3QBUA

Crystal structure of putative peptidoglycan deactelyase (hp0310) from helicobacter pylori
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
290
structure length
290
Chain Sequence
AKEILVAYGVDIDAVAGWLGSYGGEDSPDDISRGLFAGEVGIPRLLKLFKKYHLPATWFVPGHSIETFPEQMKMIVDAGHEVGAHGYSHENPIAMSTKQEEDVLLKSVELIKDLTGKAPTGYVAPWWEFSNITNELLLKHGFKYDHSLMHNDFTPYYVRVGDSWSKIDYSLEAKDWMKPLIRGVETNLVEIPANWYLDDLPPMMFIKKSPNSFGFVSPRDIGQMWIDQFDWVYREMDYAVFSMTIHPDVSARPQVLLMHEKIIEHINKHEGVRWVTFNEIADDFLKRNPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title The Structure of Helicobacter pylori HP0310 Reveals an Atypical Peptidoglycan Deacetylase.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
total genus 96
structure length 290
sequence length 290
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2011-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 3qbuA00
3CL7A 4LY4A 1NY1A 2I5IA 2NLYA 4OUIA 2Y8UA 2C1IA 2QV5A 2CC0A 3S6OA 4HD5A 5JMUA 4M1BA 2VYOA 4WCJA 2J13A 5BU6A 3RXZA 3CL6A 3WX7A 1W17A 1V6TA 4NZ1A 3QBUA 4NZ4A 4U10A 4NYYA 4V33A 4F9JA 2C71A 3HFTA 4NZ5A 4NYUA 2C79A 2C1GA 2DFAA 2E67A 2W3ZA 3CL8A 4NY2A 2IW0A 4L1GA 1XW8A 1Z7AA 3VUSA 2XU2A 4NZ3A 4F9DA 1W1A1 1W1B1
chains in the Genus database with same CATH superfamily
1VFUA 4RE2A 3L4UA 3NDOA 3SW6A 4PUKA 3QGKC 1UHVA 4HCLA 2AGTA 3M1ZA 3UCDA 1ISYA 3FYPA 1N7KA 3CIWA 3W1LA 4D1IA 1M6JA 3NVDA 2PBOA 3WH5A 3V7PA 2YCIX 4K2SA 3MY9A 2QNEA 3W24A 4RE3A 3LRKA 4ZB2A 4HOZA 1KV8A 1XP3A 3VYLA 4HMCA 1Q4NX 2FVLA 4NRSA 5HJYA 1E9LA 5HBFA 2GQ8A 4PYSA 4U28A 1X8FA 2WANA 4BI7A 4DYJA 5AC4A 3WD3A 1HW6A 5JBDA 1L9WA 1OHLA 2BFGA 4WUIA 4Z08A 1SZGA 1KM6A 5BU9A 2ODOA 4IM4A 2WZTA 2GDUA 4ZQNA 1L6GA 3W7MA 5D9NA 3AROA 3SQLA 2WQDA 1RAKA 3LD5A 3W7GA 4X22A 4HSHA 3TJXA 4DJDC 3DFYA 2DVTA 3EA3A 1NP2A 4QCFA 1DHPA 3O05A 3BAWA 4PCNA 4HPHA 4W7WA 1BRLA 2J74A 2ABAA 2QW5A 4ORMA 1QWGA 4RE0A 3TC6A 1MDLA 4MFEA 4WX2A 2HS6A 4HZ6A 1M65A 3VKKA 1B3ZA 1QPKA 1AZ2A 4FSAA 1JI2A 2OWCA 1EJSC 4HNCA 2WCSA 3GBDA 3PUGA 2NZLA 3W88A 1GCYA 4L61A 1J96A 3S5YA 3ZZ1A 4WCJA 3T0BA 3GXFA 2CLKA 5D8ZA 3C2EA 1WB0A 2XH0A 2X1IA 3G3MA 3GXTA 3UWYA 3EPMA 2X30A 4UTWA 4XAZA 4Z1AA 3T44A 4MKSA 2YIHA 2YL9A 3ARPA 1EA0A 3UXIA 1O5QA 2ACSA 1SFTA 4MLJA 3OYXA 3VNIA 4YXGA 4LYKA 3TYZA 2E8ZA 5LGZA 3KP0A 1OG0A 1XISA 4MAVA 3NCOA 1IWAA 1UASA 3RJYA 4KWOA 5F2LA 5A69A 1JYWA 3LSCA 3M4HA 3BO9A 3MO7A 3BG3A 3UJEA 3NR0A 4XBJA 3LCHA 3VCNA 5DRCA 4O11A 4CN6A 3IIXA 4UFHA 1TJPA 3LI0A 2VFFA 3NPVA 2NW0A 2W79A 3SUUA 3F1QA 4WSHA 4GZIA 5M3WA 2HISA 1UMYA 4PB5A 3THUA 3BPWA 3MT1A 1S3TC 4IQDA 1JZ6A 4EPDC 2NUXA 3W73A 1E0XA 3DI0A 1AA1B 2Z29A 2H6RA 1NELA 5F4SA 5A6LA 3ZFHA 1NARA 2WMGA 1EEXA 2YL5A 3S46A 2J7HA 3PFMA 3SGUA 3H24A 3AHYA 4O14A 4BI5A 3T2QA 4DJFA 2ZZ7A 4IFKA 2ZDSA 2Z1XA 1TZZA 3K30A 3N2MA 5LNRA 1KO0A 2D2OA 4KETA 1LBFA 5T9BG 1EPVA 1IIGA 4C6KA 1IE7C 2WLZA 3SY8A 4DNHA 4FA3A 3RLHA 4PUUA 4HU4A 3URQA 4K1WA 5D9OA 1ZBWA 5D38A 2HWGA 3WUEA 2F9RA 3E2QA 4AIOA 3GUGA 4IWWA 3IANA 1X98A 1XLHA 3DHDA 2FVKA 3G1FA 1LL7A 3GTHA 4CNPA 3SSZA 4JY9A 3GU2A 2E5BA 1F3XA 3L4ZA 3THCA 1ME7A 3LHVA 1N8IA 1KFBA 3HA1A 3SR7A 1EPXA 3T81A 3QV9A 2HNEA 4UTJA 1E1EA 2P0OA 2JK2A 2E9BA 1EB3A 3VGEA 1S5MA 4MLRA 5TNVA 3NO3A 4DZHA 4JIPA 2E9LA 2PWGA 3VZXA 1TFVA 2R1KA 4XZLX 4F8XA 4O10A 2WMKA 4F3HA 2GQ3A 3WJZA 1YNYA 2V2DA 4G5DA 4M6UA 3HGSA 1BSLA 4IHCA 4IL0A 2H90A 1DXEA 3VU2A 2J66A 1RUSA 1EBGA 1WPCA 1GG0A 1GYNA 6CGTA 1KXTA 4UMAA 3C0LA 1J0ZA 1EJXC 4O16A 3GDMA 5L9FA 3W2KA 2O92A 2WLYA 2QCHA 3BE7A 4BCEA 4QQ3A 4WLCA 1N82A 4ZSUA 3ARVA 1E40A 1CXEA 1FXPA 2FGBA 1J9YA 3SCSA 4MYXA 1C8XA 4M1RA 3MZ2A 4MB5A 1O4UA 4XD4A 1T6MA 2DVUA 4O0KA 1OFBA 1XBXA 2E09A 4HVXA 3WH8A 3SURA 4DVOA 4E5TA 4EKJA 1E4LA 4LRSA 4MDPA 4CVWA 3LNMA 2HZGA 1R2RA 1GJPA 4LVFA 3SCTA 3B8DA 1AMYA 2DZSA 1UWSA 2NSOA 2ALRA 3VFCA 2GVGA 4NG3A 5I00A 2BGNE 2O7QA 3BG5A 1NFBA 1HKKA 2Y8KA 3EKLA 3W70A 4O18A 3IIOA 1RHCA 1KBBA 3B40A 1GHSA 5I79A 4EAYA 3ZXWA 5EU9A 3RM8A 5IHRA 4UOJA 2NLIA 3DIPA 3BAXA 1W9BM 1DBTA 3GAYA 3O0FA 3L0KA 4ZA0A 4C6BA 3UVIA 1P4CA 4WQ6A 4R27A 3E5BA 3QC0A 4NQ1A 1LOSA 3BLKA 3PS7A 2XIBA 1YPFA 1U22A 4XSMA 1B31A 3TQKA 1AD4A 4OBSA 5A94A 5D05A 3NUKA 1HQTA 3LRLA 3SZ8A 1BKSA 5EMYA 4K39A 4UR8A 1C8YA 2BY1A 2PLKA 3PJWA 3QEZA 3PBVA 3UZ5A 3RX2A 2VYOA 3QF0A 1D3CA 2Q3RA 2XM1A 2XVKA 3FX4A 2Q6ZA 1XSJA 1XGZA 1ZJIA 1DJYA 1EQPA 3WQ8A 4PRTA 3SRHA 2QJMA 3HBLA 3NDZA 2DUXA 1FTXA 2VHLA 4XKYB 5HXMA 3ZSSA 3W7IA 3G1YA 3NQVA 3KDNA 2ZA3A 3ECQA 2AL1A 3A13A 2YDQA 1FWFC 1BVZA 4RV8A 4XZ9A 2C15A 3WF3A 1CIUA 1C7TA 1Z41A 2V0TA 1UR8A 1OYBA 1JAEA 3S9ZA 2PURA 3PTDA 3RR1A 3QY8A 2VEKA 3UXDA 4N2YA 4FI4A 2GYIA 4AIEA 1KR0A 3CV2A 2OGJA 2PGRA 1DIEA 5FIPA 1WX0A 3S1GA 1XLFA 3R89A 3CHEA 1BXNA 1W5PA 1MUCA 1H63A 3AYRA 8XIAA 4JOMA 1TQXA 2PDIA 5K3VA 2VZVA 1J4EA 4Z1BA 1IIHA 1WDRA 3ARWA 3XISA 1I45A 2ZX9A 1D7FA 2VZTA 4FP1A 1QNSA 3MKCA 3RF9A 1A3XA 4GG9A 3LHZA 4B91A 4J3UA 5FSEC 4GJIA 4I5XA 3G1XA 3TYCA 3UYCA 3EWZA 3AXIA 1XLCA 4UTTC 5HJXA 2FH6A 4LALA 5K9DA 3NOYA 2HROA 4HGXA 3VGDA 1GOMA 3KTSA 1VC4A 3E0WA 4MUPA 1S3HA 3AMGA 1RPXA 3O6YX 4A3YA 1VIZA 3P62A 4Q7IA 5HR7A 3T09A 3GNPA 1TV4A 3UWEA 3VIGA 4R34A 3MHUA 3AAMA 