3QBUA

Crystal structure of putative peptidoglycan deactelyase (hp0310) from helicobacter pylori
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
290
structure length
290
Chain Sequence
AKEILVAYGVDIDAVAGWLGSYGGEDSPDDISRGLFAGEVGIPRLLKLFKKYHLPATWFVPGHSIETFPEQMKMIVDAGHEVGAHGYSHENPIAMSTKQEEDVLLKSVELIKDLTGKAPTGYVAPWWEFSNITNELLLKHGFKYDHSLMHNDFTPYYVRVGDSWSKIDYSLEAKDWMKPLIRGVETNLVEIPANWYLDDLPPMMFIKKSPNSFGFVSPRDIGQMWIDQFDWVYREMDYAVFSMTIHPDVSARPQVLLMHEKIIEHINKHEGVRWVTFNEIADDFLKRNPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title The Structure of Helicobacter pylori HP0310 Reveals an Atypical Peptidoglycan Deacetylase.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
total genus 96
structure length 290
sequence length 290
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2011-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 3qbuA00
2J13A 3RXZA 4NZ4A 1XW8A 3CL6A 3CL8A 3VUSA 3CL7A 1W17A 2CC0A 2VYOA 2NLYA 2XU2A 2QV5A 2C1GA 4HD5A 1W1B1 1Z7AA 3QBUA 4V33A 2Y8UA 4L1GA 4NZ1A 4WCJA 2C71A 3WX7A 2E67A 4NY2A 5JMUA 4LY4A 1NY1A 4F9JA 2C79A 4M1BA 2W3ZA 5BU6A 2C1IA 4OUIA 1V6TA 4NZ3A 1W1A1 4U10A 2I5IA 2IW0A 3S6OA 4NZ5A 3HFTA 4NYYA 4F9DA 4NYUA 2DFAA
chains in the Genus database with same CATH superfamily
1CB7B 1Q7ZA 3MMUA 3SCQA 3MHGA 2X1SA 3VE7A 1KKRA 1BEUA 4JTDA 4WRHA 4MY8A 1EGVA 4IFRA 2EJ1A 1QPNA 2HK1A 1G4PA 1TWWA 1WBHA 3NPVA 2JBMA 1Y5XA 4H00A 3GBEA 1KFKA 3WK0A 1GJWA 1Q4NX 4H2HA 2OO6A 2D22A 3O07A 2XIMA 2EAWA 3SGZA 1QNRA 5KSWA 2VCCA 4K68A 3AQUA 4N6EA 4KWVA 1CXKA 4RDZA 2D69A 4NZ3A 3VZXA 3MUAA 2PRLA 4TTUA 3NO1A 3DH7A 5DY2A 1UD3A 1UBSA 1DBTA 4FHAA 4L4MA 4DJEA 3SCWA 1MZRA 2Z24A 2E8YA 3ERPA 3MUCA 1QPKA 3SUSA 2WMIB 2G50A 3KDOA 4OKDA 2BXZA 4MHBA 4PEKA 5CZSA 4POCA 1Q13A 3S4TA 1XSIA 1TO3A 3O63A 1V4YA 2AQWA 1XF0A 1XISA 1SO5A 3D47A 4OU1A 4ADSA 