3QBTB

Crystal structure of ocrl1 540-678 in complex with rab8a:gppnhp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
130
structure length
130
Chain Sequence
DSVRIMDRMENDFLPSLELSRREFVFENVKFRQLQKEKFQISNNGQVPCHFSFIPKLNDSQYCKPWLRAEPFEGYLEPNETVDISLDVYVSKDSVTILNSGEDKIEDILVLHLDRGKDYFLTISGNYLPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ras-related protein Rab-8A
publication title A structural basis for Lowe syndrome caused by mutations in the Rab-binding domain of OCRL1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/hydrolase
total genus 25
structure length 130
sequence length 130
chains with identical sequence D, F, H
ec nomenclature ec 3.1.3.36: Phosphoinositide 5-phosphatase.
pdb deposition date 2011-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qbtB00
1V7MH 2X70B 4KFZC 3HNTL 4MAYC 3ZE1E 5GS2D 3HE7C 2DQTH 2OXGA 1CFSA 2AJSH 2YC1A 1FYTB 32C2A 1WZ1L 5CD5C 2P4AB 5F7FA 2D0HA 4HPYL 4BH7A 3IJSA 1BWWA 1U3HD 5IEHA 2NNAB 3EOTL 1SVZA 4MXVF 4DFIA 4CUCA 5T1DL 5C92A 3QA3B 1JPSL 2DI9A 2QSQA 2B39A 4G6AC 2BOBB 1EO5A 2EIDA 2CXGA 1MVFA 2CO6B 3VW3H 1T1XA 3R4DA 1KLGB 4OFIA 2Y6SD 3ET9F 4LFHD 5F88B 5SWZE 1G9MC 2AK1H 5LXGL 1ACZA 1HHHA 3OWEA 2NLJA 4LSQH 4I8DA 1JZ7A 1IQWL 4IIQA 4LU5L 4OSUH 2WWKO 5ICXB 3B9AA 4QLRA 2YBRA 3QUXB 4P48A 5C6TL 1L0YA 5CS7A 4HBCH 1OTSD 4PJ9B 4JRXD 3PV6B 3V7AG 3BWAB 4TULL 2YRZA 2P5ED 2EXWD 3U0TA 1CFTA 5H37H 1EEQA 4FQ2L 4P57B 1BOGA 4M6ML 1FGNH 4H8WL 3LQZA 3GKZA 3JUYA 5IB1B 4DQOL 4LARL 4DUVA 1MQKH 3MOQA 3C5ZD 4PGBB 4HWUA 5DJCA 5KVMC 1RUKH 3SDYH 3U9UB 4R7DB 3QDMA 3D87B 3DX6B 4P3CH 5D5MB 2EYRB 3ARFB 2RCSH 1KTLA 3ZKQD 3QNZA 3HB3C 2BSRB 2FL5B 4N9OB 4RMQA 3KYOA 3GBNH 3MRCB 2D9CA 2PYEA 2SEBA 5FA3A 1A9BB 4OI7A 4OLWH 1KJ2B 5ESVB 2O26U 2GSIA 4S1DD 4AIXA 5IESL 1T83C 4Y4FB 2AQ1A 1UGNA 5K9KB 2DQJL 3NZHL 5TE7L 5TFSL 2BOCA 4XP5H 1DLFH 4LDOB 3MLRH 1QFWL 4N0FB 2IQAA 1KENH 1DBMH 4ZDHA 3OKEA 3W9DB 1NCWL 4XX1G 2VE6A 1T66C 4FQIL 1L7TH 4JQXA 4YNYB 3MUJA 4C56E 1DTUA 5KVFL 2EYSA 2X7LB 3MRKA 4ZXBD 1RZJL 2QADB 1UH3A 2M8XA 5DD1H 5GGTL 5DHVB 3PGDB 5D7LE 5TQ2H 3GMLA 5FB8A 4MJ5A 3HC0B 1NEZG 1DN0B 4Q6IC 5KSVB 5JW4Q 3RTQA 4N5EC 3HS0B 4XP9H 4HGKC 5C0DA 1T4KA 4X98A 3Q6FA 5J9PA 4EN3B 2DYPB 3F12B 5EB9A 5SWZA 2VZ1A 4PIRF 4DTGH 5FHBL 5ICZA 1IKFH 5C0RL 2H26A 4G8FA 4G6FB 2GUOA 5CJ5A 2GTZA 1LE9A 3D39D 3K4ZA 5TQ0L 5SX4I 1F4YH 4LBEA 4NNXB 5TH2A 1KJMB 1FFOA 4JO3H 4R6UA 3QWOB 2E7HA 4LHQB 4OIIH 5EBWA 5LCVH 5DC0A 2A73B 4R4BB 1KLFA 4NNPL 3S36X 4HF5H 4WW2A 4PR5A 1OAUL 5DFVC 2NY1D 2R2BB 2IAMB 1JNNH 2X44D 4HS6A 1UM5H 3TO2B 2WIIB 4KGLA 1NFDB 5KJRL 2FIKA 1CT8B 2PXYB 4M48H 1SY6A 2MKLC 5GGRA 2HJLB 2ENSA 5JIKA 2E7BA 2ZNXA 5F44A 5IHUH 3CZFB 3BPCA 3CVHL 2VDKL 2HN7A 3ARDA 1FDLL 4JFFA 5IM7A 5BV7L 3I6GA 4RMSA 2VR5A 4XNQA 4MXVE 2V2XA 2GK2A 4JQVA 1YJDC 4ODBD 3R06A 1JCKA 4QYOB 5HBBA 2Z31B 3FT2A 5ESQA 3VDBA 1BD2E 4MXQC 2UZXB 4I9WD 2N4IA 5EU6B 4K7FB 3OQ3B 4NKQB 2VISB 3MNZA 1N5YH 3FRPA 4N5UA 2JCCB 1HHKA 4ZSOA 5HYIA 2W0FA 4N0YL 4K8RH 3EJZC 4JFZL 1V3MA 3B8SA 4EQ2A 5SX5K 5DJ2B 4AG4H 4MB3A 1A7NL 1EZVX 5JZ7C 1A64A 1BZQK 2AV7A 3MNVB 3Q3GA 1JPGB 5DFWH 1IEBA 1QSFA 1PYWB 3MA9H 4C56A 1JYVA 3CNKA 5CMAB 3FN9A 2AJZB 3WNLA 4N90E 2DOCA 3PGCB 3VFGH 5D7LA 2XN9D 4QRUA 3X17A 4Y2DB 2YR3A 4MVBC 3SCMB 5GRJL 3RKPA 1JFQH 3U6RB 3PP4H 4HLZG 1NEUA 1D6EA 4HPOL 4Y4KD 3T8XA 1K9TA 3ZE2E 3REVB 4Q2ZB 4HUVB 4HJ0D 4RAVA 5FO7B 2ZSVA 1IE5A 3S34H 4RFOL 4NO3A 1Q9WA 3AB0B 1FAIL 4YGVA 4N0CD 3BH8B 1ZLVH 3GM8A 4HG4J 1HCVA 3QEQB 1EBPA 1OP3K 5H94B 1CR9L 3QPXL 4Z7NF 1YY9D 1QBLH 4Q74A 1ZE3C 5DMJB 1G7HB 5GZOD 1ZLUH 4PRDA 3U4AA 25C8H 2C3WA 4LF3B 4KMTL 2B7DT 3IDIB 2VLKD 3LVEA 1UKQA 2AXGB 4NZUH 4KK9C 1TZIA 3UTQB 2ZSWA 4D0CB 2WINA 1VENA 4U4BA 4KKCC 3FOMB 3DROB 1TJIH 5CEYA 5HGAA 4WCYL 5A2KH 4R26H 3M07A 2XOTA 2R0WL 5FO9B 3QDJB 3NZ8B 3QQ4B 1FJ1A 3VRJA 5C0FA 3IDMA 3BKMH 1T22B 4LIQH 4ZODA 3QQ9C 4ONHB 4JFQA 4X7FC 1ZSDB 2VDRH 4QXTB 1BD2A 4Z7VB 4OD2A 2DM4A 2QSCH 3BSZH 2NY4D 1IAII 4JHWH 3VGBA 1F13A 5LKNA 1V05A 2XACC 3MRHA 4XPBL 2C4XA 4PJ8B 4XNZB 1M1SA 1MHEB 1U8IB 3EFDH 3BO8A 1G1CA 4BSVA 3RX7A 1IM3A 1K8DA 4D0DA 2B1AH 3J7HA 4XC1H 5EU3B 2Y36H 2ZKHL 4ZAKB 3LN5B 4KTDL 1HKLL 1U8PB 2X89D 3U46B 5TF0A 2ZCHL 1TCMA 4YXLH 2Y72A 4HDIA 4PD4K 1MAKA 1G0YR 1VFBB 4M7KL 4MNHA 3L9RB 1YNKH 3FQRA 3WNMA 3GSUB 4KKBC 3DO7B 4OUUB 5EO0A 4QHUB 4D9QD 1HQRA 3QUMA 5DMGD 4KK8D 3SBWA 4P3DB 4QRRD 3VD5A 4BSWA 3BPOC 4P2QA 5C08D 3K2MC 5MEOA 3QH3A 4X7CC 4RGOH 5BQ7B 5IFJB 1T5XA 2HWZL 4KGJA 1EIBA 4QTHB 3QPQD 4MAYB 5E6IA 3HE7B 4ONFL 3T2NL 5KTEH 1BQLH 3LV3B 4IMLB 4MJ6B 2NY3C 3NH7H 3UYOD 2D4FA 1T0MA 2UZYB 4O9HL 4ZUWA 1RZ8A 2EC9U 5JUEH 4M62H 1K8IB 1TETL 1CF8L 1I1FA 1F3JB 3QUZA 5EULV 3AROA 5D93C 5IFHH 3C6SB 1FORL 4XBPA 4M43L 4BFGA 4RX4D 1KB9K 3ECBB 1EFXB 5EZJA 4PRPE 4NSKA 5FYJD 4P9HL 3ZKNC 3MGAA 4YHIA 4IMKA 1CN4A 4OGAC 4O2CA 4JB9H 3ZYIA 1T1YA 4LVHB 1I3RA 5BO1H 4LK4A 1OLZA 3L3IA 5B3NA 4NO0D 3BRFA 3K4AA 3WFHB 1RJZA 2BVOA 1NCDH 1N6UA 1SBSH 5FCSH 1K4DB 4E9LA 2P47B 4S0SD 1GGBL 2V6HA 2P5WD 3BP7B 2FWOA 5I71C 2GEEA 3P9WB 4OJFL 3UC0L 1TTUA 1TZHA 4LPWA 3FFDA 1TZGH 2WZPD 4GBXA 2WBJA 3RDTD 15C8L 1I9JL 3S4SB 5AZ2H 5LGJB 3PWUA 