3QBUA

Crystal structure of putative peptidoglycan deactelyase (hp0310) from helicobacter pylori
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
290
structure length
290
Chain Sequence
b'AKEILVAYGVDIDAVAGWLGSYGGEDSPDDISRGLFAGEVGIPRLLKLFKKYHLPATWFVPGHSIETFPEQMKMIVDAGHEVGAHGYSHENPIAMSTKQEEDVLLKSVELIKDLTGKAPTGYVAPWWEFSNITNELLLKHGFKYDHSLMHNDFTPYYVRVGDSWSKIDYSLEAKDWMKPLIRGVETNLVEIPANWYLDDLPPMMFIKKSPNSFGFVSPRDIGQMWIDQFDWVYREMDYAVFSMTIHPDVSARPQVLLMHEKIIEHINKHEGVRWVTFNEIADDFLKRNPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
molecule tags Hydrolase
source organism Helicobacter pylori
publication title The Structure of Helicobacter pylori HP0310 Reveals an Atypical Peptidoglycan Deacetylase.
pubmed doi rcsb
total genus 96
structure length 290
sequence length 290
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2011-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 3qbuA00
3S6OA 3HFTA 1W17A 3WX7A 3CL6A 4NZ1A 1Z7AA 2XU2A 1V6TA 2DFAA 4NZ5A 2Y8UA 2CC0A 4V33A 2J13A 3VUSA 1W1B1 4U10A 4L1GA 1XW8A 2C71A 5BU6A 3CL8A 3RXZA 2C1IA 4F9JA 1NY1A 4NZ4A 2IW0A 4NZ3A 2NLYA 1W1A1 2I5IA 3QBUA 2C1GA 4M1BA 4NY2A 2E67A 2QV5A 3CL7A 4HD5A 4NYYA 5JMUA 4F9DA 4WCJA 4OUIA 2VYOA 4LY4A 4NYUA 2C79A 2W3ZA
chains in the Genus database with same CATH superfamily
4E2VA 4NAEB 3UA3A 3E12A 3CIVA 1JIBA 1OX4B 4MUPA 1NOFA 1QJWA 5CAHA 1BYDA 1CXFA 4B9ZA 1FWEC 1TWSA 3PZOA 4Q8WA 4NSBA 3AICA 4S3DA 4XKYB 4GYJA 1DJHA 2A6LA 2PTZA 4GPNA 1V3IA 1TREA 4AYSA 4K6AA 3CHFA 1UKTA 4JIHA 1NDVA 3UGVA 1PZ0A 5G1YA 4NI8A 4A8LA 1J6PA 1VCGA 3FOKA 3QR1A 3TFCA 1Q6LA 2XFWA 3R5EA 4TO8A 1YPXA 1YBQB 3VDBA 3L65A 4U2YA 4F66A 1R9XA 4F40A 1I4NA 4AD3A 5BW6A 4RK8A 4L1WA 3VGGA 1O5RA 5F4WA 4BI5A 3N29A 4AX7A 5CGMA 2FVLA 4RW3A 4QDWA 3ZLHA 1KTNA 3NL5A 4FXJA 4ZFMA 1W5QA 4KERA 3GZ3A 4I5UA 4HNNA 5JUVA 3T2QA 3SCWA 2PDJA 1NF7A 5EMLA 4IPIA 1P1MA 4JBRA 5FEXA 2ZZ6A 3LHYA 1D9EA 4LRSA 1KFEA 2NQ9A 4WY0F 3ZS4A 4Q8MA 3QYSA 2WC3A 1TPVA 1V0NA 1E56A 5A6BD 2YB1A 1DJZA 2ZRVA 4OJYA 4DJDA 4IHCA 5CGTA 3BG3A 1A0CA 2ZUSA 2CESA 1DJIA 1EEPA 1GVRA 3I65A 4JCLA 4BS0A 4XD6A 5BRPA 1C8YA 5MF5A 1R3VA 4TX6A 2V6AA 4O57A 1FX6A 3SFWA 3A23A 5HWMA 3AI0A 3TTQA 3WLLA 1ZUAX 1RAKA 4QJ5B 1JEZA 1SZRA 3D47A 3KRSA 4DJEA 3CHVA 4PN2A 2Z2BA 1CIUA 3FJ6A 9XIAA 4JAWA 3STFA 5D03A 3NO5A 3VGEA 3CYVA 3O63A 3E02A 4PRWA 1OK4A 2PWGA 3LENA 2POZA 1MW2A 4DM1A 3DI1A 2V0TA 4K7YA 1IGSA 1ZNNA 5REQB 3M0VA 3AZSA 3MUAA 2IMRA 4DQWA 3QXBA 2CWXA 2E9MA 5CAKA 1EHNA 3WNPA 3WMSA 3HPSA 3PFRA 1KNWA 4PTXA 1XF0A 3OG3A 5D2VA 3AO0A 2DUXA 4GX8A 2XISA 1RCOB 3SGGA 1V02E 1P4CA 3PULA 3OYZA 4MTVA 4FR6A 4H19A 4HJFA 1XPYA 3PPGA 1FCUA 2BXYA 2H90A 2VC9A 2P3EA 2CEQA 3BLFA 3EWDA 1KGXA 5J8LA 3WNNA 1J0IA 3W6LA 1JCLA 3WDQA 1BSIA 1DJXA 1W5OA 4BY3A 1SM9A 1I2NA 2BY2A 3DFQA 4BKNA 3NGFA 2YXGA 4TX9A 4IOTA 1R3YA 2ZZ2A 3PZMA 5DRIA 2YJQA 4Z2HA 5C7VA 4MB4A 1L2UA 4H6EA 1FWTA 3KDNA 3TJ4A 1XDMA 3S1WA 2VX7A 2VDGA 1P5BA 1V6YA 5A8GA 3W7KA 4ML4A 1HO1A 4O19A 3NZQA 1EX1A 1R8LA 1XIBA 5JH1A 4XO7A 4EXBA 2OT1A 4RE0A 1NWSA 3LHUA 3L68A 3P8IA 5CGQA 3ERPA 2XVGA 1NIUA 2ANUA 4JIIX 3UY7A 4CCEA 1Q4NX 4ATLA 3S4TA 4QEHA 1WYIA 1DWIM 8TIMA 4M1RA 1N7KA 2D2JA 2NX1A 4JTTA 1TPH1 1UJPA 4RCXA 3TSDA 1XUZA 3IIVA 3O15A 4ES4A 3O8AA 1PO9A 3KBWA 3LY0A 4A35A 3P60A 2WJFA 1G9HA 3N6QA 1UWUA 1KKOA 2PDGA 3BTNA 5BXSA 3HURA 3RU6A 1I1XA 4G7EB 3N18A 3BQ5A 1KWGA 3T0BA 3CQ0A 2VYOA 1LBFA 1HGYA 4I7UA 1NSJA 4WUIA 4W7VA 1G67A 2ZUMA 3W38A 3ZVHA 4P8WA 4HNLA 5I07A 3PTKA 2GGJA 1JYNA 4AZ7A 3M5XA 2PWEA 1XV8A 1F3XA 1XG4A 3L0GA 4DNMA 3TW7A 4ORMA 2FPVA 3W75A 2D2GA 2DW6A 3IRDA 1SO4A 4LFYA 4DNHA 4KWOA 5FJIA 1J0YA 3M7WA 3TTOA 1ITCA 3R1ZA 1JYXA 1DIOA 4MVAA 3ARUA 1KRCC 3VABA 4GUFA 3LLDA 2NUXA 3PFMA 3QV7A 3BLLA 3WQ8A 1XGZA 3L0KA 3G77A 3GDRA 2A3CA 4QLLA 1XSKA 4TV5A 1VS1A 3CUFA 1GVIA 2Z26A 4Q4RA 2CLLA 1W5PA 4B92A 3U2CA 1R7AA 3B04A 2V63A 3G1SA 3EKLA 3GR7A 1J5TA 2B7PA 1BPLB 2VTFA 2E25A 4LS1A 4EF9A 2W61A 1XIHA 3FDGA 3GG7A 1ZU8A 3H23A 5CC5A 4S3AA 2YA0A 3E96A 4Z2IA 2DZAA 2CWNA 2ISSA 3MMUA 4Q8QA 3JVAA 2I5QA 4P7OA 4Q8NA 3GLCA 3P62A 1JVNA 2FZNA 1TPFA 4RE4A 1X98A 3ES8A 4LXFA 1GKQA 4K2SA 4Q8PA 4BI6A 2Y7FA 1JZ6A 1S5WA 3ABXA 1KGUA 4L7ZA 2VQTA 1OX6A 3QPYA 1P43A 3QMRA 4BQ2A 1LLZA 4FF7A 4D1IA 3VZXA 2J8FA 2OEJA 3NQMA 3LN3A 2YDSA 1UHVA 4LUYA 1GQJA 4MKVA 3PR2A 4F0SA 1Z7AA 3GXTA 1OF6A 3VOCA 3WJYA 4KRTA 1GTHA 3KP0A 5ECUA 5AZ1A 4EANA 3NQCA 1PX8A 2JQXA 3E1F1 1J10A 4B2DD 2MANA 4E8CA 3GAKA 4O18A 1B9BA 2NV1A 3AHTA 2J78A 2GGEA 4HTBA 3DENA 5DQPA 1XBXA 2EAWA 2WO5A 4OOZA 4WJEA 1PTDA 1Z69A 4DZIA 3E9AA 2XWDA 3NWRA 1BYAA 3EDDA 5J5DA 3PB2A 4IGHA 4LY4A 4XSLA 1F6YA 1KM6A 4EXAA 1MFVA 4LQ1A 2G3FA 5KEZA 2QS8A 3AS2A 2ZTJA 1RP8A 5BU6A 1QW9A 2ACQA 2AOSA 1XM3A 3KTCA 3TUUA 3W0KA 4GRSA 3W9ZA 2YB4A 1XUUA 3LA4A 5E1QA 4RV3A 4PB3A 5FI8A 4CVUA 3W7QA 1F6PA 5KINA 3VNLA 4IJRA 3W1RA 2GSHA 4KRUA 2PODA 2OSYA 4Q7NA 3A4XA 1FY6A 2WSKA 3O07A 1OM0A 3PWGA 3MI2A 2F6UA 1BF2A 1M3UA 3GKAA 4NXSA 3NPWA 3AIUA 2ADAA 3AOFA 3SUTA 2REQB 4MYXA 3F4WA 5LSMA 3P67A 1OGSA 4ZBCA 3AMLA 2Z2UA 3MU7A 5A94A 2VXNA 2FGBA 5F1VA 1GONA 2YDRA 1C29A 2BS9A 5EA9A 4FX7A 4KCUA 3VIOA 1R6WA 3EDEA 3NA8A 3T07A 