2AAVA 4GBXB 4S2SA 1EJOL 4L8SB 4NYLB 3QXDB 3RZCC 3QDMD 4PY7B 4GRWB 4CNIB 4PIRF 2J8OA 1RI8A 5BQ7B 5DMJB 5JORA 2J1KA 1SQ2N 4Z7UB 4E41A 5JHDA 3MLUH 3WFHB 4YXLH 3EFFA 4K7PH 2J4WL 5CWSB 5KSAD 1MHPH 3CX5K 1JRHI 1OAXH 5DO2C 1KNOA 4KK6D 3P9MA 3VDCA 1NGZB 5MEND 2CLZA 2VQ1A 3QG6A 3LZFH 1JNLH 4M62L 1ED3B 1RZKC 2D4FA 3PGFH 4XWOC 1UT9A 1R3IH 1NCTA 1CCZA 4JM2C 3NPSB 1G9EA 3KDMB 4WO4D 5FYLL 1XIWA 4JVUA 4LBEB 1H0DA 4TOYL 2IANE 4N0FA 3G5YA 3SBWA 3VFTB 3SO3B 2O61A 2HLAB 2ICCA 3QG7H 3D3VE 3PGCA 3PWPA 1S9XB 4H8WL 5T3XD 4AEHL 4XPGL 2XQYK 4WW2B 5J13B 5GS3A 5IVNA 5FECB 1NFDE 4UIMB 1AGBB 3WFDH 5GXBB 4QRTA 32C2B 5FYJE 3FHAA 1NLDL 1K8IA 1T1XB 1K4DA 4PJAB 4YR6B 3GMNA 1DLFH 2AQ1A 4DGVH 5I1GH 3SKUD 4LCUA 2XA8L 3BJLA 3GHEH 2A6KA 4ELKA 3NFSL 2EDJA 3WNOA 4G6JH 4OZIB 5I1EH 2UYLB 2ICWJ 3WJJA 4JB9L 2F19H 4FNLL 1X4YA 4CL7A 2ZCKL 4ERSL 3B9KA 3DRTA 1KCRH 4HC1L 1FE8H 1M71B 2HFFB 1E6OL 1UM6H 3AB0C 5B22A 5BVJB 4KRPD 3UAJD 1NL0L 3X3GH 2DLTA 2MCPH 4GRWH 4CU7A 5HDQL 4MCZB 2QSTA 5I0DA 3W81A 3QIWD 5JNYA 5EU3B 1NCCH 3JV4B 5I6XB 1HSBB 8FABA 3DUUB 3BKCL 4EJ1C 3DPBA 1F00I 3EYSL 3MBXL 4IRSA 4KJYA 1BFVH 2FDBP 4UUJA 3MLZL 1U3HC 1KTDA 3QUZD 3LN5B 1PAMA 1AP2B 1JHLL 1UYWH 3I50L 3KR3H 4RCAA 1G7LA 1ZLUH 4HKBB 4KVCH 1I1FA 4GXVL 3U36A 4QRPB 4YXHH 1MCOH 4TUOB 2GSGA 2JELL 3O8XA 1CICD 3BMWA 1YY9D 1ES0B 5I76B 4JFXA 2GEEA 4HK0A 3VWJD 5C6TH 2YXMA 4HJJL 1XF4A 2X1OA 1MRFL 3AMLA 4FFVD 3MRMA 3HI6L 5EO1B 4J8RB 2CSPA 4KROB 3GKWL 1RZGA 5LQBH 3S5LB 3F65A 4CN4A 1G6RB 3MCLH 4M9OA 5B8CA 3WFZA 4BFBD 1W0YT 4JN1H 1H5BB 1HNFA 3LD8B 2DQJL 1P1ZB 5GSVB 1KGCE 4WRLA 5HHVL 4Z8FL 15C8H 2WP3O 3QUKB 5ITFA 5CEXA 5D5MB 4QTIH 1RUML 1T83A 1QPPA 3N50A 5TE4L 4PJCA 3O4OC 4IIQA 3V5DB 5TDPA 5SWZE 3I6GA 2H2PC 4I3SH 2RCSL 3GM0A 4G8IA 4OM0L 2WIMA 2YD2A 1HIMH 5FYKH 2FBJL 2LABA 12E8H 1S9YB 5A2IH 2E7BA 3RUGB 3O41B 3HPLA 5HTSA 3VFNA 3KPRA 2DF3A 3RGVD 1KENH 4FQ1H 4UU9A 2ADJA 1GGBL 4CMHB 4OZFB 1CDYA 4MS8C 4P59H 4P5MA 3SN6N 1G9MH 5IBTL 4FQXD 5C0AD 5J9PA 5GGUB 3GSUB 3MRPA 4KJWD 3KPPA 4MD5A 3TT1L 5ISZE 2Y07H 4L8CA 5DD3L 1DUYA 1ORQB 4N8CL 2ORBH 3OKLA 1MJJB 4PB0L 2VR4A 3GSVA 3GUTA 2MNUA 4KRLB 3CU7A 2CH8A 3F62A 2EEAA 5D7JB 1C5CL 2BNRA 3MNZB 2IFFH 3JWDL 4X98B 1J0ZA 2BVOA 4MQSB 1EZVY 1CLOL 3C5SA 1JVKA 1C12B 3FB7A 2HFTA 3T3PE 3WXWL 5L88H 3C87A 3RL1A 1FIEA 3GMMB 1QSZA 3DX8A 3F58H 5DJAA 1T04B 3D48R 1HKFA 2BVPB 3HE6A 5E8DH 4K9EC 1XF3B 2XG4A 3RDTC 1XCQB 4P2RB 3HNVL 1KLFA 2PTTA 1II4E 3HZKA 4ZG1A 1NJ9B 2DLHA 4I48B 1ULVA 1U8QA 1LK2B 4LLUA 1RUPH 2X4NB 1G6RH 3LV3A 4RGMB 3RWHA 1FCGA 5E2JA 1INQB 2CKBB 2G2RA 1IEAA 1R5IB 5KOMC 4RRPA 3HC3L 4IRJD 5EU6D 4ZNCD 4MQ7A 1WC7A 5B38A 5HYJE 3F7VB 4UTBH 1VACB 1K8DB 1L6ZA 4OLZL 4YBQC 5C08B 1YMMA 3S37X 4N9GB 3IVKB 4G6KH 3L7EA 1T3FA 2N4IA 5EFIB 2NYYC 2P8LB 4LLQB 1OT1A 3U30B 4HHAB 4OF0A 3QEHB 3PP4H 2UZXB 2X4QB 1OP5K 4UV7H 1ACZA 4OFYD 1F2QA 2VDRL 4OZFH 3UO1L 2YD4A 2KDGA 1EEUA 5F9OH 4GG6F 5TQ2L 4Q97A 5IWLA 3LS5H 1KN4H 3B9EA 3E6FB 3OJMB 3GSRA 1SY6A 3HZMB 3SDCD 1HILB 3RWJA 2DQDL 3DX6B 3OKDB 1I7TA 2C9AA 2ZG2A 4PGEB 3QXUA 4I18A 2A77L 5BS0D 1NC2A 2FRGP 5FYJU 2I07B 5CGTA 3MBED 4OBRA 2LTQB 1IE5A 1N6UA 4TQEH 2YPLD 1S7SB 2H3NA 3HNTL 1N6VA 5FOBB 4ALAL 5KANI 3AU1A 3TV3H 2AK4E 3WXVH 1Q9WA 3U7WL 1RZKL 4PJFA 4HUUB 1EMTL 1K5NB 5F1NB 3B9KC 1Q94A 2V7NA 1YC8A 3I75A 4DZ8B 5C0JA 5K9OA 3MV7B 3N1FC 1ZT7A 4OQTL 5HI3D 3DNKA 2UZIH 2HT2D 1WICA 3ILQC 3CLFH 3UC0L 3NVQA 5E94A 3D85A 1J10A 2W38A 1LE5B 4WV1B 5TDNA 1CE1L 3NZ8A 4HGWA 1QEWB 3C6LB 4TPRL 4R8WL 4NZRH 4JQVA 2DD8H 4PD4K 3I6LD 4IRSC 1YN7B 4ZMAT 4XPTH 1QFOA 4OCYH 3LEXB 4HK3J 3QEUB 1F11A 5FA3A 3UDWA 5EUOB 2CKBH 1JGVH 4XXCA 4DGYH 5DSCB 4PJDE 4P2OA 4ZODA 4F9LA 5IEHA 1MAKA 5CHNB 3TA3C 4J4PD 4KQ3L 4I2XE 4L4TA 1FNSL 4M1DH 5I74C 4X6DA 1HQ4A 1YEHL 2BNUA 1WBYB 1T7VA 2FIKB 5CGMA 2AJVL 1V5JA 3QA3A 1V8HA 2Y6SC 4MA7H 5IB3A 2ITCB 1I1RA 7FABH 5B8CC 4R96A 3MNWB 1LO3L 4JKPL 4QOKE 1CGWA 4LF3B 2WUCL 2VJXA 4H0GA 5A3ID 2Q8AH 5HI4D 