1JPFB 4K3EH 3GSNA 2YUWA 1MJ7H 3LOWA 4WNQB 2JELL 5MENB 4XPFL 5GS0D 1QSED 5EOTA 5GQBA 5T3ZE 4NOBA 1ZANH 1INEL 4X9FA 3RVTD 1T7YA 3ULUL 1J88A 1WITA 2MCPL 2AS5M 1NQBA 2Z91B 1JP5A 8FABB 1KELL 4Y7MA 5HVWA 3MJ8A 4L3EE 5AYUH 3PWLB 5KS9B 3TT1L 2VUYA 5F6HI 1MCCA 3MFGB 4JKKA 1GZQB 2A9MH 5A2JH 1CLZL 3VXOA 5I1GH 3RPIB 4FFZH 4PJBF 1AXSA 4YHZH 1UA6H 1BQHA 4PY7A 3C60C 5F96H 1FVCB 2ZCLL 3CSYB 1FZMA 3KAAA 2R39A 3OKKA 3QXVA 4CJ1A 4DN4H 2A6KB 3B9KA 3V95A 4Q9QL 1DBBH 5IT2L 4NKMA 1GIGL 1ORQA 3KPMA 3MRFA 4OFPA 1YEGL 4FQHA 3I9GL 3F7YA 5I6XC 4K71C 4GAJL 1U3HC 5CJBA 5E8DH 5DYOB 1NGXA 1FL3A 1SJHA 5CBAB 4NZJA 3DUHA 3FB5B 2CLZB 2GT9B 1IBGL 4G9FB 4X7EC 5EPMA 2VITA 4L29B 5AWNL 1ZLWK 4P5TB 3X3GH 3FQUB 3QIUA 2Y6SC 4JE4B 4QOKD 4S0TD 1SYSA 4UIKH 5GJTL 1JV5A 4M61B 1ZKAA 2C4FU 1M71A 2HMID 2BVTA 4XXDB 3EAKA 4Q6IB 4HMDA 2AXHA 3MSPA 5E03A 1H0DB 1KCRL 4PRPA 5D4QA 5D7IF 3T77B 5SWSD 1OTSC 1QYGL 5K59E 2VLJB 1RZFH 4OZHF 1QNZH 5ABDE 2YD2A 5D70L 4MJ2A 5KN5B 3ULVF 5H2BB 3O6LL 2PTUA 2IH1A 1ZHKB 5L6YH 1ZHLA 4I18A 3MUGB 4POUB 2IANE 1N6VA 3VWJA 4GG8B 5F1OB 3C5ZC 3MYZA 2E27H 2H32B 3T0DA 1OAZL 3PABA 2BP3A 2WUCH 4U0RC 4JHZA 3P0GB 3VRIB 3O45B 2CDGA 2VDML 3FL7A 3DV6B 2ORBL 3QUYA 3F7VB 4PUBH 2R0ZH 4PG9A 2XZAH 4NCC1 5CJ8A 3G5YB 3G6JB 3T0VA 4Q7DA 5I9QB 5ERWA 3RVWD 4NFDA 4KHXL 2Y7QA 1LQSR 4P49A 5I1JH 4HJJH 1DVFA 5I17A 5I66B 4OV5B 1BVLB 3LS4H 4S1DC 1W0WB 1M6OA 4QRTB 1KXTB 1L6XA 4OF7A 4L3EA 3SDXE 1PKQB 3GSNL 2WM0A 2BNQB 5MERA 2FBJL 3FB7A 5CZXD 2X4PB 2VZ3A 1DQTA 4V1DD 2NY5L 1ZS8B 5E94A 4K3JH 1V3LA 2MQ0A 4XP4H 1XF4A 5L9DL 2Z35B 3H42L 2F53B 4LCIL 4E0RB 1BLNA 1K5NB 1WZMA 2W65A 2ZUUA 4GW4B 4HUMB 4ZXBC 3CXDH 3QEHA 3DX9B 5INCA 1YN6B 4F15C 3MLZH 5JXED 4ZFFA 3BZFA 5HPMA 4YDVB 3LKNB 3SGEI 5F9JB 1B0GB 3ARBD 2AJ3B 2Q7NA 1QR4A 5TF1H 1CFNA 5HHMD 3CUPB 1BVKA 4S1SH 1V7ML 3HZYB 4G42A 1DLHA 4JFPA 4YO0B 1FO0B 1QRNA 1Q0YL 1XF2A 4UB0H 3HG1A 1OOAA 3OGCA 1G7IA 3WNOA 4IRZH 1YPZE 2UZIH 5IV2B 4WWID 1G0XA 2H2PD 1JZ4A 4ZFGH 3I50L 4R96B 1OAXH 4W6YB 3JBG7 4JFOB 1A1NA 4Z7OE 1ZHNA 4ZTPH 4XVTH 5EUKB 2YK1H 5I1IH 3VW3L 1SQ2N 1T3FA 2HKHL 1SHMA 4UDUA 4JG1L 1UJ3A 5CD3A 1A4KA 1MCBA 3L1OH 4LSQL 4W6XB 2NY1C 3FFCB 1FN4B 2NY2D 5C0AE 4LLUB 1H3UA 1KJVB 2OS7A 4HBCL 1QEWB 4NJ9H 4YBLC 1VFUA 5JORA 2VZOA 1H3PH 5C0JB 3KPQA 5CUSH 3GHBH 4NZTL 4O2EA 2JKXA 5DJAB 2JJTA 4M5YL 4U33A 1FGNL 4GH7B 4NRXB 3DXAB 3KDMA 1ZVSB 4JO2H 4WTZA 2UUDH 4U1HB 2XQYK 3B2UD 5IMMA 1RUKL 3ILQD 4PJ5B 1BP3B 2CKBH 3UCRA 2EE3A 1XCQB 4CN1A 1U92B 1WF5A 1RUPL 5JA8B 2JF1A 3SDXA 1U8NB 2I07A 3BD3A 1F6FB 3ZE0E 3BMWA 3WN5C 5DDHA 3D0VB 4OZHE 4YR6A 5F8QC 1NSNH 2VLRB 4F2MB 3ARGD 3RZWA 3MREB 5E5MA 4HAGA 5SV3A 3UTPD 2J4WH 4I3SL 4EIGB 1D9KA 1U8HB 1A6UL 5F9OL 2VERN 1JWSB 2FJFB 4X6BA 4PJXF 4JLRA 1CTNA 1CU4H 4U7SA 4XP5L 1DLFL 1A21A 3BISA 4ORGA 1OSZB 3MLRL 1AO7B 5ANME 3B9EA 3R1GH 3K8LA 1TQCC 5BVPH 4KQ3L 1DBML 3VFSB 2NPLX 3D48R 1CIDA 3PWPB 4FNLH 1IC1A 5HDLA 1U93A 3MRIA 4Y4KC 4M8QB 3W39B 3WFEH 1LK2B 3S35L 1G6RH 5MEPA 3LKPA 3F6LA 3OKNA 4HJ0C 4I3RH 1RJYA 1YPZA 4HW6A 2KDGA 3BPOB 4MSWB 4N0CC 4MCYB 1R5WA 4JY6A 4CBPA 3GJEA 3PWVB 5E2UH 4JGJA 1YY9C 3AU1B 4XP9L 4NRYB 1W8NA 3BQUA 4L8BB 3S7GA 5J89A 1Z3GH 5GRVL 1AGDB 3SOBH 1NH6A 4DTGL 4HIEB 3U4BH 3EOBB 3UTOA 4MS8D 1JNLH 2DKMA 1K2DA 5KSBB 1DUZA 5TE6H 1F4YL 4EUPA 4CMMB 4EQ3A 3T0WA 3LEXB 2ILLA 2PUQT 2VABB 3EOAB 1MCSA 2X1XR 1U8LA 1DQLH 3V6OE 4FXLA 2IMMA 3IF1B 2EEDA 2OYPA 5LCVL 1YEDB 2IQ9L 3RL1A 1IKNC 4U3XA 4HF5L 1RZGA 1T20B 4IRJA 3DVGB 1UM5L 4Q9BA 5KZCD 2NYYD 3MR9B 1UCBH 5I71B 4OZFB 4XNMB 4M48L 2VDOL 5SX4H 5C0BD 4HK0B 1KF9B 4LGPB 2NY4C 5JW5A 1CXFA 1I1AD 2Y07H 5IHUL 2IPKB 4J3SA 3P4MB 5GIRA 2NXZB 2RHEA 4U49A 3GIZL 4TSCL 2EH7H 2HFFA 3ARZA 4HKBB 2WUBH 4P46A 5E1AB 1KIPB 2APTA 4GAYB 2Z8VC 1NFDF 4JN1L 3MLVH 2XWTA 4RZCB 2YA0A 3FO9B 5DEGB 1JI2A 2D0FA 5CCKH 1CICD 1FYTE 2VXVL 1CGWA 2Z92A 5JNYB 1GHFH 4PRIB 2FJHB 5ALBH 1I85C 2J8UB 3GMQB 5HYSB 1FYHB 1N5YL 3IJHA 4X4ZA 3T2OA 5ANMA 4QNPF 1R3HA 1IGJB 1RURH 2Z8RA 4X6DF 4HKXB 2P49B 1I7UA 1HYRC 4YGAB 5C8JA 5DMGC 4P23B 4R4FH 4UV7H 3U7YL 3RWGB 3H6JA 3WS6C 4NQDE 3PE9A 3GJFA 2RAMA 3EYQD 3O6FA 4G6JH 1XH3B 3L7FA 3SDDC 4KZEH 1CE6A 3QPQC 5E6YA 1W0VB 3OR7A 4UIMA 5D7JA 2OXHA 1PKOA 3T3MF 2R8SL 2X4SB 5E7FA 1Z6JT 2LV4A 2R2EA 4NO2B 4K71B 4PRAB 1U3HB 1IM9A 5BJTA 1HHIA 4YDJA 1X6LA 5MEQA 3MFFB 4QF1A 1JFQL 2JTDA 4QHLA 3PP4L 5DZOA 3RUGB 4F33A 1MCRA 3OBAA 1IGTB 5GSVB 4KXZI 1IQDB 5E2TH 5LG1A 1XR9B 2YD8A 4P2RB 4O5LH 3DV4A 2PO6B 5DVNA 4LASH 1DQDH 1MPAH 4TQEH 2OZ4H 5D5ME 1NGYB 3TIEB 4HSQA 4YEFA 3UMTA 5KW9H 1OQOA 2DLIA 4BUHA 4WEMB 2A6DB 2X41A 3V6OA 1FV1A 1FG2A 1P7QA 25C8L 3D2UA 4JFYA 3T3PF 2H3NB 4YHPB 2O61B 3S36H 2FJGA 3IDYB 4KAQH 4UDTB 1ES0A 5DMKA 4NZUL 4LVEA 4PREA 2YPLB 1S7WB 1GL4B 4NQED 5C71A 2DQEL 4PP2A 1OP3H 2A77H 1AI1H 4HK3J 5GS0C 5GXBB 1DE4A 4U6HB 4Y8AA 3E1F1 3VFNB 3QI9D 2UVFA 1H3WM 3RVTC 2RR3A 4U0RB 1AFVH 5I1DB 1NL0L 3DVNB 1FAKT 5E5RB 4I4WB 4LIQL 4HLZH 4KZDH 3AMLA 4RGND 2DJ4A 1S3KH 3TO4D 3DVFA 2DAVA 2DJUA 2VDRL 1NAMA 1FYTA 1CD0A 1I8LA 3P30H 5F7KC 3FMGL 1CLYH 3BSZL 4JHWL 4MJIE 1M4KA 2ZOKB 2O5XH 4ESKA 5GRWA 1PJ9A 4YDLB 1SEQL 3DI2B 5L7XH 5IR1B 5GS1C 1T2XA 1X7QA 3LMJH 3AREC 2UV3A 3EFDL 