3B05A 1XS2A 4AUBA 3PB0A 3SUVA 3GFYA 3VD3A 1SO5A 3CLMA 4IIEA 3PBVA 4PCFA 1OGBA 3GWQA 1ZJIA 2OYMA 3BANA 1Q6RA 3CT7A 3QR3A 3P7YA 1N2VA 1HUVA 3LI1A 5DANA 4GBDA 2DZPA 3APGA 3VMOA 2VRJA 4UNIA 1XYZA 4D1JA 4F48A 3O1NA 4F0MA 1GZ1A 3OGSA 4P7RA 3KHDA 1VP5A 2PWVA 1H3GA 3UXLA 2X1SA 1N8IA 5LIYX 4LNYA 3VKCA 3PUGA 3MV11 3WLJA 1ZHAA 4MWAB 5HNTA 1KLYA 3NG3A 3R10A 4CVWA 1YHTA 1JYWA 5HJYA 1OINA 2OYLA 3NEHA 1D3CA 2X30A 2CIPA 3ITOA 1XI3A 2PC4A 5AZ0A 1CGYA 1GVEA 2VJXA 4HU0A 1E15A 3OP2A 3ALGA 4HHLA 4N42A 5T8GA 3N25A 4PMVA 1TVNA 4NX5A 4DYKA 3IJIA 3IJDA 2C0AA 4GI4A 1H5YA 2E68A 4HHMA 5TQLA 4C65A 4NQ1A 3C61A 3KVJA 3KCJA 3V35A 1YTEA 5K4XA 3NQVA 4R7OA 4WY0A 2QYGA 1KBKA 4OIFA 5CSRA 3TNOA 4DWSC 5EL1A 3II1A 3M5ZA 3EXTA 1F3WA 2EQDA 1WAUA 4A2RA 3LXBA 2YDAA 2UY3A 3CUJA 4ERAA 3UYCA 2FB3A 3EEGA 3CTTA 2D0GA 3EOEA 1VCFA 1FP8A 5FKYA 3A64A 1RPXA 2R1LA 5CPTA 3UZYA 3CASA 1CT5A 3D3AA 4QROA 3RHGA 2CLPA 3OHMB 3BOFA 3TN3A 5KZEA 4LTSA 4G8TA 4DLFA 3R13A 1LROA 9CGTA 1SJCA 2Q02A 3MANA 4AIOA 1XBVA 3WZ0E 1TO3A 3WY1A 1EB3A 2GL5A 3S2NA 4UWMA 3URAA 4ROQA 3IEBA 2HEJA 3W53A 1TQXA 4UC5A 1XC4A 4C6DA 4RZBA 1B3ZA 1KFKA 4ZB0A 2VFFA 3LDVA 4QFUA 4WXYA 1PIIA 4NYUA 1QPKA 2ONEA 1IEWA 3K5XA 2Y5JA 2AAAA 3RJYA 3DGRA 1FKXA 3TQVA 3UWYA 3MDWA 2D69A 1E55A 4UMCA 3ELFA 3KL5A 4QXIA 3HN3A 4NJJA 2W6RA 2YA2A 5TAOA 2UV8G 3FA5A 1POKA 3ITLA 2CZFA 2QCGA 4EPKA 3S1GA 3T0CA 5H8PA 4IQEA 1F8MA 4E8DA 3K1GA 2Y0FA 1EP1A 3WQEA 4B16A 3WLQA 2J9XA 3CAVA 2ESCA 2O92A 4CGTA 5G4HC 2V8ZA 1LQ2A 4G5DA 3S3GA 1P6CA 3HB9A 1SYTA 2HROA 4FNTA 1HL9A 5KSWA 3FVDA 3FSTA 4JCMA 4GNKB 4AVNA 4IMFA 1NOWA 1P0KA 3QQWA 4HD5A 4QDPA 1RY8A 3EXSA 4L1XA 4OV9A 3ALFA 1JFHA 4J28A 1Z48A 1FWDC 2IQTA 3ABQA 2PWHA 5IOBA 4NXKA 1WDQA 4MG4A 3PJUA 1ENUA 1RY0A 1D7FA 1OFRA 4X3ZA 3U0HA 3PZ9A 5IRPA 3ABRA 1QXLA 4N6FA 4UOJA 1WDRA 3GG1A 3UJ2A 3W76A 3IGHX 3GH5A 1EPXA 2EG7A 4WJXA 1US3A 3MO4A 1OC6A 2WLYA 4X0VA 1Y5VA 3ZQ9A 2D2OA 2E1WA 2G50A 2QMJA 3C52A 3FEMA 1UW9A 4EP8C 1AH0A 4DM2A 1JL8A 3ABZA 4B5SA 1JZ2A 3WQ4A 3BJFA 1ZS2A 4U5IA 1MNSA 1B57A 1VB9A 2PRLA 1R3TA 2ZX7A 3WLRA 1I0BA 1X8CA 2HJPA 3VD4A 2NT0A 3APTA 3KOXA 3SRHA 2J8TA 2WMFA 2YLLA 4D72A 1XHGA 2BSLA 1JCNA 4LUTB 3L21A 3FIGA 3AHYA 3WNOA 2O7QA 2Z28A 1DJQA 3TC3A 4HZ6A 3CMGA 3G6LA 5C71A 5DMNA 3G3MA 2FQIA 1XDJA 3T6CA 4IZGA 1ME8A 4RR4A 2FZMA 1EPVA 3PBMA 4HTYA 3SJNA 1TB3A 1JZ5A 3W7LA 3TR9A 4RPPA 4QNEA 1TA3A 3UZ5A 4MIMA 1OIMA 3NCOA 3VAVA 1LM1A 1XW8A 2NQJA 4GIAA 3LU2A 1PL9A 2AKMA 2AGTA 4HGXA 3G2GA 4EF8A 1TZ9A 4ZZ9A 1VCVA 1C8XA 1M65A 1SW7A 3EOUA 5CG0A 4DIAA 3R58A 2ACSA 1AQ0A 3NPVA 2CNCA 2GVJA 2DPEA 3ICJA 1EYWA 4I6VA 1UR9A 4H7CA 4Z2GA 2BGSA 1WZAA 5G4WA 2AQVA 4C6MA 1FTXA 2TAAA 4GC4A 4DBSA 1O60A 5LNRA 4HQVA 1YKWA 1WBHA 2W4XA 4QQUA 2WHMA 4NILA 5FJOA 1TFVA 3QC0A 4IFKB 1X1ZA 3M0JA 4LAZA 3AS0A 2ZRXA 2OYKA 2R6OA 1HKMA 4NJGA 3WYZA 3L4TA 1CLVA 4CD4A 1TCDA 2RUSA 2E40A 4FXFA 1FFRA 3FHQA 3M0HA 4H9VA 4H6KA 1GEQA 4O0ZA 4KS0A 1E1CA 4MY1A 2Q71A 3BZJA 2X42A 4DUOA 2G3MA 1J01A 2JGQA 1SFJA 4GQ0A 1DE5A 1O7AA 1SMAA 4AY7A 3KBNA 2ZADA 3AMGA 1GYNA 3M46A 3NUKA 2DZVA 1MXDA 2HXTA 4Q4QA 1K7XA 4XD5A 1S5TA 4HHHA 4IIBA 3EBVA 5BWAA 2R1PA 4C6OA 1HJXA 4QLKA 3GXIA 3IJLA 1O1HA 3ZVIA 3SIZA 3L4ZA 1E51A 1ZFJA 3WJWA 2YCJA 1TSIA 1TVPA 4TXEA 3OLGA 1UWTA 1I45A 3FK4A 1UP0A 3W22A 1UR8A 1P6WA 1XIDA 1F8IA 3L66A 4NHVA 4J2MA 1JDFA 2WMIB 4MPKA 2W5FA 3SJ3A 3CU2A 1W32A 2J6VA 3UWWA 2GDUA 3CPGA 4Z42C 4X22A 1PEZA 3NQGA 1JDDA 2REQA 3C2RA 3FX4A 1SJAA 2DGAA 1G5AA 4JKLA 4GZ7A 3GIQA 2FB2A 1O1ZA 2G0WA 4MNLA 4B15A 1CWYA 1MFUA 3MW7A 5G1MA 1W3JA 4GYPC 3HFTA 3I6RA 4D71A 4WR3A 1R85A 3OLEA 1XLCA 3SI9A 1B54A 3M5YA 1HW6A 2JF7A 1OFQA 3TYDA 5DY2A 5DMYA 3UYIA 4YWSA 2DT3A 1U30A 1XPGA 2V67A 1QATA 1EGZA 1EO5A 1P7TA 4HN4A 1XCFA 2VWTA 1LWIA 3VOJA 3BAKA 1T6MA 3KOFA 4IWWA 1U1HA 4HYRA 1KKRA 1W37A 2OB3A 3O0FA 3UR7A 4H9ZA 5C2XA 1GVOA 4FNUA 4N4PA 3VIHA 4RDYA 2XUCA 3W02A 2ASHA 4AW7A 4DPQA 5AHFA 1G4TA 3TQKA 5H1WA 3BLPX 4HN8A 3VCNA 4GIYA 1M53A 5GVJA 3EMZA 3VNKA 3ENLA 1F7BA 3IJQA 1S39A 4LEFA 1XYFA 1FWBC 1ITQA 1B3OA 5T26A 1C8QA 1Q2RA 1NP0A 1DWHM 3B4UA 1VPQA 2YL8A 4DJFC 1IT0A 1XL9A 5LIUX 3BVJA 3HG3A 5GNZA 1DXEA 1OFPA 4CQBA 1R0MA 4N9EA 4AU0A 1NWRA 1MYRA 2QIWA 3WSUA 4X0NA 3SUUA 3W1NA 7PTDA 3UU0A 3GXMA 4LVAA 3C2OA 2D23A 4YYCA 2DW7A 3FKKA 5FAGA 5HINA 5M2FX 1AW1A 1KTCA 2Q8XA 3SFKA 4ZENA 3W29A 1J12A 5AHEA 5M3WA 3KXQA 1OHLA 1M03A 1HJUA 1QOPA 1FHVA 3QTGA 1DQXA 1TJRA 3PZGA 4QIUA 4GXWA 5BROA 4YJ5A 1E6SM 2QUUA 2WYSA 1BRLB 4NG3A 1KFCA 3MCMA 3AS3A 1Q8AA 3WQ6A 3TYBA 3VCCA 3SSZA 1QU4A 2A3HA 5CBJA 3OB8A 3WF2A 4MJMA 3FAWA 3NVDA 2GGGA 5D04C 1K7FA 4F2UA 4FALA 1RSCA 5MKGA 3FJLA 3N14A 5FOOA 3VKJA 3ZJ8A 3DBPA 4LYQA 1OT1A 4HT3A 1AQFA 1HJQA 5U7SA 2EG8A 4AMCA 4JTIA 2AMGA 2EXOA 2BTMA 3PJTA 3W2UA 2PU0A 2QCCA 1SW3A 1KQZA 3B0PA 3YPIA 4IQLA 3TW6A 5JIPA 3CAQA 2PLCA 3EX3A 4ICNA 3WEMA 4J40A 5D33A 5TNVA 1GVFA 2ZA3A 5LA1A 4W8BA 1TPC1 3CB8A 4ACZA 1IWPA 1IF2A 2HNEA 4C6PA 3W1XA 1R87A 2QF8A 3RF9A 3R11A 3RR4A 1DWGM 1MUMA 1A3HA 5CSYA 3ZM8A 1CBGA 4CD5A 3SGZA 2WM1A 2W0UA 2YIHA 4DEFA 5A2CA 1Q5MA 4PMOA 1GJWA 4AHPA 1XFBA 4PMYA 2HVNA 4ERGA 3MA8A 3SQSA 3IUIA 4ZMGA 1A5AA 4NNCA 2VC5A 1UR0A 2BV9A 1NU5A 2J88A 2OKOA 