2P0IA 3LCWA 4HT3A 3CV2A 4KBXA 4BF5A 3S1WA 1DQXA 1EPXA 1EA9C 4MWAA 1A5BA 4NIRA 4QQ3A 4RZ5A 4CQDA 2E3ZA 3WYZA 2VD8A 2OLSA 1YPIA 2XGZA 4HU3A 3QHOA 4MJ4A 3TYZA 2PDUA 3QLDA 4RLIA 1GT8A 4HCHA 2HROA 2OGYA 4FNPA 3W7MA 1EQPA 3CQKA 5IRPA 5FF3A 1JDFA 1TFVA 3B9AA 1KCXA 4UTFA 3UCCA 4DUWA 5DMMA 3HG4A 1W5MA 3RCYA 2Q8XA 3I3DA 1KTBA 3PFRA 1EJUC 5H8MA 2Z1KA 3RLUA 4O54A 1QDSA 4RK8A 2ALRA 1UZ4A 1P5BA 3W0KA 4A3YA 3GUWA 3R0UA 4NHVA 2JIWA 3A12A 3VXGA 2HDJA 3ZJ7A 5A8GA 3WIJA 1YTEA 1UR3M 1SZNA 3G0XA 7PTDA 3VO0A 1Q6RA 3VIHA 2XVLA 1OWQA 3RN6A 1XXXA 2QIWA 4DZ5A 1GQKA 1TRDA 4QM1A 3CAVA 1PZ2A 3S0CA 4D8AA 2PDNA 3GVRA 3U57A 4Z0JA 3IK2A 1HP4A 2G3MA 1KB3A 4O13A 1SZFA 1UW9A 1I2OA 3LV6A 2PFHA 2EKCA 4I90A 3TJIA 4LBRA 3OIHA 2Y5EA 5JVLA 4GG9A 5CZJA 4Q6XA 4DM1A 2YSWA 5EL1A 3N2OA 4AHQA 1KRMA 2QCDB 3DFTA 3GAKA 1J0ZA 4MNKA 3EKZA 3H2EA 1B57A 3VE9A 1XWYA 3TC6A 1E55A 3CIVA 2Z1XA 1POKA 1GEQA 1Z7AA 3OPSA 2Y1HA 3LHWA 3BGGA 3WQDA 5J8LA 5AYIA 2INEA 5PTDA 3GIYA 4B3LA 3AIEA 2INFA 4IQDA 1UA7A 1JGMA 3SCRA 2ZZ3A 2PWEA 1J10A 3W1PA 4PODA 4HZ8A 4GKLA 3F4CA 4HBKA 1VBRA 2Z00A 1EOKA 2QVNA 2D23A 4FSAA 1KV5A 4IOTA 1V3IA 1F5ZA 5HDRA 3CAQA 1EIXA 2YXXA 2GDUA 4GX8A 4MYXA 3WF0A 1FH9A 4CU6A 5IM51 4EPDC 1RLDA 3MSRA 4CCZA 3HPSA 3FVDA 3AZSA 4O4VA 3MYOA 1UC4A 4OWGA 1H50A 3UJFA 3P8JA 1VYSX 4HN8A 1H51A 3SN1A 5EFFA 3WF4A 3VD4A 4LCSA 4OUIA 5D09A 4QNWA 3BJTA 4JOMA 1GOXA 1Q2SA 3M0IA 4P8VA 2A3EA 3MCOA 9RUBA 4DLFA 1G1YA 1W1YA 3W76A 2OMAA 3N73A 1FHUA 4D6JA 4AMCA 4DJFC 3R58A 4GUFA 3LCXA 1QK2A 1BAGA 3A4XA 2B7OA 2X1UA 4PB3A 3PZTA 4IXHA 4F0MA 1ZRQA 2NV2A 1B1YA 2GWNA 3PJXA 3MCMA 2DJXA 1QRQA 4AWSA 4IP4A 1SFTA 5F1UA 4UNKA 4HK5A 2FLIA 1P4CA 5BNKA 3LSCA 4N9DA 3GH4A 5I00A 1X96A 3EWDA 4GGBA 3P82A 2P5NA 1VIZA 1HVQA 1BSIA 1XIBA 1IR1A 4QLJA 5IFTA 5FESA 1OC7A 3TQ0A 2GGHA 5I77A 1WZAA 4HZMA 1HTIA 2E9BA 2XIJA 2FDMA 1UROA 2V2DA 2F6KA 