4NC1E 4NT6B 1X4ZA 3QFDA 1HWHB 2BOBA 3PQYA 4ZO6A 4O00A 2B1AL 1XT5A 2Y36L 7CGTA 5LWYL 2X42A 2EE6A 4ZFOB 3H9YA 4NQDA 2IBBA 2EO1A 1P1ZB 4YXLL 4PJGF 1IAIH 1TPXB 4EOWH 1EGJH 3TP4A 5EIQA 5E1HB 1S7SA 1JTOA 4LPYA 3M1BB 3B2VH 4KU1A 3PV6A 3BWAA 4KVNH 4ZXBB 1HEZB 1TDQA 4N1CA 1CK0H 1UACH 3DWTA 4F15B 1EAPA 2C3VB 5D1XD 5KBNC 5LGHH 2HMIC 1JGDB 4X6FB 4RNRA 4PGBA 3WL9B 2H1PH 4U6XB 1TTFA 1NFDE 5KTEL 1BQLL 4XCCH 2BNUB 3NH7L 4OD1H 5E00A 1MEXH 4MD0A 3BYTA 2Y23A 4FXGB 4LEXH 3DX6A 5D5MA 3D3VA 5JUEL 4M62L 1CDHA 2QL1A 2BSRA 4AMKH 2FL5A 1J0IA 3D39B 3STZB 5IFHL 1AHWC 2FO1A 4X5XB 5DT1H 2DTSA 3UDWC 3NN8B 5CP3H 1LNUB 5JPMB 3MRCA 5ISZA 3QNYB 3RY6A 3MXVL 1J05A 4N8VA 1P4IH 2FR4B 4N0RA 1H5BA 3HN3A 2CQVA 1KJ2A 3PV7A 5ESVA 3JUZA 1JF5A 1AQKH 4PB0H 2APVA 5BO1L 4HEME 1HHGA 2CDEB 4ODTH 1XGPA 1BFSA 2NY1B 3NCJH 4XMKH 3S5LG 1SBSL 2JCCE 4OCRH 3RVWC 1KTRL 2UY6A 2MTPA 4YBLB 5HYQA 1A7BA 4KK5D 1NCBH 4WFEE 3WDHA 2B8OT 3OXRA 2V9QA 3W9DA 3C2SA 5JHDB 4K3EL 1MJ7L 4U6YB 4BZ1H 2XZZA 3VG0H 1GAFH 4HUUB 4OZGB 3KNBB 5D96C 2X4RB 2Y9RT 1CFVH 2QR0B 4MJIA 1NGPH 1ZANL 1QBMH 3PGDA 4WTXA 3FONB 4Z95H 1YEJL 4PJEF 5T3ZH 3VXNB 3V52L 4H1LG 4IOIA 1DN0A 2BXYA 4HH9B 3VU2A 5IIEA 1OP5H 1S7QB 3WN5B 4X6CB 1VSCA 4EI5D 2V5TA 3WIHH 2ZUVA 1U2HA 3BPNC 3I3EA 5D1QD 3F12A 2W9EH 3F58H 3B6SB 5AUMB 5T5FH 5EZLA 4FFZL 5JXEC 4YHZL 3T3PE 1UA6L 5F96L 1O0VA 3HAEB 1RU9H 1TFHA 2F54D 3ARBC 3MV7D 5E5UB 4PJCE 3NCFB 4P4KD 3BOVA 1A0QH 3NIFE 1AY1H 2NY7H 5AYQA 1DBBL 3QEQE 4NNXA 4JQIH 5D7SL 1WTGT 1J8HA 1FSKC 2E9JA 3O6KH 5KS9F 1DBKH 5TGBB 4GLRI 3BT2H 4O51B 3BFOA 4M03A 5DO2D 5EOQH 2H2PC 3MBXH 4H8WC 2R2BA 2OBGA 3TO2A 1N8ZA 3TBTA 2WIIA 3QUZD 2H8PB 2VDQL 3DURA 1CD1B 4MQSB 4ODUB 5KVEH 3O4LB 2HJLA 3GMPA 2M1KA 3VXMB 2XNAA 1SM3H 3X3GL 3PXJA 1QSVA 3QIBD 4WENB 3QDJE 3ZKXB 4RCAA 4K2UL 4YHML 2KQMA 2NY2C 3TNNB 4AL8H 2DQGH 3CFIC 3T1WA 3V5DA 5HJ3A 3IDUA 4YWGH 1RZFL 1QNZL 4Z7VE 1FBIL 1P9MC 2FD6L 2W9DH 5KAQF 2ICWJ 1LO5B 3NCYS 2VLKB 4K9EH 4K7FA 3MO1B 5L6YL 4Q0XH 5IQ7H 1X5YA 2HG5A 2VISA 4IRSD 1VEMA 3G6AB 2JCCA 1IAIM 4PV8B 1R3KB 3OKMB 1NCUA 5CEXB 5EBGA 3X13A 4HWBA 4X5WB 5DJ2A 5GPRA 3S3PA 3WO4C 3B2UC 2E27L 3MNVA 3ILQC 4WHDA 4K3DH 1MRDH 2WUCL 1A2YA 4I77L 4PYGA 4UT9H 3RX8A 5LAXB 2HFGH 4XXCC 1U8MB 2NXYD 3F7QA 3M17B 3KXFB 5EFIA 2AEPH 4PUBL 2R0ZL 3G5VB 2XZAL 5DLML 5ACLA 2VZUA 1A6AB 5I1JL 3PGCA 4ODSH 1JK8B 4GT7A 2OL3B 4HJJL 4B7IA 5T3XL 4DKAA 5ESAA 4PGJA 3NPSC 4MDIB 5DS8A 3NFNA 3ARGC 3LS4L 4OLEA 3WV0A 3U6RA 5E2JA 4HFWA 4CVUA 1J0HA 1YNTB 4MXWH 4Q2ZA 2BSED 4RMVA 3S4SG 5FO7A 2X4TB 1J87A 4KI5D 3OB0H 2VMFA 5D9SA 2AABH 5HY9A 4PJCA 4XP4L 1XGRA 3VH8B 3Q0HA 5FYLE 2P1YA 3BH8A 1ZT1B 3LKSA 3ES6A 3O9WD 2VDLH 4CDHA 2Y5EA 4JKWA 5ENWB 1T0NA 5J6HA 4H5SB 3HI6H 5GGVH 4Z7WB 2DD8H 1G9NH 1DL7H 1G7HA 1T1WB 3FAXA 2DMBA 3MBEA 1JWUB 2NY6D 3EYOB 5E95B 4W70A 4DVRH 3MLZL 4QRRB 3IDIA 4U1NB 1U8KA 5IBUB 2AXGA 1YMMD 5C08B 5FOBB 3SDDB 4GKSB 2X05A 2E6PA 4YE4H 2APFA 4E5XB 3ZTNH 1YQ2A 4S1SL 2O5ZH 1CDBA 4A2MA 4ZYKB 1OAKH 5DF0A 3U7AA 3FOMA 3QXDB 5E7BA 5DWUH 1QBAA 3MRGB 3TVMD 4UB0L 4OLXH 3WO3B 5EBLA 4DFHA 3NZ8A 2GFBB 2UZIL 1LP9F 4MS8C 1P6FA 1HXMB 4WWKD 1EBAA 3EDFA 4ONHA 4LRIC 3SGEH 4ZFGL 3HMWH 2DLEA 3IXTB 3EOYG 4OIBA 5MENE 2DIJA 1XF5B 4QXTA 3AXLB 3WJJA 4LSTL 3VGDA 4Z7VA 2B5IC 5GRUH 4ZTPL 4XVTL 5IVNA 3MLTA 5ID0B 4PJ8A 4M6NH 1EERB 1YQVL 5GHWL 2G60H 3VI4E 3L1OL 5KAQG 1MHEA 1U8IA 3IFLL 3K1KC 4KKLD 2NYYC 4I1NB 4M1DH 4MNQB 5JXAH 4QY8B 3HUJB 5EU3A 5KS9E 4NJ9L 3BP6B 5KSAD 5GGQL 3CCHA 3LN5A 4XBGA 1PLGH 1MVUB 3FQTB 1H3PL 4KPHH 5KVDH 1I1AC 3KPSB 5CUSL 3VRLF 4HMEA 5LGKA 5C07E 2YPVH 2VXSH 4GAGH 4PJAB 1Y0LB 1ETZB 3UTTD 5JQHC 2FHCA 1VFBA 5E2VL 2Y1VA 4IS6B 1QSEB 3L9RA 3TPUA 3GSUA 4JO2L 2HLAB 3DO7A 4GO6B 3BN3B 1CICC 4NIKB 2CKBL 1Q9OA 1WC7A 3LY6A 1IAOB 3ULSB 4F7CA 4GQPH 3SGKC 1ZOXA 1NFKA 2FLBT 2WQRA 3MV9B 1E6OH 3MLYH 1T7VA 4AH2B 5BQ7A 2RIKA 2CRYA 4MAYA 3HE7A 4LVNC 5M95B 3DSFH 4IMLA 4G9FE 2BVQA 3CIQA 1NSNL 4HXBH 1U3YA 5FGBC 2DF3A 4X9HA 1K8IA 2PNDA 1E4KA 3EYQC 2J4WL 1ADQA 4OZ4A 2ATKB 3P3YA 3CFCH 3TNMB 2BVPA 3C6SA 5GS1B 2OP4H 3BKCH 3UO1L 3AREB 1CU4L 3ULVH 1EFXA 2L4OA 3RGVB 4Y5VC 1P4LB 1FIEA 3OKDB 1Z9LA 3IJYA 1MFAH 3I75B 2P45B 2VLJE 4OF6A 1RAMA 1EJOH 5IQ9A 3RWEA 5ACZA 3WFHA 4FNLL 4H25B 5J1TC 1GC1H 1G6RL 3BP7A 4MZ2A 4KRPD 2ARJA 4I3RL 5EUOB 3S98A 3VA2C 4IEFB 1ITCA 3C2AH 4JM4H 1RIHH 3U36B 4HZAA 4X4YB 4WNQA 5JR1L 5MENA 4XPHH 3KLHD 5E2UL 3A6CH 3FN3A 2D03L 1ZK9A 4EEEA 5CIPA 3G6JE 5E9DD 1WBZB 2CO7B 4HIXH 4XGZA 1Z3GL 3PL6D 3A6OA 2Z91A 3X11B 3U4BL 8FABA 3EDKA 1JNLL 3DRTB 2VN4A 4FQQB 4DW2L 5TDNA 4AY0A 4AIOA 1N26A 2BNQE 2VZTA 4LSVH 3QI9C 3P4OB 4K23H 4KTYA 1U58B 5DJDB 1J12A 4HV8B 4MB4A 2GSGB 2OJEB 1DQLL 5C07A 1FVCA 2DDQL 1UQSB 3RL2A 3CSYA 3DX8B 1XGYH 3MRJB 1T83A 2A6KA 5HVHC 2IALA 3LAFA 2EDEA 4HEPG 3TO4C 2F53E 2CGRH 1SJXA 5FA4B 1QFHA 4K8RD 3MRRA 4O4YH 1UCBL 4CADB 3HPLB 2QKIB 1FCCA 1R3LB 2E7CA 3BGMA 3VGAC 4J8RA 2Y07L 4P0DA 5HGHB 1QLFB 5CBAA 4TRPH 1RK0B 3FB5A 5GRXG 2ED7A 2CLZA 2WUBL 4G9FA 4V1DB 5D96B 5CKAA 1AC6A 3MLVL 1VACB 5IB2B 3FQUA 5CCKL 3OJ2C 1SJVA 3ELAT 2OTWB 2OX5A 1GHFL 2ERJC 5ALBL 3JWOL 4XXDA 3UPRB 2V9RA 4UUJA 3S96B 5HTSA 4DGIH 1H0DA 4I48A 4QXUH 2DICA 4KQ4H 3U1SH 