2DUAA 3W2JA 1JJKA 1K03A 1KV5A 2QCDB 1QWKA 1WQ5A 4HIBA 3DKLA 5T9CE 4I3GA 2NV9A 3G1AA 1EF3A 1WXYA 4Z1AA 3STGA 3N1AA 1T99A 3QFEA 3RIKA 3WDHA 1HG3A 4M80A 1KBIA 1TR1A 2C18A 4LWWA 1SR0A 3CZLA 2VO5A 3NJ3A 1H0GA 2XDFA 1NDWA 2CLHA 2JALA 3ITCA 2JBMA 4JDBA 3W1TA 2J47A 1AZ1A 2ZOXA 3SCOA 2PD9A 1VRXA 4CQAA 2IPJA 4MFEA 1OIFA 3F03K 1VHNA 4G1NA 2VZUA 3W7EA 3TA6A 1NF0A 4LSBA 3O7UA 1XIIA 3WMCA 2Y7DA 3BGGA 3H7RA 1S2AA 4LBUA 3GNDA 5E0KA 3QV6A 1G94A 1TKKA 4LBRA 5IFTA 4MMWA 5A2AA 2Y7GA 3KRBA 3N19B 3THQA 2J4GA 1I2OA 1UUOA 2XN2A 3LCGA 4NZJA 3AQUA 4IFRA 4AEFA 5A6TC 1WOBA 4MNMA 2GWNA 2V3EA 4US5D 1DTNA 5EMJA 1CLKA 3WFAA 3EYPA 2X7VA 4W93A 2YL9A 1E4IA 3WFZA 3UPWA 3KBSA 4ADUA 1HT6A 4CLMA 4GNVA 5B7YA 4QCEA 1GKPA 1NWTA 2DT1A 4F9JA 5XIMA 5F2MA 1OVDA 2NLYA 2YBUA 3ID7A 2WCSA 2B81A 3BW2A 3HPZA 4DB7A 1EDQA 1W1ZA 1ZAHA 1TMLA 3N2BA 1ICSA 1YDYA 5D8ZA 4ONVA 3SAZA 4RE2A 1QFEA 3G1HA 4WDXA 3UR5A 4GOAA 2WSPA 4WSJA 1J11A 3W7PA 2A3BA 3SCNA 2YL5A 4J3WA 1AFSA 2WBKA 5D9NA 1XC6A 4LUSB 3WLMA 1FXPA 4UTTC 3AIRA 3RLVA 4AXNA 1GW9A 5EB8A 4DWSA 3N2MA 4LB4A 1KR0A 5A69A 2FHFA 4B5TA 4JICA 3N3TA 3I3BA 4WEVX 4JIPA 1WOAA 4PSRA 2VQUA 4NZFA 1W6TA 5HMFA 1G69A 3IVSA 4J3SA 3AHVA 3H54A 1VFOA 2OEKA 4GHRA 5K9CA 5PTDA 3GE7A 3HPFA 2H9AA 1J2WA 4ZSUA 4IIGA 1WB0A 4X61A 7ODCA 3B3DA 2GUYA 1EQPA 1PXGA 2DH3A 1HTIA 5FAJA 3GM8A 5HUOA 2DSWA 2X1IA 1W1B1 3SEPA 3T0AA 4CN6A 4J5NA 5AKQA 2BNJA 3TSMA 3M16A 4Y9AA 1T8XA 3UNDA 4REQA 4EKJA 3QLLA 2XWEA 5K4ZA 3VKDA 3RCNA 2QUNA 3STCA 3WEOA 3TW9A 1J9YA 5F2LA 1KWKA 4HZ7A 1U5JA 1MW3A 1RPKA 2UBPC 1MW0A 1FDZA 4KQNA 2E6AA 2BXVA 5A95A 4Q7IA 3AYRA 2V5LA 2GWGA 1FQ0A 3GC4A 1UIOA 3NSXA 4CEXC 4FF5A 3V3WA 2QDDA 4H6QA 5K9XA 2BASA 1W91A 2W66A 1CDGA 2E09A 4A4AA 2X2YA 1QBBA 3UPMA 4EPEC 4JX5A 4DF1A 1FFQA 2YDQA 3KVMA 2IKGA 2GVGA 4GVHA 3CYJA 3G1DA 2WKGA 4O12A 3EWZA 1AUSL 4Z17A 4QRNA 4JN6A 4E0CA 8A3HA 4S3EA 4DYEA 3KAOA 4NRSA 4Z1DA 1ZJHA 3M1ZA 2CHNA 1C7TA 1X96A 4MWAC 2YA1A 1VH7A 3S6DA 1OK6A 3IGUA 1GW1A 3WUGA 2RH9A 1X97A 1E6PA 4L4LA 4E2BA 2HK0A 1BQGA 4LVFA 2PF0A 3PAJA 4LANA 4PMNA 4PMXA 4J3ZA 4NNAA 4R88A 4AHOA 1ONWA 4AWTA 1VQTA 1VD6A 1X6UA 3N04A 1IEXA 2ZZ4A 1A4LA 4D2JA 2QUTA 4O1BA 4LAOA 1XLHA 2ZVRA 4GE8A 3AS1A 4YIWA 3UWEA 2DZSA 1OFEA 1V5XA 1F9CA 4GYFA 4C6JA 2JFEX 1VHCA 5C9RA 3LV5A 4S23A 3GKFA 4KWWA 2QCHA 3SIMA 3GO2A 5DCBA 3NDYA 3NURA 2ABBA 4A3YA 5E6YA 4CQCA 2J7EA 1GVYA 1O68A 1WZKA 3EWXA 2HPIA 2BBFA 3E0WA 5A6LA 3PG8A 1OFAA 3BC9A 1JAKA 2V30A 2OQLA 1KM1A 1T96A 1VGAA 4IM4A 2YKKA 4NZ4A 1HP5A 2BDQA 3GNXA 2VEPA 4CD7A 3P81A 1EJVC 3QHNA 3S5NA 4CNTA 1E0WA 1RBOB 2BHZA 3A22A 4CNSA 1H1YA 3ZLGA 1XLJA 3IIPA 1GOIA 2GVYA 4CKQA 1PDYA 2PWFA 4ZO7A 4DO7A 2G97A 2WPGA 3POHA 4O1DA 1LUCB 1UH3A 4L6HA 1Q66A 3FSUA 2CHOA 4KRZA 1J4EA 3MB9A 1YYAA 3P14A 1JPHA 1S2UA 2Y62A 2XVKA 3DFPA 2RKXA 3WD0A 4EPBC 4JFTA 3BAWA 3GNPA 3DHPA 1IZCA 1KV8A 1YXYA 3VI2A 4CD8A 3EOLA 2X1UA 2BGNE 1WKYA 1E6NA 4LAUA 4KW2A 4Z2JA 1OABA 1PYMA 4W84A 4B9YA 4UB9A 2NXGA 3RM8A 2F9RA 3PZTA 2VRKA 3P93A 3OQEA 3DESA 2XHYA 3M47A 4A3RA 4PCSA 2B4GA 3GHRA 1QOXA 4WJ8A 3H24A 3AALA 2WVSA 2J7BA 4C1KA 2G37A 3SUSA 4FLQA 1TX0A 4RZ4A 4L4OA 1TCMA 3WX7A 2CETA 2BVTA 2YOCA 3HFYA 3OZOA 4WIWA 2YXXA 1EH9A 3G0UA 1FWNA 2D3LA 4O54A 5DX7A 1YQ2A 4Y9NA 1DJGA 1UKQA 1DXFA 3OZMA 1ZBCA 3DUGA 3UWZA 3LMYA 1LTDA 2OX1A 3LPGA 1CXKA 4ZOAA 3U7VA 5AYBA 3L12A 2OWWA 3QW3A 1VLIA 5G2HA 2EG6A 1UD3A 3GFXA 2XFRA 1EJWC 1W9BM 3SB0A 1UJQA 1RA5A 2W62A 4BR1A 2GOUA 1RHCA 4XVDA 3RAOA 3ZMRA 1DJWA 4JY9A 4YVPA 1AG1O 4S3FA 1E71M 4LNCA 4A22A 3WJXA 3GR8A 2WAGA 1K8ZA 3RO6A 4UQAA 3PP7A 4U4MA 3WL0A 1EJ7L 5CH9A 3VM5A 1OT2A 2YW3A 1WKDA 3KP1A 4UQDA 3FY1A 5D9OA 2FPYA 1EZ2A 5HWJA 4RLIA 3C56A 3FKRA 4HZ8A 5CZTA 4MHBA 3WO8A 1XYCA 4GXMA 3W2KA 4CNNA 1VEMA 1P0EA 3F2DA 1NARA 3FFSA 1CGVA 3QY8A 2QV4A 1LYXA 3KCLA 4DO4A 3UXAA 4H2CA 1AZ2A 3M43A 3VIGA 2O9RA 3S83A 3AROA 4E6MA 1K70A 1ESWA 1LLOA 2QCLA 5DT7A 4XD4A 4Q8UA 1PZ3A 3O05A 2YL6A 4GNJA 4GFIA 4F3HA 3CHEA 5FF2A 4PYSA 2J74A 1XIJA 2X8RA 2FPTA 2JF6A 4UTLA 1LCOA 4FNQA 3W84A 2Y6ZA 2PDFA 3W2MA 4AWUA 3SBFA 4CU7A 4YTQA 1DIDA 4C6QA 4YCPA 1VIZA 3R0UA 5BXPA 4IPPA 5ABFA 5D30A 2Y63A 2J7CA 3OBKA 2HVMA 1B30A 2FKPA 3DYPA 2EPOA 3OGRA 4UMBA 2CZDA 4Y90A 1H7XA 3WQFA 4N6EA 2HVOA 2X7WA 3UXDA 1ZJBA 1QDSA 4QP0A 2PPGA 4HPXA 4PMUA 1JG9A 2JKAA 3CH9A 3WQPA 1GZJA 5CEWA 1KW1A 3TYEA 1V77A 4MB1A 4OBRA 2XINA 1T8QA 1A50A 5A6KA 3GHSA 1OFOA 3N9KA 3TSBA 3LEPA 2WXDM 4G2DA 2CYGA 1RLCL 3L4YA 3EZ4A 1DKWA 1XH1A 2DUZA 1CW2A 1KM0A 3B8VA 2IQDA 4IQJA 1CTNA 2O9OA 2DEPA 3PZQA 4UTUA 3GSMA 1XH2A 5CC3A 3NSNA 3H2FA 4X2PA 4MAZA 4GD0A 3HTWA 1SO3A 7ENLA 1EZWA 2JEQA 4K8GA 1Z8AA 1QI3A 5G5IA 4ZEPA 2WMIA 2ACRA 2QAPA 4H00A 4M5PA 3CV6A 3TKFA 1OY0A 1PDZA 2C1IA 3W1PA 3WBYA 1BKHA 5DCEA 5FSDC 2O4MA 4TR9A 1FUYA 1KM3A 1ZZMA 4D6JA 3A4AA 4M0XA 4GY1A 3GK0A 4E2DA 3MBFA 1ZCCA 2Y4SA 5I02A 1ML1A 3CQIA 1ADSA 4LU0A 3W85A 1AH4A 4GH3A 1UD4A 3PS7A 4YHGA 1TUFA 3KOYA 1XRVA 1LOQA 4AZ5A 3RM4A 3GU2A 4XZ9A 3PBWA 2QDHA 1P1XA 1XCWA 4LW7A 1OG6A 4ZXOA 4AISA 1E40A 4WXZA 3GC5A 5LHEA 3RCMA 4DF0A 1S2CA 2RDXA 3D3FA 4FNRA 5CZSA 1TMHA 5HNNA 2XIBA 5JVLA 3A4JA 4PZVA 2VHLA 1H1ZA 2A2IA 4ADSA 3I7RA 3R94A 3CM4A 3CIXA 2QLYA 4YHEA 3FA4A 