2X16A 3RRXA 3TAOA 3A6OA 3R4IA 1Y7VA 3V35A 3ITCA 1DWIM 4F66A 1HKMA 4HHHA 4W7UA 5A6KA 2ZRYA 2EKCA 1JR1A 2NWSA 2P3ZA 3QQWA 2ONEA 5D8WA 1M1BA 1FH7A 1E6PA 2RDWA 3VC6A 1QHOA 1G94A 2WJDA 3MVIA 3A5FA 4JDYA 3LENA 3NL3A 1FWAC 3KOXA 1WA3A 1QBAA 4LVDA 2YL8A 3PZMA 2NX1A 5CZSA 2GUBA 3F2BA 1ZBCA 1PJ9A 5JMUA 5ABTA 3FA4A 1LYXA 3QRHA 3DHFA 2W6RA 2X0HA 2OGYA 1RLDA 3W7CA 3L68A 4FR1A 4LQ1A 2CLMA 1U1HA 3W1UA 4DUXA 2PP0A 4FOUA 3IACA 2OQLA 4P8XA 4DN1A 4H6RA 4PMDA 1X6UA 5D09A 4C65A 2FMNA 3I4EA 2GL5A 4QJ5B 1OBAA 4LUIA 3N04A 3QLDA 1HKWA 2YDAA 1FCVA 3W6YA 3WSUA 1RQHA 4ZOCA 2J62A 1ZCCA 3EDKA 1BG9A 4B3LA 2TODA 3AIQA 3UCQA 1VH7A 4HK7A 3R0DA 1QO5A 1ZGDA 5HWMA 3ITXA 4LXFA 1IZKA 4DM2A 4XBSA 3E2SA 3W1XA 3G0SA 2W9MA 5K2ZA 1XD1A 4QAIA 1F3WA 2WM0A 3OGVA 3WQVA 3ZIZA 3NZQA 4MNJA 4US5D 2OX1A 1BEUA 1GQIA 4TX8A 1VFSA 3NO1A 1QTWA 1GHRA 4ZO6A 2E6YA 4H4IA 3ITTA 4RJEA 4MWAC 4LAUA 2R24A 1VYPX 4DYKA 3DBPA 4UTHA 3DH7A 2QJJA 1H60A 2XINA 4LVBA 1RK6A 4BR1A 3DYOA 3CNYA 2W61A 3GXPA 1OSEA 2CPUA 1ONXA 3S1UA 4X63A 3W7NA 4ZODA 4AWTA 4FLQA 3PAOA 4ZXOA 3QY7A 1IT8A 3NL6A 4UR7A 3G22A 3LX9A 1YEYA 2OSXA 3GC5A 1UCWA 3E9AA 4IMAA 1YNQA 4AY1A 4M19A 5MKGB 1HX0A 3J7HA 1XKYA 5FKYA 2UZ9A 4WJXA 1AL7A 3VAVA 4UNLA 4AD1A 2D23A 4CD4A 4Q8OA 4J2MA 4KEMA 1R3QA 3HURA 2FGZA 2F7FA 3GHSA 4OOZA 1EOMA 1VBJA 2DZAA 4BF9A 1V6YA 3O3RA 3WD2A 1FXQA 1V93A 1WOBA 4JTFA 5HJLA 5JH1A 3VIFA 2HPMA 4DPPA 1UR1A 3Q67A 1S1PA 2V3GA 1CB7B 3NQ7A 5KETA 2GUUA 1QNOA 5HQLA 6ENLA 4WY0A 3QMSA 3SBFA 2UY4A 3O8AA 4KH2A 2OJPA 2DFAA 2OT1A 5CZKA 3WBXA 3WNKA 4B3KA 3W2LA 5JU6A 2Z00A 4ORIA 2QV5A 2ISSA 4FIRA 3UQNA 2GOUA 5HUPA 1A53A 4W93A 4JCMA 2I56A 2DJLA 3OZMA 5H6HA 4PRRA 3W7DA 2C16A 3AFBA 2B81A 3KFTA 4PEKA 1XLEA 3JZUA 1G4PA 1TPC1 2MUCA 1NQKA 4GPNA 3WF0A 4URIA 2OODA 3C8NA 2X7VA 4JNYA 1ZAIA 5C9WA 4LBSA 1TTJA 3SUWA 1OD8A 1NDWA 2YOCA 3OZPA 4CU6A 3CAVA 4FALA 3ZVHB 3GDKA 1Q6LA 1RD5A 1ENUA 2GUYA 2VC5A 3WDIA 3VMNA 5E1QA 3HF3A 3GR4A 1GNXA 3I7SA 2NQ9A 4HN8A 4BHYA 4PGLA 3UU0A 5G4WA 1E1CA 2X09A 1R86A 1CCWB 3KWXA 1HIZA 5HOSA 1Q8JA 3F5LA 4Q8TA 4B5UA 4Z2LA 5AHLA 3BCFA 1K9TA 5LIWX 2CEQA 4Z42C 5BW6A 3NQGA 2Y2WA 5D2TA 1UR0A 5FAJA 4NIRA 4GYPA 4LFYA 3RJXA 3LTPA 2CERA 3R0KA 1LRTA 4I7WA 3SUSA 1EJWC 3EEZA 3IIPA 2O9OA 3RUBL 4YIWA 4RZBA 4A3QA 1KTNA 2EPNA 3STFA 3VIMA 1LORA 4RW5A 3VTRA 2HTMA 4U31A 4DUOA 1RBLA 2BWGA 1W9XA 5HA7A 1A5UA 3R11A 1XIMA 3GDTA 4C6LA 5D37A 4XK2A 1R87A 5A6BA 2EG7A 1OEPA 4YPJA 3FJNA 1MXSA 3FJ4A 1PBGA 4KWWA 3WLKX 2JGQA 2V8ZA 4Y6GA 3U2ZA 3UJ2A 5DT7A 2P76A 2Z7GA 3O06A 4CD7A 1BAGA 5B80A 4CQ9A 1LWHA 2YW4A 1NIUA 4QDWA 2BZNA 1S1RA 3K4DA 5C8BB 3NGFA 2WHKA 2YR1A 3ABOA 4B15A 4BEUA 3NOEA 3QH2A 5A6JA 2O7SA 2ZTKA 2UY3A 2VEFA 2QT3A 2XJ7A 1XQLA 2VO5A 4UNIA 3GG0A 3KL0A 1ZAHA 2FTYA 4PMVA 3VNLA 2QS8A 2QQ6A 2FPVA 1XX1A 3GSMA 1XHGA 1PYFA 2X05A 1YIXA 4MB1A 1PX4A 4MVAA 3UGVA 1RJRA 2J27A 3K1DA 4E4FA 4AC1X 4QGCA 3STCA 3WK3A 4AWUA 3DGRA 4PR4A 5TD4A 1HGYA 1OIMA 1KRMA 2WMIA 4H9ZA 2Z1WA 2VENA 4EVZA 5C55A 1VEMA 1GOQA 1JQXA 3AJXA 3CZ8A 4GKLA 4MF4A 2DT3A 1DIKA 1HP5A 3C0JA 2ZQ0A 1BRLB 3HGOA 3W37A 3M0MA 3LBMA 4QEHA 4LV4A 1K8ZA 4IIHA 1UC5A 2QGHA 4DWSA 3IGUA 3QKEA 2BS9A 3ICJA 4GH1A 4GK8A 1LWIA 1EXPA 1HZYA 2PDUA 2YX0A 3CQ0A 4LYPA 1VJSA 3AHVA 3LXCA 1RVKA 1ADSA 5G1TA 2I7GA 1R7OA 4MAZA 1TPEA 3C8FA 4ZOEA 4CCCA 4GQGA 3W1MA 5EA9A 1OVDA 4DELA 2QUVA 4M3PA 1Q3NA 1MQPA 3T0DA 4K68A 2R9RA 3R13A 1TE1A 3ZJ8A 5F2MA 1PZ1A 4NZ4A 4TU1A 4M81A 1XYAA 4R7JA 5HATA 4JY8A 1P0DA 1BXCA 2QCMA 4HK5A 4FEZA 2BY0A 5LNSA 1UB3A 3VOHA 3M0XA 3RPMA 1CLKA 5H91A 1GPFA 1MRAA 4GZ7A 4QS6A 1FWEC 3UR2A 4LS0A 1KFCA 4MG4A 3EOLA 2B7QA 4C1KA 1UD2A 3GS6A 2E67A 3GH5A 4CNSA 3ZYZA 4OBTA 5FOOA 1YADA 3VE9A 3U3HA 3H22A 1ICQA 4MZ8A 3S9YA 1T0OA 4L1WA 5EY5A 4TMCA 3BOXA 2CLIA 5K4ZA 2CLLA 4GUFA 1MW2A 1EJUC 1CENA 1MVYA 1SYTA 3B0UX 4M51A 4CQAA 1TV7A 1VHCA 2E40A 3E3HA 4KW2A 2J24A 3BWWA 1UPMB 3WQFA 1LG2A 2GDVA 1X1OA 4IFKB 3PC0A 3TFCA 4FNPA 1NP0A 2FZDA 2G41A 1B4EA 1RCOB 2PD9A 4G7EB 2HV5A 3LV5A 3FXGA 4DF0A 1PHWA 4LY4A 1P48A 1JDDA 4O4WA 4O1CA 4IMCA 2CHRA 2G3JA 4LCQA 3ZO9A 5LIKX 3VIPA 2PLCA 4IPJA 3FJ6A 4JS3A 3S83A 3ALGA 5AHNA 3LCXA 1HVQA 1ZAJA 3DCPA 2OZ0A 1VB9A 1ZJBA 1DKWA 2SFPA 5D30A 4E4UA 5IXEA 5HMDA 3IVUA 2WB5A 3HV8A 4Q8QA 2A3BA 2NQHA 5CCZA 2OFJA 5CLTA 4E2DA 2VFHA 1WDPA 4N6FA 3CUXA 1UW9A 4L4MA 1TG7A 2IQ0A 1FWJC 2ACUA 5TF0A 2OYLA 3N2BA 4ZQMA 3PTKA 4YTUA 1CECA 1W3NA 3GFXA 4UB9A 3NG3A 5LNVA 2YBVA 3LCFA 3CHFA 3LYEA 4DHGA 1UH4A 4ZO7A 5KSWA 3U2EA 1CEOA 1EOKA 1QMLA 2DV0A 3URBA 4G9PA 3DFOA 1K7EA 3ITGA 3F4VA 2B31A 3RXZA 4XZNX 2Z6JA 1W3JA 3R6IA 2VFIA 3EX3A 3BW4A 5CPLA 4HKPA 2OLAA 4IQLA 3WQOA 4IMDA 2ZX7A 1M04A 2PDYA 2ZZ4A 1V08A 2FZNA 1R38A 4XG1A 3STPA 4K8GA 1NF0A 5D33A 1AH4A 3GW3A 4IG2A 4PUDA 3WMSA 1Q45A 5FF7A 1XIIA 3AZRA 1WKDA 2ESCA 1W9DM 4DAFA 3GC4A 8RUCA 1BYBA 1LROA 3CEUA 3QTGA 2OZ8A 4ZFCA 1F07A 4Y9NA 4WJEA 4AWEA 1JXKA 2WPGA 4AXNA 4ZQOA 3LPFA 3HQNA 3W71A 1HNYA 1LUCB 3BXWA 7ENLA 3DU0A 3AWOA 3L66A 3FXYA 4GIEA 5HPOA 1FWCC 2BNJA 3PY2A 4S3CA 3V5FA 5EL1A 4R7WA 4Q4MA 4L5ZA 4GWEA 4E38A 1DEDA 1UJQA 1TREA 5AHFA 5I02A 3L4WA 3O9NA 2IMRA 5FEWA 3UPBA 3EX2A 2Q8XA 1YDOA 5A6AA 4YVXA 2WO5A 2I9EA 1A4MA 3TMQA 4EF9A 