5IROC 5F70A 4BSJA 2IPUK 2VLJA 3BPNB 4L4VD 3VCLA 4HH8A 1YC7A 4HIIB 5KN5A 3LN9A 4P9HC 2EDNA 1C1EH 3GM0A 3PP3K 5D71H 2QHRL 2DKSA 4DKFH 4UV7L 5EC2B 3O6MH 3DPBA 3RWDA 5FYLL 2F74B 1A6ZB 3L3OA 5ID1B 1HH6A 4G6JL 1CCZA 4WFHD 1ADQL 3QJFB 1G7JB 4JCLA 3FFCE 4KZEL 1IGIH 2YOCA 3QXAB 5IVOA 1BREA 1FSKB 4G8GB 12E8H 4JFXB 4HS3B 4MWFB 5K9QG 2ATPA 5IKCB 1PY9A 2V5SA 1YDPB 5HI5D 4RA3A 5TPWH 3HTLX 3D69B 1CXIA 1JHTB 3K4DA 3G5YA 3S6CA 3G6JA 3WHXB 4AIZB 4LLVB 1NANI 1YYML 2Q3ZA 2X4NB 5E2TL 2OJZH 5I66A 4OV5A 5F9WB 3QRFM 1BVLA 1BX2A 4PJ5E 5D2LB 5L88H 3MLPA 4PGEA 4O5LL 1J11A 5L2JA 1OF2A 1DQDL 5GGSY 1MPAL 4TQEL 2OZ4L 1T5WA 3RUGF 5FM5M 3LHPH 4IM8A 5F1KC 1ZS8A 4KK5C 1J8KA 3K46A 5K9QI 4RIRA 4WUUD 1INQB 2VLRE 3OG6B 3S36L 4I2XA 5HI3D 4KAQL 5I73C 4FTVB 5J4MA 1S5IH 2ICEB 5E0QA 3T08A 1Q1JL 1IC4H 1S78D 5HHOD 1AI1L 4HUNB 1K5NA 3QDGD 1ITBB 2CUHA 3O3EB 4X0KB 3WO4B 4WU7B 4D9RD 4F9PC 1NJ9A 4PV9A 5TDOB 2R56H 1YN6A 4LQFH 2H6PB 3PHOB 4XAKE 4FQXB 5GZNC 2EXYC 2WAHA 1B0GA 2AJ3A 4IDJL 3FB8A 3PWPE 1JL8A 3ARQA 4UU9A 1NMAL 5E8PA 3GKWH 1WFOA 5DK0B 5FDYA 3CUPA 3TBVB 6FABH 2AXJA 3HZYA 4L1DA 5BOPA 1S3KL 4EI5C 4IBLT 1NLDH 4ZOBA 1M7DB 3UX9B 3QCVH 3E2HB 3NPSB 1KGCE 1CLYL 4CU8A 4X99B 3SBWC 1YEKH 4P4KC 3CD4A 4JFEB 2X2YA 3PDOA 4LRNL 3LMJL 4JFOA 4ZTOH 4PRHA 5JW3H 5EUKA 5DQDH 4FFVD 1CFSB 2ZUWA 2YC1B 3GSWA 3AMKA 4OLVH 1KYOJ 2R1YB 5A16A 5DO2C 2DL9A 5IEHB 1EGJL 4PB9H 1FN4A 3QUZC 4LLUA 5F3HA 4PP1D 3HI5H 5KSBE 1QEWA 1TNNA 2AK4D 2LFGA 3B2VL 1GOFA 3EJYD 1QFUH 2F5AH 4KVNL 1NDGB 2ITCB 1CK0L 3PDDA 1HINH 2NZ9D 1T1XB 2DB8A 2DQDH 4YEEA 4IMKC 3DNKA 1I8IA 1II4E 3TYFA 2YN5A 4DCQA 5LGHL 2COQA 3OF6D 1YUHA 2NLJB 1R6VA 2FBOJ 2CRIA 3UEZA 2EYTA 4QRPA 2Y06H 1J1OH 1L4IA 2YBRB 4NM8L 4XWGH 2H1PL 5GJSL 4U1HA 4XAWH 4XCCL 3SKOB 1JYNA 3G9VA 5HHQA 4PJ5A 3CX5J 4OD1L 4R90L 1TITA 1MEXL 1A22B 2V9TA 1KB5A 4LEXL 3VFTB 3CDFA 2CJUH 3T65B 4IRSC 5ECJE 5TDPA 5BV7B 5KG9A 3CXHJ 3T4AA 4CVZA 3ZHDA 1A6PA 3GBMH 4AMKL 4JM2F 3LQZB 4L3AA 4XHJD 5DT1L 3GK8L 3KPTA 3P4LA 2IGFL 3PIQA 4MDJA 2B5IB 3D0VA 4XTRD 3LRHA 2NY5C 2VLRA 1P4IL 1NCTA 1OPGL 3MZGB 5DVMA 1KG0B 1PSKH 4PJDA 3MREA 1NAKH 2OTUB 2CIIB 1AQKL 1CXEA 4PB0L 4MA7H 4PRIE 1U8HA 1IGFL 2NXYC 3DO3A 2GYSA 4ODTL 2FJFA 1KTLB 2J8UE 3NCJL 3QNZB 5HYJE 5KZCB 3QDHA 2YD3A 2FH8A 4R8WL 4R4ND 1NC2A 3KYOB 1CWVA 1A7QH 1OSZA 4HX1A 1NCBL 2SEBB 3AAZB 4U1JB 3VFSA 3CFBB 3PWPA 4BQ8A 3TCLB 2GSIB 1QZ1A 2GCYB 3MV01 4RFEB 5HDBF 3BP4A 1FLRL 2OQJA 4BZ1L 3VG0L 1GAFL 2PTTA 2P24A 5I8CB 2GJ6D 4XC3L 1CGXA 2HTKD 3ESVF 4POYA 2ZG3A 4KI5C 4S2SA 1FVDA 1ND0A 4FABH 4UINH 4Z95L 3O9WC 3LIZH 4OGZA 2VE6B 5HI4D 3DOSA 4XVJH 3WXVH 5F1IA 4GRWF 4S1QL 3AU1A 1HCFX 3WIHL 1MCLA 2NY6C 1TVHA 1MFNA 2W9EL 5T5FL 4FQLH 1D5MA 3BW9A 2V7HA 1RU9L 3EOBA 1JI1A 1A0QL 4PBXA 5KSBA 1UG9A 1AY1L 3WNPA 1FPTH 1OSPH 4CMMA 4JQIL 1QPXA 5FYJH 2MOVA 3O6KL 4JRXE 3EOAA 1PBYA 4M93B 3TVMC 5C0DB 1DBKL 3Q6FB 2X40A 1B2WL 3IF1A 2P5EE 3QYCA 5DFTA 1YEDA 4Q9RH 3BT2L 3WDIA 5J6GA 5SWZB 3WKML 5T5NF 2LU3A 4WWKC 4LHJB 5J12C 4G8FB 2AEQH 2YPLE 2GUOB 4MHHG 1QLEH 2D31B 3VWJC 3VD4A 1LE9B 3MR9A 3FO0H 4XNMA 4KI1A 3CLFL 4LBEB 4HK0A 4ZUTA 4ELMA 2V2TA 1FFOB 1SM3L 3ZMRA 2IPKA 2D2OA 4KMQA 2J5LB 4WV1C 2V7NB 4PJBA 5D7KD 4H1LH 2JK5A 4C83B 4HS6B 1KIPA 3PDGA 2XYCA 4NYLB 2DQGL 5IOPA 5KSAC 2J6EH 3MCLH 4YWGL 1CTOA 4MLSA 1BWMA 3QXUA 5GGRB 4YBHA 5F7EH 1S9YB 1JZ8A 3GBLA 4PRIA 4K9EL 3V6BR 4Y19D 4Q0XL 5CILL 5IQ7L 1UB6A 3BPCB 1KB5L 4FFWD 5HYJA 4JFFB 5HYSA 4NQEB 1DFBH 5IM7B 3I6GB 3UYRL 4XNQB 1KN2H 5F72S 4PGDA 3C8DA 2V2XB 4P99A 4AEFA 3W11D 3R06B 1IGJA 4NO5B 4JPIA 3QI9B 1E4XL 3FT2B 1G84A 3BKYL 2EH8H 4NM4H 4K3DL 3C60A 1GPOH 1WIOA 4UT9L 5HVHB 1UZ8A 4TVSa 1CDIA 3MNZB 4KV5F 3WLBB 3THMH 4XNXH 1WVZA 2AEPL 3TO4B 2LU4A 4G80B 1W0VA 3SGDI 1UZ6F 4ZSOB 2W0FB 4KC3B 3D9AH 4APQD 3HC4H 4NO2A 1FCGA 1U3HA 4W4OC 4UOW0 2MNUA 5CGYC 4PLOB 4KUCD 2E9BA 3Q3GB 3MFFA 3CC5A 4U6TA 4NKOA 2AQ2A 1IEBB 1QSFB 1PVHA 4MXWL 4BKLA 4HT1H 3ZDXF 4C56B 4OT1H 2Z0BA 4RRPA 4H0IA 1MCPH 1WAAA 4O2FA 5CAYB 5JPNB 3EHBD 2ERJB 5FF6B 3WUWB 1BF2A 3O11B 4FXKA 4TNWF 5MHSD 1NGYA 2VDLL 3DECA 3TIEA 3D39E 3HZVA 3MC0A 3HI6L 5GGVL 1D6EB 2Y5TA 1RUML 2DD8L 3MLXH 4JRXA 3T8XB 1DL7L 5I1KH 2A6DA 4NJAH 2P5EA 4Z76A 1MWAH 1KJ3L 1MI5D 3VG9B 1RIVH 1AP2B 4RAVB 4DVRL 1GGIH 2H3NA 4B5EA 1JPTL 4NN5C 2X1QA 2MFNA 2OK0H 1EZVY 5T33H 3QCUL 4RBPH 2NY0D 4NO3B 3E6HA 3IVKA 4JHBA 4YGVB 2GI7A 3RWIA 4YE4L 3KLHC 3C5ZA 2O5ZL 5T5NG 4Z7WF 1OAKL 4MMXC 1B6DA 1EH9A 2Q87A 1GYAA 3PL6C 4OLXL 4PRDB 5INDB 1D5BB 1DR9A 5DC9B 1NBQA 4OCSH 3VWKD 4HC1A 5JHDE 3HMWL 2IH3B 5C6WH 1FZOB 2AVGA 3PWJB 2F8VA 1V5JA 4OZGE 1F4HA 2VQUA 5KANG 5GRUL 2VXTH 3NMEA 4KTEH 4I9WE 2FX8H 5HGAB 5LQBL 4M6NL 3NOIA 3X12B 4MD4A 2G60L 1PY4A 3FT4A 3IDMB 2W1NA 3CX2A 4IJ3C 5KVGH 3P2TA 3FQWB 4K8RC 4M1DL 1I8KB 1WFUA 4CMHC 2NZIA 4X6CE 1J10A 3NCYP 1PLGL 4KPHL 5KVDL 4ZFOA 1P1ZA 3L5HA 5CJOH 3G5XA 1LO4H 3VXUD 2YPVL 3MRHB 2LTQC 3CU7A 3VXTA 5CGTA 5F6IB 4NN7C 2ARWA 5KANI 3BO8B 3M1BA 4BSVB 1MJJB 4ZXBA 1KCUH 1HEZA 4J7RA 5EH1A 1L0XA 4D0DB 4EZMA 2C3VA 5B8CC 4WEUD 5I19H 3MLYL 4X6FA 4PJAF 5IG7A 3RIAF 3INUL 1S5HB 4G6ML 1WFNA 2EDXA 2EO9A 4HDIB 2X9XA 3MA7A 4EI5B 1T6VN 3ISWA 1CXKA 4AJ0A 2MQ3A 3DSFL 5DRWB 1F58H 