3NQBA 1RUSA 4JEQA 1E72M 4NIRA 4WF7A 2VCAA 2ALRA 1ONXA 3MHUA 2PE4A 1JDEA 3TC6A 4IMEA 3TLLA 3EWWA 1TWDA 3WL1A 2D22A 4V15A 3RFAA 4HSNA 1K7EA 4AZHA 3OG2A 1H11A 3M0KA 3MUZ1 3E0IA 1Q45A 2ZRWA 2CBVA 3D5HA 1A5OC 2Y61A 5AYIA 4CN1A 5KETA 1GKRA 1YIXA 2AAMA 1RXOB 3V16A 2XM2A 9RUBA 1OX5A 1UIPA 4ZO6A 3PANA 3S9IA 3SCRA 2ISDA 4JTQA 1OEPA 1U1JA 3WH5A 2C3ZA 1NFBA 1YADA 6A3HA 4PCPA 3TFXA 1JDCA 1QO5A 4D6IA 2Z6IA 3P8JA 2Z7KA 2E9BA 3SECA 2Z27A 3LZ5A 4B3KA 1LWHA 2TMDA 4NX0A 1OYAA 3V18A 2PDLA 1QNVA 3W74A 1LL7A 4GQBA 4MFDA 4WZHA 3MUIA 2E1DA 1UWAA 1XGDA 3CWHA 2WMHA 1ME9A 5HQEA 2BVDA 3JW7A 1L6SA 1HKVA 4LF2A 1LRNA 1WDPA 3A9BA 1XIMA 3M0XA 1ZP4A 1UPMB 4JOMA 4Z1CA 3EPOA 3AIWA 3S6TA 5IBXA 3QHMA 4QNWA 4Y2WA 2GPTA 2ZRZA 3HMCA 3GHTA 3B8WA 4NJKA 1BXCA 1CGWA 1QAPA 1LBLA 4GG9A 4E8GA 5I6SA 1I1WA 4Q4OA 5FESA 3VTRA 1TTIA 5JU6A 2AMXA 1M9HA 4M51A 1A5UA 4IGSA 1XLLA 4D8LA 4AC7C 2RJGA 1GHSA 4MAVA 2X1RA 3TVAA 5BOOA 3BW4A 4LYPA 3GVVA 3ARSA 3T42A 3PSWA 2PF8A 3N12A 3IAQA 4G7EA 2GJRA 1GZGA 3Q94A 4CU8A 3AXIA 1E5JA 4JXCA 1W2VA 2FMOA 2KZHA 4MJ2A 4R34A 3OA5A 1G0CA 3L4WA 3LB0A 2A7PA 3S1UA 1H7PA 2QKFA 4DAIA 1M6JA 5BCAA 1WAWA 1HFBA 2W92A 1BVNP 1F73A 7A3HA 5AYYA 4M7TA 2VKZG 3HO8A 1HIZA 5T91A 3RYSA 3G8EA 3WLSA 2F2KA 3SRFA 2WOQA 1HNYA 1HJWA 2CU0A 1EDTA 4QLJA 2EF9A 4XZBA 3FCPA 5FF7A 3KTXA 4A3HA 3JU2A 3MZNA 1PKLA 2VENA 1VZWA 3QSTA 3MCOA 1FH9A 3F5JA 4RNFA 2VWSA 3QZ6A 3M41A 3OGVA 2XTKA 1GOWA 4GVIA 4LX4A 4HU3A 3N15A 2E9LA 4WGHA 2GJPA 1E70M 3ZSSA 1XYLA 2Y2WA 5I3FA 3KBVA 1DIEA 2G4JA 3JUGA 2ISWA 3W4RA 4Q22A 4TMBA 2BODX 4K8EA 4B5WA 2DZUA 3H21A 3T7VA 1IT8A 3KWXA 3NTYA 5DY3A 4FX6M 4DF2A 3N73A 4EIVA 4BF5A 2UWFA 5HXMA 5I5RA 4O13A 4IF2A 1K9EA 3LNPA 3KHJA 5C9WA 3E5BA 4LB3A 4KFNA 3AAMA 1MNZA 4QAIA 1IEQA 4UTMA 2OTDA 3DX5A 3HM7A 5H91A 4BJHA 1NEYA 1QHZA 2PZ0A 4UQCA 3C4UA 3XISA 1T0OA 5CPQA 2YCKX 2OPJA 4IMAA 3W3OA 3B8IA 3CC1A 3TTSA 3M0IA 3QZAA 4NJIA 2GJXB 4A21A 2OLSA 4QAWA 3PBYA 3G1XA 2PAJA 4IG2B 2EPKX 1SSGA 4JTCA 2FZBA 3SM0A 3L2LA 4XZLX 1TZZA 3RK8A 2VX6A 4AIEA 2I9EA 3SW6A 2ABAA 3G22A 5I3KA 2A6NA 4OOUA 5KZDA 4PTWA 5EMMA 1R86A 1GWJA 2DH2A 2POTA 3W25A 1YPFA 1MXGA 5KMYA 2GFTA 2PB1A 4IUGA 1ICQA 3MV01 4B91A 4QHRA 1GGOA 4E3TA 5FJJA 3DFTA 3N4EA 3TYCA 3UZXA 1K9TA 3CZGA 2PCQA 4R7JA 2ZUVA 2CBJA 2R82A 2X09A 4FNPA 1JXJA 2WM0A 3ITTA 3G1VA 2IQ0A 2BX7A 4MZ1A 5BOEA 4I6KA 1W9DM 1Z3NA 1POJA 4PBEA 4IFKA 3CEUA 1WXZA 3KZSA 2CKRA 2DT0A 4XG1A 4DJDD 4AG0A 2BY0A 4D6DA 1E9YB 3ITGA 1K3UA 2F7FA 3QM3A 2YR1A 1GG0A 3UETA 1QI4A 2OJPA 3TN5A 1QR7A 2PURA 6CGTA 4O1EA 1XYBA 4Y6GA 3DI0A 3FJ4A 3K8LA 3G5EA 4MKNA 4I7VA 3NDZA 1QI0A 2V5BA 4FOKA 3REQB 4GABA 3G3DA 3OW1A 3OVQA 4JPGA 3AIBA 3VIFA 3LPFA 3W1QA 2VUYA 1B4EA 1WE5A 3R0DA 3FXYA 3CWOX 4GINA 1QCWA 2E5BA 3ITXA 4V1XA 4LPCA 3NNTA 2Y88A 2W79A 4RX0A 4Z1BA 4XV0A 1JI1A 3LTPA 3G1FA 2NVCA 4HNOA 1WUFA 3HGOA 2WQPA 4S3CA 3KCOA 3W07A 3GZAA 1V3LA 1ZJAA 5LNSA 1ZBVA 3A21A 4BEQA 3E38A 3NL2A 4AB4A 1JZ3A 1Y5WA 3AFBA 1YNPA 1UZ4A 3BGJA 4E4FA 3QY7A 1CI1A 1A5LC 2HE5A 3R12A 1LJYA 1IZJA 1JZ8A 5HJLA 2G95A 3WK0A 4UFKA 1N82A 3T55A 5CXPA 2D0FA 1QI5A 2VI0A 1JCXA 3RU8X 4IMGA 4DRSA 1ZENA 4AC1X 4AIUA 3F2CA 1W3NA 3N34A 4CCDA 1UWIA 2WKLA 4Z1YA 1UB3A 1BWKA 4AY1A 1IWAA 4W9TA 3VA8A 2GK1A 4LGXA 4HA3A 2OX4A 3EEZA 5D38A 1K6WA 1JPIA 1SO6A 3FDKA 2YW4A 2VEKA 2YBVA 4QSFA 4IP4A 2X05A 3E2SA 4B3ZA 1GQKA 3ABSA 2AKZA 3GRIA 3VK5A 2X16A 1WV2A 4BK9A 9XIMA 1MMFA 4Y7EA 1JUKA 3WQWA 1YBQA 5KTLA 5GNXA 2HISA 5EMUA 4KWSA 1RVGA 3MUCA 3PJWA 4KCTA 4TTUA 3FGCA 5AC7A 1YEYA 2RAGA 3GNOA 4LS0A 3RMJA 3EB2A 4O28A 1CNVA 3A3HA 3THDA 3OLDA 1RALA 3LCXA 2GUUA 2ZUNA 6TAAA 2WMKA 1UYQA 3HPXA 3SCUA 4W86A 4PGLA 4H3DA 4IP5A 4GXPA 1QT1A 4WOZA 2A1YA 4L9ZA 5E6ZA 3VNZA 3CUGA 4HKPA 2PCEA 4JNMA 1K8CA 4IMDA 3Q65A 1J79A 4UZUA 3QPEA 4DHGA 3H2EA 4UQBA 4UCGA 3W7IA 4U5KA 1Q7QA 2V9DA 1B3XA 3W37A 4DO6A 2HQAA 1PHQA 4OWGA 4HB7A 1T5AA 4Q4SA 3O16A 4Q8VA 1TX2A 1UROA 3OU8A 2Y8UA 1QMLA 3HBLA 2EPHA 3T0DA 2WKJA 3T9PA 1LRQA 5HQMA 2B0MA 4DBEA 1GVSA 3CB3A 3VILA 1ONRA 2J6XA 3P6LA 4AZCA 4NZ5A 1BEUA 1F05A 1JNEA 4M8UA 2VGIA 3IIZA 4RDWA 4LYKA 4I5RA 4IIDA 3SO7A 5C0QA 3TONA 1GQLA 1YPIA 4A3QA 1FWIC 4J3TA 1P0NA 5J04A 4QE1A 2QW5A 1G7UA 3PTQA 3SN0A 5IDZA 1H7WA 2FVKA 3M6DA 3VDHA 1XDLA 5LXEA 1WA3A 3LQGA 4Q6XA 1WCGA 3CAWA 4ALDA 3KOWA 1DTUA 3GXFA 3E5PA 1Q7ZA 3DG3A 1UKPA 2VR5A 5EFDA 3EDJA 3NQAA 4AF0A 1FCBA 1EC7A 3T81A 1HXJA 3M0MA 4PR4A 1JPMA 1DPMA 4CQ8A 4PUWA 1NQ6A 3BSMA 3DHDA 4YVXA 3EDKA 3T2OA 4JTAA 2SFPA 5HQLA 3W24A 1A49A 2O4QA 3VYLA 5CPNA 2C1HA 3QEZA 2IW0A 3MSRA 2ZZ7A 5TD4A 3O3RA 4KWUA 1AQHA 1FA2A 5C2GA 1NDYA 2B7OA 3S5OA 1FWJC 1QHPA 2IXUA 3STPA 1GPWA 3IJ9A 4HK5A 5HR6A 2CC0A 2QHAA 2YLAA 2FFIA 3MSYA 1WP6A 1DHPA 1VPYA 4GJIA 2O7SA 1YE6A 1LLWA 4INFA 3T05A 3SADA 3UZZA 2G8ZA 1SVDA 3EWBX 7REQB 4JTSA 2PRMA 3WDRA 2QNEA 4YTTA 4GGHA 4DXXA 3DFOA 2HNHA 3OTRA 1LL4A 1JULA 3W73A 1H1NA 4P7LA 1KRBC 1ZAIA 4LUTA 2VEMA 3GU1A 3OEXA 3WLKX 1KFWA 3CV2A 2GSEA 3QMTA 5AC4A 1CEOA 1ELSA 1X38A 5FEPA 4KGJA 4A2SA 1RBLA 1TA3B 3BV7A 4HVXA 3OVRA 4PH6A 1E6QM 1EX5A 2CKSA 3OQ8A 4GFSA 5A3HA 1QW8A 4Y96A 1MW1A 3GU9A 3NIYA 1UBSA 3NDOA 1XSIA 4O53A 2WVUA 1S5MA 3EMCA 4CD6A 1OSEA 3ARWA 3TK7A 3FNDA 5I06A 