1V7ML 1T1WB 4ZOAA 5HHPB 4ZFOB 2YA1A 4Y19A 5FYLD 3JV6B 1YNKH 2IF7A 4NWTH 4WU5B 1ZLSL 1DE4A 2UVEA 3O3EB 4RRPG 3SEPA 1RIVL 4U33A 2VXVH 3LPWA 1BBDH 4I5BB 5B38G 3IAQA 5EBLA 3SDAC 2NY3B 4NQDD 2NQCA 5B4MC 1BVLB 2Q86A 3TO4C 3SE4A 2DDQH 3NCYP 1E28B 3HR5B 3SO5A 2Y36L 3VXSB 1R24A 5HYQB 43C9A 2P24A 2X1WL 2A6DB 1D5MB 3AC0A 4GKOA 3H42H 3KPOB 4KGLA 2F74B 5C0NC 3C5ZB 4RNRB 1TQCC 3FMGH 4MSWA 1J5OL 2YPVL 1S7QB 3FQNB 1IKFH 2XZZA 4KV5E 1AO7A 4XB8A 5HHQA 1FGNH 1ZXQA 2N7BA 4C56A 4HXBL 1OF2A 3MRLA 4EBQH 3GMPA 2KL6A 2Z31B 2DWEB 2G60L 3MOQA 4NO0B 5DC9B 1ZA6B 2R0ZH 5E2VL 5DHVA 1MCLA 4XAWH 1FL6B 5KOVC 1T2JA 1OTUC 1KCVL 1EGJL 1JPGB 3FHQA 3BPLB 1EBPA 4RGOH 2R1XB 4TSAL 4U6YB 4LSSH 4HPOH 5ID1A 5F70A 1PZ5B 1TZGL 2HMID 5AZEH 3JUYA 3VFVB 1R3LB 4YFLI 1TJIL 3B9AA 5HVFB 3CVHL 1MCPL 1M7DA 4JPKL 3P3YA 2L4OA 3O6FC 3EOTH 2NY1D 2A6JA 5F7LB 3ZHLA 1A7QH 1D9KB 3DXAE 4EUPA 5KVEH 4FP8H 2VC2L 5ENWB 4N0UE 1XR9B 5I73B 3BH8B 3KPSE 4RMQA 2E7HA 5TPWL 1T66D 1AXTH 4NHCH 4F8TA 2VE6B 5D7LD 5TE7H 5DMIH 2HFGH 4P46B 4M93C 3ROOA 1ZHLA 4NFDA 1SMOA 3QEGH 3L7FA 5GISL 5CSZB 3D0LA 2BY1A 3UTTA 3KWWA 2QHRH 2CJUL 3IJSB 5DRZA 3LKQB 2GFBB 4H1LA 4GW5A 1IBGH 4Z7VE 5CJQL 5H94A 1EA9C 1OSPL 5EWIL 1CGXA 3QQ9D 2PXYA 1YYLL 4ODHL 5A2LH 2GAZA 2F8OA 1U8JA 4J1UB 3NAAL 3GM8A 5LWYL 1C5DA 1XH3B 4HF5L 1P2CB 3BDXA 4IOFD 2OR9H 4K9EL 4EXKA 5KZCD 2W0LA 1MQKH 4QRSB 1U8LB 4YWGH 1YEFH 2WQRA 3D39D 1S8DB 5GRUH 3OKOA 2LV4A 1U58A 1AI1H 1HHGB 4V1DE 4GKSB 1QVOA 1NSNL 2W9EH 4KKAC 3FZUC 5IUSA 4CDGC 3BKMH 2XTJE 3VD7A 4NM8H 3CX5J 4LSRH 1CDGA 2WV3A 1CLYL 3VFOB 1QKZH 5TH2B 1FLRL 1T1ZA 5HVHC 5FUCE 1UA6L 5CEZL 1KG0A 1NLBL 4ZO6A 4GRWE 3BW9B 4ELME 1SJEB 3L3OB 3KXFD 3IKCB 4D94A 1MREH 4Z7UE 3ARTA 5GSRA 3W39B 4JFQB 2R2BB 4RFOH 5JIHA 2BX5A 3WS6A 3CZFA 1KT2A 3EOYG 2C7UA 4QHNA 2VLJA 2P5WD 4WI8A 4A2LA 5JZ7D 3CXHK 5KSVA 1S7RA 4G8GE 3V6FB 1RVFH 4XXCC 4Y4FC 2WSKA 1IKNC 1OT2A 3MCG1 1AGCB 5C9JA 3QULB 3HZVA 1UWEL 4BFEA 4K3DH 4XNUH 1JFQL 5JA8B 5ALCL 4HG4J 2NLJA 4XPAL 2ESVB 4XRCB 5GZND 4JJ5A 1KCKA 1A7BA 4JFDA 2CDFA 4RMSA 1A9EB 3I3DA 4AJ0A 4L4VD 3T0BA 1N4XH 3UTQA 4G8EA 5HYFA 3V8CA 4WFEE 5E2UL 4XBEH 1P4BH 1ZA3B 5A2KH 4M00A 3Q1SH 1MHCB 2BNQB 3OB0K 5KN5B 1OW0C 1RHFA 1W0WA 2P42B 3G6AB 5D2LF 5MERA 4R9HA 4XVJL 3L5WB 3T1FA 4KH2A 4NO2A 5I71C 4PJAE 1S7TA 1SYSA 2GQHA 5T5NG 1U3ZA 4LIQH 1WBXA 1MFBL 3WBDA 5GGSY 1FDLH 1JGEA 3RZCD 4ORGB 4AEEA 2HWZL 2G9HA 1H3VA 4WWKA 5FIEA 5DWUH 3B2UC 5IJKA 1LNUB 4WTXA 2F15A 1KB5L 2AJXL 3VFSB 1HH9B 1YY8B 3RWCB 4FTVA 5IROA 3GI8L 3TPUA 5C07D 4HIJA 5DO2D 2OYPA 4YHYC 3QJFA 4OAWA 4U4BA 4M3JA 2VZ3A 1LDPH 4Y4KC 3ZDXE 1BAFL 4URTB 3SDDC 2X9YA 3CH8A 1SEBB 1MCRA 3L3DB 2CQVA 5FK9A 4XWOD 3PIQA 4WI4A 3TM6A 4JM2D 3M1BA 3FQUA 4K3JL 5F6IC 2DYPB 3QNYA 4NCC1 3LQAC 1I1AA 2DQUL 3SGJC 3Q6FB 3DIFB 1XGPB 3CH1B 1QQDA 4EZMA 3NIGF 4U7SA 5JW4M 3WL9A 1U8OB 2FH6A 3P4NA 1HYSC 5C2BL 3KPLA 1P5VA 1JUFA 4MVBC 2A1WH 3ZYJA 1HHHA 1QD0A 4GUPB 1RSFA 3W0WB 3HUJF 1VFUA 3K46A 1HZHH 4U7KA 1P4IH 3QIUC 3IU3B 5E70A 4DVRL 3IXAA 4CADA 2FZ3B 1NDMA 4MNHA 4OCLC 1EEZB 5D5ME 4K2UH 1B4JL 4OQ1A 4S1DC 1ZGLP 3FQWB 4NRXB 5L7XH 2YSSA 3HHRB 4EI5B 1LO0L 4YGVB 3IFOB 3IS1X 1QA9B 2P8PB 4OLWH 6FABH 3QXVA 2VZTA 3QJHB 2PW2B 4X6CB 3RUGE 4U0RC 3NN8A 5IEKA 3DHJA 3TEUA 1HNGA 5F71A 1WAAA 1RJCA 4MQXC 4A6YB 4NNXA 4OCXL 4YDLB 4JFEB 3VFRA 4BZ1H 1KIPA 2FLRT 3H9SB 4HZLB 1VGKA 3ARBA 4QTHB 3T2NH 2ADGA 1FSKC 1HQRB 4GO6B 4G6FB 1NMBL 1AXSB 5HDBF 2XZQH 2GJZB 2YD5A 5E8EA 4Q9BA 1KFAL 5IVXF 4HT1H 1U3HD 5JOFB 1A3LH 3CFEB 3SGDH 1OM3H 3JXAA 3V6ZA 1Q9LB 4MDJA 1MCDA 4YHPA 1NBYB 3VXME 2OS7A 1W72A 3E8UH 5ESAB 4TSCL 2MMXA 4YNYA 5I1DB 4OCRL 2AJYH 2BFVH 2Z4QA 4ZFGL 2EE3A 3MJ8A 4BJLA 3PE9A 3MV11 2VLKB 2H1PH 4XHQA 4ZO9A 3PP3K 3CFBA 4RWHA 2VKXA 3QAZC 1HH6A 1XF2B 2Z92A 2YEZB 1FFOA 4X6BA 4U1IB 2OJEA 1TPXC 1YEGH 2CIIA 3A6CH 3VXTA 3HKFA 1MF2L 3QDAA 2IC2A 4FQQB 4OUOA 5F97E 3X13B 3OF6A 4OB5L 4GAGH 3RJDA 5DEGA 2X4RA 4EN3A 1CD9B 3QDGB 4WDIA 3TVMC 