3FQRB 2GK0B 3EO1B 2QQLH 4HXBL 4UV4L 2F54B 1KIQA 1KCLA 1HQRB 3QUMB 2R4RH 4AZ8A 3LZFH 4UQ2A 4P4KB 1OWRM 3RVVD 1U3JA 4P2QB 1T0PB 3D39A 3STZA 3CFCL 3BKCL 3EDDA 5JPMA 4YK4C 3ULVL 3WE6A 3B4NA 1T5XB 3QNYA 3HCVA 4JO4H 5DRNB 3HKFA 1ZT7A 1VFAA 1JGEA 5DQ9B 2YEZA 1EJOL 2PW2B 3RIFK 2ZG2A 1JNJA 1T0MB 1U8JB 2VLKE 3GO1H 1V7NH 3QHFH 4ZUWB 1HOCA 1RZ8B 5HI5C 4KV5E 1I1FB 3QUZB 4YDIH 5J57B 1GC1L 3KJ4B 4XBPB 2UWEF 5EU4B 3QJHB 4AK1A 5EZJB 1CYGA 4NSKB 1XF1A 2G9HA 2Z93A 3GIVA 4YHIB 1UJTA 4O2CB 3I84A 3C2AL 4JM4L 1RIHL 3L3IB 2IMNA 3ZYZA 1M7IA 3UJTH 4HUUA 1KXQE 2H32H 3KNBA 4OZGA 1UWGH 4XPHL 5DHXB 2P8PB 4I5BB 1JZ6A 4X4ME 3MRNA 2FWOB 1KTDB 4HIXL 1TZHB 3TPKA 1CG9A 3FFDB 3NAAH 4GBXB 2WBJB 5HI3C 2FLRT 5E4EC 1DZBA 4LHUG 2UYLA 3DUUA 3VXNA 3QAZC 1MJUL 3TBWA 2B0SH 1U6AH 4L8DB 1TIUA 2D7MA 4J2XA 1BGXL 1S78C 3GSNB 3ZYOA 4HC1L 1S7QA 4PGCA 4X6CA 3WN5A 1K6QH 4ENEC 2HTLD 5I8OH 1I8MB 4LSVL 4NN6B 5EOTB 3U48A 5AUMA 4LDEB 1Y18B 3HAEA 3CFJA 4ODXB 1XGTA 1HSBB 1PGRB 4TPRL 1WLHA 1XGYL 2ICCA 3SQOH 1RHHA 3QUKA 1C7SA 1VDGA 3WFCL 1KCSH 2CGRL 4O4YL 4PD4J 1MFCH 4YH6A 1EA9C 2BRRH 4GKNA 2XN9A 4BFBD 1JYXA 3GUTA 4O51A 4LCYB 2C7UA 4LGRB 4QRRE 5C08E 2FB4H 4PJFB 1FZMB 2P43B 4TRPL 1OW0C 4Y4KA 3SE9L 2H8PA 4LP5A 5C0IB 3B9KB 4YHKL 5GISH 4ODUA 3N50A 2X6MA 3O2WH 4NKMB 3A6BH 5D7JC 4FFVC 2QTEA 5AZEH 3KPMB 1GVIA 5H35A 4ODVH 4M7ZC 4OLZH 4NWUH 1W72H 3SDAD 1DBJL 3O9WB 3H3PH 1MCQA 1WUNT 4N90D 1SJHB 2BHUA 5FAAA 1FO0H 2IFFH 4QXUL 3TNNA 4KQ4L 4PP1C 4RWYH 1KB9J 3Q5YA 1IZJA 5EPMB 1YEHL 4NQVB 5EU7C 1LO5A 3O2VH 4GW1B 5D71L 2NZ9C 2ZZUT 5ALCH 4DKFL 1K4CB 1W8OA 2I24N 3O6ML 1X5AA 1DQQB 4RWHA 5JOEA 1JV5B 3HRPA 1M05A 5IGXH 1A5FH 1XIWD 2DM3A 4X5WA 2DMKA 3NFPB 1MCKA 3ARWA 2ADFL 3QFJD 3MRQB 3HUJE 1CGSH 2P7TA 3TVMB 1OAYH 2FATH 3IRPX 1ZT4B 1NMBH 1AD0A 1IKNA 2B4CL 5GGVY 5LAXA 2IH1B 5I16B 1U8MA 4WWKB 5J12B 4M1GH 3QULA 3VXPB 4WTWA 4XHJC 3VWJB 4MA8H 4X4MA 5IF0A 4HIHB 2OR9H 1UKSA 4NHUB 1QSEE 3OJVC 4XTRC 1JK8A 2GY7B 1F97A 2OJZL 2XG5A 3PABB 1JZ5A 1MRCH 1MCOH 3VDAA 2CDGB 4WV1B 3VGHA 3W2DH 3LB6D 5ELIA 2KBGA 3MV9E 3QUYB 1Y6NR 1DDHB 4QGYA 4PG9B 5F1NB 4R4NC 2A0LD 4OGYH 3LHPL 4E42B 1A7OH 2X4TA 5CSGA 4DJMA 5DJXB 2Y7QB 1NANH 2X89A 4MA1B 1DVFB 1RUQL 5I17B 4DAGH 3VH8A 1MIMH 2R4SL 1I85A 3TN0D 5D2LF 5F6HJ 4L3EB 4Z0BL 4JANA 1IC4L 4L8SC 4JVPA 1WEJH 4CVWA 3GMNA 2HTKC 5F7MC 2Z4QA 3HHRB 4QRRA 4U1NA 1NGZB 5E94B 4YUEL 4U6VH 5DK2A 4BQBA 1LVEA 3RWCA 3WS6A 5C08A 1BJ1J 3ZL4H 3K2UH 3G08A 1U36A 2Y25A 4OFDA 5HI4C 3GKWL 5ICYB 2DQCH 3C09C 5FYKH 1NLDL 2FO4A 4YZFE 4F3FB 3QCVL 2W65B 5I8KL 3QEHB 5EUOE 2WNGA 5INCB 4H26B 2DQHH 4ZFFB 1EEYA 4A6YH 1CD9B 1MELA 1HXMA 1YEKL 1CZ8H 3EO0A 4RX4A 3JV6A 2EDKA 1BEYH 2AI0H 4TYUA 1CFNB 1MFBH 1XF5A 5D1ZD 4P2OD 4ZTOL 3N0PB 5JW3L 1DLHB 3MX0A 2BDNH 1GGTA 3P4NA 2YSSB 2EDDA 1QRNB 4OCXL 4OLVL 3HG1B 5ITFB 3OGCB 4JDVA 1G7IB 5A43C 5ID0A 2NX5D 4NO0A 4G8EA 4NQCD 1AD9B 4TVPE 4PB9L 5FV2A 3P9LA 2P5WA 4QY8A 4LSRL 3HUJA 3BP6A 1QO3A 1QFUL 2F5AL 2N56A 2Y4SA 4NFBA 1MVUA 3RDTA 3H9ZA 3GSRB 1ZHNB 2R2CA 2PN5A 4NN5B 1HQ4A 1JGLL 3MJ9H 3GMRA 1A7PH 4UDUB 4WIQA 3IDNB 1KXVC 2O5YH 1AGEA 1T04B 5CD3B 1A4KB 1I3UA 1IGCL 3RY5A 4IS6A 1QSEA 5IHBA 2Y06L 1J1OL 4XWGL 5MP6L 3L3HA 4NRZB 3BP5A 4XNUL 4FQ1H 4XAWL 4YBQD 2IJ0C 1U91B 2F5BH 2OMBA 4B0MM 3PL6B 5JORB 3ZZ1A 1IAOA 3TT3H 1O5DT 2PF6A 1KULA 2CJUL 4FFWC 5H8DA 1HSAA 3JWDH 3MV11 2HJKB 4AH2A 3GBML 1QG3A 2VQ1A 4G3YL 4OZFH 3VFRB 4MB5A 3W11C 4WO4D 1SYVB 1EK3A 3KDMB 2I9TB 3D85D 3CVIH 4V1DE 1NFIA 1MJ8L 1PSKL 3UTSD 3O2DA 1HWGB 1NAKL 2EDBA 5D8JL 7FABH 3SE8L 3OKLA 4MA7L 5EG6C 4R2GD 3QISA 5GRYA 5T3ZD 1ED3B 5GS1A 3DGCR 2Q86B 1UYWH 2DN7A 4CMHB 2ADIB 1A7QL 4APQC 3GI9H 3I75A 1ZGLP 1WV7T 4F8QA 3WUZA 4MNGB 1NMCB 1TQBC 3U30C 1IARB 4XCYB 5HYFA 5E5MB 3DX7B 3H9SD 1CXHA 1D9KB 5HHME 4NN7B 3LH2H 3IFNH 4JRWA 4JLRB 3QZWB 1HHJA 4XMPH 4GSDH 5DGQA 3QSKB 2R0LH 5BZDB 5EUOA 3UBXG 4DGYH 4G8GE 1I7RA 1T2JA 3JWNC 4QOKA 4FABL 4Z78A 3RKDC 4UINL 4LSSH 5B8CB 4JPWH 4ZOCA 4G7VL 3LIZL 3MJGX 5SWSA 1BM3H 1U93B 4XVJL 4CNIB 1FIGH 3IFPB 3MRIB 5I75C 3LKPB 3P77A 1GOGA 1R3IH 1YPZB 4FQLL 3V5KA 5D2LE 3X11A 4DKEL 2NY0C 4RAHA 5BRZD 3DARA 5IB3A 3CJJA 1AHWA 4FMFA 3DRTA 1R5WB 2LU7A 4YK4B 1FPTL 3IB4A 4LAQH 1OSPL 3UBXI 2ESVD 3TLRA 3ZE1F 5FYJL 2J8OA 5DJDA 4HV8A 1HKFA 2OJEA 3BQUB 1UQSA 4Q9RL 1C5BH 3RZCD 3VWKC 4HXAH 2WWMD 5TE4H 4JDTH 2AEQL 4FZ8L 1CS6A 1QLEL 2JJWA 5EZIH 3RWHB 1DUZB 4CADA 2QKIA 3MMEA 4EUPB 2FZ3A 4HKJA 2IAND 2PW1B 1YEFH 1GXEA 3N9GH 4OFYD 4YQXH 4GOSA 1QLFA 3RL1B 3QHZH 4NQSA 4ISVA 2QQNL 1E28A 1GGUA 3WSQL 2KH2B 4DK3A 3HE6D 3IS1X 1JIBA 4V1DA 4OBRA 3QIWD 2J6EL 3MCLL 4WUUB 3DUSB 4WUKL 3V4UL 5B39B 2OTWA 3PNWA 5F7EL 2MCG1 3I6LD 4OI9A 2D7QA 1PQZA 4XH2A 2BNRD 1CDJA 2L0DA 2CK2A 2NTFB 3UTPE 3N1GC 3RY4A 1C12B 4NQTA 1Q9LB 2VDPH 1KN2L 2HFFB 4JFEE 3EO9H 3QDGB 4WW2F 1BZ9A 3P9MA 1MOEA 5JXEA 2A74B 2WP3O 3ESUF 2V17H 3ARBA 4M00A 5CGMA 1GPOL 1G6VK 3MODH 3K3QA 3JTTA 4ZPTB 4YLQT 4DEPC 1JGVH 3OAYK 1G7JA 3THML 4XNXL 2R0KH 5FK9B 3MGOB 2DMCA 3QXAA 4KJQD 3IJHB 1ACYL 4DWHA 4M3JA 3D9AL 4JFXA 4Y16D 3HC4L 3HR6A 1S7UA 1D5XB 3MBEC 2BK8A 3QG7H 5EWIL 5IKCA 4MQTB 3GMOB 2JJUA 4GKZA 5KSUB 3HZMA 3RVVC 5C70A 1A6VL 3GJFB 5CLWA 2XTJC 3V9FA 4JGUA 