2P0IA 3WF3A 2J66A 1TTQA 4FXSA 3V36A 3GS6A 3APYA 1V7YA 2YYTA 3UA4A 1W9UA 4C7FA 1RQEA 1DWAM 5HNRA 3HGJA 2PGWA 2FDSA 3SY5A 1VC4A 1BF6A 2P76A 3MP5A 3RPTA 2OZ3A 3OJGA 3KEHA 1O5XA 3P0WA 3G24A 1DWFM 1WUEA 2Z7GA 3VUSA 3BOXA 1QTWA 1CXLA 1SZEA 4TQTA 2E7FA 4FHAA 2RDUA 5D05A 1YNQA 2GJXA 2P1FA 2VFIA 2PS2A 1BXNA 1TJ2A 3LZ3A 2VR4A 1G4EA 4I5XA 3CUIA 1MXSA 2WZEA 2OU4A 2F38A 4AH7A 1DL3A 1D2KA 5EPDA 2ZQ0A 4OE7A 4EACA 1UCWA 1TR9A 3V7PA 1OFDA 2LLEA 3EWYA 1E4LA 3CPRA 1G1YA 1F3EA 1Y7VA 3B97A 3NQ6A 3E2RA 4NAFA 5L9FA 1F4AA 2QGYA 5H8UA 4BWLA 3LPPA 4JHOA 4YLWA 1W9PA 5A5WA 1BAGA 2OO6A 1W5MA 2Z1XA 4PUJA 1XKJA 1PWLA 3RDKA 1QW7A 4UOZA 3U57A 4M6UA 2OOFA 2DT2A 3W7RA 3WJZA 4O17A 3WH6A 1HKJA 3DYMA 4AIBA 1I2QA 1M7PA 3BICA 2FGZA 5BNKA 1BSLA 3LCLA 3KOZA 2E8YA 3PG9A 1R3RA 1AJZA 2H3BA 3KWSA 5HULA 4YNGA 2INZA 1IHIA 3LD5A 1UC5A 4E2OA 3WMLA 1XLMA 1H63A 4DJFA 2BZNA 3F4DA 2QPXA 4KH2A 3GVQA 5HJXA 2KX9A 2L5HA 1NM9A 4TOQA 4UNLA 3RPDA 3WDPP 4LCRA 3T2PA 3EX2A 3QV8A 5IBXC 1BWLA 4TV6A 4JFSA 3RO8A 1D3HA 3FW6A 5B80A 2VVSA 1Q6DA 1OZQA 2ICSA 1WPCA 1S5VA 3TV8A 4HA4A 2BVWA 2XVPA 3C2EA 2PZNA 3M9YA 3CQJA 4JIEA 2GGHA 2ZE0A 2OQYA 4HPHA 2E67A 3R8RA 1MZHA 2OELA 2QQ6A 5HNUA 4QG9A 1ISWA 1TZ7A 4D6FA 4IIFA 1JI2A 4ZXLA 2E6DA 2HRWA 3LRMA 5A6MA 4ZR8A 1TJPA 1NWUA 1U1UA 6XIAA 3CL8A 3OBEA 4UFLA 2X1TA 1D3GA 4Q4KA 5SWUA 3R89A 4Y9PA 1XIGA 3SSJA 1KM4A 4EAMA 1K9FA 5I09A 1S3HA 4M1BA 4EXQA 1B4KA 2E5DA 2CLFA 4L64A 4DJDC 3BWWA 1XJBA 1JCTA 2VELA 2WC4A 3SCQA 1XFCA 3VD7A 1XRTA 4C7DA 2GGIA 3TOYA 3V1PA 3LXCA 3IIXA 4K1WA 3RXZA 3ITYA 4LVBA 5DN1A 3DHFA 4W88A 2CZVA 3LS9A 3UCQA 4HK6A 1JCMP 3ONBA 5E09A 2E0PA 3RX4A 1KM5A 3MYOA 4GK8A 2PTYA 4WLCA 1HQTA 3WH7A 2VEGA 2J24A 1VBGA 2GJLA 4WX2A 4A8IA 4DUWA 4LOCA 4O8AA 4D6CA 1Z42A 2PWDA 3VNDA 3BG5A 1A3WA 1J93A 1Z44A 4LYRA 2J8GA 1GPFA 1W1VA 3KFTA 2R94A 4JQ4A 1DE6A 2R14A 1BHGA 4MPQA 1J6OA 4HU4A 1QI2A 1VJIA 3AJXA 4CNPA 4JHMA 3WH8A 5FJUA 1FWRA 2V2CA 2E6YA 2QPUA 3GHUA 4JN8A 4ZTXA 3K8KA 3DC8A 3RN6A 5D2TA 3BG9A 2WNWA 6TIMA 5JXQA 2WWCA 3H8AA 4RZ5A 4HSOA 1IXQA 4HCHA 2Z1KA 2WZHA 2WNZA 5LKYA 1HZYA 4I7WA 4IXXA 4MWAA 4R33A 1ISZA 3EX6A 1U5HA 3AHXA 4OU1A 4Y8EA 2BY1A 4H8VA 1H7RA 2WHKA 3BGAA 2VURA 4XBSA 1MWOA 1GK8A 7TIMA 1EA0A 2BP1A 4BCEA 3NZGA 2NUWA 3BPWA 3S6OA 2QXWA 2WHLA 4V1YA 3F1QA 2YX0A 2WLZA 1OCJA 2CFFA 4OBTA 2PP1A 1GOMA 5BXTA 4J27A 3BCDA 4ZODA 2XFFA 3N9RA 1L6GA 1RJRA 5DO8A 3NZ1A 2D1ZA 1V51A 4H4IA 3UR8A 1TV3A 3OPSA 1FRBA 3WBXA 1QNQA 4US5A 1FCQA 2BG5A 5C7HA 1X6NA 1TVLA 1KCKA 3LLFA 2QULA 4RDVA 2RFGA 3GVRA 3LERA 4BEUA 1SFSA 1CYGA 3F4CA 4Q8OA 4WGXA 3QQ0A 5E9AA 3TYAA 4V2XA 1S1PA 4C6LA 1OC7A 3BCJA 1C9WA 5C6MA 4O50A 3LGGA 5E9XA 3GW3A 3VZZA 3PZIA 3QGAC 1IQ8A 2VFDA 1CB7B 1UP3A 4N2YA 4F8XA 2A0NA 3PY2A 4U33A 1MDLA 3TZFA 3ZR5A 5C55A 3M0YA 1XLDA 3IVUA 1EF2A 1B3WA 1R2RA 4NI3A 3IUHA 5E0FA 2O55A 5E93A 4IGNA 1OCNA 4IX0A 4PMRA 4K7VA 1EJUC 1S2TA 3CPUA 4LV9A 3B0YA 3VIIA 2NZLA 3OIHA 4ZQOA 1YRRA 4GCXA 1LQ0A 3OODA 1Z89A 3QRHA 2E5CA 4D6HA 1E73M 3AZRA 1PSCA 3THCA 4GO8A 3I3DA 3WENA 4J4KA 1W1PA 4JDYA 4LH8A 3RLGA 2GDVA 4FP1A 1ECEA 3TJLA 3URQA 2FVMA 1JF5A 2ZUUA 4OVXA 2VOTA 4KF1A 3SN1A 1VBRA 1W0MA 3A6OA 1QK2A 4L9YA 2P8BA 4JL2A 3ARYA 3L7RA 4F2BA 3QV9A 4JR5A 4WKHA 3VFLA 2QDGA 1CGUA 3LSBA 3VC5A 4EAYA 3U48A 3T40A 3U4FA 3EOSA 4DO5A 3WNMA 5EYWA 3N6JA 3CZKA 5LA2A 4MLJA 3FXGA 4QEEA 4P8UA 2WCAA 2DZTA 2PDIA 2B31A 1HX0A 4M82A 5C54A 4RXGA 1DOSA 1IEVA 3CZEA 3UNTA 4BQ3A 3GG0A 2E6FA 1VFHA 1KCZA 3E49A 4F2TA 1BTMA 4ACZB 4GWEA 3FEQA 4MDOA 1TWWA 1RA0A 1R3SA 4KCWA 4JTHA 4PL1A 3E0LA 5C9ZA 3GBEA 2WMGA 1GEHA 3IK4A 4MKSA 2Z00A 3PZNA 1KFBA 3W82A 5CBBA 3W88A 4JTKA 3VIMA 4FO4A 3LUTA 3MYPA 1EBHA 4U3AA 4GYKA 1BKSA 4N0RA 3A12A 4P7QA 4FIRA 2VMFA 4M19A 4HYWA 4PRTA 1W3LA 3KUMA 3DGBA 3STEA 1FWAC 2EJ1A 1V0KA 3VGDA 3P5ZA 3IJ6A 1H49A 3QN3A 3H22A 1EWDA 3O6AA 4DBWA 1KRAC 1L9WA 1KC7A 1OADA 4Z2LA 3GTXA 4OV4A 2JGYA 3QFWA 4JNYA 4ILSA 3W1LA 5A6AA 4XD3A 2DZXA 4DWSB 1FWHC 2ZRYA 3WQ5A 3BURA 2Y5SA 5FJRA 4NP7A 2PGRA 3I7SA 1UBPC 3MTWA 3FN9A 4C5YA 2VL4A 3QGKC 3NXFA 5FACA 1X39A 4DUVA 1BD0A 4IXHA 1QUMA 3L2IA 1YDVA 4ZB5A 1AMYA 2ZVIA 2YZRA 4HA1A 4OGZA 4ROPA 4XK2A 2JKEA 6REQA 1SMDA 2PDUA 3HG4A 2ACUA 1F6KA 4PSPA 1QPQA 1ZL1A 3U2OA 5IM51 1U5VA 1EKOA 2V82A 1WBJA 1MUCA 1GT8A 1VAHA 2UY5A 1XCXA 1EIXA 4JYDA 4MSSA 1AQMA 3THUA 3FS2A 2ZIDA 1RD5A 1XYAA 3AC0A 2VRQA 1AMKA 3MDUA 3MT1A 5CPLA 1R5YA 5HR7A 3A3XA 3UD6A 2WW5A 4N9DA 3NQ7A 4REQB 5EY5A 1DHKA 2GLKA 4J7RA 1V0MA 2I14A 4C1NB 7CGTA 3AIEA 2HE8A 1JZ7A 3WQVA 4CCCA 2BOFX 5CG7A 2I57A 3I3EA 2V81A 2Y8KA 4AQLA 3V0UA 1GQNA 2C0HA 1ISXA 3WQOA 3IANA 1GNXA 3RUBL 3UFYA 1ECQA 3G0SA 2QJHA 4LAMA 1UMYA 3UT0A 3MUY1 1NFGA 5I3IA 1KXQA 5EBUA 2I17A 3WELA 3S5YA 4PULA 1V4YA 4H9MA 1FOBA 5E0CA 1O66A 1US0A 4GGBA 5AVNA 3BSGA 4QS6A 4GQRA 1PZ1A 1RQHA 3M5VA 1CCWB 1N8WA 3BARA 4HMNA 4Y9MA 4Q32A 1L8NA 4PTDA 5ENLA 1NVMA 2YCLA 2PDWA 5HOSA 1PYFA 1XINA 3ARZA 4KFOA 3MO7A 4HSHA 2OODA 4I9JA 1CX9A 3T1GA 1C9DA 3T0TA 3BAYA 2OWXA 4HHPA 1CXEA 2VEIA 2F2HA 3GTNA 4M7SA 4QS5A 4KESA 2TYSA 3ARVA 1V7AA 4C6BA 4WDUA 1YW1A 4JYFA 4P7NA 2HPMA 1S3TC 3D46A 4OQVA 1KXHA 1OC5A 3LNMA 1UZDA 5EBAA 5MKGB 3DG6A 1UD2A 1M68A 4UNKA 1TPDA 3W86A 2J9YA 