5D2VA 1T8XA 4KIRA 1GJUA 1F3TA 4JTLA 4UIOA 2GOKA 1GOWA 4CNSA 1GOKA 1M41A 3ARZA 4ASTA 4GC4A 4ZR8A 1US2A 2OKOA 1O5RA 2GWGA 2HBXA 1JZ3A 2E40A 3M5ZA 4YTQA 1WPCA 1AG1O 1OYCA 5JH1A 3W87A 1VS1A 3UZXA 3EA2A 3CHVA 1KCKA 1VPYA 2ICSA 4WDWA 1S5MA 3RRXA 1JYWA 2LLEA 1Q65A 1FWDC 3T42A 5FSDC 2X7VA 3OIXA 2C6QA 2FPVA 1E40A 1UJQA 3URBA 4IGMA 3OTRA 4UQDA 1ME8A 2FH6A 2Q02A 1P43A 1KFCA 1EF3A 4UMAA 1KTCA 3ITXA 2NV1A 2DVUA 4XUYA 4H9MA 4K7YA 4JTJA 3C8NA 3T78A 3G6LA 4KMQA 3VFCA 5CC3A 1UQYA 4R53A 1OX5A 2G5WA 3H2CA 3FGCB 2ZUTA 4JFSA 2WXDM 3MI3A 1E0VA 3B8DA 4XAGA 3HA1A 3OBKA 5HMDA 3STGA 3W1XA 3TXVA 3U8GA 3U5UA 1RVGA 3W1MA 3BANA 3KL3A 1UKSA 2JKAA 3N4AA 1CECA 1NDWA 2Z2BA 2VWSA 3DG3A 3N2XA 4HZ6A 2PP0A 4W5ZA 4ZTYA 5AOUA 4H01A 1WUEA 4ZMGA 1JPIA 1PX4A 2JGYA 4KIEA 1T41A 1B90A 4L65A 2G97A 3BV7A 4RE3A 2PTXA 3STPA 1VRXA 3E3HA 3WQOA 4Q4QA 4F0SA 2QF7A 2DH2A 2G3NA 3NQCA 4UWMA 4EANA 4PYSA 1EOMA 4H04A 4ZOEA 1B9BA 1P48A 2C8NA 3GSMA 4CGTA 1RK5A 2E1DA 2CITA 3UGRA 1CXEA 3LPOA 3TYUA 4HHPA 4X60A 4AF0A 3HG5A 2DQWA 1EJTC 3TH6A 5AHNA 3MSDA 2WPGA 3GZAA 3BAKA 3KTSA 4L4LA 1K9DA 3SCPA 1CZ1A 3W7GA 4KGJA 3L5AA 4AWEA 4B5UA 3S5OA 3G1AA 1UWRA 4EAYA 2UV8G 4C6JA 1RD6A 2WBKA 2PWGA 2PSNA 4LF2A 1ADSA 5AHLA 4KPLA 4AU0A 1ZQ5A 2IS7A 3LLDA 1XRFA 4IUOA 3KTXA 5FOOA 4CLMA 1JDDA 4KEVA 1OVDA 3GFXA 3PPCA 4UQBA 2NQ9A 2P8CA 1OYAA 5E93A 3DKJA 3VKCA 2JFEX 5I3HA 2ZOXA 4BK9A 2VC5A 2J7DA 1OIMA 4IMFA 3CT2A 2PDGA 2ZUMA 3SI9A 1HO1A 3CBWA 1E51A 4LB3A 5C9UA 5FACA 3C5QA 2ATMA 3SCVA 3RJYA 3P93A 5CGTA 3VZZA 1VJSA 2QGHA 2OO0A 3NXFA 3UZ5A 1EZ2A 3MKCA 3LI0A 2YB4A 4W88A 3QMRA 1OCBA 3GHSA 1H1NA 2VRQA 2EG8A 1SSDA 3CEPA 5G2HA 5AC5A 4GI4A 1ZALA 4N42A 4NJJA 5DN1A 1V02A 1QI4A 3VGHA 1LT8A 5AN7A 5KITA 3AFBA 1NFBA 3RMEA 2Z25A 4NXSA 1SMDA 3T09A 4YTSA 3WH8A 4YU1A 3WBAA 3TW9A 3T44A 1OT2A 3U4FA 3Q2DA 4EAMA 2QCHA 3BW3A 1QI2A 1EX1A 3VVGA 