4G7YH 4AIZA 4JZJA 1FVEA 2BZDA 2X4NA 4HT1L 4OT1L 3QO1B 3OR7B 4UIMB 5D7JB 1OTTD 1QQDA 3L6FA 4M7ZB 2DLFL 2R2EB 4I0PD 5BJTB 1ZGLA 1UXSA 3P11L 4YDJB 2HRPL 1TJHH 1KBGL 3L3KB 1QTYT 4QF1B 1NCAH 4QHLB 4OLYH 5I15H 3GB7B 5DQJB 2C9AA 2YWZA 1F8TH 2AK4B 3U9PH 3MLXL 4MD5B 4Z8FH 4NJAL 1MWAL 4HCRA 3VFWA 1RIVL 1GGIL 4PJ7E 1Q94B 2EDRA 4LEOB 5ADPH 2H9GA 3DV4B 2ICEA 1F11B 2CMRH 3AC0A 3QXWA 4MCZB 5DD0H 3O3EA 4X0KA 5AD0A 4O02H 2H6PA 3PHOA 1FG2B 1P7QB 5MI0C 3D2UB 4JFYB 4XXCA 5C0AD 4GW5B 1ZA6B 4OCSL 1ES0B 1JZ2A 5DHYB 1NGWB 3TBVA 2V5RA 2G75B 3NA9L 4ZO9A 4PP2B 1KSRA 2HTLC 5IVXA 4DZ8A 4LP4A 4XNYH 4ZFZB 4LNVA 3MOBH 3ARGA 2PTVA 4KTEL 2VWEC 2BHYA 4KRLB 2GITA 2FX8L 1R5IA 4GRWH 4X99A 4Y4HD 1B4JH 2XKUA 1MNUL 1F5WA 4G9DA 4PJHB 3WFBH 5CINL 4XPGH 1BHGA 5DD3H 5KVGL 2YMXL 3MRMA 1NAMB 4BFEA 2R1YA 3UTZA 3ULUF 4DZBA 2XWBA 5CJOL 3RGHA 1LO4L 1V3KA 1S8DB 4JY5H 4EBQL 5K9JH 1J9CT 1JGUH 1E4KC 1UT9A 4L8SB 3KHQA 1P84K 2P44B 3V8OA 5J1AA 1X7QB 3ULVD 2GJ6B 3LKQB 1NDGA 1P5UA 2DM7A 3PQYB 3QFDB 2ITCA 4CVXB 2M26A 4GJTB 4NQDB 3SDAC 4DKDC 2J88L 5I19L 4R7NB 2IBZX 3C09B 4NDMA 2CUIA 1MAML 1NBZA 1S7SB 3BJ91 3SKOA 5FGCE 4KDTC 4JZOA 1H8NA 1D5IH 1WIPA 5DZLA 1T7WA 4EDWL 3CVHA 3VFTA 4NCC2 1IC7L 3T65A 4RQQA 1QACA 2R4RL 3FRPG 4C54A 1EAPB 1MREH 5BS0D 1QFPA 2XQBH 5CKGA 4LRIA 3AM8C 3VXQA 3O3BB 1XIWC 4EXPX 3RQ3A 4NBYB 5IJKC 4RNRB 2R2HB 5EO1B 4RMWA 3KWWA 4JO4L 1D6VH 3LQAH 1BBDL 4M7LT 4PJ7A 1J18A 1KG0A 2YD5A 2DLTA 4F57H 5CEZH 5FGSA 5E00B 4WU5A 2OTUA 2CIIA 4MD0B 4PY8J 3WFZA 3GO1L 1V7NL 3HNSL 3WD5H 2HKFH 3D3VB 2FYYB 4JFFE 4NQEE 3WS3B 1NC4D 4YDIL 1RJLA 3AY4C 2WSKA 3ZE2F 5L2KD 5C0BA 1LHZA 3CFDA 1G7LA 5ISZB 4M4PA 1I1AA 1J05B 4N8VB 3AAZA 3CAFA 5EZOH 4U1JA 1H5BB 1UFUA 4HCRL 3CFBA 4NC2B 4K7PX 3TCLA 5J13C 2NQCA 2GCYA 5L0QC 4ZMAT 4RFEA 4UT6H 3VXSD 1HHGB 1XGPB 3UJTL 4JJ5A 3AGVA 2A0LC 1UWGL 5I8CA 3KPNA 3W82A 2Q8BL 4ZSOE 3BEVA 4LPXA 1CICA 2AW2A 3IU3A 5HYQB 3MRLA 1RV6X 1J5OL 1LEGA 3TN0C 1E6JH 3NAAL 3OXRB 1QKZH 3SGKA 2XY2A 4URTB 3EYSH 5FV1L 2B0SL 1U6AL 1MAJA 2FDBP 3F62A 2OL3H 4JY4B 1QSFE 4TNVK 4AENB 1K6QL 3P0VH 3QWQB 3JV4A 4BJLA 5I8OL 1WBXB 1X5KA 5FGBA 1TTGA 3IDXH 4MJIB 2HAZA 1A6WL 1NPUA 3MZTA 3K8MA 1OGAD 4JFHD 4OZIB 3V4PH 4F7TA 1G1YA 4FQCH 4IOIB 5I0ZA 4Y5VA 3BYYA 4QTIH 5IIEB 1PX3A 2WMPA 4APQB 1MFCL 1BPVA 3CPLB 2B2XL 3X3FH 5EZLB 3O3UN 3U30B 1LO2H 5DUPL 1IFHH 2FB4L 5IB5A 2D31A 2X4QB 1T7XA 4HS8H 3KR3H 5D1ZC 5GISL 4P2OC 1KCVH 5A40E 1B3JA 3O2WL 5GGSB 3A6BL 3WNKA 3EJJX 1J8HB 5AZEL 4ODVL 4UILH 4OLZL 4NWUL 1W72L 2V7NA 3QUXD 3H3PL 4W6WB 4UI2A 3QEUB 1WSST 3L3GB 4PJ9D 2VDNH 4C83A 1FO0L 2NMSA 2BXZA 3BDYH 4M1CD 1N8ZB 4NYLA 3TBTB 5I75B 4D9LH 1IC5H 3S9DB 4P2CG 3DURB 3CSGA 1MI5B 1T03L 3Q6GH 2I5YH 1Q8MA 3LEVH 4Q6YA 1J1XH 3I6KB 1S9YA 3O2VL 3GMPB 2MPAL 3BAEH 4LPVA 2XNAB 4OGXH 3ULUE 5FDWA 2NY0B 1VKXB 2GJZB 4NQEA 2W9LA 3K74B 1BFOB 3VI3F 5IGXL 1A5FL 4NO5A 1S7VA 3QI9A 5L8KB 4UAOC 1MCWW 2XXCB 4YBQC 3V5DB 1CGSL 2GW5A 1OAYL 2FATL 5HJ3B 2KZ1B 3BKJH 4IHOA 3ARFD 5JOFB 1PZ5B 1XGQB 2GQHA 2HG5B 3WLBA 1XCTA 4M5ZL 4Z5RA 3TO4A 4OQTH 3RPKA 3ZSTA 2X1OA 4G80A 4WO4C 2LVCA 3X13B 4YPGA 4NCDA 2BRQA 5FXCH 1B90A 1X5XA 1A2YB 1MRCL 1QR1B 4Y4FD 3LD8C 4R2GC 2Q76B 5EFIB 1P6AB 4FP8H 4O58L 4OGYL 4AM0B 4CRPA 1INDH 4OFVA 3ALXA 1A7OL 3T04D 4X80L 2CDFA 4NUJA 4UNUA 5JPNA 4DN3H 3RA7H 3O81A 5ESAB 4OM0H 5FF6A 5DS8B 1MIML 2F54E 3NFNB 1PAMA 3O11A 3WUWA 3MV7E 2Q8AH 4P2QE 5EIIB 5F7LB 4HFWB 1K85A 5IROA 1WEJL 4YHYC 1WT5C 5FUZH 3KLSA 1AQDB 5I2IA 2QADD 5BXFA 5JDSA 2ADGB 1LK3H 4NC0B 1AP2A 2BC4B 4U6VL 4L9LA 5D1XA 5D9SB 5HY9B 1U3ZA 4LSDA 4PJCB 1XGRB 3K2UL 3GI8H 3BE1H 2EDWA 1FNFA 5IEKA 3LKSB 3ES6B 1N59B 2DQCL 4OF5A 1T0NB 5J6HB 5E8NA 1G6RB 5FYKL 4EN3D 2DYPD 2R9HD 4KRMB 4CDGC 4NHCH 1N0XH 3MBEB 5IFAL 5INDA 1D5BA 3AFLA 3REWA 3DBXA 1U8KB 4A6YL 1FZKA 4N8CL 3SE4C 4HIJB 5F97E 2XTJB 1CZ8L 2IH3A 3GRWA 1FZOA 2AI0L 3PWJA 4I3GA 4X7TB 4XT1C 4JRYD 1BQHG 2ZUQC 1I9IH 5J3HC 2BDNL 5E56A 3C5SA 3NCEB 2EC9T 4K9EC 3RZCC 5EBLB 2IAMD 3X12A 2WWMC 1MLBA 3C08H 1F42A 1H3TA 4LMQE 3FQWA 3MV8A 1I8KA 3M45A 4TUOB 5IW6A 2JJSC 4J6RH 4KDVA 3MRBA 3MNWA 2PYFB 4TVPH 5HHXH 4Q58C 3MJ9L 1A7PL 2P8MB 3MLTB 2WANA 3ZHKA 2Z31D 5E8EB 4G43B 3HE6C 5A1AA 1MJJA 4F9PA 3MCKA 1GCFA 4U1MB 1YECL 5J56B 3QIWC 4M02A 4X7DC 5K59F 2YHGA 5EU6D 2BVUA 2F5BL 3CCHB 4XBGB 3N85H 5MI0B 2AGJH 1A14L 3GEWB 4CU7A 3BD4A 4UNVA 3JWDL 5DI8A 3HPJB 1S5HA 5I18H 4PJFE 4HQQH 3VFMA 3EYUH 4DOHB 1NEZB 4EI5A 4ZUSB 1AE6L 4KWUA 4MA3B 4PG2C 4WFED 5D1QA 5DRWA 3TPUB 2GK0A 3ZKSD 3OTTA 3EO1A 5DJZA 3W9EA 2F54A 3RU8H 4KKAD 4XPAH 3GDBA 2DQUH 3MV7A 1F2XK 1Q9OB 1WC7B 7FABL 1UM4H 4P4KA 4F7CB 5BZWA 1MIEH 3FHAA 1CIUA 1F3DH 3VI3E 4KJQC 1S9WB 1UYWL 5DRNA 1G9NC 1MHPH 3IXAA 4WJ5A 4Y16C 4PTUB 4Y2DD 5DQ9A 1UCTA 2PW2A 3SCMD 3VXRD 2BVQB 1U8JA 5HXMA 5T1DH 3SKNB 5FM5O 1JPSH 2ZNWA 4OZ4B 3SDXF 5DJYA 2BVPB 1N2RA 2F19H 4Z7UA 3U0WH 1B0WA 5EU4A 3NCMA 3QJHA 4GSDL 2DI7A 1OT1A 2R0LL 1CE1H 4DGYL 1OTTC 1F4WL 3IJYB 5DD5H 1IQWH 3QIBA 1XR8B 4I0PC 5IQ9B 3SDAB 1AXTL 3TCXA 4JPWL 2E5EA 3QEQD 3RWEB 5BMFH 1S7XB 5ACZB 3GNML 3NTCH 1BM3L 4PTTA 4TULH 4V2BA 2P8PA 4I5BA 4L4TD 1KACB 1YC8A 5CHNB 1UC6A 4FQ2H 4YDKL 4YPJA 1KTDA 3VD3A 4LKXA 2ARJB 5DD6B 3QP3A 4LSUH 4M4RA 