1VCVA 1UUQA 4LVGA 3SAZA 3B0YA 4TVCA 2XVLA 1O60A 1VQTA 3IUIA 1WNOA 1ZLPA 3INPA 1DJNA 1LL4A 2PSNA 1XIDA 2TRSA 1PAMA 3QY6A 4RDWA 4DZ5A 5CBBA 1QOQA 1OYCA 4QROA 5IOBA 1WUEA 1RPKA 2XZ9A 5CPMA 5AC6A 3GTFA 4N0RA 4QX4A 3MU7A 1YX1A 3GZ3A 1EHAA 4LJ3A 1S2CA 3KVJA 3LM3A 5FL0A 4L64A 4RR4A 1E5JA 4F2BA 3DKLA 1BSIA 4OFCA 1SUXA 5GJMA 9XIMA 4P7NA 1BWLA 2WVSA 1H7PA 1E43A 3QMRA 2PDMA 4P7OA 2BG5A 2BTMA 4WXZA 1RD6A 3CO8A 4GIRA 4ZB5A 3TKFA 5E6YA 3E74A 4PFHA 3BV4A 3FS2A 1XLBA 1EGVA 5F2GA 2XG9A 5BCAA 1JGMA 3UZWA 3OYZA 1SPQA 2XFFA 2P10A 1JGIA 1OD0A 4EXBA 1GK8A 3DI1A 4EOUA 3TA9A 5C0QA 1JCJA 3CTLA 3QVQA 4EXQA 3R79A 1TX2A 5HQEA 4QJ4B 2WM1A 4S1FA 3G1AA 2DQXA 3BVJA 1IWBA 3L5LA 2BLEA 1NSJA 5C5YA 4CNTA 3UY8A 3VIIA 3RMJA 5K7JA 1TJRA 3USBA 3BAKA 1KRBC 2WHLA 4X2RA 3BURA 4UC5A 4CNNA 4WGHA 2WKJA 2NQJA 4O50A 3OGSA 3S2NA 1R3YA 4HU0A 4Z1DA 2D73A 1K6AA 2WVVA 2YKKA 3GE7A 4NJKA 3KVKA 2ISFA 3BTNA 4US6A 4HNVA 4FNRA 2GGIA 3U4AA 4NZ3A 3P82A 2WAGA 3GDRA 1M7OA 1VLWA 5CZJA 5D03A 1KW1A 3LDVA 4UCFA 1PKYA 2V69A 1W1YA 1IXNA 4C6CA 5AC5A 3KE0A 3T78A 5CC6A 2X7WA 4IIFA 2QIIA 5DEZA 3GHRA 1PXGA 1Z3NA 1EXBA 4C1LA 3V1PA 3U6WA 1ICPA 3KOZA 1J11A 2J7EA 3W29A 4JQAA 3E1F1 3U5YA 3C2VA 3S3GA 5AYIA 4IXHA 2JKAA 2Y6ZA 3UBPC 5F2IA 4ZTXA 1JPDX 4C7DA 1GORA 1DJHA 4GRSA 3UA3A 2C3ZA 1GPWA 4HU3A 2X2GA 2DZWA 3QFWA 4XVEA 1EGZA 3BOLA 4MYAA 3Q58A 3ZT7A 1US0A 4FXJA 5DELA 3TYUA 4H6KA 1K70A 1EH9A 2I17A 1W0MA 2VRQA 3WD1A 3HU7A 2ZZ5A 1YDYA 4Q7NA 3O6DA 1VFHA 4GXMA 2XSBA 3WDQA 4NAEA 5D2XA 1XH2A 1XF0A 3CHVA 1KCLA 4A35A 3ZR5A 3DYPA 3GYCA 3IUHA 5JH2A 1C8QA 3TTSA 3MC5A 5DF0A 3E0LA 3NQMA 1KBKA 1DWHM 4JEQA 3WDHA 1Q6GA 2WJEA 3I3DA 3PZQA 3DFPA 3S2MA 1J0KA 3EWBX 1W2PA 5E0KA 4Z0JA 3VE7A 1Q2RA 3ARYA 4DXKA 2HPIA 1I2OA 3P3BA 1NWSA 2DSWA 1XLAA 3GNOA 4LU0A 3TXVA 2VRKA 1A5NC 1TELA 1EDTA 4WD0A 3VILA 1TWSA 4HZ7A 2KZHA 2Y7FA 1WKEA 2Z1BA 4E4PA 2Y7DA 4IPNB 3ZLFA 2ZVRA 1E55A 4BK9A 2G97A 4GYKA 2DW6A 2DY3A 3MDWA 1DJWA 1P43A 1P6CA 3LZ5A 2ZRWA 3U4FA 1AJ0A 3QOKA 3D5HA 4A8NA 1QPRA 2G3IA 4DUWA 2YPIA 2CHNA 1XIEA 4ZQPA 1VGAA 2ZX5A 2E5CA 2YGYA 2PDLA 4QEEA 2DU2A 3W7EA 2JGYA 3VD7A 3MHGA 3SCVA 5HWNA 2DT1A 4FAMA 2BVTA 3O6AA 4HYWA 1X96A 4K3ZA 3IVSA 2GJXA 3N29A 1K02A 2Q8ZA 4JTCA 3NWRA 1CGTA 4P8WA 3M6DA 3WF1A 4A8RA 4MTVA 2Q02A 4PCTA 5FJTA 3VCRA 5FEXA 4DJED 1EP2A 4J3TA 3U7BA 3ES7A 4P5UA 1JXJA 3WKZA 1WDWA 2VR2A 4C6DA 2Y1HA 1B9BA 4X9YA 5CAKA 1GVOA 1F6KA 4NZCA 4NZ1A 1RCXB 2GWGA 1NH6A 2WZEA 1GTEA 4Z1CA 3A24A 4BQ5A 4GI9A 4KIEA 4L4LA 1X7FA 1NQ6A 3BGAA 4ZOAA 3VD4A 2ZRUA 1C92A 1KGWA 2XIJA 1OCBA 4KEUA 4DF1A 5L6UA 4NT0A 1HG3A 4ZL1A 2G3MA 3AZSA 1XH1A 3W74A 1Q6QA 1XICA 4AVNA 5LXEA 2IPJA 4I8YA 1OX6A 2OT0A 3OPSA 3WLOA 4MNMA 3WD0A 3SRDA 1D3GA 1OGGA 3K5XA 3GH7A 4LUYA 3EEGA 4NZ5A 4PCFA 4WY0B 3UG8A 3A12A 3TQ0A 2QUTA 2ZBTA 4D6HA 4HA1A 5D32A 3IGSA 2W5FA 5IDZA 2PA6A 3VZYA 2ZOXA 2PDXA 4MNLA 1V5XA 3C3NA 4GBUA 4H6QA 1E6NA 4QDMA 4PRWA 3U5UA 2XYLA 2YBTA 4WKHA 3AS2A 2NUYA 2O4QA 1AUSL 4GCXA 4NI3A 5DBUA 3PFRA 1OABA 3TOPA 4KPLA 3NDYA 1YPXA 1EWEA 1XLJA 1A49A 3FN9A 5D2YA 3OLIA 1QUMA 4UFJA 4TMBA 1WZMA 3KS6A 4NXSA 3VNKA 5J8LA 5CSRA 3LNPA 3E0IA 1UR4A 3P81A 4JTIA 1QAPA 5G4HC 1UQZA 3CL6A 1Y5XA 3MB9A 5G1YA 1POKA 4PMUA 4KESA 1B3VA 3WQ6A 3SCNA 2ZX8A 3LMZA 1ITCA 1AL8A 5FJUA 1E1CB 4JL1A 2F6XA 1EUAA 4GY7A 3SIZA 1WDSA 4WK9A 3WCZA 5JQ9A 3VMOA 3M6YA 3D6NA 1TSIA 2PDJA 4D6JA 5BMXA 4FB7A 2E1WA 1Q6RA 4WVXA 3WL0A 3FGCA 5C2XA 3PNUA 2QCLA 3ONBA 1BYCA 2EGZA 3N4FA 1CGXA 1V6XA 5KITA 3CT7A 1UIOA 4QBXA 1YDVA 1JZ2A 3W2MA 4JN8A 2WWDA 1H5YA 2AOSA 3N34A 3UNDA 3G1VA 4PMOA 3H2OA 5EMUA 4IJCA 4PMQA 1KLYA 1WUFA 3BSGA 3JVAA 1PCKA 5H8UA 5D4YA 2A4AA 3M41A 3TW7A 1Z9AA 4UTKA 1OY0A 2HK0A 1XW8A 2XN0A 4FXSA 3DC8A 3S47A 1V3HA 3TMLA 4FLOA 5HAOA 4OE7A 3VD5A 4Q8VA 1XG4A 9RUBA 1KTBA 2ASHA 3F5KA 2MANA 3UXLA 3ES8A 2DZTA 1GOKA 1WDDA 4FF7A 4JFUA 2WSPA 3M64A 2UY2A 2YZ5A 4GUJA 4YL2A 3B9NA 4G56A 4CU7A 4FS9A 2R6OA 4GXPA 4QNEA 1K4GA 5GNZA 2CFFA 2WOQA 5BXRA 4PUJA 1TJ1A 4QG9A 4UTLA 3LOTA 1MO0A 1G4EA 3ITOA 3UFYA 1PIGA 4GI6A 4H6EA 5I2UA 6XIAA 5AHEA 1XYLA 2PC4A 2E7FA 1ZY9A 4ZEPA 4RNHA 1BXBA 2WMIB 4C6NA 3LLDA 4AB4A 2VX6A 1QPQA 1DWAM 3WMCA 1ZBVA 4DJEC 3A3XA 2A7NA 4LS2A 4AYSA 2XGIA 3B3DA 1ZP3A 2XISA 4DWSB 4W4QA 2GDQA 1O94A 1GVQA 4C91A 5BXTA 3FCPA 3N9SA 3M0ZA 1UH3A 2V82A 5A8PA 3VMPA 4YS1A 4UWMA 3RCNA 3C0SA 2Y70A 3ABZA 1TWZA 1PL9A 2CWXA 5A6SA 4KT2A 3PUEA 3MBDA 3U57A 2ZZ1A 2EO7A 4FNQA 1MEWA 3TN3A 2QAPA 3TNBA 1GQKA 4IF2A 2XSAA 2ZE3A 3RM9A 2VWTA 3LCIA 1DVJA 1WDQA 4EF8A 4IGNA 2JIWA 5AYXA 3RU8X 1S2VA 4H9VA 2XVNA 1JG9A 8TIMA 4O13A 5KZ6A 4HPNA 4AD4A 3POCA 4A2RA 5E6ZA 1ZTVA 3N25A 2ZXDA 3TH6A 5A2CA 1VFTA 2RDXA 2WJFA 1IEIA 1KM3A 2E28A 3WBAA 4IPIA 4LEQA 1B0IA 5C6MA 1OGSA 2NX9A 4C6IA 4J40A 1AMKA 3BL3A 1Q6EA 2QPXA 1JDEA 1XM3A 3L2IA 2HQAA 3A21A 1GZ1A 4M7SA 3V5OA 3CK5A 4N42A 3KCLA 1UD4A 4RE4A 3RX3A 1JULA 3LG3A 1IWPA 3BV7A 3RM4A 3SCUA 1N55A 2CW6A 4BWLC 3IK4A 1L0PA 1MUWA 2E0PA 4IT1A 4QG6A 1QNRA 2GJLA 4G6CA 4J3VA 2BVWA 3M0IA 4MOZA 5A8MA 4H9YA 4LAMA 3TC3A 3EMCA 3GFYA 3WLQA 1I6NA 3VO0A 1W31A 2C91A 3WLLA 1VAHA 4NY2A 4PL1A 4HOXA 3TN5A 5IBXA 2A0NA 5I77A 3JRKA 3W72A 2WW5A 5JIWA 2A3CA 1LM1A 1JI1A 2ATSA 1Q6FA 3RCYA 