3VDGA 3VGDA 4HHHA 5ABFB 3SEPA 5M3WA 3BLOA 2XFRA 3CPUA 4D71A 3LD5A 1U30A 3OYZA 3N14A 3NYZA 3DZ1A 1HQTA 3NPWA 1YDYA 4GVIA 4O1DA 3DU0A 4MLRA 4OV9A 3W6MA 1W1VA 1ODZA 3UPWA 3RAOA 1R86A 1K8XA 4U33A 1MYRA 1M5WA 1JRBA 1DJHA 1GYMA 3N18A 3K8LA 2DY3A 1KFLA 1ZFJA 2VGFA 1PS9A 2PD9A 4NZJA 1UD5A 4EACA 5JH2A 1K4HA 4P8WA 1H7RA 8RUCA 4HHLA 2CFFA 3O0FA 2D0HA 3EB2A 2JKEA 4RNHA 3UNTA 3CASA 1S1PA 3OP2A 2GDVA 4M7SA 4PH6A 3EOEA 5HA7A 1UPMB 3MSYA 2X8RA 2QPSA 3W23A 1TWIA 3KLKA 4AXNA 5A94A 1C91A 1EB3A 1GVIA 5DX7A 3UJEA 4L5ZA 2EPHA 3VDAA 2ZDSA 1JUEA 2WJZA 5A6TC 1LQ2A 3ECQA 1PX8A 2OR2A 1FH8A 3QN3A 3S5ZA 2DVXA 2CLLA 1K7FA 4A3HA 3N4EA 4ZOCA 4QJ5B 1UZHA 4H6EA 2XGIA 4NZCA 4WDUA 1X8CA 2ZC8A 4V27A 3IGUA 4KT2A 2Z6IA 1IV8A 1L6YA 4OT7A 2PLMA 3OGVA 2E5BA 5KMYA 2WB5A 2WWCA 3UP8A 3G3MA 3GDLA 3UJ2A 3SURA 2WJDA 3GUGA 3FA3A 4V15A 1DOSA 3BARA 4N6FA 5DELA 3T0AA 3U9IA 3LY0A 1VFHA 3H4XA 1VCGA 2Y24A 4F2TA 4PMOA 1X6UA 4AF0B 4P61A 1FVPA 5HAOA 4WQ6A 3LOTA 4Q32A 3MBDA 1VC4A 3KL0A 4MJZA 3WQ8A 1DWFM 4JFTA 3RU6A 4O4WA 2ASHA 4E5TA 3HGSA 1O12A 4US6A 4GI9A 4GFIA 2W67A 1W3NA 3UGVA 3UWEA 2J7EA 5IFPA 1NY1A 3P6LA 3WD2A 4M80A 4PUJA 4YNGA 2OEKA 5F4XA 3H2MA 1X7IA 1OGSA 1GG1A 2P1FA 2R91A 3BICA 3BPWA 4AZ6A 3TVAA 4AEOA 1R7OA 4Z2IA 3NEVA 3AYRA 4S3BA 3TNOA 5I3FA 2X42A 2FJKA 1EQCA 1A80A 4IG2A 4S1FA 2J62A 4F3HA 3T2QA 1PKLA 1XL9A 4HOWA 3CMFA 3VNDA 2AL1A 2ANUA 4WD0A 2BXYA 4PTXA 1NQ6A 5GVJA 1U5JA 2XSAA 5D9NA 1HIZA 1ZBCA 4DNHA 2OPJA 2VEFA 2R9RA 3MT1A 4FOKA 3UA3A 1G4TA 2R24A 2J8GA 5CSRA 4KFOA 3MVIA 3NQGA 1DXIA 4IIFA 3E96A 1ZHAA 5I09A 3CWNA 3M6YA 2B7NA 2VJXA 3GDRA 2NV9A 5IBXC 3Q94A 3PZ9A 4GKTA 1ZGDA 1VR6A 1JCXA 1G0CA 1BF6A 1PXGA 2ZZ1A 3PUOA 4DZAA 1WX0A 2FHCA 3VMPA 1K9EA 1CGWA 1XBYA 1X38A 1XD1A 2XIQA 1M7PA 1L8PA 3EXRA 1W91A 8CGTA 2ZFAA 4GABA 3O9NA 3AHZA 4IPNB 4R3UA 2UY2A 4DJDD 3BXWA 2PPGA 1OFDA 5HR7A 3KVKA 3RHGA 