3V0WL 5FM8A 2X4OB 3VXRA 1JE6A 3ET9F 4JG1H 2H2PD 1GJIA 1UJ3B 3WS6C 3C09B 3FQTA 1K4CB 2BVTA 2GK0B 1IZKA 1KPUB 1N5AB 4ZXBB 1NFKA 4OIBA 3ARFC 1IAKA 4XCYB 3DVGB 1NEZA 1QRKA 3LMJH 5JXEA 1T7YA 4XCFH 1A1MA 2EH8L 4OF6A 4OFDA 1QR1B 2VIRB 3T4YB 3L5IA 2C3HA 5D96C 4O9HH 4FQHA 3LPGA 3CVIL 2NTSP 3KYAA 2X7LA 4NBXB 4WUKL 4MS8D 1A4KB 5GRWA 4GW1B 1GIGH 3G6JF 2PTVA 4KKCC 1R3KA 4HS8L 5FFLA 1MIEH 4OT1H 5C3TA 5D1QA 4KHXH 2X05A 5I66A 1OTTC 3FQRA 3VDBA 3BISA 4PJXF 3OGCB 2RFXA 4FFWC 4A6YH 3O6ML 4PRHA 4W6XB 5E8PA 3S36X 4JDVB 5CUSL 1A7RL 4HWBH 3C6SB 2YD1A 2XWJA 3DLQR 5DUBA 3TBVB 3FCTB 4P2QA 4UILH 3EYUL 4I3GA 1P84K 4JHAH 1A3RH 2W0KA 1H3PL 5M94B 4JKWA 4PR5B 5D7IA 1CG9A 1UADC 1D5BB 5DJCA 2R2CA 1Z5LB 1SJVA 1DBKL 2EECA 4IMKA 1LK3H 1WTLA 1CQYA 1LE9A 1FORH 1UM4H 4OV5B 1FP5A 1MCEA 2NX5E 4PD4J 4C83A 3D0VA 2R2EB 3PGDA 4DTGH 1JN6A 2CLRA 4OKVB 3RDTD 4E0RA 1RZ7H 4YBLB 5JHDD 5KTEH 5D7KD 1TCMA 4GQ9L 4TULL 3MV7E 2D31B 3GSXB 3U9PL 5IROC 1PSKL 5FKPA 4U0QB 4Y8AA 2CO7B 5MEQB 4NT6B 4U1SB 5E1AB 2IQ9H 2EKSB 1FBIH 3O81A 1KIQA 2AEQL 4ZAKA 1FO0B 5L0QC 5BZDB 5CEZD 5F7NC 3D6GA 3SPVA 3QDMB 3ARYA 2E8YA 1JWMB 3EGSA 4ODWB 3HRPA 4YBQD 4MNQA 5DGRA 4R0LA 3FB6B 5EUOE 1DQTA 2NYYD 5BMFH 1B2WL 4YEFA 4UDUB 3IDIA 2Y06L 4L8BB 4HUXA 1K9TA 3PWPD 3BGFB 1QSEE 3DTXA 4MAUL 1XGUB 2QR0B 3LEYH 3MRFB 4JFFD 5INCB 4GW4A 4HKXA 1A7NH 1HN1A 4WGVB 2Y23A 5MENB 2JJWA 3UTPD 1V05A 1RJZA 5GGSA 1G7PA 3L5HA 2E6QA 3X11A 1KIUA 3WN5A 2BVQA 4ODTH 4IRZL 1SM3L 1GGYA 2BSED 5DFWH 4WO4B 2PCPA 2VXTH 1DBJL 2DQIH 5IMMB 1DFBL 1A6TA 2DBLL 3G6DH 3H7BA 1F4AA 4R3SA 5GGTL 1A2YB 1ZLWH 1I9RL 5E2TL 3MA7A 4CW1B 4M5ZH 1G7QA 4PRNB 3H9ZA 4NUGH 4WFHE 3MRIB 2A83B 3HI1A 2C3VB 3B9KD 1CTNA 3L3JB 5AAMA 2VLLA 5DK0A 3FRUA 4ODVL 1I3RA 2DL2A 3GDBA 3LQAL 3ILQD 4YFLF 4WFGD 3UPAA 5MHSD 5HGAA 5BW7C 1IC5L 2YMXH 3VXSE 1VEPA 4D9LL 2AKRB 2OL3B 5DHXB 5D1XA 4LLDA 4HJGB 2DIBA 4R7DB 1I4FA 4IRSD 1PG7X 1X4ZA 4I0PA 2BXZA 2F9BT 4KI5D 4F2MA 4OD1L 4OLUL 5C0GA 4FZ8H 5SV4A 3WFBL 2V5RA 1U8NB 1CGTA 2J6EA 1YEEL 1F02I 4LARH 2EDLA 1FO0H 2ZWLT 4PY8I 3TA3D 3TIEB 4KRPB 1JF1B 5FXCH 3WHE0 2WWKT 5SV3A 1IEBA 4L8DB 1K2DA 3REWA 4RA3A 4NO3A 1H3WM 3S88H 1DL7L 3I3BA 1IM9A 1AD9A 3FO0H 3NABL 2HN7B 4OFKA 4DEPB 3NCYS 3QIWB 4OD3L 1IGFH 2Y6SD 2BY0A 3OTTA 5EU7E 1J12A 1SJHA 4U1MB 3RY6C 1HKLL 3RWGB 5BJTB 1FVCB 3QUZB 2L7JA 1ZEAL 5HSFA 5M95B 5EOCL 4DZBA 5DRNB 3ES6A 1YN6B 5TF0A 3MRCA 4LSUH 3V0AC 1U8MA 1CICB 3OKEA 1TJGL 2EH7L 3RY4A 3NZHH 3V95A 1LEIA 3DO7A 3VWJB 3UJTL 4WFFD 4Y5XA 2R2HB 1QBBA 5FUOH 1P7KB 4ZUSB 5EOQL 5FF6B 4QHMB 2IH3A 3SDAD 2FGWH 4LLYA 1K85A 5B4MD 3BGMB 3KPRD 1VCAA 5F7FA 4KHTL 4WEMB 2HRPH 4R2GC 4M7ZB 5JMRA 4F58H 4OF8A 5C1MB 5T3XH 4LFHD 3WIIL 3NBNA 1A14L 3ZKQD 1Z9MA 4OZGA 4EI6A 2DQTH 3IJHA 2FECI 4HBCH 5EN2B 4I0KA 5C0ND 1CZ8H 2V2TA 1A0QH 5GJTL 4NQCA 3I3EA 1UZ6F 2DJUA 2OL3H 43CAB 5E1HB 2Y7QB 3RGVB 3B6SA 2B4CC 4OGXH 4X9BA 1OTUD 2FJGB 4U7MA 3K7UA 2XZCL 4M6OL 2OTUA 4LIQE 3MUY1 4BSJA 1OD9A 1AY1L 4IMKC 4FQXB 5C0AB 2NXZC 4WGWB 4NRYA 1FVDB 4LPVA 3BMVA 1BM3H 3DMMA 3TWCH 3TT3L 4F7MA 3HE6D 1ZHNB 1RUQL 3N9GL 3ZKNC 4Y88A 4JO2L 2JJSC 3MROB 1LMKA 1S7VB 3T4AA 1LEGB 5SX4H 5FGRA 3DRQA 4HFUH 5E8NA 3CMOL 2PYED 3NA9H 1DDHB 2V9TA 3VRJA 3O6FD 4KTDL 4RFNC 3QUMB 5C0FB 4OTXH 3NACL 1RK0A 4Y5YC 4IOIB 1KOAA 5I16A 3QYCA 1J8HA 3VFPB 4B5EA 3VFMB 3QWQB 5BZWA 5A2JH 1IGCL 4PTUB 1PFCA 3TNMB 3GO1H 3V5HA 3WIHH 4X7SH 4PJDF 1EUTA 4YX2H 2X4SA 5E03A 1JPFB 1NKRA 5MEPB 3A67L 4ZD3L 8CGTA 3BDYH 3ZT5A 3SOBL 5J1AA 3QUXA 1YMMD 3GI9H 3MUZ1 3FO9A 1L7TL 4AEIH 3BT2H 1T6VN 2W60B 1G9NC 5BXFB 1G6VK 3T09A 5BOZG 1N2RA 1TQBB 5KVDH 2XRAL 1GGIH 1OHQA 3E2HC 3S4SG 2ESVE 2BHUA 1A6ZA 3PDGA 3F5WB 4WNQB 4IRJB 5EU6B 1BJ8A 2WIIA 3CPLA 1L4IA 2Z93B 3FB5A 3G5XB 3LN9A 3MUHL 4PREB 4YHIA 4GAJL 5FHAL 1N6QH 5SWQA 4OD2B 5LXGL 4ONFL 4M6AA 3BI9X 4NN5C 5ICZB 4KKAD 3FZUD 1ZT4A 4UT6H 2D9QB 3MREA 1VFBB 4FXKB 2GJJA 1B3JA 5GGQH 1OAYH 1WQVT 4KMTL 5T33H 4CVXB 3BPCB 2VISA 1MI5A 4M1CC 5D2LA 