4HA4A 2R1LA 1QDSA 3MSRA 6REQB 3EX4A 4Q8WA 5HINA 5REQA 4FX8A 3ZJKA 2P53A 3ANYA 4PTDA 4J3WA 2XFRA 2VNCA 4AEOA 3KOFA 3NQBA 4LNYA 5HNUA 4D8ZA 2GQAA 4CN1A 2YZRA 4ZO9A 1OK4A 2HBXA 2PZ0A 2HK1A 5C2GA 4F0SA 1HJVA 3CUIA 4R3UA 3HMJG 1U83A 1XD0A 3VIKA 1BD0A 1H1NA 3BW2A 3PUDA 1J5SA 3W7KA 1HJXA 4AYGA 2VZSA 4TIMA 2OKTA 3L2LA 1VYRA 1HUVA 3SB0A 3WUGA 2QF7A 4KWVA 3KCJA 4IUOA 4DZIA 3HQOA 3V0TA 4GIYA 3T55A 3HV9A 3SN4A 3EX6A 4DPQA 2V9DA 1V0KA 3BH4A 3LMYA 2AKZA 5AY7A 2P8CA 1ADOA 3M5ZA 3P60A 5F4XA 3AXHA 4BQ3A 3EOUA 1HGWA 1RP9A 4O8RA 3SN1A 1I60A 4JCLA 2G8ZA 1VCFA 3S1VA 4FOKA 3WLPA 4DF2A 3NZGA 4YTQA 1KQYA 3OHIA 5H8MA 1VS1A 4D6DA 1G67A 1VHNA 4JFWA 3R8GA 3LBCA 3M0JA 3UXAA 3GU9A 3RDKA 2HVMA 3KXQA 1TV8A 3KOWA 2A3EA 3CZKA 4A2SA 3L67A 1BF6A 4R5EA 3C6CA 4IG2B 3OJGA 4XB3A 3WL1A 3W3OA 2ACRA 4PZVA 2VCCA 1O12A 3BGJA 2BGQA 4PTVA 3APTA 3GFZA 4ZTYA 3SRFA 1KCXA 4QLKA 4H00A 2EKGA 2Z6IA 3DAQA 3GNXA 2PDHA 3WFLA 4S3EA 4UTMA 1QRQA 1G69A 3N4EA 2WMHA 3DFTA 3IAQA 4IQEA 5ECUA 2PDNA 3G6MA 4S3FA 3B8TA 5I7GA 5KINA 5DMYA 4K6AA 3MUCA 2VEMA 2OX4A 5K4XA 1CXIA 3EOEA 1EFZA 4LEFA 3HOJA 2X40A 2E8YA 2XH7A 1XLLA 3P8IA 1SR0A 2QGYA 4OECA 2QLYA 2WYSA 1EYEA 1W1ZA 3KUMA 4L7ZA 3O15A 1KWKA 5BWFA 1KXHA 1JUBA 1VJZA 2G3FA 2IXVA 3HZ3A 3I7QA 5G4EA 3UESA 2D20A 1K8YA 4XZMX 5M5DA 1A3WA 3TFXA 3EXTA 2INFA 4NP7A 1WKYA 4J1OA 4MGGA 4KQNA 3VD9A 2BV9A 4Q4KA 1WBHA 3G1HA 4MJ4A 2R82A 4UCGA 4K7YA 3TTEA 4A3HA 4AZ5A 2JF7A 2J78A 3B4UA 1WQ5A 2ZXAA 4XAYA 3REQA 2ZX6A 4C6QA 1PTDA 1TMHA 3GUWA 1ZP4A 3RNDA 1UWQA 2VZUA 2PWHA 1FWTA 3UPWA 3LBOA 1W37A 1D9EA 5AYBA 1XQKA 2J8TA 4JX6A 4E8CA 1GQJA 3UJRA 3P7YA 1ICSA 4PMJA 1F8MA 1Q6CA 4DJFD 2QJIA 2ZE0A 1W56A 1Q4WA 4LUJA 2ZZ6A 4ZO8A 3GNNA 4F9JA 2VGIA 3HPZA 5FF4A 2PDGA 4A22A 2DSUA 4R85A 1TWDA 3EWXA 3N2TA 4L6HA 4OJYA 1TIMA 2RAGA 1XYMA 5CLWA 2F2HA 3VOCA 2VD8A 4DBSA 3HG5A 3JR2A 1JCLA 3CHDA 2P88A 4F2UA 4OTKA 2PDKA 1UR3M 3DFHA 3CPUA 4YLWA 3F5JA 3CAWA 1LT7A 1UD8A 4H2HA 4JQ3A 3MS8A 3I10A 1WE5A 1I75A 1K03A 3FNDA 3FKRA 2EJ1A 3N2XA 2GSJA 3IUDA 1A47A 1DL3A 3FHQA 2TPSA 4GI4A 4Q33A 1XCWA 2VMFA 1YQ2A 3OVQA 3TJLA 2OTDA 1ITQA 3H4GA 1NWTA 1OCNA 1SW3A 2PTXA 3BSHA 1TR1A 5FL1A 2E25A 3Q45A 1I9CB 2ZA1A 3UJFA 1DORA 1JRBA 2WVVB 1EC7A 2YXGA 1K3UA 2CZ5A 4PB4A 3P2VA 4DI8A 3OVGA 3CL7A 4M82A 1KRCC 3THQA 1TPVA 4QE5A 3U2CA 1WZKA 1GONA 3WQWA 2EJAA 5M1TA 5CEWA 4R9OA 2C1GA 3WQEA 2DVXA 2E6AA 3H4WA 4YCPA 3L7RA 1W8GA 4RKAA 1PZ0A 2JQXA 1NOWA 4J7RA 3QKZA 4A21A 2V3FA 1EIBA 4KCTA 1E6RA 3D46A 4V2XA 5I03A 3DESA 4LX4A 4B2DA 1LLOA 4BY3A 3UVAA 3FVDA 4Y2WA 1YHTA 4RDVA 1H7RA 5SWUA 3B06A 3CV6A 4K7VA 3VCCA 3NQ6A 3CMJA 4JTDA 1M7XA 3VOIA 2UWFA 2WSYA 2X41A 4CUCA 2C18A 5GQBA 2FHFA 1REQA 4BF7A 4NAEB 5U4NA 5C9ZA 3B9OA 1ME9A 2NWRA 3GVQA 1QOPA 2F61A 3MP4A 2BX7A 4LV9A 3MSDA 3K8KA 4E2VA 3CLMA 1UWTA 4M24A 2D1ZA 4GUGA 4PUWA 4Q4QA 2J6VA 3W22A 3S6TA 3OLGA 1PV8A 1X6NA 3ZVIA 1AQ0A 2V3DA 2GOKA 1F73A 3VPLA 3PAJA 4GFSA 1J2WA 5K9XA 3MANA 5AYZA 1JFHA 3HTWA 2PDQA 2DH3A 3T0CA 1V03A 3ZJ7A 3LGGA 3RCMA 3H2CA 3P14A 1R9ZA 1ZNNA 2CKSA 4JTQA 1RJQA 1PEZA 3QV6A 4B9YA 3KTXA 3I6EA 3OBAA 1KD0A 4CD8A 4AH7A 2CU0A 3KRBA 4XUYA 2PTDA 4CEUC 2QZRA 1G9HA 5K9CA 3P84A 5CKSA 3CQJA 3N13A 4LH8A 4UTWC 3VM5A 6TIMA 1VPYA 1PB0A 1IT7A 4B16A 1FKXA 3TOYA 4R9XA 1I8JA 4V33A 1YPIA 2RUSA 4XIMA 4PTNA 2DP3A 3GKAA 2GJXB 2HXTA 1UKSA 1EP1A 2RJGA 5FCZA 1C3FA 4A29A 2G0WA 4RXGA 2DSKA 2PBGA 1ZFJA 1G6CA 1QW9A 2A21A 2Q09A 4Q8UA 4BKNA 4AD5A 1IV8A 2CLEA 1E9ZB 2IQTA 1DTNA 3GXIA 2V81A 4UR9A 1DQXA 2VD9A 3WLRA 3CUZA 3CBWA 3S6DA 1H61A 1JNDA 4PB3A 4KF1A 3K2GA 3WG6A 3GG1A 1FP9A 4EPBC 5I23A 2XFYA 3GVWA 5HR6A 1R85A 4FO4A 7TIMA 2DZXA 2WC7A 2ZUWA 2ZYFA 3PWGA 4C6MA 2OQYA 3FJLA 3ATYA 1W3TA 3KHJA 3AXXA 3P80A 3NA8A 1I2NA 2OSWA 3SJNA 4IPPA 3SGZA 4PBFA 4LVAA 3PZUA 3MJYA 4C60A 1SFLA 3F4DA 3N14A 1QI5A 2V30A 2VR5A 4ES4A 3ZLHA 4DJFC 4GQQA 1LOLA 3B0XA 2J8FA 4GY1A 3EWYA 4RX0A 1A5OC 1QJWA 1OX4A 6PTDA 1PKMA 3PNZA 1AZ1A 3GXDA 1QI0A 2D0FA 3TCSA 5I3IA 4E2BA 3RGTA 4H3DA 1PUDA 1KFEA 1BTMA 2Y24A 3G1DA 3KZPA 2IKIA 4JD4A 1YRRA 2WWCA 2YLAA 1CXKA 1T99A 4GX8A 4LS1A 3C86A 1ZJHA 1EL3A 4OWGA 2QUNA 2X0SA 1RJPA 5A8OA 4ZXLA 4DZAA 3IVTA 3AUOA 4IX2A 1K77A 3IRSA 3VZZA 3GQYA 5JIPA 5B7YA 2AKMA 4LUSA 4CNUA 4QRNA 3UW6A 3DHUA 3DX5A 2ZDRA 5IDIA 1FRBA 1PPIA 3L0GA 4LYRA 1F5ZA 5FESA 1ZL1A 4B4FA 1EJTC 5A2AA 2Y62A 4NNAA 3APGA 3W82A 5C7HA 4O28A 3P8JA 4XTDA 4LT9A 4WOQA 2Z2BA 1THFD 2QPSA 1D8CA 3B0PA 2PEVA 5T9CE 4PC8A 4K37A 3MUAA 1KTCA 2Z1VA 2ZKMX 4ZGYA 3FGCB 3PJTA 2HE5A 1MFUA 4GX9A 1JEZA 3UR5A 3FAXA 3OW1A 2ZUSA 4G1NA 4JFTA 2CXEA 6TAAA 1BPLB 4F0HA 1JZ4A 3UWZA 4QISA 3EAUA 4OV4A 5HNNA 1H5VA 1WKFA 4XZHA 1XWYA 4E8GA 4HJFA 4BA0A 1F4AA 5HNTA 1M9HA 1R46A 3YPIA 3W7LA 1FHVA 2J7DA 4ML4A 1EZ2A 2FYMA 3AIBA 3PULA 3ITVA 3A22A 5F1UA 1O1ZA 5E5CA 2QDEA 3TZFA 2QPUA 1R3RA 4DXXA 3W7PA 1V3MA 4DM1A 5AHMA 1FUYA 4KCVA 2PFHA 4XZBA 3NSNA 4L56A 2ON3A 1BF2A 4PA8A 4MDOA 1AW5A 2UY5A 4AX6A 3MCOA 4Q32A 2W27A 3R58A 4OUEA 4S2BA 1V02E 5CZTA 1IEXA 3WK0A 1CX9A 1IEVA 3GDBA 1HKIA 3UF9A 3JUGA 3SIMA 4NILA 3OQ8A 3GIYA 1CGUA 4YMZA 3TWAA 4H04A 1XYBA 4EP8C 3EPNA 2F6KA 3WQDA 2CZVA 4HNOA 3DDMA 2PD5A 4PFMA 1NJJA 5CGMA 4MWAE 4R53A 2V5DA 4NU7A 1Q5MA 