3B9NA 2VD9A 4ICMA 3VINA 1WO2A 1EO7A 1A3XA 5C8BB 4AD1A 4WY0B 3P61A 3B9DA 1VFTA 4A05A 2H3DA 1EUAA 1FHLA 2WV8A 4AD2A 1HL2A 5LIWX 3OLIA 1ZPTA 2FLIA 3PPHA 3ZR4A 1EDGA 3ATZA 3THAA 3VXGA 2C7FA 3KM8A 1E6XM 2NX3A 3HPAA 1UR4A 3IPWA 4QTGA 1XLFA 1O6IA 4JQ3A 1YX1A 3DERA 4TX8A 1JXKA 3CQKA 1OF8A 4JTRA 4MWAD 1KQYA 1R46A 3NYDA 4PTNA 1HVXA 2X40A 1JRBA 3GQYA 4AAJA 2DORA 4HYVA 1K1DA 2VZOA 1H60A 3MKVA 3QR0A 1M7XA 3W83A 4UR9A 1LDCA 1SJDA 1QOQA 4K38A 3QOMA 4PUDA 1UR3M 3ZR6A 5A8NA 3R6IA 3CNYA 1AVAA 1PAMA 3ARRA 2V5JA 1HN1A 2WWDA 3L4XA 3U9IA 2PDKA 3E6EA 3A24A 4H8UA 2PEVA 3I6EA 3AWNA 3INPA 5DBTA 4Q4MA 3PNZA 3QMSA 2ISFA 4GACA 3AIQA 1EBGA 2X41A 1EQCA 3NOEA 3RRAA 2RJHA 3P84A 3HMJG 1E9ZB 2IKIA 2GOKA 1XD0A 4LT9A 3SGUA 1KCXA 3R43A 2AL1A 3B40A 4M29A 4UIOA 5AHMA 3EPMA 3RITA 4XAPA 3MP3A 3U5UA 4W8AA 5I3DA 4DZAA 4GLEA 3TQPA 4XUGA 2G3NA 2QF7A 1E43A 3IV3A 4KWVA 3NZPA 2FTPA 3FYYA 4RJEA 3M07A 2HS8A 3F7JA 4CEUC 1FH7A 4GZIA 4W85A 3B0VC 3SY1A 3VUPA 2EPLX 2ZC1A 4UFMA 3RX2A 1CXHA 4KEUA 2A79A 1CLXA 1FP9A 4RE3A 1F3TA 1Q6OA 1CGXA 2YYUA 3GDMA 3BE7A 4FNSA 4AZ6A 3KZPA 4AF0B 2ZBTA 3PSVA 1E3XA 4H9UA 3ECQA 3KVLA 2I5IA 1RQBA 1C93A 2XM1A 4UTTA 4PBGA 3PUDA 3GC2A 3E74A 3VC6A 2E4TA 2WJDA 2PLMA 1DQUA 4WKFA 4XZIA 5I23A 1GORA 1L2QA 5GNYA 3UPBA 1G4SA 4C6EA 1AL7A 3L5LA 3VIKA 3N13A 1I60A 5T9BG 1NH6A 1TPB1 3GD6A 1TUXA 4E5TA 2A3EA 1VBUA 5JQ9A 4TTGA 1KA9F 3GNRA 3BLEA 1BGGA 5XIAA 2PC8A 2XSBA 4KIRA 1EXBA 3OHIA 3G0XA 7REQA 2ZA2A 1TJ1A 2GZXA 2DSKA 1Q8JA 3GXNA 4O15A 1VEPA 3I4KA 3AUOA 5JMUA 4YU1A 4L6DA 3PJXA 4EX4A 3DBNA 2FHBA 1EWEA 1OYCA 2CXEA 5KITA 4L4PA 3UR2A 3HJEA 4YTSA 4ADTA 5HPOA 3LSCA 1WZMA 1WXJA 3DAQA 1XP3A 1UD5A 2BGQA 3S0CA 1VFFA 1JD9A 3NXLA 1H09A 2ZXDA 4J3XA 4QJ1A 4JIRA 3EGJA 2P53A 2NLIA 4EPDC 2ZX5A 1Z41A 4FSAA 3O6CA 4L5ZA 4YTRA 5ABTA 3EXRA 2PDMA 3URNA 3ZWTA 4FOUA 5D2WA 3LM3A 2XFYA 1B90A 2CPUA 4K36A 4XZNX 4GJ1A 4FS9A 2PDBA 5CZ0A 3MUXA 4FPSA 4H8NA 3LTYA 4YPJA 1Y5XA 1YDNA 4D6EA 3WCZA 1P6BA 3BQ6A 1OD0A 3PWAA 2J7DA 2ODOA 3D0CA 4ZB2A 4NNBA 3VNMA 4JTGA 3T8LA 3MHFA 1E0VA 2XSXA 2A3LA 3B03A 2MUCA 1EOKA 1YNYA 3WBWA 4JIQA 5TF0A 2J13A 4LEQA 4JQ1A 1B5TA 4Y8FA 1XLAA 1A5KC 1EA9C 2XN1A 1ODUA 5EFFA 2Q8LA 5BMWA 4JTDA 4DN1A 4H04A 4IJBA 4DI8A 3EA1A 3WNLA 2PLKA 1E0XA 1Q65A 1ZBWA 4EOUA 2J9ZA 2GUBA 3ONCA 3VPLA 1L6FA 4QJ3B 1V8EA 3S8HA 4O14A 4PRRA 3UJSA 3VM7A 3HG5A 2PGEA 3GAYA 1M7OA 4OUIA 4PUMA 2ZTKA 4IQDA 3ZT6A 4YN5A 2OSXA 2XU2A 5REQA 4PMJA 2VDHA 3GTHA 4C1LA 5AHNA 4WQ6A 3HGSA 1ITUA 1W8GA 2CZEA 4DWDA 1FWSA 3Q37A 4JTJA 1IIGA 2P50A 2FH6A 4W89A 1W1YA 3AIVA 4R53A 1REQB 2ZUTA 2J7GA 3TZNA 1GCYA 1MI3A 3GUWA 4YTUA 4D8AA 1ZCOA 2VZSA 3RCYA 3LHVA 2AL2A 3MWCA 2ZZ5A 1RJQA 4F4RA 1R38A 1QNOA 2NQ5A 4MOZA 4AHQA 3NPXA 3QYQA 2NV2A 4QX4A 3PZUA 3VO0A 4M56A 4QG6A 3VNJA 1GYMA 6ENLA 2PDNA 3H53A 1PIFA 3UG5A 5CBIA 1OB0A 3G1RA 3QLDA 4JYEA 2ZICA 1XWYA 5BYWA 1LP6A 3IS4A 2Y70A 2J79A 3IV8A 1MQPA 1TV4A 3DC0A 3IGXA 5DMMA 3ANYA 5CKSA 2PLJA 3KL0A 3L0NA 1TPWA 3CEPA 2OKTA 3VFCA 4IX2A 3OBAA 3DIPA 4LAKA 1NTHA 1LT8A 3XINA 4JKMA 3SN4A 3UBPC 3DFNA 1DWJM 3MQTA 4A3UA 1P0DA 1BTCA 2FMNA 1AH3A 1K8YA 2I56A 4S3KA 1IYXA 2C15A 3VX0A 2QJMA 2WQDA 4V28A 2CHRA 5A1AA 4QG8A 4PMQA 5A8OA 5A8MA 3Q45A 4UTFA 3CTLA 3DECA 1E9LA 2JEPA 1VPXA 4WSKA 1OCQA 1MEIA 4MY9A 2DFAA 4UTKA 3I6TA 1HKKA 1GJUA 4NT0A 3EA3A 1JFXA 3HU7A 4OHQA 4CUCA 1LUCA 2QR6A 1JCJA 1UOZA 2XZ9A 4BF9A 4XUYA 2QJNA 3TXVA 3ZT5A 3F5KA 3DKJA 3UJRA 3USBA 4PCNA 1NELA 3PBGA 2A7NA 4S2CA 5GQBA 3T44A 4EWJA 2J25A 1VFLA 1VF8A 4MUZA 3ZVHB 1V79A 5A2BA 2WB5A 4NVTA 1TIWA 3W7MA 2FJUB 5I3HA 1KO0A 3BLKA 3UVIA 5HMDA 2DQWA 4QJ4B 2QDEA 5KZ6A 3OVPA 1V93A 3UCCA 1SPQA 3C86A 3Q2DA 2QUVA 3LM7A 3CUHA 1W9XA 5DF0A 2JK2A 2ZDRA 2Q8ZA 4R85A 5FIPA 4AD5A 3V5FA 1IWBA 4JS3A 1L0PA 3LPOA 2NSOA 1UWQA 1S2WA 4C90A 1H7NA 2Y85A 1IXOA 2QV5A 1PCKA 3WFLA 3L5AA 2WZTA 2HBVA 1W54A 2R1KA 4P61A 4HMCA 1EFZA 1T40A 5AY7A 4PMDA 3H7VA 1Q63A 4BZYA 4WSHA 3VVGA 4O11A 3R25A 1YMYA 3VMNA 1ZAJA 1O4UA 4US6A 4C6NA 1V3JA 4XAYA 3GXPA 4UQ9A 3RNDA 2OVLA 1U83A 4WVXA 4UOQA 4DYJA 2JKPA 2VUNA 4BI7A 4OBSA 5LNVA 3W7HA 3KBJA 2R9RA 1VRDA 2VZVA 2NUYA 5XINA 4XIMA 2C1GA 3GYEA 3Q4DA 1EJRC 2OWCA 2DZBA 4O52A 4ENLA 1EHAA 1R3QA 4IPJA 1FHUA 4BF7A 1PTAA 3IWPA 3R79A 4GVGA 3N11A 1WDDA 5J5RA 1XXXA 5EMKA 3BSHA 5D9PA 3GVGA 2YFNA 4GUIA 2VDIA 1RJPA 5JBFA 1EP3A 2TRSA 3DU0A 4HNVA 2QAFA 3UWUA 4F0KA 2PTXA 1KRMA 1W56A 5G1TA 1WKFA 2WVTA 4MZ8A 2XGZA 3TROA 1AA1B 1V3HA 4X2RA 3GXDA 3E3HA 3ES7A 1QBAA 4NZ3A 3GH7A 3GFZA 3K4DA 3K8MA 5CQ1A 3WDIA 1KFJA 3CAKA 2W67A 3W00A 1TWIA 1ONEA 2TPSA 2XZ7A 3GDLA 1XBYA 1GQIA 2BY3A 4W7UA 2I1OA 1PX4A 1XD1A 1X1OA 2E8ZA 2VR2A 2V2HA 3LK6A 3PK7A 3TAOA 3N4FA 3O06A 3K30A 1QO2A 3S2JA 2EHHA 1KXVA 3OA3A 4GVFA 2ZXBA 7TAAA 2C14A 2HZGA 3B4YA 2JIWA 3U5YA 1EJSC 3LMZA 1MQRA 2CERA 5M1TA 3BXWA 1A5BA 4MGGA 3UG8A 3S47A 1RLDA 1MSSA 3TN4A 4O10A 3UQNA 4GI6A 1OZMA 3EDFA 3VOIA 1A0DA 3AMCA 1UD6A 3A5FA 3ZZ1A 3GB6A 1YTDA 5K9DA 1AJ0A 1E1CB 1R7OA 3MC5A 3QTPA 2PTDA 2XGIA 1JR1A 4FMVA 3QY6A 1A80A 3MWAA 3FAXA 3V75A 2R91A 2ZC8A 1RBAA 2PBOA 1V3KA 4M6VA 3KDOA 1D7KA 4ZGYA 5C2CA 2F8QA 3E0VA 1EGVA 2V69A 4WDTA 2ZCGA 2CCRA 1E0UA 1Q7MA 3QVQA 5HWNA 4AEOA 4S2BA 3NGJA 4HZMA 2Z1VA 