2C79A 1XIIA 2ZA3A 4J3VA 3HPZA 3MSGA 2WSKA 4NU7A 3TYBA 3WQCA 3D46A 1WP6A 2J79A 4QEEA 3R8RA 1RCXB 4CKQA 4MPKA 4XUGA 4QROA 2DZSA 2PGFA 3N4FA 1SW0A 1GUVA 4HTBA 2D2GA 3WSUA 1NH6A 1EXBA 3W74A 3N04A 3FDGA 2VDIA 1RP8A 2RDXA 1NQKA 4AYSA 3ZZ1A 4WCJA 2A3LA 4MNJA 4JBRA 4R88A 1S5VA 3NQ6A 5JU6A 2Y8KA 1YBQB 4CNNA 1XCFA 2H8XA 5CZKA 1S2TA 1QW9A 2WKJA 3FV9A 4PCSA 3CO4A 4J3WA 1IZJA 1OK6A 3FAWA 3PPFA 4ATDA 1Q8JA 5H8PA 1B9ZA 2HCVA 1M65A 3T0DA 3WX7A 1VFFA 1QUMA 3DYOA 3V18A 2XYLA 2MANA 4MFDA 2VFDA 4FLOA 4P7RA 4HNNA 3POCA 3EA1A 4LUSA 3AOFA 3AHXA 1OY0A 2BVWA 3DIPA 1G94A 2OQYA 1B30A 4MB3A 5HINA 1X97A 4C6MA 2C14A 3T0TA 3UR8A 1AFSA 4E3TA 4BF7A 3W1TA 4DWSB 3W02A 3H8AA 3QMSA 4S3KA 3BK0A 3T07A 5I2UA 3GXNA 4BQ4A 4NZ1A 4KEMA 2I14A 4H9TA 4CCDA 1XLBA 4DXVA 4C6EA 1H60A 3PZUA 3VNYA 4DJFD 1EEXA 1NARA 4E8CA 3WDPP 3PULA 5MF5A 1TX0A 3N6QA 4M0XA 3UG8A 4IPJA 1GZGA 1VFTA 2ZUNA 5D9PA 3RX4A 3DYPA 1GQNA 1O94A 2GL5A 3VIIA 1LRNA 2Q6ZA 4AZCB 4RL3A 4G1NA 5A8MA 3SY8A 3LM7A 5I3JA 3RCNA 5LXXA 2GQ8A 4S3FA 2WMFA 4XAYA 4JIIX 3GNXA 5BWFA 3H2FA 4JDBA 3I10A 1O66A 4LUTA 2CLIA 4B5VA 2XIBA 4C6DA 3W07A 4YWIA 1J8VA 4XTDA 3MPGA 2CCRA 1LT7A 1I8JA 2X0YA 2WOQA 3KRBA 4H4IA 3T1GA 4NT0A 1BRLA 1ZL1A 1EJRC 2A79A 3TKFA 3HV8A 1ISYA 1UP0A 1HP5A 2Y7DA 1JR1A 1GYNA 5CZ0A 1GTHA 4I8YA 2ISSA 3H55A 1CW2A 1CGVA 2WKLA 4JHMA 4D6EA 1DE6A 3W2JA 1KM4A 3KBWA 3WUGA 5I07A 4QE4A 3MJYA 4B5XA 4OV4A 1QOPA 4MUPA 5BRPA 2CZDA 1XR2A 4Q4PA 1OGGA 4HZ7A 2ZX5A 2GDQA 5K9XA 1VBHA 2IXVA 3SCSA 1UUQA 3ANVA 1J0IA 1U2YA 5U7SA 3T55A 3TA6A 4MFEA 5CQ1A 4JNZA 5IHSA 1WV2A 3W2NA 4W4QA 1EUAA 3N9SA 4C6OA 5T9BG 3M4HA 3DBPA 2VFEA 3ABRA 2VGIA 3UCQA 4K1WA 3TUUA 4ICNA 1OX6A 1OQFA 1E70M 2GK1B 4XB3A 4AEFA 3Q45A 2E5DA 3VIPA 3U48A 1DIEA 3VPLA 3IVSA 3OHIA 4GE8A 3S1GA 1H7XA 5DCBA 1HF6A 4GOAA 3OG3A 3W7QA 3PJTA 3TLQA 2J4GA 1TIMA 2RH9A 3B4YA 4PUEA 1W5OA 2QS8A 2HVNA 