4HPGA 1B9ZA 4LB4A 2NUWA 4L65A 2A3HA 2RJHA 3MV11 4AZGA 4HB7A 1UUOA 5HK4A 1ZSXA 4ZB0A 3G0XA 4GC3A 4DYEA 4Q8NA 1MI3A 4ERAA 5I5RA 3UPMA 4NRRA 5E70A 1PE1A 3G6LA 4GUHA 4JFVA 3P61A 3CC1A 1OFAA 3A3WA 5EGRA 1R6WA 4AFYA 2CESA 4TVUA 1EO7A 4C6OA 3M43A 1QFEA 2VX4A 1Z42A 3EX1A 4O52A 3WFZA 1CGYA 4UNKA 1HL9A 1AQFA 3SECA 3W01A 3VNMA 1VEPA 3M9YA 3N73A 5AKQA 1UWIA 2Y0FA 4AW7A 1A80A 1JCTA 4Q3MA 4WKAA 5C71A 3C2FA 4YJ5A 1RQBA 3MBFA 3MP3A 3LTSA 1H0GA 2OPJA 1ISWA 2G4FA 4H9MA 4UQEA 2HEJA 1LQAA 2WBGA 4INFA 3LLXA 4YVVA 4HMNA 1SM9A 1B2YA 3WIJA 3T7VA 2DSVA 2Y5JA 2ZUTA 1GW1A 2QVHA 3G18A 4Y9AA 3ZWSA 1X97A 1TR9A 1TIWA 2A7RA 1EJ7L 1XYFA 2CXGA 3WNLA 3AUJA 4RL3A 1A5CA 2J13A 5U7SA 1UKQA 1SMDA 3CGTA 3NQFA 2AQVA 1NDZA 4Q8MA 1RVGA 3APYA 4XWUA 1JZ8A 2Z26A 3TYEA 2WZIA 3Q65A 5CG7A 3BLOA 4V27A 3KLLA 3PPHA 4HSNA 3IJ9A 5IFPA 3DG3A 7ODCA 1AVAA 1ZCOA 4O15A 2PWFA 4DIAA 1OC6A 2V5KA 3A47A 4KWUA 1Z89A 4A3RA 4UQAA 3RK8A 3LB0A 4AXKA 5C9RA 3LGDA 4FLRA 3V3WA 3WLTA 2VX5A 4JIRA 1DXIA 3C3UA 2XIMA 2PRLA 3T1GA 4L4OA 3FIGA 2NSXA 4CN4A 4WOZA 1UP3A 3AHXA 1TRIA 2IPFA 3VUSA 1AK5A 3WO8A 4JX4A 5A6BD 5EMMA 4UMBA 3H2MA 7XIMA 3QYSA 3H4XA 1H41A 2J7BA 1XBZA 4OBRA 1FBAA 3UR8A 3HGRA 1XLMA 3T40A 4HA3A 3VDCA 4K8HA 1B54A 3TU9A 3VDAA 2XZ7A 5REQB 2ATMA 3I3EA 2HSAA 1O1HA 1QK0A 2W91A 3H12A 2VGGA 3KRSA 3WNPA 2OWXA 3MHFA 1QK2A 4NF7A 2Y5SA 2XPKA 4MWAD 5BOEA 1RBOB 4CGTA 4JYDA 4N4PA 1UKOA 4KFPA 2O55A 1B3YA 4H7ZA 3WN6A 5TQLA 4LC8A 1V3LA 3NO5A 4HU8A 3ITYA 4I6KA 3PVFA 3O0KA 2GVYA 3UA4A 4P8UA 2FJKA 1XS2A 3OIXA 2PDWA 3W23A 3V36A 2REQA 3KS5A 1W1VA 4JBRA 2H3BA 2PF0A 1U2YA 4KCUA 4X61A 2VOMA 4X60A 2AL2A 4N02A 3VOJA 1V3IA 4M7TA 4TX9A 3EDJA 4P7RA 3QJAA 2V63A 3LK6A 1LZOA 5A5WA 3AHTA 3DERA 5I78A 3KL5A 2GK1B 2NXGA 4RCXA 3F4WA 4D2JA 1X1ZA 1KBJA 3KZSA 3M47A 3UGRA 3EB2A 1BYAA 3HPAA 2ZUNA 3AU2A 1BG4A 4ZOBA 2WVUA 1Q7QA 2Y7EA 4DWSD 4FR6A 3A23A 1UP2A 5CG0A 2CCRA 2WSKA 2WHMA 2YSWA 2TAAA 4HYVA 1FWWA 3ARQA 3PPCA 5AYYA 3S6OA 2DZVA 3MSGA 4RV3A 2WSRA 4CCDA 4F0MA 3G1RA 1OC5A 3V75A 4OU1A 3DHPA 1LJYA 4ACZA 3HIJA 4GLEA 2ZIDA 2PWDA 4AHOA 2QXWA 1TE6A 3ABXA 1XSKA 3WF2A 3OP2A 1I2PA 2WQPA 2NV9A 4ERIA 1Q7MA 3G0UA 3PG8A 2G3NA 1BQGA 3W6LA 1J6PA 1RLCL 3LZ3A 2PAJA 4F2TA 3WY1A 2PWVA 2VRJA 1DXFA 4EE9A 5DXYA 3HG2A 4LWWA 3AO0A 2OEJA 3GAKA 1UP0A 4EWJA 3GWQA 1ISVA 3B8VA 1EQCA 1ZZMA 4D8AA 2BGSA 4IISA 1JCYA 3N6QA 3NYZA 4Y9MA 3HQ1A 2YYTA 5BNKA 1PCWA 1LBLA 4LBUA 1MNSA 3XINA 4EAMA 1KM5A 1AH0A 1QNQA 4GNVA 4REQA 1FWSA 3H6OA 1XINA 4FX7A 4JICA 3C0QA 3IV3A 4W87A 3T9PA 2GVEA 3W76A 1YTDA 1PS9A 3A9IA 3SUVA 3GK0A 3WELA 3CMGA 1EGMA 1R5YA 3WBYA 3WH7A 1ZU8A 1XUUA 4XD6A 1PWMA 1M01A 1QT1A 3WX7A 1GT8A 5HQMA 4W86A 2X1SA 3SN0A 1RY8A 4MZ1A 4HT3A 2OU4A 3FOKA 1XI3A 1OZQA 1XRFA 4FOJA 1JYXA 1CWYA 1PHQA 4YU1A 1E56A 4FF5A 1BYDA 2W66A 3PANA 1TQJA 2D69A 3B0VC 4N7QA 3WK1A 1XFCA 3CPRA 1KCKA 2FJUB 2V5JA 3HG4A 1UG6A 1DJQA 1J0HA 1XDLA 2J75A 4HPJA 3TX9A 1E5NA 1P6BA 5KTLA 1M7PA 1E4MM 3CUJA 3H2FA 4GYPC 1SJCA 2R14A 1SVDA 1GYMA 4LAOA 3OVRA 1E0WA 1MXGA 2JF6A 3H23A 2VFEA 2E6DA 3BDKA 3O07A 4A8IA 3KBVA 1KFWA 5LA2A 4KEVA 1M68A 4S3BA 3BLPX 2RGMA 1A0EA 4F9DA 7REQA 3W02A 1VBHA 2I9UA 3BG9A 3OA5A 1U1JA 1C9DA 3MUXA 3UZYA 3EB4A 5D9MA 5C54A 2DH2A 2QJHA 2ZVIA 1R9YA 3M5XA 1GJUA 1G7VA 3JU2A 2HBVA 4W84A 5CGQA 2CITA 2J88A 2E6FA 1DQUA 4J3SA 4D6CA 1GG1A 1NTHA 2CLOA 4U2YA 4NKCA 3DFSA 1YYAA 4JIHA 5TAOA 2J9ZA 3TLQA 4DQWA 4E3VA 1P5BA 3LS9A 1R2SA 3E0VA 1IT0A 1UYQA 2Y89A 3TDFA 3WENA 2TMDA 5JVLA 1W9VA 1TCMA 4S3DA 4GZEA 4PTMA 2VI0A 2GWNA 1EDQA 1PKNA 1TYGA 2J7FA 4UOQA 1XRSA 1E71M 4GJ1A 4J3ZA 3WDRA 1RQEA 4MHBA 3CT2A 5JBEA 1KBIA 1REQB 4B5SA 4AD3A 4IFRA 1O5KA 1PIFA 1VF8A 1S2AA 3M7SA 9XIAA 3QV7A 4GQBA 3W86A 1PX8A 1MUMA 1A5LC 4XZWA 5AFDA 5H8PA 4POCA 4W88A 1WAWA 4J4KA 1VEOA 4L6OA 4PSPA 3C52A 4W89A 3MI6A 4ADTA 4JL2A 4UQ9A 4Z2KA 1G0CA 2D22A 3NQCA 3CQHA 4XO7A 2EG6A 2VVNA 4PTXA 3WQ4A 1OADA 2P5NA 2ZC1A 4L4PA 4H2CA 4ZQRA 3ATZA 4OVXA 3WQ5A 2WZHA 1VBRA 4DWSC 3GR7A 4AY7A 4ZE4A 1B57A 4JQ2A 1SZEA 4AVOA 3LRMA 1N2VA 3GXMA 3QHMA 1NVMA 1DIOA 3CEPA 3VGHA 1P1MA 5F1VA 2H8XA 4I3GA 2BOEX 2FFIA 2BHZA 1UZ1A 4FXFA 2YA1A 4Y9PA 4C6PA 1ODZA 4GGBA 3ZOAA 2YDRA 4Y8FA 1NDYA 4RNIA 3PZ9A 4IXXA 4DB7A 3TW9A 2VGFA 3KTCA 3V18A 1EWDA 2CETA 2PRMA 2NV2A 5B7ZA 4S3AA 3EDFA 2PGFA 3AMLA 1CYGA 1RZMA 1UROA 1NWRA 3QR0A 1AD1A 1G1YA 1GVSA 2NVDA 2CLHA 3ARUA 2PGWA 4PMNA 1CLVA 3TV8A 3AU6A 1O5XA 3CMFA 2I5GA 4QLLA 3VGFA 1MFVA 2Q71A 2BMBA 3AISA 5CQ1A 3RLVA 1TVNA 1F6YA 5MKGA 1ONEA 5DY2A 3TSMA 3AQUA 1WZAA 4DXVA 1S5WA 1SZNA 3CQKA 1W6TA 1NM9A 4AZCA 3QW3A 2BXYA 5ENLA 3A4JA 2OQHA 3NQDA 4JPGA 3W00A 1I2QA 3G1SA 3Q4DA 3OG3A 1I1XA 2G37A 3WDJA 4XO6A 1KR1A 3UJSA 2Z24A 3N19B 2ZA2A 3EA2A 4ICNA 2W3ZA 2Y5EA 1VYSX 3PR2A 2C0HA 1BLIA 4JHOA 1T8XA 4JNMA 4L1XA 2EAWA 4CNOA 3C2YA 1R2TA 4LUTA 1V3JA 5E0CA 3GM8A 2PTZA 2C6QA 1QO2A 1OX4B 2VL4A 3IPWA 2NVCA 3AS1A 5DCBA 4W8AA 1FH8A 3ZM8A 1V8EA 4E6MA 1XG3A 2YXOA 4O0ZA 1HP4A 3KHDA 4XVDA 4JFSA 2QCDA 4AWSA 3BQ5A 1JDAA 1HN1A 3UD6A 2D2GA 3WJYA 3E2VA 1P6WA 1ADDA 2BBFA 1L2UA 2FPYA 3CUGA 2C1IA 4UZSA 2D2HA 1G01A 3GHUA 3W7RA 3W7QA 1NAL1 2IXUA 3S9IA 1E70M 2OG9A 4LUSB 4W8BA 1Z8AA 4NL1A 5DMMA 4IIEA 1Z6KA 3H70A 3ZVHA 