1MHEB 1F8TL 4B0MM 2OZ4H 3T0WA 5IW1A 2WMPA 3ZE2F 4F7TA 1OP3K 4YDJB 3IRPX 3OR7A 3SDCB 1FZJB 3HNSL 4UV4H 1EEYA 3J8F7 5HYSG 4KDTC 4MXQC 5BS0B 4Y19E 3VG0H 1KB9J 3MBEB 2EDDA 4A2MA 2ZCHH 2WNGA 2YPLB 4YUEL 3QUMH 3JWNC 3CLEH 4D9QD 4TSBL 4LKCA 5DD6A 4Q0XH 4YHZL 3MGTA 1AC6A 1FL3B 4Y4FD 1RFDH 3UZEA 3T77A 5ADPL 1FZMB 1AIFB 5C09A 2Q6WA 4L4TD 2B0SL 5FO9B 5DMKA 5I75B 5I8OL 3LS4H 2LVEA 4DWHA 4JJHA 1QYGH 2VLRA 3S98A 3QCTL 4BUGA 2Y9RT 2XWTB 1M4KA 4P9MH 2Q76B 2XFXB 5B39A 3KJ4C 4YO0A 3PL6C 1RU9L 4X0KA 2R23A 5FDYA 4LVNB 4F15C 2ARJA 4LPTA 1Z6JT 5HHOA 2Q8BH 1EHLL 4Y19D 1RZJH 4QCIA 1H8OA 3UROR 1CGSH 5BO1H 5DMYA 1CTOA 3LVEA 5KAQF 4Y5XC 2JK5B 1T0PB 4LQFL 2ZUQC 1BJMA 3QO0B 3KYKH 1T4KA 2R0WH 3CDYA 4JY6A 4U1NB 4UDTB 3DETC 1D5ZB 1LHZA 1RIUL 4H0IA 1YPZE 4Y89A 5CD3A 4RDQG 2GUOB 4Z7VF 5DRXB 3NCCB 5C0IA 3MX0A 3T0VA 3RBSA 3B2UD 2NY4C 3RI5F 1EH9A 1KACB 1F42A 2ITDA 1KBGH 3WNNA 3MZGB 4LPUA 4MAYA 4X6CE 2VL5B 3G04A 3STLA 5E99H 5L2JA 1MFEH 4MJID 3EO9H 4JFEE 4P9HL 2NW3A 5EO9A 3ZL4L 4GT7A 1P6FA 3UJJH 4Y4KD 1X6NA 1Q72H 1AQDB 1M7XA 4XCEA 4GMTH 2FLBT 4NQDB 3UTSA 1ZOXA 3ARGA 3R1GL 3MLRH 3QXAB 2EDKA 3DECA 3TJEL 4AG4H 5CMAB 4JZJA 1HXYB 5F89B 5IIEB 4CVUA 3QWRA 2Y4SA 1MOEA 1I8KA 1F3JB 2ICEA 2ZSVA 1OAQH 3LDBB 3TIDA 1UXWB 1JZ2A 3OJ2C 1HYSD 2RGSA 3HE7C 4ELMF 4HWZA 5EBMB 1YEJL 2Z8VC 4ZUUB 2IPTH 4H26A 2DQEL 4MVBD 2AABH 2VLKE 3QZWB 3D18A 1JHKH 2NR6C 1YNTB 3BP7B 3O45B 3EYOA 2DOCA 5E6IA 1INEH 1CF8H 2FATH 4ZOBA 3FB8B 4LSVL 3QIUD 4NKMB 4BK5A 5KSBA 4LKXB 1ZT1A 1TITA 3NFNA 5DS8B 2AEWA 3C5JB 1TCRA 2CGRL 5HPOA 5A2FA 3QDGE 4U1LA 4S1DD 5ELIA 4AIZB 1RIHL 4BELD 4Q9RL 2GSIB 3BUTA 5FO7B 3SJVD 3C9NB 1ITCA 2W0FB 3P4MA 3PHOA 2J4WH 4NQED 5MI0C 4LFHG 5IV2A 5AYUL 2B4CL 3VJ6A 2ZNXA 1QLRA 3LKNB 2NY1B 1C7TA 4RWYL 4MQXD 1MLCA 4QNPF 5E8OA 5FA4B 3MV9A 1ORSA 4M62H 4HS6B 1BOGB 2ID5A 4J3SA 2H41A 4NIKB 2IANA 1DQJA 4AL8L 2IAMA 1URLA 3CDGB 1E27A 4M8QA 5FYLH 2R69L 3K2UL 3DVFA 4Y16C 4TOYH 2HLFC 4DUVA 1EHAA 1NFDA 1JWSB 1Y6MR 4PJIB 2NCMA 4H8WH 4S0TD 4AEHH 5E7FA 1Z3GL 4XPGH 3CFKB 1JHTB 4ZDHA 4MD0B 1CE6B 2ICWI 4ODBD 4XGZB 4LLWA 2DLIA 1AHWC 5I1CL 4R4NC 5IKCB 2YD8A 3O2WL 3HS0A 2EDTA 1NLDH 2VZSA 4R6UA 3SKOB 3BEVA 4YZFE 3TH2T 4G8FA 5E5RB 5KZCB 3D39B 3Q48A 1S7UB 4MB3A 3GBLA 1A1NB 1G9NL 2CKNA 2XA8H 4Z7WB 3WUWB 3EYVB 1J1OH 3NFSH 5CAYB 3S96B 3TVMD 4GXUN 1EIBA 3ZDXF 4P4RA 1FFQA 4JB9H 4FNLH 1N59A 2W9LA 2ZCKH 4KMLB 4ERSH 3ARFD 1I7RB 1E6OH 4QRRB 3FT2A 1NL0H 5ANMB 2FL5B 2FGZA 1MHHB 2CRMA 2E9JA 4HUWA 5HDQH 3IAGC 5D71L 3QDME 4JN2B 2BVEA 4PJ8A 4M7KH 3LCYA 1JPTL 1P53A 3UZVB 1X5FA 3UYRL 3KXFB 3BKCH 4EDXB 4UBDD 5FOJA 2ATKA 4KKCD 1FAIL 1CQKA 3EYSH 3MBXH 4PV9A 5IBUB 4O5LL 5DJXA 3TO2B 4DKDC 5ID0B 4MD4A 2BVYA 1OTTD 4F7EB 1HOCA 3BN3B 4NWUL 3TZVA 4FFWD 3BP4A 4GXVH 4N8VB 2DWDB 2VITB 1AFVL 4P23A 2P5WB 3QQNA 3O2DL 4X8JA 2JELH 1EVUA 5MENE 5K9QG 4HJJH 4HH9A 4RSVA 5I30L 4XTRC 1S9VB 3MLWL 2H26B 3HI6H 5CZKA 3BE1L 4MWFA 4JZOA 1WWWX 1SBSL 3GKWH 25C8L 1KELL 4XP4L 4Y2DA 1KLGA 2X1QA 4U6XB 4D2NA 1QO3A 3UYOD 4H88L 2YXFA 3WKML 1OAZL 5L8JB 1QFPA 2NY5C 2JE8A 2WBJA 5SWZA 3RUGF 2DQJH 4FFYH 2J8UF 5IHBA 4L4VB 1JMZA 4APQA 4NOFA 1T0MA 3EDDA 2J6EL 4L9LC 1Z9LA 1KEML 1RUMH 3U0PB 3P4OA 2DI8A 1EEQA 5T3XE 5TE4H 3S34L 2RCSH 1XGRA 3EO1B 3F8UB 1I85C 1RHHA 2FBJH 2NXYC 3N1PC 1UB6B 5K9KB 1KC5L 1BOYA 2DM2A 5DD1L 4ZS6D 1CXIA 2YUWA 4QRQA 3GB7B 3SKJL 5D2NC 1GGBH 2FNBA 2WLYA 5DUML 5LBSL 2A73B 4OIAA 3KPMA 3LRHA 2VABA 5ISZA 4CAGA 5IBTH 3RZCB 5JW5B 5A43C 1ZE3C 4PJ9A 3MRKB 3EOAA 3FFCB 3A6OA 2QSCL 3IJYA 4WW1B 1JP5A 5TJWK 4MMZC 4R7NA 2P49B 3R8BB 3LH2L 1SHMA 3TT1H 3LKOB 5IMLB 5DD3H 3LQZB 3VU2A 3SQOH 4N8CH 4S1SL 4FXGA 1NCAH 4M3KB 5C07B 4Z7OF 3I9GL 4PB0H 4RFEB 3IDGA 3KS0H 3RI5K 4NO5A 2ZOLB 1PG7W 5D6DA 3SKNB 3MRJB 1C5CH 1RURL 1U93A 3U2SA 3VE0A 2H6PB 2V2XA 1CLOH 4LASL 1TVHB 2HJFB 4GLRI 4MJ5A 5F3BB 2J2ZA 1T0NB 4JM2B 5GHWL 2X9XA 5DJZB 2HFEA 1NGQL 4X5WA 2BRRL 1F13A 2ZPKL 4B41A 3FFDA 2H8PB 4AIOA 3CFDA 3HNVH 4N68A 