4XIAA 4XVEA 3FYPA 4LV4A 1OD8A 2BHYA 3SDOA 2I7GA 1B31A 4NKCA 4X63A 1RK5A 1W1TA 2CW6A 1D8CA 4LY8A 3CV7A 4MNKA 2VX4A 6ALDA 3B8TA 1SUXA 1BFNA 3N2TA 2Z4GA 4X60A 3NL3A 3P80A 2Q09A 5CPOA 1SSDA 3WBAA 3QQ1A 2I16A 1UH2A 3HG2A 2ZRUA 1UQYA 3MBDA 3DFHA 3BLDA 2XG9A 4W7WA 1S38A 1KM2A 3MKKA 5HK4A 5AC8A 3MP4A 5LNUA 4HNCA 4UCFA 3H12A 3MVTA 3WLIA 1OX4A 1ISVA 1XQKA 2DIJA 4C6IA 2IXVA 1JPDX 4AVFA 1WDSA 4IP7A 1C90A 1VFUA 1Y0EA 5C70A 4LUIA 3CV1A 1FWWA 1XLEA 1JYVA 5A6JA 2W91A 2G41A 4C6CA 4AD0A 1TV5A 4EVZA 2WSYA 1H7OA 4GBUA 4H41A 3D6NA 3M64A 4IISA 1M1BA 3NQFA 4G6CA 2FTWA 1ODZA 2OZ8A 1H51A 4YS1A 3ZJ7A 2DSUA 3MVIA 4PB4A 2H9AB 3LGEA 1HP4A 5EU9A 4DI9A 4U31A 1W31A 4HOWA 1LG2A 3W6MA 3OIXA 3TP4A 4IPNB 1JCYA 2ZYFA 1IE7C 1H4PA 1HJSA 1XRFA 3N3MA 4PB5A 5M03A 3ZIZA 2FDMA 4P2VA 2A3AA 1A47A 3TN6A 2BFGA 1A0EA 4DJEC 4DUXA 1CXIA 2CLEA 3W1MA 5I03A 3AISA 3A5VA 2NW0A 1FH8A 2F84A 1FCVA 5F2IA 3VKKA 4UTWC 2D20A 5CLWA 3FJNA 4RZ6A 2NWRA 3OVGA 3KS5A 2FZDA 2HWGA 3GW0A 4F0LA 5LHFA 3ZO9A 1V0LA 4KIEA 4YCOA 4JFWA 4FOJA 5G2WA 3W2LA 4S3JA 1PHWA 4W8LA 4LBSA 1S2VA 2X0SA 1NAL1 3DZ1A 4C7GA 3Q67A 3B8UA 1PWMA 5U4NA 2XVNA 3AU6A 1RZMA 4S3GA 3L4UA 1V6WA 4F0RA 3LLXA 3TE9A 5L6UA 3PBUA 1Q2SA 4HNUA 3UEQA 3WJSA 3PPFA 3VZYA 1DJYA 2P8CA 1W1A1 3W70A 5LZLA 2MNRA 2UZ9A 3HV8A 4H1ZA 4KPLA 4NAFB 3QKEA 3AMDA 3NM3A 3QF0A 1KBJA 3FHAA 2V68A 4F0HA 2X2GA 4RPQA 4I90A 1GOQA 4KCVA 3V5OA 1FWFC 1Q4WA 3KX6A 5BU9A 3TMQA 3CIWA 1ZY9A 2JIEA 3NO3A 3R2GA 3C8FA 2D3NA 4Q33A 3DDMA 4WDWA 2TSYA 3K2GA 2DDXA 4O8RA 3VGBA 4JGDA 2VC6A 2OZ0A 1BQCA 3VCRA 4YWIA 2VCBA 1SGJA 4DBDA 3JS3A 4U28A 5JIWA 6PTDA 1PE1A 2ZX6A 5E70A 4UZSA 1RD6A 1TPEA 2RGLA 1HL8A 5CPMA 2CLMA 3E0FA 4O4WA 4J9JA 3TWAA 5F7UA 3LX9A 3AZTA 1LG1A 1UC4A 2IS7A 4XO6A 3LV6A 2XSAA 2HXUA 4XAGA 3UZWA 3S1XA 2EGZA 4H6RA 4DPPA 3ARTA 4K3ZA 1PB0A 3Q58A 5DRCA 4ZE5A 4MB3A 3VDAA 1B9ZA 4A8NA 4PBFA 4PEEA 3UVAA 3OYXA 1CPUA 1XR2A 1A4MA 3NAVA 4OKDA 1QRQA 5CC7A 3KTSA 3LXAA 1AW2A 1QNSA 3TYUA 3EB4A 3IJ7A 3NM1A 1DV7A 3USZA 1DORA 3F2BA 5D8WA 1DVJA 5HPCA 3V1HA 2DQXA 4PA8A 3CL6A 4HU8A 1V6TA 2R24A 4MLRA 1KTBA 2VGGA 4PUKA 3F5LA 3UXIA 1SW0A 2A5HA 5A8PA 3CK5A 4LUJA 3TX9A 4HCDA 4QBXA 2FH8A 3TIMA 4L6OA 1C8VA 2OG9A 5AVHA 4V33A 3HQPA 4D6GA 1E4MM 1N8FA 1V08A 4KFPA 5DMLA 3PC0A 4JTEA 3CXOA 5LYRA 1THFD 2VCCA 4ERIA 1I6NA 1SJBA 2VGBA 4GIRA 4FIQA 1ITXA 3ARQA 3AXHA 2OMAA 2HS6A 2OGJA 3M44A 2F6KA 5ABGA 4IL2A 3W87A 1FKWA 4GUGA 4XZMX 1OYBA 4DZ5A 3VD9A 4R5EA 3VOHA 4DZHA 3M0LA 3WK3A 4GKTA 1LZOA 4JTUA 3FV9A 3LBCA 4KT2A 2FTYA 1K4GA 1GUVA 4AX6A 3HV9A 4DJED 3W81A 3U4AA 1F76A 4H2HA 3WMBA 4K1GA 1YE4A 2HBXA 5FEZA 3SURA 1NFPA 1GTEA 4S3BA 3WD2A 2O9TA 4LALA 5F4XA 3QJAA 1ZGDA 5CCZA 4GIEA 1E3ZA 3LI0A 3U3HA 4J1OA 3UG4A 3L5MA 3C3NA 4XQ6A 1F4HA 2GJNA 3MI6A 3EWCA 1GG1A 1GVQA 5K7JA 1WX0A 4FLRA 5FEWA 4ZFCA 3QPZA 4B2DA 5LNWA 1VKFA 1B3VA 3WNKA 1UWRA 3TC7A 1O5KA 2Z24A 1BGAA 3I4EA 1IT7A 2YSWA 1XH0A 3G6MA 5GJMA 2OSWA 1EIBA 2DJXA 1BG4A 3KL3A 3WIJA 3IVTA 4S38A 2OT0A 3CJPA 2CLOA 4HOZA 3E2QA 1RR2A 5FF0A 3M0ZA 3B9EA 1P48A 2D73A 3SQMA 1K77A 3RLUA 2PDPA 5K2ZA 1Q6QA 4UFIA 1XBZA 3UJEA 3MMTA 4NJHA 3O0KA 5B7ZA 3H4GA 1VR6A 4NF7A 1OBAA 1I2RA 4ZVJA 4JD4A 2R1NA 2J62A 2W9MA 3BAXA 1EL3A 3CQHA 2YGYA 3B9AA 3BOLA 3LRLA 4RKAA 4PUUA 4PC8A 1XRSA 2GQ3A 2P88A 1KXTA 3KS6A 4S1FA 1IV8A 1QK0A 2FFCA 3CLWA 4RV8A 2V3DA 4TVDA 1CZ1A 2QJJA 5TIMA 2RDWA 5DEZA 3AHZA 5HUPA 4Z0JA 2QCDA 1W17A 3RRXA 5DXXA 3ZWSA 2B7NA 2QPSA 1K9DA 4S39A 4P5UA 3ZOAA 3FYOA 3ARXA 5AFDA 3FVMA 3N2CA 1ZTVA 4NAEA 4E38A 4WRHA 4C6KA 3K13A 3WLTA 1YXDA 1FWCC 2ZX8A 3CO8A 3VMPA 5TBOA 4EK7A 3H2NA 3EX4A 4GO9A 5AC5A 3DOPA 3LCWA 1KR1A 3TJIA 4OZOA 3WQGA 3EKZA 4LCSA 1J8VA 3GY1A 4GH1A 1JD7A 3CGTA 4EWND 5K3VA 4ZE4A 2CLKA 4XWUA 3W7JA 4GA8A 4UFHA 1M5WA 3RG6A 2NVDA 3LG3A 2DIEA 3CL7A 5BZAA 4CN4A 3RR1A 4H8HA 5A6SA 2R1MA 4FK9A 2NQZA 4K68A 4UTWA 1MEHA 3IUDA 3B0XA 4IPLA 5ABFB 4Q7BA 4AXKA 5FSEC 3LBMA 3BL3A 3CUZA 3P3BA 1YXCA 1UH4A 3GDBA 3GG8A 5CZJA 2XYLA 3NQ8A 4MB5A 4B90A 3UZJA 2Z29A 3IJ8A 5D2YA 3GNNA 1HKIA 2P3ZA 2NXHA 4A6GA 4B3LA 3WF4A 4OFCA 2UY4A 3W7DA 3R0KA 4ZOEA 3N17A 3H26A 3OOQA 4L65A 4C91A 1RP9A 4FI4A 2QCFA 4I9AA 4I9MA 3BLIA 3BCFA 3NL6A 3CMFA 3GDTA 2Z1SA 4ZQMA 3VD5A 2VEFA 3W23A 2Z2AA 1BLIA 3I10A 3GUGA 1LORA 2NXIA 3DYOA 1J5SA 3JR2A 5G2IA 2PI6A 1Q6CA 3GX9A 1LOLA 2V3GA 4RUBA 1I8JA 4UBPC 1VJZA 1X7IA 5IHSA 4O0QA 3IAPA 4DWSD 3SY8A 1F5ZA 4O4VA 3AYVA 3CS2A 3GTFA 3A3WA 1R3WA 3L23A 3AUJA 4KKXA 3L2MA 3WLHA 5CSUA 4NUWA 1BRLA 3PVFA 3BV4A 3O2LA 3TCEA 2AQWA 4ZCWA 1FHDA 5BMXA 3EA2A 2FZ8A 3NR0A 3A4WA 2G4FA 4C6FA 3KBMA 2INEA 2HCVA 4UQEA 3WUEA 4JX4A 2WANA 5H2ZA 1EP2A 1E1EA 3M7SA 3QH2A 5HA7A 4XB3A 1JGIA 2O0TA 1VJSA 3RX3A 5FD0A 4MWAE 3UW6A 3EWUA 4RDZA 3K4AA 2YCEA 3WDJA 2CBIA 2VX5A 4G56A 2UY2A 3OO2A 3S46A 1PTGA 3V0SA 3R4IA 2QZRA 4H83A 3W1AA 3H4XA 3FA3A 1KGWA 1E6RA 1PKYA 3PZVA 4XSMA 5BXRA 4YL2A 4FX8A 4ZQPA 3URBA 2XIOA 3QGVA 3TR2A 3WQCA 1IXNA 2WCGA 1HKWA 2PP0A 1TPUA 5AN7A 2DY3A 2YZ5A 4U2ZA 4J2PA 2WMJA 3R8HA 3HJZA 4A8RA 3PHAA 3TWBA 2XIMA 4NL1A 1I75A 2E3ZA 4QR6A 3MSGA 5H8MA 3U6WA 3LOTA 3S42A 3QBUA 5CLTA 1RH9A 3C2YA 4H7ZA 2GQ9A 4CQ9A 5G4EA 1QWGA 3GVWA 2Y1HA 3CMJA 2R8WA 2DZWA 5KZMA 2FYMA 4E4UA 4PEKA 