2PB1A 2Z27A 4I90A 2DUZA 3W1QA 3POHA 3W84A 2VC6A 2VFDA 1CGVA 3GLCA 3ARZA 4R88A 2BP1A 1J0IA 5FAGA 4QLJA 4ACYA 2O4MA 1XL9A 4QJ3B 4IOTA 2XTKA 4QE1A 3B03A 1T40A 3W87A 5IM51 3UG3A 1JCMP 3KX6A 1X6LA 2GJNA 1T8QA 3NVTA 4UQBA 3Q2DA 5BU6A 2ZADA 3R94A 5E9XA 1VFFA 1V6WA 1TKKA 5CPOA 2J79A 4MZYA 3ZWTA 3EZ4A 1XLIA 1TRDA 3QMTA 1GKQA 2BASA 3WEMA 5LA0A 4HNLA 4S23A 1S2UA 3H2AA 3HG3A 3A4WA 5HMSA 1XIFA 1P0KA 3II1A 2D0HA 2PMQA 4YTTA 4PMYA 5CH9A 2DEPA 2QR6A 3NJ3A 4E2OA 3RU6A 1XIGA 2DZBA 3N9RA 1HXJA 3R5EA 3WLMA 1XUZA 3CZJA 3GG8A 3G2GA 2I57A 1XPGA 4KMQA 2HNHA 2WC4A 5DLCA 5DX7A 3EDEA 2OKOA 1VP5A 3ZT6A 1HTIA 1O7AA 3T08A 4IPLA 3WK2A 4O0QA 4O1EA 1MSSA 2DSZA 1KXVA 4NJJA 2EQDA 3BLEA 4IGMA 4ZMGA 3HN3A 1GGOA 5CSYA 2CYGA 3RRAA 2FVMA 2B7NA 1LCOA 3BAIA 1DTUA 1V79A 4KGJA 1DJGA 4IX0A 2QCGA 1UOZA 3BZGA 4WR3A 2NQ5A 3NSXA 2WK2A 3CB3A 1RR2A 1FHDA 5E0FA 3I7RA 4JHMA 1O5RA 3CPGA 1HO1A 4S3JA 5EBAA 5G5IA 3WBWA 4P7QA 3G8EA 3DC0A 3TK7A 1LWJA 4OQVA 3AMCA 4NUWA 1OB0A 2ZRXA 1N8WA 4BS0A 2YA2A 3GKFA 4D6IA 2GJPA 4JQ1A 3EB3A 4K36A 5MHBA 5KZMA 4LSBA 5LHEA 3VIOA 1JF5A 1PWLA 1B5TA 2P3EA 3IJ6A 3W27A 4LCRA 2J47A 1B3OA 2DGAA 4ICCX 1P7TA 3DG7A 4LTSA 3PZNA 5KZDA 4Q6JA 1YXDA 3QN3A 5FJPA 3QV8A 3CXOA 4D6EA 4UQDA 1IGSA 1O95A 4O17A 5DO8A 3N6HA 2FZBA 2INZA 2D0GA 3RFAA 2VC7A 3QBUA 4L80A 3W0KA 3CHCA 1SW7A 1H7NA 2FDMA 4GVIA 1QATA 4JHZA 1EEPA 4GBDA 4ZE5A 3SFWA 2WPBA 2Z28A 3UWQA 4ILSA 4XV0A 1M03A 7TAAA 2OELA 2C1HA 2A3AA 4LC6A 4UOZA 4AZ6A 5CSUA 1HKVA 5HNRA 3K4WA 2AQOA 3B8WA 1P1XA 2J4GA 5I3JA 1LBMA 1RCQA 2DIEA 4Q22A 3MQTA 2FHBA 3B9EA 3H2NA 1H1ZA 4CU8A 3TYBA 3JW7A 1IEQA 3PSWA 1X39A 4TV6A 2QHAA 3WJXA 5AB3A 5D9PA 3QZ6A 4C5YA 4FPSA 4GD0A 2OLHA 5LHFA 4GI8A 4AC7C 1LDCA 3EWCA 1CXFA 2UV8G 2WHJA 2VDIA 1XC6A 5CC5A 3RN6A 4Z2GA 3D0CA 3EKZA 4JAWA 1KWGA 1X8CA 2W0UA 4ASTA 4CLMA 1SU5A 2VUYA 4TO8A 4CQBA 1YW1A 3TQPA 4DO6A 3W26A 1P0EA 3C2OA 3UCCA 4B4HA 2QV4A 1LQ2A 4D1JA 1FQ0A 1FWRA 4U4MA 4AF0A 2RGLA 4GQRA 3R10A 5FA5A 1RH9A 5CJMA 3SADA 4Y8EA 3DECA 3CAQA 3PTMA 3QPEA 4RUBA 4QNWA 2ADAA 3GVGA 1SMAA 1UPPA 1XC4A 3B8UA 3MJMA 3TONA 1XCXA 4LB3A 2G95A 1LT8A 2X2YA 2GGHA 4PSRA 2YFOA 2Y85A 1C9WA 3VDGA 4G7EA 4AEFA 5HMEA 1B90A 1XBYA 3VDBA 4HCHA 1K6WA 4WDWA 4MY9A 2I5IA 1PKLA 4NJHA 2RDTA 3B97A 4PMXA 3SI9A 4IGHA 3CH0A 2D3LA 4DNMA 7A3HA 4U10A 2IKGA 3ARSA 1SQ7A 3MMTA 2YB4A 2ZZ3A 1C29A 2W63A 3AXMA 4ZR8A 4RW3A 4PE8A 4JXCA 4LAZA 5DBTA 1FCQA 4MB3A 1JFXA 3V0SA 4DO7A 3ZR4A 3MCNA 1PIIA 1F3EA 4XBKA 1RA5A 2V3EA 3ABQA 1VKFA 4MJZA 2QKFA 5FEZA 1JD9A 1GUVA 4XAPA 2REQB 1TTIA 3SQSA 1XYCA 3RLGA 2BB0A 4YYCA 1YE4A 3W7OA 3F4CA 2Z1KA 4LNCA 1OG6A 2AL2B 2EHHA 4N9EA 3H53A 3NM1A 1S2TA 3LM7A 5BXSA 4W9TA 1UD6A 2HDJA 3AYSA 1B4KA 4PCSA 5E93A 1VFOA 3U2OA 3BOFA 3AS3A 3VUPA 3TQVA 3QM3A 4YTSA 1WV2A 5FF2A 3NL2A 1IXOA 3OQEA 2QDDA 4AZIA 3PG9A 3M07A 2GGEA 2G50A 4RZ5A 1QHZA 2G5WA 1CPUA 5CZ0A 1E3ZA 4AMAA 2Y8UA 5FF0A 1KNWA 4XD5A 1OCJA 2BSLA 2QMKA 4DJDA 5BZAA 3ANUA 1J01A 4HOWA 2CZEA 4GZJA 5I06A 3W28A 2HMCA 1QBBA 3E0FA 2ZUMA 2HRWA 3L0NA 1F7BA 4QM1A 5DCEA 4AIBA 3W1NA 1LUCA 1FFQA 3G3DA 2FB2A 1CI1A 4ACZB 2EPMX 5I24A 3IJ7A 1JZ5A 4M29A 1BWVA 2XIOA 3PHAA 1YE6A 1CW2A 1KM1A 1DE5A 1JUEA 3PUOA 1R0MA 1KM2A 3O16A 3UETA 3OBEA 1XPYA 3EOOA 1FKWA 1QNVA 2PDCA 3QR3A 2ZUUA 2XGBA 2ABBA 3R43A 1E51A 3MYPA 1IZJA 3SFKA 1I0BA 4IP5A 4V28A 4H83A 1Y8BA 2E4TA 3G24A 3N11A 3OBKA 1R3VA 3PPGA 1KM4A 5CC3A 1QCWA 2PTYA 3TLLA 5G1MA 3LI1A 3O2LA 5IHSA 3K8MA 8A3HA 1ELSA 4WDTA 1QPNA 2WBKA 2UBPC 3ENLA 3T6CA 4UTFA 3LERA 2ZRVA 1XDJA 1R3WA 4EX4A 1QW7A 2AAAA 1S5VA 2OO6A 2ISVA 4YYFA 4JTSA 4LW7A 1AJZA 2FLIA 3V16A 2E1DA 4REQB 1ME8A 2A6LA 2PWEA 1Y5VA 3AIRA 4G8TA 4N4QA 1S5TA 3MWAA 5KMYA 1XYZA 5EBUA 5IRPA 2X1RA 1W17A 1Q7ZA 3PWIA 3CZEA 3WLJA 4RDYA 1TO3A 1A5AA 2XDFA 1E0UA 3EKGA 3T2OA 1GQNA 3E2RA 3L65A 1BGAA 4M6VA 5DN1A 3P93A 1Y65A 1CTNA 3TN6A 3M0VA 2PWUA 4IMFA 4DX3A 1XKJA 3M46A 2I14A 3GIPA 4CCZA 4O1BA 4ADSA 1JZ7A 2RKXA 2NQLA 2WXDM 1F2JA 3ZS4A 1H0IA 3ABRA 2R8WA 4IL2A 4NXKA 3GB6A 1A4LA 3STGA 2YLLA 5CJNA 1IF2A 2FMOA 2KAUC 3AIWA 3IJ8A 4MY1A 4LBRA 1UC4A 7REQB 4JTRA 4ROQA 1OX5A 3TC7A 1E73M 4FIQA 4TXEA 3ISIX 4HHPA 4I7UA 1D8WA 5CBIA 1YBQA 1XJBA 2WCAA 2V2HA 1F6PA 1TPFA 3W81A 3U7VA 3WMLA 4IJBA 1UR2A 1E9IA 5HANA 5I6SA 3RITA 4P2VA 1MDRA 3I65A 1X38A 3IJQA 3SUTA 4GO9A 3FKKA 4ZZ9A 1F74A 1OFEA 4K38A 1JZ3A 2POZA 3CTTA 3VI2A 5AC8A 4GHRA 4B92A 4B5WA 1BFNA 1PO9A 3KL3A 1CXLA 4I6VA 1M3UA 5BXPA 1EF3A 3IJIA 2ZICA 4JN6A 5FEPA 2DIJA 1B3WA 3AIVA 4U5KA 1VIWA 3THDA 1RY0A 5LZLA 4HNTA 4GC4A 1GOIA 3KW3A 5BOFA 4LY8A 1K8XA 3AALA 4TUFA 2ICSA 1X1NA 1GVYA 4GCAA 4GNKB 3TSDA 3GTXA 1GVFA 4JYFA 1W54A 4ZVJA 5CPTA 1U30A 1TB3A 1MW3A 3B04A 2V5LA 1R3SA 5DANA 3KBJA 5GNYA 3NTYA 1POJA 2BOFX 1S2WA 1A3HA 3FA3A 2NVAA 3UG5A 3A4XA 2D24A 4UFLA 4XAFA 2Y7GA 5M17A 2PE4A 3CZLA 2YDSA 5A1AA 2AMXA 2QCEA 1M41A 4XX6A 3AS0A 4R33A 3UWVA 4RXFA 5LA1A 2V67A 1V3KA 1MW0A 2PTWA 3TR9A 3QTPA 5ABGA 1JVNA 3PPFA 4YNGA 1UR9A 1G4SA 1PDYA 4NYYA 1V7AA 3KBSA 2PUZA 1FWDC 1TZ7A 1XR2A 1KGXA 5G2HA 2IPWA 1JF6A 2YCLA 2JIEA 1XFBA 1DWFM 1SO3A 1XH0A 4WKFA 2JKEA 3RO8A 2IPGA 4LANA 1GJWA 3TN4A 2QF8A 1LLWA 5C7VA 3QLLA 2OZTA 3EA1A 3F4NA 3TSBA 1K9EA 4WXYA 2OYMA 4Z2JA 