1V6TA 2YDQA 1SU5A 2FHFA 4PRRA 1W5PA 4GX9A 2PURA 3FKKA 1MUWA 3NL2A 4BY3A 3GVWA 4Z1BA 3WDJA 4IISA 2J7HA 2EJAA 5BXPA 5HK4A 4MMWA 3WDIA 2Q3OA 3QTGA 1W31A 4I5RA 2OZ8A 7TIMA 4IMCA 1YDNA 2PC4A 1W56A 1F74A 1M7JA 2QLYA 3CAWA 3V4BA 1B3OA 2ZX9A 2WLZA 2WW5A 4CD8A 1XLEA 1FQ0A 3B97A 2QDHA 2OJPA 4TU1A 1T40A 2TYSA 3UBPC 1XYCA 3IGXA 4DXXA 3UR7A 4D1IA 3UCDA 4E4FA 5LIXX 2Z2UA 1XUUA 1W54A 3NL3A 1CXLA 1SFSA 3GTNA 3TC7A 4QDWA 3ZM8A 3TN3A 2ZCGA 1Z32X 5EMKA 2JEPA 3EX2A 1AZ2A 4JYFA 3PSWA 3NPUA 1YYAA 2NXIA 3SO7A 3TQPA 1W9VA 3HQ1A 3AUOA 4GWEA 3T8LA 3QPZA 5F2IA 1SJBA 1VFLA 5CCZA 1VLIA 3TONA 4WJEA 3IIPA 3WEZA 3STCA 3C0SA 1KBIA 3WLQA 2ACQA 1Q66A 4EPEC 1W2VA 2HK0A 1ONXA 2XWDA 2WM1A 2RUSA 2PODA 2RJHA 3K13A 4KESA 1HKIA 3QV8A 4DJFA 3NUKA 1WZKA 5GNYA 4CD6A 4N9EA 3DHFA 2ZRUA 1U5HA 1QVBA 4A8RA 3RFAA 2ZVIA 1B4KA 5KZEA 4GRSA 3VKBA 4IUGA 2XZ7A 5EA9A 3UXLA 4B92A 5A2BA 2E68A 3NQDA 2TSYA 5AYBA 4HN4A 1MZHA 1W5NA 4M5PA 1LCOA 4P7OA 2BHUA 1F6PA 4GK8A 4H7VA 3VKDA 1P7TB 4NJGA 3E5PA 2Y5SA 1M68A 5HUOA 1HJWA 5LNRA 1PAMA 3G3DA 4PL2A 1LQ0A 3HM7A 2WNZA 4AISA 3BGJA 4GZIA 3BLEA 1BRLB 1JF5A 3ES8A 5EYWA 4MAVA 3F4VA 1RJPA 2YDRA 3GH5A 4HNOA 3QPEA 5CC6A 1OCQA 1EKOA 4UXDA 4JX4A 1YNYA 3LGEA 1E0TA 4NKCA 3A13A 3PFMA 3QOKA 3MP4A 4YN5A 1A5LC 1TMLA 4YL2A 1KFEA 3C4UA 3GU2A 4YWSA 3NM3A 3F2BA 3TFXA 2A7NA 1VP5A 4OHQA 1THFD 1EHAA 3G1DA 4IWWA 1G6CA 5C70A 2GGEA 1TJ2A 1HZYA 3V0UA 1GQJA 1K1DA 4D6CA 3ARVA 4AZBA 4JY8A 2PWVA 4C91A 3IJLA 5K2ZA 2PB1A 5HJLA 1UR8A 2ZC1A 5I6SA 3WD1A 4JL1A 3NGJA 3Q4DA 2XUCA 5G1MA 1W9UA 3TU9A 3SN0A 4GUHA 2FZNA 3WL0A 4LSBA 1BYBA 2VD9A 3FSUA 4ICMA 4RV8A 5A6JA 3KS5A 4LAKA 4GQQA 3PG8A 1K8CA 1E6XM 1MXGA 4XX6A 5T8GA 2PDPA 9XIMA 2EF9A 3WLNA 3R0KA 4PMQA 3VD3A 4V1XA 2X0SA 4YVPA 3G22A 1XCXA 4G7EB 2I5GA 1OFPA 2I9EA 2IKIA 3LB0A 1VBJA 2PRMA 4URIA 1T6MA 3VD7A 4HKPA 4MNLA 2NQHA 2PGWA 5DCEA 3TSMA 