3TBTA 1D5IL 4JO4L 1PYWB 1BX2A 4KJQC 4Y5VA 2AEPL 3OXSB 3KPNA 1JRHL 1A7OH 3K8MA 2OTWB 4L29A 5TQ0L 5K59E 3HC3H 2IPKB 4FQ2L 3QIBC 3I02B 1TZIB 4RMTA 4YK4C 3GMRA 4OLZH 2D4DA 3RWEA 5GIRB 1HHKA 1Z0NA 2IAMC 4OFVA 3M8OL 4N5UA 2V5TA 4KY1H 1FYTD 4CJ1A 1A6PA 2HVJA 4I9WD 5H2BB 3LKRB 1JZ5A 4EDWL 2A9ML 3VWKC 3BZDA 1Q0YL 5JDSB 3OQ3B 4YDIL 3F7YB 1CFVL 1F4YL 1ZWIA 2VDRH 3AB0B 3AGVA 5DQJA 3T0EC 4X5XB 3NIDE 5TQ2H 1AGFA 3B8SA 5HYIA 2XI9A 4S11A 5C0AE 5DF0A 1DVFC 1U8KB 1DQQB 2UWEF 5F7WC 2DQDH 4OLXL 3BZ4B 3RU8L 1VPOL 2AK4A 1KLUA 1U3HB 2A77H 3P9LB 1DUZB 4NBZB 4Q6YA 3GHBL 2K3TA 1QACA 4CMMB 4PLOB 2FH8A 3D69A 3GGWB 3HNTH 1H3XA 1FJ1B 3P11H 3GKZA 3U7WH 1RZKH 1BFTA 1J05B 3RA7L 5I8EA 3PJSA 2OQJB 2MKWA 4Y1AD 2ZUXA 2IMMA 2DQHL 3QHZL 4OQTH 4PLKC 5EIVA 2E7LA 3VRIA 2F58H 2GT9A 4R2GD 4PJ8C 3DX7A 1CE1H 2ZCLH 2XYCA 4U2YA 4TPRH 1DJSA 2Y5TA 2OM5A 5EU4B 2FO1A 2FIRT 3EYQD 3PNWB 1B0RA 1P5UA 4DVBB 1VADB 1I3GL 3BIBX 3O4OB 4U1KB 5ETUB 5EU5A 2X2YA 2I60L 4I2XA 3NH7L 5F7MC 3TZVC 1QSVA 1X3DA 2BVUA 4Z78A 1NDGB 4NBYB 4LLMA 5F96L 1MUJB 1EAPA 4JQXA 4AH2A 1JWUB 1TMCB 4P2QD 4PJGF 5EU6E 1ZHBA 4KQ3H 3TCXA 4ZOEA 1FNSH 3RWDA 3ZDZE 2X09A 3CVHB 4QOKA 2AJVH 2XKSA 1FV1A 2HRLA 1TXKA 2OTPA 4C56E 2BP3A 3CFJB 3QRGL 1CFNB 3EYFB 3MRNA 2C3XA 2NXZD 3QI9C 1H9VA 1GHFL 1XFPA 1LO3H 3FOMB 4JKPH 3NMEA 1RK1A 4LVEA 2GIYA 4RIRA 2WUCH 1BQSA 1BQHA 4UZGA 2V7HA 4FQJH 1NBZB 2JB5L 4NKDB 4DK3A 1YNLL 3IFLL 2M8XA 2OCFD 2ZNWA 4LCYB 3S4SB 3ZKMC 1GOHA 2EIZA 4HXAH 1DBAH 1D7FA 1CI5A 4XZUB 1ZLSH 4K23L 5MEOB 4OLVL 4XVTL 1S5IH 1A3QA 5DFVC 4LEXL 3GJFB 1OD7A 4Q2ZA 3LOWA 4Z5RB 2VUYA 1KJ3L 4U3HA 5HHXL 5CBAA 5BS0E 5I2IA 3WS3B 2AXGA 2Y36H 2YPLE 4PJ9C 1QUNA 3EDJA 4HWEL 4X9HA 2PYFA 4Q9QL 3RDTB 4WWID 4F33B 5H35A 4GSDL 3KLSA 1KJ2L 1RZFL 3O3BA 3OZ9L 4KKNA 1J5OH 5IB2B 1V3JA 1U8IB 3U1SL 2YPVH 3UP1A 5HGHB 4PJBB 1CDIA 4RGNC 3UTTE 3T8XB 4M7JL 4N0RA 3VW3H 2NY5L 2G60H 4JY4A 1FL5B 4J3TA 4D9RE 5HYSB 3G08A 5ESQA 1TJHL 4PG9A 5D6DC 5E2VH 2IGFL 1P9MC 4MHHI 4NQXB 1QLFB 2QQNH 2JCCF 2HVKA 4AYFA 1KCVH 1YEKH 2XNAA 5GS1A 1EGJH 2P5ED 5FUZL 5T1KD 3PUCA 1CR9H 3RNKA 2VB5A 3IXTB 3VXPA 4XVUC 4TSAH 3IDNB 3V7MA 2MTPA 4JGMA 2HJKB 5C0DA 2V2WA 1NGYA 4DW2L 1Y18A 1TZGH 3DXAA 1IGYB 1IILE 4N0UA 3KPSA 3QQ4B 3PGCB 3PWPB 3ARXA 3CVHH 1IC7L 1MCPH 4JPKH 3RWIA 3KYOB 1D6EB 4JFFB 5FM4A 5SWSD 4NQSB 5C6PB 4M1CD 1VDGA 4U2ZA 3U83A 2VC2H 3LAFA 4UMGA 1MFDL 3BO8B 3O3AB 5FO8A 1KPRA 5TPWH 2Z8WC 3CGTA 4ONGH 3BFOA 4PG2C 4PTTB 4M7LL 2BK8A 2FX7L 1KYOJ 2XWBA 4HIIA 2AV7B 1GGTA 2OJZL 4HQQL 5IOPA 3OXRA 5KS9F 4MXQD 4LCUB 5ICXB 2EDXA 5GISH 4Z7VA 4GQPH 4XNMB 4RMUA 3O9WA 5I1JH 4JZNA 2F53D 3B2VL 2CJUH 4WCYL 5D1ZC 3U0TB 2E7CA 3OPZL 3FT4B 1DN0B 1SYVA 2BSTB 3GJFH 3EHBC 1XZ0B 5CJQH 1LGVA 3BWAB 2BOBB 3B9KB 3TBSB 2AP2A 2X89A 2FB4H 5F9JB 3MUJA 4WHTA 3RVXC 2ED9A 4ODHH 5F7DB 2ZUVA 3NAAH 4NQDE 5F88A 5LWYH 3VI3F 5C0EB 1JGLH 4HF5H 1EXUB 3CK0L 4E42A 4V1DA 1LO4H 3P73A 1M05A 4K9EH 1IGJA 4M03A 1UWGL 1IGTA 3K1KC 3B43A 3RVUC 1MSPA 4HLJA 4IRSB 2HH0L 5GS2D 2EC9U 4LCCA 5IR1A 3PL6D 1BBJB 1NSNH 2R1WA 5I1IL 3JTTA 4GBXA 3QSKB 4L8SA 4HWUA 4NYLA 2A9NL 1X5GA 5I1AB 3QXDA 3AAZB 1GRWA 4PY7A 1CLYH 4CNIA 1KB5B 3TA3B 4N0YL 5BQ7A 5I17B 1UA6H 5CEZH 5DVOA 3D2UD 4NZTL 5GPRA 4Z7UA 3ULSA 5I74B 1BJ1H 5C0BE 3WFHA 2C26A 2B39A 3DETD 2E7LC 4OCSL 5LAXB 5CWSA 4JHWL 1KTLB 3VMPA 3HLAA 3GMLB 4JEGB 2UUDH 4DFHA 3D25A 3W2DL 5B8CB 2WK2A 1G7IB 3KJ6L 2WBWB 3MXVL 3R06B 2NY4D 5GS0C 3VRLF 2F5AL 2AGJL 5FYJL 3MLVL 4MZ2A 3WJLC 4J3WA 5FCUL 2EDOA 3ARDC 3V9FA 4I3RL 3KDMA 1T80A 1EDQA 2DAVA 5I15L 4LBEA 1IL1A 1UWEH 4X7TB 1JFQH 5IG7B 3SDAB 3VFTA 5ALCH 1YMHA 2HLAA 4O2EB 5CILH 3KPRB 1KTKE 3TO4B 2CR6A 3D87B 4WW2A 2NY0C 3UBXB 4P3CL 2AK1H 5FECA 3NCBB 1P4LB 5EUKB 4UIMA 4MXWL 4PJIE 1AGBA 2ARJQ 3DMMD 3Q5TA 2DTML 32C2A 3AUVA 3GRWL 4MD5B 4WENB 4Z0BL 1T1XA 4PJAA 4YR6A 5F1OB 1TQCB 3UJIL 2BOCA 2R8SL 1DUYB 4ZUWB 4UT9L 1VFMA 4XVJH 3OKLB 1WEJH 4YEEA 1EO8H 5FGSA 3THML 3GUTB 2NR6D 1FNEB 3EJZC 3QQ3B 