1J18A 3DFNA 3OG2A 4C7GA 3COTA 3JS3A 1US3A 3QFEA 2WMJA 3SY1A 1IXPA 3N3MA 1WXJA 4X3ZA 2W4XA 2G96A 1KCZA 5CPSA 3PZTA 2PP3A 1JYNA 3AMDA 1Q6DA 4OUIA 1L2QA 4PUNA 1TA3A 1ZUAX 4MKNA 3QGVA 5BRPA 1IR2A 5I3GA 3FVMA 1DE6A 1OF6A 4NNCA 4IZGA 3QPYA 4DAIA 5LGXA 2Y61A 5BWAA 4AZCB 3L9CA 3ANVA 2WJZA 3NAVA 2QUMA 4DI9A 2FHCA 4RLIA 1B3XA 2CBIA 3WLNA 1Z48A 5FSDC 3TYDA 5GJNA 2WVTA 3IV8A 5FF3A 3UP8A 5I0DA 2QCNA 1P0NA 2NLYA 2VDHA 4B5XA 4WSKA 2HVOA 5IBXC 1Q6OA 2DQWA 1VR6A 1OWQA 3BC9A 3BJFA 3B8SA 3MYOA 4W7VA 4LUTB 3FY1A 2OR2A 3NURA 2A7PA 1UJPA 1XRVA 4OZOA 3W25A 3W9ZA 4DWDA 1TV2A 2Z1SA 1JPIA 2DT0A 4A05A 4B9ZA 3H54A 4DO5A 1VRDA 4O53A 4ZSTA 3LXAA 1K7FA 4B5NA 4UFKA 2NQZA 5J5RA 4R7OA 2QCDB 4B2DD 4CEXC 5DQPA 4ZQCA 4QSHA 2W62A 1EIXA 4GKTA 4UTTA 3M0KA 1MQRA 3IIZA 4PL2A 4HPXA 4J2PA 4EPEC 2PCEA 3TAKA 1V4YA 3WNMA 3F2DA 2YYUA 3KRZA 9CGTA 3A3HA 4NSBA 2D2JA 3ITLA 3SM0A 1TCDA 3M44A 4JQ4A 4F0KA 5AC7A 4OHQA 1F3TA 1J93A 2Y8VA 1P0BA 4HQVA 1V6VA 3W6MA 4JZ5A 4KWSA 3NFUA 5A8NA 4GVGA 1QI3A 5J04A 1JPKA 3URAA 2C13A 2PDPA 1FHUA 3WUFA 3S2LA 3WLHA 1XGEA 3GW0A 5HUOA 3HO8A 2A3LA 1V0NA 3HQPA 1XLDA 3KDOA 1H51A 5JXQA 1TV3A 3S2CA 4V1YA 1JIBA 2P1FA 4DLMA 3MMUA 7PTDA 3N9KA 3CAKA 3M0YA 3H8AA 3OLEA 3BZJA 3N12A 4C6EA 2JALA 3DZ1A 5I3DA 5GJPA 1U5JA 1W32A 3D3FA 1KB3A 5FI8A 3RIKA 2C19A 3UEQA 3HGJA 4GISA 4PEEA 5CXPA 2E9MA 2GZXA 3WF4A 3SO7A 2OCZA 5XIMA 1I0DA 3OOQA 4K1GA 1EF2A 1M7JA 4GIAA 1NWUA 4EACA 3KVMA 1WAUA 5ABFA 4HHMA 2JFEX 2XWDA 3NYDA 2XSXA 1W1IE 4QXIA 3RO6A 3MI2A 4I8DA 3TJIA 1VLIA 2Q01A 1AJ2A 1QOXA 1V02A 3QW4B 2HS8A 1H50A 2XWEA 1L6FA 2PP1A 6ALDA 3SCPA 2RHGA 3NZ1A 2PF8A 4KRUA 3PWAA 1XGDA 2BHUA 3N15A 1MZHA 1PZ2A 3WDPP 3U0HA 1MMFA 2W67A 1ONRA 3GVVA 2YXXA 1MWOA 2O0TA 3R8RA 1XIJA 1AW1A 4X0VA 2VJXA 3SRKA 4KRTA 4JTHA 3TR2A 3UY7A 3VDHA 3GDLA 4H9UA 1FFRA 3VABA 3BW3A 3GIQA 2E77A 4TTGA 4MWAA 3N18A 1JPHA 1OYAA 1YXYA 3QHNA 2GGGA 4GMEA 3ZMRA 1G5AA 2F2KA 2HVNA 3BANA 2OB3A 4Q4PA 1QI2A 1IXQA 1TPWA 4AG0A 1L8PA 3IIVA 5A2BA 4JKKA 4GOAA 4JTUA 4U33A 2QCCA 4WHBA 1TWWA 5XIAA 2O9PA 2YBUA 4YHGA 3NNTA 5AN7A 3D3AA 3CWHA 5H1WA 1BTCA 5BYWA 1GOXA 1FDJA 1WZLA 3RX4A 2O9RA 3EDDA 2CZDA 1P7TB 2CLPA 4Y9OA 2OXNA 3UT0A 3GNRA 2PPGA 5BROA 4W5ZA 3MKKA 1R8LA 4QQUA 3C56A 1ISZA 4FNTA 1C93A 2QIWA 1XDMA 1UWAA 2CNCA 4MMWA 4HNUA 5D2WA 2RDUA 3G8RA 2DT2A 2EPHA 3WNNA 4XISA 3GTNA 5DMNA 4RZ6A 4EPKA 1RSCA 1XIBA 3FDGA 1L6SA 2ZXQA 2ALDA 4TX6A 1FY6A 3VOGA 1UA7A 2ZUVA 1SFSA 2QMJA 2JEPA 1JJKA 3K4AA 4H8NA 4O12A 4Z1YA 2KX9A 4WGXA 4NI8A 3GX9A 1UBPC 3N2CA 3MMWA 1NU5A 4QR6A 3RPTA 4W85A 2Y63A 1TPB1 3L12A 1DIDA 1DPMA 4F0RA 4HD5A 4WIWA 1LRNA 4JKLA 2FIQA 3PM6A 3FK4A 3T8LA 2YA0A 3S5ZA 3UERA 1OFRA 5LNUA 4WY0F 3R25A 5A3HA 1SW0A 4O1DA 2J8GA 1HJUA 2IW0A 3ZR6A 2VZOA 2XM2A 1V77A 2YJQA 3XIMA 4MPQA 1ISXA 1NOFA 1T5AA 3QQ1A 2XVPA 5G2IA 4IP7A 3SCOA 1GOOA 1V7YA 3LXBA 3KVLA 5BOOA 2R1MA 3PJXA 3STEA 3P0WA 3FFSA 1BWKA 4IUGA 3M5YA 3T8QA 1OZMA 4LRTA 3M5VA 1W5MA 3GYEA 2J77A 3E6EA 4DBUA 2A2IA 3BMXA 1FWHC 2FTWA 4X2PA 3W85A 3PBUA 2FPTA 4C6JA 3WEZA 4AF0B 4U2ZA 3GH4A 1TPH1 5I09A 3PZVA 3TEVA 2FTPA 1GKPA 4WDUA 3OGRA 4O1FA 2GSEA 5HWJA 2XHYA 4MNKA 3L5AA 4G1KA 3MDUA 4IFOA 1TVLA 1D2KA 3FEQA 3OTRA 3EWUA 3U48A 3ZJ6A 3QC3A 1R9XA 3GY1A 1SJBA 3CO4A 3SDOA 2CLFA 3CU2A 3GRIA 6REQA 1FWIC 1EO5A 4O19A 1Y0EA 1PVNA 3C4UA 5FJIA 3VNYA 4NHVA 1OINA 1GW9A 1RP8A 1W5QA 4C90A 3OZOA 2HE8A 3HJZA 3NEHA 2A5HA 3ALFA 2VEIA 1KFJA 4WZHA 3NZPA 1AQHA 4BEQA 3H2EA 4PMRA 2VX7A 3NSMA 1AODA 2VTFA 1ITUA 1OQFA 3TA6A 2X0YA 3EXRA 2P50A 1HJWA 3BLLA 2WKLA 5CPNA 2XUCA 5E9AA 5T26A 4RK8A 1PDZA 3NPWA 4D9PA 4AU0A 3P74A 1FCBA 1MYRA 3T2PA 1CXHA 2WCGA 5BMWA 1W3KA 2QUUA 1S39A 3QXBA 3D47A 3C5QA 1EC9A 3U9IA 3KBNA 3QPZA 4F48A 4LPCA 3HPSA 3NPUA 3ME3A 1LP6A 1U5HA 1EC8A 3C2RA 4QFUA 1FX6A 3E02A 4M80A 3WD4A 2CWNA 8CGTA 4MSSA 3PSVA 2V5CA 2VQUA 4US5A 4PUEA 5DCDA 1QHPA 4WEVX 3QHOA 1JPMA 2FZMA 2DJXA 3RR4A 2ISDA 1UZ4A 2OEKA 4A8LA 1S5NA 3FA5A 4XIAA 4B90A 1J6OA 2HXUA 4HIBA 3UR7A 3VGBA 3R12A 3VKCA 1HJSA 4I9AA 4JYEA 5FD0A 1TV5A 3T42A 3VFLA 2A79A 1MEIA 2VP8A 4HSOA 4XSLA 5KEZA 2VGBA 2Z7KA 3VIJA 2B7PA 3W07A 4MIMA 3CQIA 3E38A 1JYVA 4GE8A 2QJNA 1F4HA 1QWKA 2DPEA 5LNWA 4NAFA 1I2RA 3WQPA 3MPGA 2HCVA 2XU2A 4K8EA 2V6AA 1NDVA 1H7WA 3EMZA 3PTQA 2OMAA 1CNVA 3UZJA 5G2WA 2VC9A 3PN8A 5LIYX 2ACQA 4JKMA 5TIMA 3AMKA 3QYQA 4WF7A 3LHTA 3WNOA 4GGHA 3LCWA 1NEYA 1HFBA 2R1PA 3PB0A 1W1A1 3DENA 4P7LA 3TNOA 5M03A 3IJLA 1C7SA 3NXFA 1EZWA 1J5TA 3N2OA 5ECVA 2GFTA 4DLFA 3Q94A 1OT1A 2WSQA 5LKYA 1UA3A 2YW3A 3W53A 4IIGA 4KKXA 1OIFA 3DEQA 1WOAA 4HYRA 3CASA 3NPXA 5F7UA 3BMVA 3LA4A 4AD0A 4QIUA 1L6YA 1H3GA 1EX1A 3DKJA 4PCPA 2BHYA 3LCGA 5A95A 4GA8A 3GXNA 3KP1A 3FLUA 3VINA 3L4VA 2QDHA 3BAJA 2E5DA 4N9CA 2CHOA 1IYXA 4LF2A 4DO4A 3E96A 1W1B1 1L8NA 5DT5A 4WDXA 3S1XA 3N17A 3BK0A 4Q8PA 4OT7A 5D2VA 4I9MA 4JDBA 2PLJA 3LEPA 3WFAA 4OKDA 3LHYA 2VT0A 3T4WA 3URNA 3V5CA 3TCEA 1WXYA 4XD3A 3OO2A 1VCGA 1HO4A 4ML9A 3CS2A 3RLUA 4XAGA 2X1TA 2CIPA 5EFFA 3MZNA 4H19A 4M8UA 4X9SA 1DP0A 1WXZA 3GNDA 2Z0IA 1LLZA 3GC2A 1R3TA 3NQEA 2WKGA 4UFIA 1W5OA 1HL2A 2Q3OA 3SSJA 1VD6A 3VKDA 3CJPA 3W1AA 5DY3A 2GVJA 1W9UA 5A6TC 3IGHX 1JRCA 4U5IA 4H8UA 4DRSA 2XIQA 3DOPA 4GXWA 1K9DA 