4IRSA 3MACH 2C4FT 4LARH 2CIKA 4L8DA 1DBAH 5HGBA 2AAVA 3WEXA 2WLYA 4YHLH 5GS3A 3EBAA 5DA0B 1TENA 3GRWL 4LAQL 4ZS7H 1I8MA 4WI9A 1ZTXL 5CIPB 3CMGA 2VRAA 1Y18A 3QDJD 3OGOE 5LJYH 4ODXA 4XGZB 1HSBA 5JIIA 1Z5LA 5C0CD 3V0AC 1YPZF 3HI1A 2GAZA 5B4MD 2VXUH 4HXAL 4MLIA 5I1HL 2AEIT 1UEYA 5TE4L 4JDTL 3UTTE 5A2IH 4HULB 1HNFA 3D18B 5EZIL 5TDNB 4QT5A 4HGMA 4Z7OF 1ORSA 4OTXL 4PJIE 4LCYA 3N9GL 1VEPA 1NBVH 4XPTL 1C7TA 4Y4HC 4YQXL 2DQJH 5C07B 4C55A 5TE7H 4WEBH 5TFSH 3SE3C 3R8QA 2DTML 3RL2B 4TOYH 4PJFA 1KEML 4WVRA 4D8PA 2HVJA 3T0ED 1YY8A 5C0IA 5D72L 2IALB 4ZAKD 3RVXD 4QWWD 4ORZC 4UTAH 1BJMA 3MRRB 5AG9A 4HD9A 5F7WC 4QEGA 3TJEH 3BGMB 1OLLA 4J8RB 1VCAA 3O9WA 2MWCA 3NPZB 4WDIB 1JHKL 4HHAA 2VDPL 4D3CH 3EO9L 3ULVC 1UENA 5IHLB 1RZJH 4LCCC 5GRVK 2BHZA 5GGTH 3CH1B 4X8JB 4NQVA 2O93L 4GW1A 2OSLA 1K4CA 1YMMA 1QRNE 2V17L 1T2QH 1DQQA 3HG1E 3MODL 3GZKA 4XCNA 2VC2H 3FN0L 4KJYB 1MCDA 4ALAH 1JGVL 3RHWK 5CBEB 2L7UA 4WTZG 4JGMA 4UUJB 1NLBL 4YXKH 4ZOEA 1GC1C 3NFPA 1ODAA 4I48B 3ZE0F 3MRQA 3TVMA 3KPPA 5C0RH 4BYHA 3VCLB 1ZT4A 1VPOH 4QCIB 3QG7L 2EXWC 3FQXB 5I16A 3KHOA 1X4XA 2OTPA 4WWKA 3C5JA 3RWDB 3L3OB 3VXPA 1GOHA 2E6QA 1HH6B 4HIHA 4NHUA 4P2OB 5F3BB 5E9DE 1A9EB 4CN4A 1F90H 1S7TA 4NNPH 3EYVB 2WK2A 3TA3D 1V3JA 2VIRB 2ATPB 2DQFA 1JRHI 1CL7I 2E8ZA 4WV1A 4NQCB 4AQOA 1NCAL 1DDHA 3RWFB 5I15L 3MRPA 5F1NA 1F8TL 3U9PL 5KSAA 1OP9A 4E42A 5JHLH 1RMFH 1SVCP 5DJXA 1A1MA 4Z8FL 2E9WA 5BV7H 1YNLH 4OCNC 1FH5H 1BX2B 5HSFA 4PGEB 1CGVA 5L2JB 1H15A 1OF2B 3UTTA 3OXSB 2CMRL 3F7PC 2A6JB 4G6KH 5DD0L 5C9JA 1T5WB 2ICWA 4UAOB 3DGGA 1L9MA 2OLDA 4XWOD 4PJIA 3E6FA 4O02L 1NGZA 4GMTH 5M94B 4RIRB 5T1LD 3SN6N 4MNGE 4F7MB 4I2XB 1VFMA 4N0YH 2AV1B 5ICYA 5E08H 2YXFA 1Q0XH 1H3VA 3D85B 4F3FA 4XNYL 4W4OA 3UTSB 1NJ9B 3MOBL 4PV9B 4EI6A 4H26A 4F37K 3GFUA 2HH0L 1UH2A 4DVBA 1EO8H 1B4JL 1A3LL 3LD8B 4R2GB 4KJWD 3FB8B 4EUPG 4UU9B 5A3ID 5E8PB 3WFBL 3LQMA 3DJ9A 5DD3L 3K1DA 1EDQA 1G7PA 3QQNA 4WFGE 2J2ZA 2DQTL 2YSSA 1UVQA 2AJSL 1IAKA 1JBJA 5ITFA 2XG4A 3SGJC 1N5AA 4K94H 1ZLVK 1TVDA 4GG6E 1AD9A 4Z7QE 3PDOB 4H0HB 4QHNA 3N1QC 2XQYG 4WFFD 1ZLUK 4P5TD 3GSRA 4PRHB 1CBVH 1FAIH 4JR9H 3F8UB 2B4CC 3IDNA 3GSWB 5I0DA 1T04A 1VESA 3BH9B 3RBSA 3QUXC 1CR9H 4NGHH 2AK1L 2HFTA 5A16B 2IADA 3HLAB 4PJ9C 3KPRD 1R24B 1WK0A 4M1CC 4OSUL 3VGFA 5DMYA 3L5IA 5E9DA 4NRZA 5F3HB 1JWMA 4KJPD 5FKPA 3FHQA 1U91A 1OY3B 5I1LB 3PL6A 1D5IL 3LCYA 1PW3A 5EU5A 2FGWH 1C5CH 5BRZB 2HJKA 1MREL 2XQBL 3R8BB 1I8IB 3TYFB 1RZIA 4DCQB 1T80A 1XF3B 3VFRA 4LIQE 1YUHB 3MUZ1 1SYVA 2I9TA 1KIRA 2EYTB 1QBBA 4QRPB 1MQKL 1D6VL 3LQAL 3P40A 5JQ6H 1IEAB 4FQPA 1HH9A 3ARFC 3LPFA 4WUUE 4F57L 5HHQB 4LCWD 3SDYL 2H41A 3RZCB 2WBWB 1KB5B 5J11C 1CI5A 4P3CL 3WD5L 2HKFL 4HAFA 5TDPB 1ED3A 2RCSL 1VERA 3T4AB 5KG9B 4CVZB 3OHXA 2OR7A 2Q86A 1EJ6A 1S9VA 2K7QA 1SY6H 4A2LA 4WGWB 3QDGE 2ADIA 3GBNL 3FTGA 4D9RE 3PIQB 4MDJB 1JF6A 4XPBH 1EV2E 2NW3B 5EZOL 4MNGA 2W0LA 4OLWL 4PJDB 4XCYA 4Y4FC 2BY1A 3DX7A 1T1ZB 2BNQD 1ZV5A 5D5MF 4X6EA 3QZWA 4Y8DC 3ZDYE 2CSPA 3DYOA 4Y0GA 3QIWB 5BZDA 1Y6KR 1NC2B 2ZCHH 4LOUD 2CLRA 4J4PD 3N1MC 4HX1B 5M7QA 2EKSB 4RAUB 1KENL 3ETBF 2BNRB 2FECI 5CP7A 1LEKA 1E6JL 5B8CA 1QKZL 2F53D 2Q20A 3E0GA 3GJFK 3EUUA 5JOPE 3EYSL 5DMIH 4CNIA 1L7TL 3IFPA 3BP4B 2OQJB 3P0VL 4L4VA 2QADC 2PTTB 3CMOH 2P24B 2EDYA 3H3KA 4YC2C 4S2SB 1FVDB 5DD1L 1ND0B 4GG6A 3SDCD 5TQ2L 5JLZA 4ONGH 4FQCL 2P8LA 3TC9A 4QTIL 5F1IB 2R9HC 1DN2A 2AK4E 4Y16B 5GZOC 1OGTA 2NY3B 2EEAA 1TETH 1CF8H 2VNCA 1TVHB 1D5MB 3BW9B 2CH8A 2V7HB 3IFOA 1IKFL 4OD3H 1IFHL 5D93B 3DHMA 4MJ4A 3KGRA 3KYAA 3RWHA 1DEEA 4P9HH 4WRLA 1KCVL 5F21B 4TTDD 4JFDD 4WI8A 4J3VA 2PW1A 1IJ9A 4JO3L 1HILB 4C59B 4OIIL 2BERA 3FFCD 4P2YA 1QSZA 2IAMC 5J6GB 1GGBH 1CFQA 4FG6D 1MFEH 2VDNL 4PLJD 1JNNL 1IC5L 5JW4R 1I9JH 2BSSA 4WUUA 3DUSA 5E99H 2I5YL 1FC1A 5B39A 4ZUTB 1C5DA 4ELMB 2V2TB 3BAEL 4NWTH 4OGXL 2NTFA 43C9B 4XPFH 1LGVA 1C12A 3DXAD 1N64H 1Q9LA 5ETUA 1MCJA 3MLWH 5HHOA 4EVNA 2ZUXA 2F8OA 3QDGA 4PJBB 3ZT5A 4PJHE 2LAGB 1SEBB 2JK5B 3ULUH 1I1CA 2A74A 2VR4A 5IOPB 1X44A 1TVBA 4K7PH 3BKJL 3VFOB 2W0KA 4ZPTA 3D0LA 3MCG1 1TCRA 1YZZA 1UB6B 2FSEB 2VZSA 5HYJB 3L5WA 5FUOH 5C2BH 5FK9A 4OQTL 3MGOA 4PGDB 1LWRA 4K8RL 2VQTA 1HI6A 2GJ6E 1T7ZA 3NIDE 4JPIB 2FRGP 5SWQA 4AG4L 1D5XA 5FECB 5CZVH 1QFOA 3PQYE 1U0QA 3B9VA 4KKAC 2N7BA 3C60B 3GMOA 4KK8C 5KSUA 4Q9QH 1ONQA 2X9WA 1OW0A 3UPCA 1GIGH 1P7KA 1UZ8B 4N8VG 2VN7A 4FP8L 1AO7D 1JUFA 3MA9L 3D1MC 2JCCF 5SX5H 5FYKD 1T6WA 3QO1A 1INDL 3EZ8A 4Y2DC 3NACH 2K9UA 3OV6A 5I6XB 3VFGL 5D7IB 1R3JA 5HHNB 5KOVC 1U41A 2Z9TA 3KYMA 2Q8AL 3SO3C 3CC5B 3L3KA 4NKOB 3GB7A 5DQJA 2DWDA 5AWNH 2AK4A 2W59A 4LCCB 4MD5A 5FUZL 1KGCD 4BKLB 5F7DA 4N9GA 2XA8H 2XWJB 3QUMH 5GJTH 3AB0C 4O2FB 1Q94A 3U2SA 4LEOA 3S34L 3OF6A 1KCRH 1F11A 4ZPVA 3GI8L 3BE1L 4FXKB 3D3VE 4MCZA 4Q97A 5D70H 3HZVB 4PY8I 2Y5TB 1QBLL 4TN9A 1BJ8A 4JRXB 3VFVA 1N0XL 5ISZE 5LBSH 2P5EB 4Z76B 3RDTC 5JTWA 3PJSB 2FHBA 4GW5A 1ZA6A 4PJCF 3LEYH 4XBEH 1NGWA 5DHYA 2G75A 3E6HB 3IVKB 5D7KE 3QQ3B 3NIFF 4F7EB 3BUYA 3RWIB 2LAAA 3C5ZB 3MOAH 1FFPA 1E0OB 4ZFZA 1I9IL 1FP5A 5ITBH 1MSPA 1AKJD 5T3XE 2HVKB 1TJIL 4WHYG 2E7LC 5F8RC 4R26L 4GXVH 3W0WD 4Y19E 5B4MC 1X5IA 1NC4B 3BKML 4PJHA 3CX5K 2IEPA 5L2KB 