3E3QE 1CT8B 2DKUA 3S3SA 2E7MA 3D39E 2BSRB 1J1XL 1MFBH 4MJ4A 1WFNA 4JCLA 5HVWA 3CJJA 2RQ8A 4Z7WE 1DEEB 1T22B 3FB7B 1VA9A 1GSMA 5F7EL 1IC1A 1JYNA 5GGVL 2D7TL 2XG5A 3P4LA 1M71A 2HWZH 2HFFA 3A6BH 3O2VL 1BLNB 1ZLVK 1NFIB 2X4UB 1KB5H 2AJXH 4OCMC 4MCZA 1SVZA 4J3XA 1CD8A 4QRRE 5EU3A 3JV4A 1HSBA 5KSAC 5ANME 1T89C 3DUUA 5CJXC 2DQFB 5CD5C 2PYEB 2O5XL 2QSVA 3O6FB 3S36L 2VQUA 3LN5A 1AP2A 4NCDA 5JTWA 1BZ7B 1E4WH 1RUKL 3V0VB 1BAFH 4HKBA 3KXFE 4HAFA 3KYNB 1IEAB 4X9FA 3K74B 4TUOA 3V7AG 1OQXA 4FABL 4K3JH 1ES0A 3BD4A 5I76A 5GS1C 2DQUH 4M93B 1YJDC 1F4XH 2Z8SA 4O02H 4Z7NE 5C9KA 2P5WE 3CSYA 5DT1L 1YMMB 2HLFD 3S5LA 1UM5H 5L8KB 1Q9KB 2H32B 3C2AL 5C2BH 1NEUA 1G6RA 1YPZF 3AROA 1H5BA 3EZJB 1P1ZA 5GSVA 4AIXA 1T1YB 1MRCL 3QUKA 5K9JL 2CDGB 4R4ND 5D5MA 4XWGL 1JZ4A 2VDLL 1WWAX 3V5DA 3B3IB 4DVRH 3GSRB 2E9IA 4L4VE 3VDAA 4QXUL 1E4KA 4UQ2A 3W5MA 1B4JH 3QDJD 1MPAL 3FAXA 2GHWB 3RUGA 3O41A 3RZWA 2QKIB 4ZS7L 2JF1A 4Z95H 2YN3A 1XF1A 3MRQB 4OZFA 5DD0H 4LK4A 3I6KB 1MIML 35C8H 2CDEA 4EIGB 4PJFB 2Z9TA 1A6WL 5GGUA 3GSUA 3K1DA 5HVHB 1PGRB 4OCXH 3UAJC 1QPXA 4M4RA 3VXRE 5HGGS 3I75B 1U2CA 3QHFL 1I8LA 4U1HB 3ECBA 4ZNEE 1MEXL 1ZT7B 4XC3H 1SEQL 1NMBH 4EQ3A 1F58L 1ORQA 3FFCE 1T03H 3TYGL 1L7IL 3WDJA 3G5VB 1KFAH 1MJJA 5C8JB 2VLRD 3VXMA 5DMGC 2XTJC 1ZSDB 2GITB 5D7JA 3MNZA 5D6CB 3WHXB 4X98A 4LCCC 4YIQB 4NRZB 4JRXE 5C07E 1C12A 1WWCA 3GMMA 4TSCH 5HHOD 2FEEI 4Y4FB 2L7UA 4NDMB 1T04A 4XTRD 1FGVL 4OCRH 2BVPA 4BKLA 1MCNA 3MFGB 4ZFGH 4PV8A 1XF3A 3CC5B 3B5HA 4PGCA 3L3KB 4L4TB 1WV7T 3U7YL 1XCQA 4JGUA 5HHMD 5E4EC 4P2RA 4HIEB 4JLRB 1FCCA 5D8JH 1LD9B 1NJ9A 4XNXL 5BCAA 2H9GB 2H32H 1LK2A 4W4NA 1IRAY 2XZAH 2X4NA 3NCJL 4OB5H 4QGYA 4UQ3B 4GKNB 2ED7A 5ITBL 4RX4D 3V0WH 1INQA 2XICA 2CKBA 1VERA 1JZ6A 1I7UB 1IAIM 1R5IA 3DUSB 4JFOB 4QY8B 1I8IB 3F7VA 1VACA 2ZJSL 5IB5B 1K8DA 2NXYD 3BVNB 1GZQB 2EH8H 4HPYH 5I71B 4N9GA 1YEIH 3BQUC 4L3ED 1BVZA 2C4FU 3JZ7A 2P8LA 4LLQA 1JJUA 4HEPG 4HHAA 1KUMA 4U1JA 2HJLA 5FGBA 3QEHA 4WUKH 2Z35B 4NN6C 1UG9A 3UTSD 2EYTB 4M7LT 4HS8H 3S5LG 1V3KA 4HIHB 3ARSA 4U1GC 3E6FA 4MX7B 3CX2A 1A5FL 3O6MH 3E1F1 5BRZD 1LP9B 2FX8L 3HZMA 5HI5D 2P47B 4DKFL 5CUSH 4YZFF 1A7RH 4G5ZL 3DX6A 3OKDA 4MJIB 5EDXA 4YHYB 5DVKA 5DZOA 4PGEA 3EYUH 4M8VA 1EHNA 1H3PH 2QV2A 3S6CA 2I07A 4Y4KB 4OKDA 2FYYB 3SDDB 5I1KH 4PJHB 1IAIH 1S7SA 3OJVC 5E6ID 1UCBL 3VXUD 5FOBA 5DJDB 5GS0L 1DBKH 4HSQA 1HK6A 5L6YL 2R29L 2Y25A 4J7RA 4YE4L 4HUUA 5F6IB 1K5NA 2KZ1B 4BQ9A 3FJTA 3W9EB 1FZKB 4DZ8A 4WVRA 3MV7A 4PJCF 4OZFG 4R97C 5KVFL 1YQVL 1QFWI 4WJ5A 3JV0A 1HXMB 4IDJL 4ZUVA 1LE5A 3CFCL 4GQ9H 4TULH 3MODL 4WV1A 5IW3A 5JPMB 1KJMB 1N3NB 1QEWA 3C6LA 3U9PH 3HR6A 4KJQD 4QXGL 1U95B 1YN7A 5JPNB 1KTRL 2A6JB 4QHUB 3LEXA 4PGJA 2AJ3A 2J88L 3QEUA 2WW8A 5INDB 3QIUB 5EUOA 4S1RH 3DGCR 1DBBL 5DSCA 4LHUA 1HWGB 4MXVF 2W91A 3EDFA 4N0CC 5FHBH 4ACPA 3MNVB 3D3VD 2IAMD 1QSEA 3SJVB 3WEXB 4OUUB 5J1TC 3EKCA 2FIKA 1WBYA 1MFNA 3T0AA 1B2WH 4WY7L 3VWKD 1T5XB 4LMQE 2Y06H 4NQEB 4LCIL 4MAUH 4JHBA 2VSDA 2ITCA 4U0RB 2GJ6D 2MFNA 4H1LB 1UCTA 5FYJD 1B6UA 3MNWA 3T0ED 1H5BC 1QNZL 3PWJA 4NUJB 4LF3A 1OSZB 2HG5B 5EC1B 1T1WA 1FSKB 3RWFB 5HHPA 1DVFD 3QISA 3ULVF 1G7JA 3JV6A 5IFAL 3EJYC 4IRZH 2XT1B 1SM3H 3QO1B 1DBJH 3O3EA 1DFBH 2DBLH 5GGTH 2YBRB 4I5BA 2X1PA 1N26A 1I9RH 5E2TH 2ZG1A 3KLAB 1ND0B 3AM8A 4G80A 3PHQB 1BVLA 4M02A 1E28A 3HR5A 2D0FA 2AJSL 4ODVH 3VXSA 1WCBB 5E0QA 5EO0B 5DC0A 4PLKD 2A6DA 3LQAH 5GJSL 1YJDL 5CINH 3KPOA 2DMBA 2F74A 3MLUL 3C5ZA 3QAZB 4O2FB 4RNRA 1FG9C 1IC5H 4QO1A 4K7PL 4PJ8D 2ZUSA 4Z7QE 3QEQD 1S7QA 3FQNA 1TPXB 3OAZK 1MHPL 1OB1B 1UC6A 1OAXL 2Z31A 2DWEA 1GC1C 1WFTA 2E27L 3TVMB 4K07A 1ZA6A 4OD1H 4OLUH 1ROWA 5EZLB 3LZFL 1JNLL 3VCLB 1FL6A 4JQIH 4PJBE 3WFBH 1JNHB 3TZVD 2IADB 3TBYA 1AQKL 1PKQB 5J3HC 1N0LA 1YEEH 3PGFL 5KSVB 3ARFB 2FR4B 5AAWA 4U6YA 3VH8G 1QSFD 1DL7H 5D96B 3NABH 5B3NA 4WTZA 5I8KL 5CEZE 4KXZH 4OD3H 3CIQA 5F8QC 1OAUL 1E4XL 1R3LA 2JIXD 4HMEA 3QI9D 4ODUA 5J11C 5SWZD 1D9KA 5ENWA 