8XIMA 1TPDA 2I16A 1J0YA 3UG4A 3PF3A 4ICMA 3VD3A 5GPRA 2EBNA 4JR5A 5T91A 1N8FA 1LTDA 4YCOA 1W1TA 3DXIA 1U5VA 4GUIA 3VNDA 2PC8A 3CB8A 4EIVA 2A6NA 3T4CA 3LCLA 1GEHA 4MKVA 4AZ7A 1BVNP 1J8VA 4KGLA 3WQGA 1OC7A 4P8VA 1DJXA 3LQGA 4BZYA 1YBQB 4OIFA 5JUVA 2P8BA 3O7UA 3PZGA 4GO8A 1RA0A 3S5SA 1S38A 3ERPA 1LQ0A 4AHPA 3DG6A 1QI4A 2PRHA 1GQLA 1V0LA 4GVFA 1J12A 4Z0SA 1T7LA 2Y4SA 3GG7A 4C1NA 3BLIA 1JD7A 1MXDA 2WNQA 4I5RA 4AVFA 3IAPA 3W2NA 1E6ZA 1A0DA 1TMLA 3W1RA 4M0XA 4MY8A 3NXLA 4BQ4A 1LOQA 3CIVA 3EXSA 3T05A 4ADUA 1EBHA 2W92A 3VNJA 1HJQA 3CV1A 3F7JA 1F8IA 5LXXA 3R1ZA 3HMCA 3USZA 3ZT5A 4QDPA 4LCSA 3MWCA 1H2JA 4L9ZA 4H7VA 5DRIA 3PK7A 3NQ2A 5TBOA 3QQ0A 3NL5A 4NZFA 4Z2HA 3AWNA 1E4IA 4Q7BA 3TROA 2OZ3A 3WYZA 1KKRA 1SO6A 1W8SA 4CKQA 1YDNA 1E6QM 1VBGA 5A8QA 2IS7A 2DZPA 4M6PA 2PZNA 3OU8A 3R0UA 4MPKA 3MTWA 4OOUA 4S3KA 4AISA 1ZPTA 4ZCWA 1T41A 1E6XM 4FMVA 1QVBA 4ATWA 4KIRA 3BGGA 3WJWA 2CBJA 4GABA 5EYWA 4CQ8A 4B5VA 1SFJA 1ECEA 1YNPA 1TUXA 1UWRA 2B0MA 4PMZA 2VM8A 1H11A 3FAWA 4I9TA 4I9JA 1OFQA 4DEFA 3K1GA 1QNPA 2FB3A 3KM8A 1W9PA 3NQAA 3M0HA 2H9AA 2YCLB 4J27A 4RNFA 1F05A 2R1NA 2WNZA 4JGDA 3CH9A 4PUMA 2PODA 3NQ8A 4IMGA 3LU2A 1E9YB 1B1YA 1Q13A 1Y5WA 2J6XA 2I1OA 3OA3A 4JX5A 4ONVA 3S0CA 4AX7A 3IK2A 1YTEA 4RPQA 1E0TA 1KGUA 5GVJA 4Z2IA 2FZ9A 5DFAA 3QOMA 4FXRA 1UQYA 4JTJA 4JTKA 4ALDA 4IGSA 2YCEA 3PZIA 4LAKA 5DMLA 2NV1A 3R2GA 3RYSA 1BHGA 3OZYA 5HPCA 3R7MA 2BVYA 4H7CA 1Q8AA 3VKAA 1HL8A 2PLMA 1JQVA 1BQCA 3B4YA 3PB2A 4H9TA 4HNNA 4QTGA 3H21A 7CGTA 1TA3B 1LG1A 1US2A 2MNRA 2YFNA 3P67A 5AZ0A 1GTHA 2ZCGA 1DOSA 3S5NA 1FWBC 3HJEA 4UMCA 2RH9A 3VNZA 3W7JA 1GZGA 2IQDA 4H01A 3LHUA 2XGZA 3WMBA 4CVUA 4HBKA 3LGEA 2Z4GA 3MI3A 1S46A 4FLSA 1MQQA 3KWSA 3SEPA 1W3IA 5CAHA 4IIBA 1CDGA 2X8RA 3CLWA 3MUIA 5EMLA 4L6DA 3KBWA 4KRZA 2VCBA 4HMEA 5EPDA 1PSCA 3IRDA 2EEXA 3SCWA 3W4RA 3TUUA 1HF6A 3AI0A 4XZIA 1RBAA 4HA0A 2IKHA 3T0TA 5ABHA 2JKPA 1CBGA 1XCFA 4AY8A 3EWWA 4DBEA 2POTA 1IEWA 4HP5A 2QULA 3LPPA 4GH3A 2Z25A 3WH9A 4YVPA 3AOFA 1AFSA 3TXZA 3MKVA 3NIYA 5C2CA 4D8LA 2QAFA 3SJ3A 1A5SA 2BOGX 3EYPA 4U3AA 1SSDA 4UBPC 4IJRA 1VFLA 4NVTA 3FHAA 4RZ4A 1ZHAA 4JIIX 5PTDA 4EK7A 3RAOA 1QU4A 1TX0A 2JE8A 1YKWA 1I1WA 3PP7A 1J0JA 1UKPA 3LN3A 4GVHA 4KEZA 4UXDA 1XLKA 3BJTA 4HMDA 3B8IA 3S1WA 4PH6A 4HZMA 3DN5A 4J28A 2J9XA 3CUHA 1EJVC 1KV5A 2OOFA 1VFMA 5T8GA 2CC0A 1PTGA 4TTUA 1EX5A 1KXQA 1ZALA 1TTQA 2AGKA 3GBEA 4Q4OA 1SO5A 4AIUA 4F79A 1E0VA 3IGXA 1LF1A 4O8AA 3ARTA 1NOUA 4FZIA 1XRTA 3I6TA 4IMEA 4BFAA 1BGGA 1UZHA 2EPLX 1UIPA 2WZMA 4OV9A 3N1AA 1F76A 3RG6A 3RPDA 1E6SM 4MFDA 2P0IA 1W2VA 1Z69A 1A5MC 1X7IA 3UYIA 4RDZA 4UTIA 4YTRA 2VCAA 3MUZ1 3ZLGA 3TIMA 3T0AA 2J7GA 1KKOA 2NT1A 2Z2UA 1YMYA 4PULA 3LPGA 2V2CA 2V5BA 1XXXA 3H26A 3QZEA 1DJIA 4QE4A 2PU0A 1TMQA 4AD2A 2OO0A 2YCKX 3S4TA 4D6FA 4KBXA 4GNJA 4HN4A 4LYQA 2LLEA 3A5VA 1CB2A 1OFOA 3OHMB 6XIMA 5M2FX 2F6UA 2AAMA 5ABFB 4KERA 1UBSA 5D04C 5EB8A 3WLSA 1XSIA 3ZQ9A 5CSSA 3MMDA 2DIKA 1AG1O 1VPQA 1Z32X 2QEZA 4F40A 2XFWA 2J25A 1GWJA 1PYMA 4J5NA 3QGAC 3MVTA 3LQLA 2VURA 4UUIA 2J7CA 2BY2A 3MW7A 2CKRA 2XH4A 5I07A 2BY3A 4Z17A 1NF7A 1QXLA 5I3HA 4TVDA 2BVDA 3S5OA 1ZENA 3KAOA 4D71A 4HK6A 2ANUA 3VXGA 4N9DA 1KRAC 4AAJA 2JEQA 1Q85A 4GY0A 4NASA 1W3LA 3M16A 3TTQA 3GVRA 1SGJA 1H09A 4QS5A 3I4KA 3GD6A 2OSYA 2NT0A 4C6FA 2WC3A 3MCMA 1JDFA 4MWAB 4FK9A 3P6LA 4F0LA 1UOKA 2NXHA 2VKZG 1QPOA 1VRXA 4NNBA 1O66A 1ZQ5A 2J9YA 4G7FA 1SJAA 2ZRZA 5LSMA 2QDGA 2DZUA 1H62A 2TSYA 1U1UA 3CZGA 1TJ2A 5I3FA 5CGTA 3W75A 3HB9A 3H7VA 3VVGA 2GGJA 3F2CA 3BSMA 3GU1A 4E3TA 1VBUA 2IUZA 3N6JA 4MJMA 3BMWA 3CL8A 2PI6A 3OLDA 2IKJA 3UZXA 1Q66A 4O1AA 4O57A 3ID7A 3K46A 3BCJA 3TW6A 1PTAA 1KFKA 1XLGA 3UZZA 4I5UA 3SCRA 4JTGA 4KS0A 3ORWA 1W5NA 5C9UA 4O54A 4FX6M 2F84A 1FDYA 3VGGA 3WQCA 2VFGA 3B9DA 3PZOA 1E4NA 1U33A 1VJIA 4M1BA 1FWNA 1KFLA 4NX5A 1CT5A 1EDGA 5HULA 3CM4A 4JTTA 3EBVA 3ARXA 3F03K 2BXVA 4ZFMA 4C7FA 3QZAA 4XKMA 3S2JA 2E68A 4NYUA 3A9BA 3FV9A 3V1HA 4YN5A 4U3CA 5EKYA 1F61A 1ML1A 4M5PA 3PBYA 3IEBA 1JNEA 2PGEA 3G77A 1WP6A 1GOWA 1D3HA 4ATDA 2C7FA 2GQ9A 1JAKA 3THAA 3CYJA 4BI6A 4WSJA 3TJ4A 1EHNA 1UWUA 4ECLA 4JTAA 4UIOA 5AVNA 1W91A 1OCQA 1K1DA 2E3ZA 1QR7A 5A8GA 4KFNA 3PJUA 2L5HA 5A6MA 3OVPA 2NXIA 3WZ0E 5EFDA 4MADA 1FDZA 4XTIA 4JTEA 2ZTJA 1C90A 1M53A 2OLSA 3AIEA 5XINA 1E3XA 1B30A 1J10A 3VK5A 3W2JA 4DBDA 3VM7A 3BUVA 3TP4A 1MW1A 5I3KA 3QSRA 1C8VA 2CBUA 3LY0A 2ZZ2A 3OEXA 4GYJA 1IQ8A 2VDGA 1OT2A 2XVGA 3SQMA 3W1PA 4QJ1A 1F9CA 5IFTA 1JCNA 4Y7EA 1AH3A 2EPKX 3LSBA 4MJ2A 4LGXA 1K4HA 1V6TA 3GZAA 4HTBA 1LL6A 1YTKA 2C79A 1CZ1A 1K9FA 4L1GA 1TTPA 4V1XA 1Q63A 4HJWA 3M7WA 4W8LA 1FH9A 1ZS2A 1AW2A 1ESWA 1KC7A 4H8HA 1TVPA 2YL6A 4S2CA 4MB4A 5GNXA 3O63A 5AZ1A 2XH2A 1KA9F 4G2DA 1TJ0A 1DYSA 3V0UA 4GYFA 2XN1A 4LOCA 2FKPA 3FSUA 2QVNA 4W5UA 5CJ5A 2O56A 2GPTA 1XIHA 2WMFA 4WJ8A 2C0AA 4QHRA 4GQ0A 1SZFA 2WNWA 1H1YA 1G4TA 3S42A 3FYYA 2C8NA 1RALA 3WBEA 2DW7A 4BQ2A 3AYVA 4F4RA 3L4TA 3MO4A 4ZENA 1MZRA 3L21A 4FHAA 3AYTA 1Z44A 4CCEA 3MV01 4NJIA 3UWWA 4AZHA 4JIQA 1DWGM 1EJRC 2VVSA 2GJRA 5DXXA 4H41A 4OGZA 3MP5A 3CYVA 1JUKA 4HHLA 1A50A 2GK1A 1KQZA 3REQB 3VC5A 5AHIA 2PS2A 3LPOA 4GFIA 1ECQA 1J2BA 3UNTA 4QSFA 2X42A 1HVXA 3VKJA