4FHBD 4J6RL 1P2CA 3CH8A 2NXZD 5DJ0B 2QSCL 5HHXL 5DEFB 2MQCA 4XNZC 3KS0J 3GSNH 1S8DA 2AEWA 4OZIE 4L8SA 4Y89A 4MD4B 3T0EC 2C1OB 2EIZA 3FT4B 4BZ2H 2GJ6A 4ZAKC 3RVXC 4QWWC 3LKQA 1OARH 1AGFA 4ERSH 5EO9B 4XC1L 3NGBC 4CVXA 4RMRA 4POZD 4Z7VF 5DSCA 1G7QA 3H42H 3N85L 2WQ8A 2AGJL 1FL5A 3G5XB 4R7NA 3V0WH 1WCBA 4HJGA 5I18L 4HQQL 3VXTB 1A4JA 3L95A 1YNKL 4P23D 4U1SA 4ZUVB 2AKRA 3ARPA 1J8HE 1U42A 4XPAL 1C08A 3U7WH 2DQUL 1OGAB 2ZG1A 3G9AB 1UM4L 3MJ7B 1MIEL 3O3BA 4QXWA 1EUTA 5MHSE 2QV2A 5IG7B 4RGOL 1Q0YH 2R2HA 3L7EA 2G5RA 5EOCJ 5EO1A 3FQNB 1K3IA 1MHPL 3MA7B 2E8YA 3D6GA 3LKRA 1MI5E 3OSKA 2HT2D 3MGTA 3I50H 1KIQB 3FB6A 1S7RB 2V2WA 1GRWA 4U2ZA 1UXWA 2FYYA 3FAWA 1DSFH 4UQ2B 3WS3A 2F19L 4FRWA 3U0WL 2HKHH 4R97C 4JG1H 3WE6B 3HCVB 4P2RD 1IGMH 3L3DB 4LVHC 1CE1L 1ZT7B 1VFAB 2PO6D 5DD5L 4J3XA 35C8H 1JGEB 3TA3C 1T89C 2YEZB 4JB9L 3O3DA 3OMZA 5BMFL 1RIUH 1RI8A 1HOCB 3BGAA 4Y1AD 3NTCL 1ZLSH 1NCDL 1MHCB 2UUDK 1PG7X 3T0BA 2YUXA 3MV8D 4NZTH 3GSOA 1GH7A 4M5YH 1TZGL 4LSUL 4Y19A 1VB9A 2YPLD 2G9HB 3MACL 2Z93B 3GIVB 5AZ2L 2BJMH 1DBAL 4D0BA 3UYPA 3BDXA 1Z2KA 5AAWA 3PGFH 4JY4A 4L5FH 1M7IB 4YHLL 4AENA 5CZXC 4ZS7L 1WBXA 4XWOC 1RUPH 3MRNB 3DSNA 3BUTA 4PJXB 2A2QT 4KK6D 1OWWA 3WDJA 1CG9B 4LKCA 2N1KA 5J11B 4E41D 2EDQA 4OZIA 2VXUL 3VXUE 2UYLB 3DUUB 2HT3D 3RJDA 3TBWB 5GSRA 5AYUL 1KLUA 4QO1A 3TWCH 5GGUA 4PGCB 4APQA 1MHHA 3CPLA 4FQJH 5C0EB 2A9ML 4I3SH 5I1GL 4U3HA 1A6UH 1UB5B 5F9OH 3V7AE 5B38A 5IMLA 1NBYB 1NBVL 3CFJB 1XGTB 1I7ZB 4KJWC 4TOYL 4UQ3A 4WEBL 1RPQA 5I1EH 2RFXB 3VI4F 3PXHA 5A3IC 2X4QA 4DN4L 2BMKB 1RHHB 3Q2CA 3QUKB 4KQ3H 1A47A 1D5ZB 2EDTA 4U1KA 5GGSA 4U1IB 2MJWA 4UTAL 5E24E 5T1MA 4P4RA 3GGWA 4U1GC 3TJEL 1TQCB 1TJGH 4GKNB 2XN9B 2VL5A 4WHTA 3BWUC 3GUTB 2E7MA 5E8DL 1KOAA 2C7UB 3H7LA 3S35H 4M7LH 5CJXC 4TUJA 3QEUA 3VMPA 3L3GA 1GGYA 2XTJE 3AS1A 4WW1A 4Y4KB 4D3CL 4P5TC 1MH5A 2VUOA 2JIXD 3W81A 4JZJC 1MI5A 3IRZA 3I6KA 4YC2B 1BJ1H 3B5TA 1N7MH 5H35B 5BVJB 4JM2D 3HRZA 4J23A 1T2QL 4U2YA 1VKXA 2GJZA 4UIKL 2VC2L 2X4OB 3FZUD 4YAQA 1MY7A 4ALAL 1BFOA 3OL2A 4YXKL 4KJPC 3ZYJA 4BH8A 1ZLWH 1VPOL 5JOFA 4W4NA 3IKCA 1VGKB 3LN4A 1PZ5A 1XGQA 3VWKA 4U3CA 2F9BT 3PWNA 4EKXA 5DJ8A 5L8LB 4HGWA 4XX1E 5EA0H 1M05B 4JRYB 1KNOA 1QPPA 3DMMD 2IQ9H 2ZUSA 2CKBA 1F90L 3SKJH 2P7TB 1KPVB 2DLGA 1QR1A 5E6ZA 2XPGB 1AD0B 4PRNA 1SMAA 4XCEA 4ODHH 5JDJA 1UKTA 2Q76A 2MHAB 3BZ4A 4C4KT 1FL6B 5I9QC 4XHQA 1EEZA 3QULB 2VDOH 4YHNA 1EHAA 4AM0A 4DOHE 5IF0B 2OM5A 1BIHA 1RMFL 4Z77A 5JHLL 3JTSA 1YNLL 2NY4B 3GIZH 4DK6A 4TSCH 1H8SA 3LKOA 1FH5L 2BY0A 5JHDD 2CD0A 2VWEE 3VXUA 4K3HA 4X6DB 5EIIA 4JN1H 5TJWK 1JRHH 1CL7H 1U9KA 5IMOB 2Q7YA 4LLWA 1AQDA 4G6KL 2VXVH 3G6JF 1ZEAH 4LPUA 2ADGA 3AS3A 4LOUC 4J4PC 2BC4A 2K3TA 5T1KD 4K3JL 4GMTL 3B5HA 1AGCB 4JAMB 2G5BB 4J12A 3TYGH 3BEWA 1N59A 4ZG1A 5E08L 4JANB 1Q0XL 3SHSA 1G6RA 3NVQA 2YUZA 2ITDA 3GSVB 3GMNB 3U7YH 4GRLD 3V6FA 3QNXB 5J0BA 3O8XD 3CXDL 3QB7C 2Z4QB 4GFTB 5FCUH 3SDCC 5DK2B 3RWCB 1EO8L 1OHQA 4HIJA 1I7TA 3G08B 5TF1L 1FNGB 2R8SH 3DIFA 4X7TA 1AGBA 1F6AB 3R0NA 3G04B 1IMHC 1JHLH 2FO4B 4XCFH 3V4VH 3VXRB 5DJ6B 2AJVH 4AT6B 2LQRA 3DHJA 4IRZL 5DVKA 4K94L 3FRUA 1EEYB 3MLUH 3DETD 3SO3B 2FEEI 3ARTA 3QWRD 1OB1A 4EDXA 3O4LD 3EO0B 1T21A 5BW7C 1OAXL 3JV6B 3KPLB 3S5LB 4TUOA 1GZPA 3LDBC 4OM1H 3VXMD 4TTDC 1EVTC 3QFJE 4PPTA 1CBVL 5ILTH 1KV3A 1DQMH 3P4NB 2PYFA 2YK1L 5I1IL 4JR9L 5CEZD 2P8MA 1V8HA 4JDVB 1OT2A 4NKIH 4NO0B 4G8EB 4NGHL 1CLCA 1URLA 2FEDD 5E8EA 4FG6C 1F4XH 4G43A 4PLJC 2VLMD 4L4TB 4C4KO 2M2DA 3NABH 1RVFH 2GIYA 4U1MA 4F9LC 3ZDZF 3P9LB 2P5WB 1WCQA 3UXFA 1QO3B 5AAMA 3RDTB 2DQEH 1EUUA 2FGWL 3GHBL 3PHSA 1HQ4B 1C5CL 3GMRB 3GMMA 3HPJA 1WTLA 3IT8D 1AGEB 5I1CH 3VJ6A 4H1LB 1NEZA 4EUPH 4ZUSA 4X5LA 4MA3A 3VFUA 3RP1A 4OAWA 3L3HB 1NL0H 1Q38A 5JQ6L 3BP5B 5HHVH 3DTXA 5F1SA 5C0CB 4QHKJ 1N3NB 1N0LA 1U8QB 3KXFD 1EFQA 2IG2H 3SJVD 1HSAB 4JVWA 2VQ1B 1S9WA 3RAJH 3FMGH 1DUYA 3TFKD 1YEIH 1MCNA 1SY6L 4PTUA 3CDGB 4PJGB 3SKMB 3B43A 1NFIB 1SEQH 1QRKA 3SKNA 3OKLB 2APXA 4N1HB 3T0EB 2A6IA 1X5ZA 1I75A 5LWYH 1CQKA 4B50A 1BMGA 2X9YA 3OKOB 5EBMA 3NGBB 4WI7A 3R1GL 3A0OA 4ODWB 5BVPL 1A3QA 1XR8A 3C6LD 1IVLA 3SDAA 2CLVA 3BIKB 3O0RH 1S7XA 2X4UB 4PJDF 5DMIL 5F71A 3RJQB 1TLKA 5E8OA 3WFEL 2HFEA 1ZVYA 5CHNA 4KDTA 1HHJB 3CMOL 2P48B 5FM8A 5DD6A 1I7RB 2W38A 3GJFH 1EXUA 1RHFA 4QOKB 3SDDD 2NX5E 3UJIH 4Z78B 1PD6A 2IC2A 2OZ4A 3AM8A 2WW8A 4ONGL 4HWZB 4LHUD 1XIWA 4NQCE 5IJKA 4HFUH 4MQ7A 4OQ1A 5SWSB 3C9NA 1NKOA 2V5MA 1UH4A 3QFJA 1KUMA 4GAFB 3CFEA 3BXNA 1MWAB 3P77B 1HDMA 3H7BB 3BZEB 3SOBL 1WJ3A 3SPVB 3GHEH 3V5KB 4OD3L 4AEEA 3MXVH 1ZHBA 4M6OH 3AY4A 5IB3B 1AHWB 5FHAH 3D18A 2EDLA 3TESA 3KLAA 4R97B 5TE6L 3CLEH 2YWYA 3QO0B 2R29H 4I0CC 43CAA 3TA3B 4CW1B 2I9LB 2XY1A 1N4XH 1OL0A 4ZQKB 3JWDC 3ARXA 4JN2A 4I2XE 4MNQD 2HJFA 1X5GA 3BESR 4RA0C 3WIFB 2XZQH 4RGNC 1MFEL 2IPUG 4EJ1C 3V5HB 4QRSA 4XB7A 2B20A 4AEIH 4UT7H 5KSBF 4P5KA 1RUAH 1F3DJ 3KPSD 4H20H 3WJLC 5E99L 3MMEB 2NXZC 4PJEB 4QRQA 2FZ3B 2AQ3A 1QLRA 4FZEH 4HKJB 3TN0A 3UTSE 3J8F7 5FGRA 4NWTL 3BMVA 4R0LC 1KPUA 1QVOB 3SO5A 2D4DA 5HGGS 1FNAA 1N64L 4WDIA 4NQSB 1OP5K 3DYPA 3MLWL 4ISVB 3RBGA 5I8EB 2EH7L 1E28B 2VSDA 4N0UE 5EN2A 5JA9A 3STLB 2R23B 3CH1A 4X8JA 1P69B 4WGVB