1ZEAH 4H1LH 3L5JA 5CZVH 3BH8A 4G6ML 4APQD 5EOCH 3WFDL 4JFFE 3ZKMD 1X5YA 1TJGH 2EH7H 3BESR 3OBAA 3UJTH 3UTPE 4NQTA 3BKYL 3GJEA 4P46A 1VHPA 4TUJB 5E08L 5EOQH 2FJHB 5DFVD 5CSZA 3GHEL 3IDYC 4I0CC 2XN9E 3IJSA 4HULB 2RR3A 3LKQA 2GFBA 4PP2B 2F19L 5EG6C 4QWWC 1EFXB 4Y4HC 3EJJX 4QYOB 3S7GA 1MWAL 4PJ9D 3IGAB 2X6MA 1X7QB 3WIIH 4J1UA 1UM6L 1A14H 3NIDF 1XH3A 1GOGA 1P2CA 4P5TC 4JAMA 4P99A 4QRSA 1U8LA 4PGDB 1S8DA 1NCCL 4G7YH 1MVFA 3HC0B 4M43H 5GJTH 1OQOA 5C7XL 4RGND 3ARVA 3JVGA 4WFGE 3I2CL 4X6DF 4GKSA 3R0NA 3JUZA 4YHML 3H3BC 4MA1C 4NOBA 4P5KB 4PJ5D 4KMQA 2DIAA 3QR2A 4X99B 5FAAA 3GEWB 4NKIL 1P6AB 2VO5A 2XZCH 4M6OH 1FRGL 3Q6GL 1MCOL 5L0QB 1OP5H 3G9VA 1AY1H 3UPRB 4D0CA 4XVUD 3QNYB 3VFOA 5TH2A 4EIZC 5LGJB 2YUVA 3TT3H 1NAKH 1RUQH 3N9GH 4JO2H 2YC1A 3BW9A 3SGKA 1SJEA 3F7PC 1WIUA 1NGPL 3L3OA 4LRIA 3C60A 5HVGB 3P4NB 1PZUB 2ARWA 3IKCA 3ZKSD 4KC3B 5GRYA 5GRVK 5T1DH 2FO4B 1IARB 1JUFB 4I4WB 4KTDH 4LGPB 3W39A 2IQAB 4JFQA 4JN1L 3C6LC 5JUEL 2WP3T 2R2BA 4EQ2A 1MFAL 3VD4A 5HYJD 3LPFA 1CXKA 15C8L 4TTGA 4GKZB 3NOIA 4MCYB 3L1OL 4ETQB 4L1HA 3EOBB 4I3SL 3V6FA 1NDMB 3S97C 4MNHB 4YAQB 1AGCA 3QULA 4NM4L 4B53A 2JJTA 3DSNA 3SOBH 3GBNL 1H3GA 3QFJE 1U3YA 4BQ6A 1L7TH 5D1ZD 4HW6A 3W82A 4J3UA 4WFFE 2ESVA 4XRCA 3ZTJH 3EHBD 4PUBL 2DIJA 2VR5A 4YDVB 3BHBA 2XRAH 1T20B 4P59L 3RVXD 1UVQB 1A9EA 2DLFL 4WTZG 5KG9B 3U9UB 2MOVA 2VL4A 5AEAA 3ZT6A 1ZA3A 5EZIL 1MHCA 3V6OC 5KN5A 4G9FD 4ZFFB 2ADGB 3HCVB 2AQ2A 5IVOA 3G6AA 3BDBA 3RVUD 4GAJH 5FHAH 3EO0B 2QSQA 3DV6B 3L5WA 4KUZL 3PHSA 3MGAA 2EE9A 2IPUG 5LXGH 1FYTB 4ONFH 3T0XA 4K94H 1QTYT 5FDWB 2IFFL 3HG1D 2I9LB 1HWHB 3V4VH 4N90D 2J12B 4ORGA 5ALBH 3P40A 5CCKL 3H7LA 4KU1A 5IHZA 1LNUA 1F8TH 2CRZA 2N7AA 3SGEI 1HH9A 3ESVF 5KVGL 5TDOB 1YY8A 3RWCA 4L5FL 3HNSH 5EPMB 3RVWC 5HD8C 3P77B 5CSGA 1J0IA 3VXTB 5C92A 1CXHA 5GS0D 1RUPL 1G6RL 3KPQB 4YUEH 2NNAB 2X4RB 4C55A 3X3FL 4WDIB 1SEBA 4TSBH 2PYEE 4YHZH 3ARDD 2B2XL 2DYPA 3W11C 4UTBL 1XCTB 4Y1AB 3Q6FA 3DIFA 2CLVB 1RPQA 4N5EC 4UT7L 3CH1A 4HV8B 1NCDH 2SEBB 3VGBA 2B0SH 1CIDA 1U8OA 3ESUF 4K3EL 2J5LC 5I8OH 4FQHB 4Q6IC 2W1NA 4R2GB 3QCTH 2NY0D 2L0DA 1MLBB 1U8PB 3HZYB 1J0JA 1RU9H 3PV6A 4BYHA 4WI3A 4X6EB 4GJTB 5J6GB 3IU3A 4LHQB 3RKDC 2FZ3A 1EHLH 4R4FH 4ZYKB 1EEZA 5FV1L 5IVZB 1W2KT 4OSUL 3NA4A 4QEGA 3FQWA 2HT3C 4P2QB 1YPZA 4NRXA 4LQFH 3EJZD 2FD6L 1RULH 3QDHA 4NGHH 3OG4B 4YGVA 3IFOA 1S3KL 1QA9A 3NIFF 2P8PA 3FT3A 1GC1L 2OP4L 4WI5A 4GG6B 1RIUH 4YHLL 5DJCB 3SDYH 3QJHA 5GRJL 2PW2A 4NPYB 4UOJA 4X6CA 2NXZB 5JOPE 2EDHA 5LG1A 1AGEB 4A6YA 3U6RA 4JFEA 4UTAL 4KTEH 5KSBE 3H9SA 2YK1L 3MACH 4QTHA 4HWBA 3QXTA 4TUKL 3VI4F 1HQRA 3ZE0F 3CLFL 3L9RB 3OV6A 1AXSA 3TN0C 2IH1B 2IG2L 2GJZA 2D2OA 1NC4D 4HFWB 3ZYOA 2FECL 5B21A 5CD5D 1WGOA 3QNZA 3ZL4H 5JOFA 4RFNB 3CFEA 4JR9L 4U05A 4Y5YB 2V9RA 1Q9LA 4JO1L 2DRUA 3MLTB 3MJ6A 4G9DB 1NBYA 4JRYD 2KZWA 5L2KD 2K1MA 3R1GH 2YD3A 3TJEH 2WM0A 2EICA 4DGYL 3MV9E 1QRND 5I1DA 1HSAB 4UIKH 4D9QE 2D3VA 3O4LD 2VLKA 1KEGL 2Q7NA 5FGCB 5KSUB 3DXAD 4QT5B 5DVNA 2YEZA 1D6VL 1YEJH 4U1IA 1NUDA 2FWOA 2YZ8A 3SGKC 3C60C 2DQEH 2AV1B 4IHOB 3ISWA 4FQQA 3BKJH 3X13A 4OGAC 3X14B 4N9OB 5E95B 3E2HB 2DTSA 3QDGA 1ETZB 3BUYB 4UB0L 4HG4K 2X4OA 4LSVH 3HMXL 2Q8AL 4LQ1A 4Y2OA 1BF2A 1K4CA 2GK0A 2P5EB 1N5AA 1KPUA 2CGRH 5T1KB 4XCYA 2A0LC 3DVGA 4K8RH 1KCUL 1RIHH 4R26L 4Q9RH 3IDJB 1QR1A 2VIRA 3T4YA 1EBAA 4NN5B 1TFHA 5CIPB 3DSFL 1AKJD 3PQYD 2ERJC 3BP6B 3L95B 1DQDL 5AYUH 2B4CH 4GW1A 1HHJB 5SWSB 2I24N 1IGML 3HI1B 4RWYH 3TLRA 5KVMC 1GGUA 4QKXB 5DD5L 4JHZA 5F93C 4P4KC 2PKDA 4D0BB 3INUL 4AL8H 3FMGL 3TBVA 4PJ7E 5SX5K 2B1HL 1QBLL 2QADC 4M9PA 2BMKB 1ZVYA 5DMGD 2XTJD 2R69H 1LP9E 5T1LD 3QUYA 2F53B 2F5BL 4PR5A 2ATPB 3OAYH 4MJIE 3WSQH 1D5BA 5I8CB 1Z5LA 1WK0A 2FSEB 2K9UA 4JFPB 4DGIL 1X4XA 4P3DB 3S35L 1Z3GH 5T3ZL 4OV5A 5ACZB 3PV7A 1J86A 4JFYB 4PS4L 4PJHE 4RGOL 2EC8A 2X4TB 2HYMA 4JFZL 1QZ1A 3O3DB 1K2DB 1L0XA 4HPOL 4LSSL 4OKVA 4GAYA 3OB0H 2EEBA 5AZEL 3AREC 1FIGL 3BPOC 4J12A 2PO6C 