4UUIA 3AJ7A 1LOSA 1UP2A 4AZCB 2YXOA 4WOQA 2A7RA 4QCFA 1KFLA 2NQHA 1HVQA 4KMQA 4Z2KA 1ADDA 1EJXC 2C16A 3BAIA 1IXPA 3UCDA 3A9IA 1GYLA 5HMEA 1H62A 3EPNA 1GOOA 3O6YX 1GHRA 4JHZA 3VE9A 3EMQA 4MM1A 4UR7A 4GC3A 4W87A 2OR2A 2WSQA 3QW4B 4RW5A 3S9ZA 1R9ZA 2DVTA 3WF0A 3EAUA 2HK1A 3HZ3A 3ZJ6A 4R3UA 2QCEA 4H01A 2QVHA 2WSRA 3BMWA 3C8NA 2VFHA 1UZHA 5DBUA 3IGSA 4Q8TA 2BOEX 2NVAA 1X8FA 2GK1B 3C0LA 3QKZA 2YPIA 1TRDA 4M6QA 1KBLA 3PPCA 3TXZA 4RL3A 3AU2A 4TIMA 3S2CA 4HMEA 2PGFA 4HJWA 3ARPA 1MRQA 4PMZA 3TTEA 3N9SA 1DIKA 1W3IA 4LCQA 5LGXA 4XAFA 3PUOA 4F79A 3O9NA 3H7UA 4FA3A 5F2GA 1BYBA 4MF4A 4J35A 1UD8A 3COTA 5DLCA 4KEMA 2EO7A 1P0BA 4GKLA 2NT1A 4NYYA 3K1DA 4XBKA 1XGEA 4XTDA 4L9XA 4M81A 5E5CA 3ZYZA 5I78A 1US2A 2XIJA 2V5CA 5I3JA 2IKJA 3B8DA 3TEVA 5AB3A 1EXPA 1Y65A 5F4SA 3UF9A 1F2JA 2X0YA 1AL8A 4JZ5A 2W27A 4J3VA 4ICCX 3MJMA 5HMSA 3B8SA 2WBGA 3UGRA 1SZGA 1XSJA 3SCVA 4CNUA 3HQOA 4EE9A 1V3MA 3H2CA 3RMEA 3QSRA 1GOKA 2VFGA 2P10A 1Q85A 3A13A 2DJLA 2QVNA 4FR1A 4LC6A 2QIIA 3RJXA 3AWOA 1DEDA 3NVTA 3ATYA 3DFSA 2PU1A 2OFJA 4W4QA 1J0ZA 1MUWA 2I5GA 2ALDA 3NFUA 2GDQA 2VP8A 4BA0A 4AWEA 2D0HA 1RK6A 1JQVA 4Q3MA 1UOKA 3WK2A 3C2FA 4PL2A 3AXMA 1X1NA 4TMCA 1O94A 1UA7A 2DVUA 1H0IA 2ZWYA 3WKZA 1W3TA 8CGTA 1O5QA 1JUEA 1K02A 4ATWA 1FBAA 4TU1A 1S1RA 3NQ2A 3T08A 3ZFHA 5IFPA 1L8PA 3QOKA 3VU2A 2BXZA 3C0SA 1Y8BA 3N6HA 1C7SA 4O0KA 3W28A 2CITA 4YYFA 1VYPX 1I0DA 1E0TA 4I8DA 1N55A 1QNPA 1XQLA 3VOGA 5D4YA 3GBDA 4PFMA 3EOOA 4HBKA 4ZA0A 5CSSA 3HQ1A 4GY7A 2XVLA 3TU9A 4KGLA 1V02A 2QJGA 3VOFA 4ORIA 3MKCA 3UJFA 1T7LA 3I68A 2O56A 2VOMA 1VFSA 4IICA 3WD3A 4CQDA 3S1VA 3OZYA 4FZIA 1Q3NA 4JNZA 4WD0A 4O1CA 4JEJA 4XKMA 4TVCA 1TYGA 5I00A 4CNOA 3P0XA 4URIA 2OCZA 4JX6A 3FLUA 1P7TB 2FIQA 2AGKA 2XIQA 3BDKA 3RPMA 4BFAA 3IACA 3LBOA 4KEZA 3M4HA 2J7FA 4NASA 4FLSA 1M7JA 3WG6A 2CZ5A 3LQLA 3UWQA 4MJZA 3VGHA 3O6DA 4V27A 3BUVA 2PA6A 4U10A 5CJ5A 5ECVA 4TUFA 5GJNA 1V6VA 3EX1A 4M24A 4MADA 1J0JA 4MZYA 4X9YA 2NSXA 4R7WA 4AFYA 5IXEA 4AWSA 1TTJA 2QEZA 3ZSTA 2C6QA 1ZBKA 1PX3A 1E4NA 4FLOA 2QT3A 3JRKA 4LUSA 1TV2A 1Z6KA 1J2BA 5EKYA 1VBJA 3N2OA 5I0DA 3C5QA 1Q6GA 1UZ1A 3LCFA 1OQFA 3LHWA 5FJTA 4HOXA 1TE6A 1VENA 2GQAA 4AVOA 3WBEA 3TLQA 1M04A 4OECA 1UPPA 4R9XA 1F61A 1H50A 1T41A 2IPGA 2FHCA 1C92A 3BW3A 3WD1A 1A5NC 2NWSA 1I9CB 2Y5EA 3TTYA 3WLOA 1MEWA 4L4MA 4QM1A 4RNIA 4H9XA 8XIMA 1CB2A 4LJ3A 4IG2A 4PFHA 3ISIX 5DXYA 5AYXA 1RCXB 5JBDA 4GZJA 1I2PA 3MI3A 4NY2A 2CXGA 1A5CA 7XIMA 3H2MA 4HPNA 3H2OA 1UR1A 3ANUA 4E3VA 4ASTA 1HJVA 2Q3RA 3QC3A 4PUNA 4PE8A 4P8VA 4C60A 3F4NA 3KRUA 1JDAA 3M6YA 2Q6ZA 3PUEA 4MY8A 3WEZA 1OFBA 3HF3A 3PAOA 3LCHA 3CH0A 1EGMA 3I7QA 4WKAA 1X6LA 2VFEA 5FL0A 5LIKX 1BVZA 5JBEA 1R9YA 5DT5A 3VKBA 4AMAA 1V6UA 1JUBA 3VDCA 2AQOA 3WQDA 3MPGA 1B0IA 1XISA 1PZ2A 1X7FA 2E28A 5LA0A 5CPSA 1Z9AA 1JQXA 5F1UA 4IL0A 3CBWA 2D24A 1AW5A 1SZFA 3IARA 1G4PA 1L6WA 4NZCA 5HANA 1OWQA 3PN8A 3S2LA 1A53A 2KAUC 2PRHA 1TMQA 2IUZA 3MJYA 1LWJA 1OG0A 1UUMA 3W6YA 1VIWA 3SZ8A 2D2HA 2XH4A 3W7CA 2ZXQA 1MVYA 4FXRA 2G5WA 1XICA 3SRKA 2Z6JA 2P0OA 3VE7A 1XX1A 2VC7A 4M6PA 3TNBA 4GZEA 3A47A 4QITA 4I8YA 1UQZA 2HDJA 1SZNA 2O9PA 3U2ZA 1R47A 4HPGA 2BLEA 1ICPA 4UXDA 1WDWA 2G3IA 1XG3A 1FVPA 3B06A 3UXKA 3BLOA 2JE8A 1H61A 3IIOA 1IGWA 3W26A 3B9OA 2IPWA 4LVGA 3MSDA 5BRBA 2WVVB 4IFOA 4ATDA 4JTLA 4D8ZA 2ZDSA 1M41A 2WZMA 1DXIA 4K37A 4LS2A 4YMZA 4QDMA 5AYZA 1QPNA 2PTWA 4XISA 2Z25A 4UFJA 3MHGA 4G1KA 1W3HA 3QHOA 5ABEA 1VFMA 4KEVA 5C9XA 4R27A 4BHYA 2F61A 3VX1A 4PODA 4L61A 1MQQA 4Z0SA 3W1UA 5I3GA 1W3KA 4DY1A 3DXIA 2CBUA 3CO4A 2V5KA 4GMEA 4MNJA 5FA5A 4GUHA 3LGDA 1E9IA 1Q6FA 3LHTA 4IH3A 3NYZA 1DBTA 1S46A 1V03A 4C1NA 3WUFA 5ABHA 1AK5A 2OZTA 3G8RA 2H6RA 1TG7A 5DCDA 2ZWZA 3LHZA 1EOMA 3L4VA 1RCQA 2XJ7A 4C5ZA 4AZBA 2FZ9A 1VEOA 1IR2A 3AXKA 1WNOA 2VVNA 4NU7A 3W72A 3TJXA 3WF1A 1B2YA 5CZKA 5D02A 1UG6A 4GX9A 3U2EA 2NQLA 2BB0A 2HMCA 4ZO9A 4O1AA 4HCLA 1H2JA 5FF4A 1IR1A 2VM8A 1PPIA 5AECA 3GYCA 1PIGA 1CGTA 2DSVA 1K6AA 2OLHA 4GJJA 3P5YA 1E1FA 2PDXA 4DVOA 1FDYA 2J7HA 4R9OA 1Q6EA 2Z1BA 3T09A 4JTFA 1XIEA 1W9VA 4L56A 3DHUA 1LBMA 3CZ8A 4X9SA 3VIPA 3SUWA 2BOGX 3MMDA 2XPKA 4LF1A 3ZJKA 1W8SA 1GJPA 5H6HA 5HDRA 2ZXAA 4XAZA 1L6YA 1R30A 2XH2A 4GISA 1CECA 4QE5A 1U2YA 2WNQA 4AZGA 5BOFA 2INFA 5IDIA 3H4WA 3S2MA 3TYZA 2WNNA 3KW3A 4JY8A 3RILA 4FAMA 1XLGA 1UR2A 2OOGA 5A8QA 4NZ1A 2V5DA 3ME3A 3S5SA 2ZA1A 4CU6A 1GOXA 3NO1A 4Z08A 2EBNA 3BK0A 1XKYA 1SFTA 4QE4A 4QQ3A 1M01A 4CCZA 3V4BA 3PNUA 4UTHA 3CHDA 4Q6JA 4F9DA 4WK9A 3JZEA 2WHJA 4JFVA 2HV5A 3BH4A 5AHIA 4ACYA 4E4PA 1KD0A 4GI8A 2GYIA 1NY1A 1YTKA 2XIIA 4WHBA 3MCNA 3SR7A 3ABOA 5LIXX 3SCSA 4JQ2A 4B5VA 3ZT7A 3H70A 4L1GA 2WZIA 3UERA 2BHUA 1TELA 1B1YA 1KCLA 4RNHA 3AYSA 2E77A 4QISA 3CT2A 2QGHA 4GUJA 3UWVA 1YLVA 4ZOCA 3GTIA 2RDTA 3TOPA 4YVVA 2PSNA 4OTKA 3KE0A 3KLKA 1VBHA 4IIHA 2DP3A 2EPNA 3WD4A 4FEZA 3PTMA 2GVEA 3RGTA 4AD4A 1KBBA 4GY0A 2EEXA 2C91A 2CLIA 2DSZA 3SCPA 1U22A 4ZSTA 4GYPA 1DP0A 2J77A 1V6XA 2Z1WA 3TQ0A 3MMWA 1RVKA 1MZRA 2ZFAA 2VNCA 2V38A 1YDOA 1W5NA 2PFHA 4IJCA 2ATSA 2Q3OA 4PCTA 3UG3A 1B3YA 3V0TA 1CENA 3REQA 4U3CA 1DQWA 1XLIA 2A21A 2BVYA 5JH2A 1A5MC 1SQ7A 4NRRA 1TRIA 3N4AA 3E2VA 4G9PA 8RUCA 2DV0A 3V5CA 1KLZA 3POCA