2D31A 3LEVH 5CJOH 1G9NH 5F6HJ 4G6AC 1NANH 5MEQA 3KJ4B 4NT6A 4NN7C 3PL6B 4G8GD 4U1SA 5E1AA 4KK9C 4FP8L 1KCSL 4W4OC 4UAOC 4F15B 3CFIC 2EKSA 4DZBB 3PWUB 4O51B 4M6ML 1FO0A 4Z0XB 3DVNB 5BZDA 3U48A 1WAAF 3QDMA 3MGOB 4TRPL 1G1YA 3OKEB 1I3VA 2HFGL 1JWMA 5CS7A 4ODWA 4Y5XB 4L1DA 1B6DA 1X5LA 3D2UB 5EA0L 2ZUQB 3BQUD 1MQ8A 1CL7I 5F7HA 4UDUA 5CLWA 4XC1L 4L8BA 3N0PB 4HH8A 3UYRH 4LLAA 1XGUA 2QR0A 5CIPH 1FAIH 1OGAD 3MRFA 4O5LH 2D0HA 1IGIL 5MENA 2NY4B 4LSQL 4NQEE 4NWUH 2H45A 3ILPB 3TESA 1AFVH 1JYXA 3O2DH 4GFTB 1FLTX 4HK3N 1YEFL 2P1YA 4WO4A 3MLWH 4YFEA 4HUVB 5IMMA 1F45A 2PNDA 3BE1H 4KQ4L 2VDML 1SBSH 1A2YA 3VXQB 1CLZL 25C8H 1KELH 3GNML 4XP4H 4CW1A 5C6WH 4XPHH 4H88H 4MLSA 3WKMH 4G42B 2ZZUT 1OAZH 3MYJB 1ADQL 2A83A 2C3VA 4J3VA 4DKEL 4LSRL 3O0RL 1KEMH 3OKMB 5I18L 4PRPD 4GAFB 3PF2A 3S34H 3FONB 3HE7B 1NCWH 3UTZB 4OF3A 4PRIE 2AKRA 4H5SB 2ADFL 1T2QH 2OL3A 5IFHL 2WUBL 4HJGA 1WUNT 3LB6C 5E8NB 4WUUD 4R7DA 5DD1H 2APBA 3WNPA 4EVNB 5I16B 4XMKL 1LO2H 3SKJH 4MB5A 2DM3A 4TTDC 2O5YL 4HCRL 5DUMH 5LBSH 1U8NA 3MC0A 2VDKL 1RZIA 2OR8A 4BSVB 4N0CD 4XCCL 3TIEA 2QSCH 1DTUA 1JF1A 4XH2A 2X4SB 5LCVH 3LH2H 4L8DA 5K9QI 1PKQE 1XIWC 2HN7A 3QIWA 3SBWC 1UH2A 2ZUWA 5MI0B 4CVZB 1IQWL 1PQZB 4U1MA 3WDHA 6CGTA 5DI8B 3I9GH 1LO5B 2EDNA 5BJTA 1BWWA 3QUZA 5JMOC 4ONHB 5D7IF 4MNGB 2X9WA 3AY4A 1N4XL 4LASH 3WIHA 5DRNA 2UY6A 1YN6A 4KI1A 4ZQKB 1CICA 4M6NL 3EJYD 5GHWH 3VWJA 3W9DB 3CPLB 1NGQH 3ALPA 2AXJA 3IFPB 1RV6X 3V4UL 1CU4H 4ZUSA 2BRRH 4Y16B 1CFSB 4QHMA 2ZPKH 5SWQB 1GPOL 5ADOL 3PP3H 1GGCH 4F9PA 3BGMA 5D93C 1YECL 3VH8B 3WJJC 1FDLL 1UWXK 3L3GB 4WHYH 4ZPTB 4XNZC 5IK3B 1Z9SA 1D5IH 2ZUYA 2VYRE 3CSPA 3MO1B 4JO4H 1X9QA 4TNWF 2AEPH 3MRBB 3ZLQC 4JG0L 1R0AL 1AHWB 1JRHH 3HTLX 5D2LB 4LVOC 5TQ0H 4P2CG 4ETYA 2BY3A 5EN2A 1A02N 4FQ2H 2K7PA 4RZCB 1HCVA 1R5VB 1MVUB 3AXLB 1ZK9A 4M4PA 1LILA 3QDJB 3KLHC 1QBML 5LGHL 2CXGA 4XVSL 3VXMD 2R4RL 43CAA 5F7YC 5ERWB 4KI5C 4EDWH 2A9MH 2Y7QA 5DJYA 3RGVA 1FNGB 1Q0YH 3QUYC 5IJVB 2FJGA 1WSST 4YC2C 5J3HD 2XY1A 4LKCB 1WIPA 1CFVH 1F4YH 4FQXA 1O5DT 5C0AA 3O8XC 4KAQH 1FVDA 2OZ4A 1FH5H 3BAEL 1IM3B 1ZHNA 1YEDB 4AM0B 3ZYZA 5DYOB 2Q6WB 1D5XB 3MROA 1S7VA 4IS6B 4OLXH 1LEGA 3RU8H 3ULUF 4U6HB 1DDHA 3QUMA 5C0FA 3GHBH 1C7SA 2A1WL 1IFHL 4IOIA 1M7IB 2A38A 3VFPA 1T83C 3FN9A 3VFMA 1HZHL 4IIQC 1P4IL 4PTUA 4OFPA 3RA7H 3TNMA 1JTOA 1JPFA 1BD2E 3ZE1E 5JXAL 4K2UL 1WBZB 2DQHH 3QHZH 1KJ2B 1IJ9A 1RJLB 1OOAA 2YN5A 4NNPL 5HHMB 2OBGA 3GSOB 3MJ9L 4JFHD 5J4MA 2W60A 4JY6B 5BXFA 1NAMA 5C0RH 4QWWD 3HUJB 3PWVB 4Y4HD 4YPGB 2VWEE 4MJ2A 4BUHA 5C0IB 1ZGLB 1V7NL 4L9LB 1I3GH 4PRDA 3F5WA 5H37H 4BK4A 3WFEL 4WNQA 4IRJA 4KKLC 4P5TD 3H2WA 5EU6A 4AT6B 2I60H 1ZVSB 3NH7H 4QXTB 1MJUL 1F6LL 2QBWA 4JDZB 2Z93A 3G5XA 3STLB 1CD1B 2XZQL 5L2JB 2NXYB 4PREA 2D0GA 4OIIH 1JL8A 5AG9A 3ARRA 2DJSA 1OM3L 5DFTA 4L3EB 4HGMA 3MUGB 1WCQA 3M07A 5D2NB 5HPMB 4KVNH 2WINB 5CEYB 2NX5D 2GCYA 4HD9A 2P4AB 1VFBA 3QRGH 5E9DD 4FXKA 4BFIA 3UTSB 4OFYA 1FYTE 4I9WE 3BPCA 1GHFH 1YUHB 3WKNA 2XXCB 3ULVC 1MHEA 4F7CB 4XX1G 2BFVL 3HE6C 5IVXB 4KGJA 1UEYA 5JQHC 2JB5H 4JREC 1INDL 1YNLH 5BRZB 3IFLH 1FAKT 2H1PL 1U3JA 2ICEB 2ZSVB 3KPTA 4HDIB 5AG8A 4YDJA 4YHNB 3SDCA 1FZJA 2YUZA 4TN9A 5GRXG 3Q3GB 1TTFA 4K23H 1JV5A 4OLVH 4XVTH 3C6LD 3A6CL 3OWEA 1I9JL 4BQ8A 5BS0A 3Q5OA 4NKOB 4G3YL 3D18B 3MBEA 4LEXH 2YPLA 5IMKA 4C4KT 5T3ZD 3VXUB 1KJ3H 5HHXH 1IT9L 4JG1L 2VH5L 1ZT1B 1FL3A 3NFNB 2HKHL 1X5KA 4D8PB 4UOW0 4LHUD 4OZGF 2DQGL 3LMJL 1FZMA 2JKXA 1AIFA 2QL1A 4HWEH 3TGXA 1QSED 1ZS8B 3TCLB 4Q9QH 5FO9A 4GSDH 4YHKL 2FHCA 1KJ2H 1RZFH 3OZ9H 4Y1AE 4DEPC 3U1SH 3MMEB 1JIBA 4MB4A 2XWTA 2HAZA 1GIGL 4OZHB 4M7JH 3HMWL 1LWRA 2Q76A 2NY5H 4LRNL 3CCHB 2XFXA 5TGBB 1TJHH 2IGFH 5IWLC 3MV8D 3ARZA 3QIBB 3OAUL 4GMSH 5FUZH 3V52L 1UACL 4YK4B 1WLHA 1UQSB 1XGYL 4FA8A 1MCCA 4GXUM 3D3VB 2JB6B 1MCBA 4J4PA 2JK5A 4NHUB 4JPIB 4I18C 4M8QB 3QO0A 3G6JB 4JHAL 5HY9B 4DW2H 1A3RL 4WFHD 2BCKB 3ZHDA 4U1NA 4UDTA 2PW1B 3N06B 3VWKB 1D5ZA 5DHYB 3NCEB