2O4QA 3ES7A 1H7WA 4JL2A 5FF2A 3KCJA 3GNRA 2PRHA 3OLEA 2VURA 3T05A 3W7HA 1M6JA 2VZTA 4PRTA 4HPXA 5KTLA 3QC3A 3WL1A 3EDJA 2OYLA 2QJIA 2VNCA 5DBUA 2O56A 1YKWA 2YZRA 1XLLA 5B7YA 2IUZA 3N1AA 1SO4A 3GG7A 3WLPA 3S5SA 4JQ2A 4AMAA 1OG0A 4XO6A 2WC4A 5BWAA 2NX9A 3SADA 2YDSA 3VOGA 4Z1AA 1JDCA 5GPRA 1LL6A 5D37A 5CBJA 1EHNA 2YZ5A 4GZ7A 1V6YA 2Y62A 4ZL1A 5HANA 1E9YB 4GVHA 4GLEA 3LXBA 1WBJA 3EOSA 4C6CA 1HO4A 4Q4SA 1C3FA 4S23A 4CU7A 1PV8A 2F9RA 3AMKA 3P5ZA 1OINA 2DUZA 3BOLA 4DZIA 1UR4A 1LLWA 2WMGA 2NWSA 2HPMA 3DECA 5FD0A 2P88A 3T2PA 1AD1A 1CPUA 1BGGA 1UHVA 5ENLA 2OODA 3EWUA 4JTAA 1CCWB 1E5NA 1O5KA 1KM0A 2DDXA 3W6LA 1WOBA 4QXIA 1Q2RA 1LOLA 2NXGA 2QV5A 4ZCWA 3TW7A 4LC6A 1GYLA 5D03A 1ZB5A 2ZADA 3H54A 4UTHA 2BWGA 1ONRA 2ZYFA 2C19A 3QH2A 3MUXA 4ZFMA 1XYZA 3L2IA 3QQ0A 4KFPA 2PA6A 1U33A 3W1RA 2VEPA 4K6AA 1FKWA 2IKJA 3SRFA 1HGYA 1PSCA 1AW1A 3H70A 3UZJA 3PR2A 3KXQA 4ZBCA 4LBUA 1TTQA 4I9MA 3WK3A 3O0KA 1YPFA 4NY2A 1R47A 4MKSA 1QW7A 4HCDA 3QW4B 1A5UA 1O4UA 1XH0A 4PUMA 3GXDA 1O1ZA 2DEPA 1NWUA 2Z26A 4OIFA 1KXVA 3WY1A 1ITQA 4QS6A 3GDKA 4AY1A 5K7JA 4JNMA 2B0MA 4L64A 3A9BA 5HPCA 3B0XA 1DTUA 5CSYA 1XG3A 1J0KA 3LCIA 3P2VA 2EPNA 7CGTA 1PZ1A 4LAUA 3CMJA 1QR7A 2C1HA 3GTIA 4C1NA 4OECA 5AHFA 3V1PA 3W28A 3C6CA 3CH0A 4OVXA 4IIBA 1DWAM 4OBSA 4PMYA 1B3VA 2FYMA 2ACRA 3I3BA 3L2MA 4UOJA 3W88A 1IEXA 2OELA 5M17A 3L4YA 2OZTA 3HV9A 1KCZA 4PB4A 1HKWA 3CL6A 2ZRXA 3G0UA 2RGMA 1V7YA 3D0CA 4ZO7A 5HJXA 4AEEA 5C2XA 2PTWA 1ELSA 2BY3A 2HS8A 1VYPX 4P2VA 4GQGA 2ALDA 4AX7A 1IR2A 2VRJA 3B8WA 3MHUA 2NQZA 4GC3A 1KFBA 1VLWA 3ATYA 3N11A 1K7EA 4A22A 3B05A 4C7FA 3HOJA 3BCJA 2PD5A 1KLZA 3BJFA 4TMBA 3NURA 4ZO8A 3B8IA 1VJIA 4XV0A 4AWUA 4CQ9A 4UTTC 4XZHA 5LGZA 1GVRA 1R8LA 4RDYA 1RP9A 3MUY1 2W6RA 2QXWA 4AD1A 2J66A 1B4EA 1TA3A 1X98A 5AHIA 4ES4A 1TTJA 1W9DM 2ZX7A 3DG7A 5ABEA 2FMOA 1AH4A 3KVJA 3SCUA 4DEFA 1UR9A 3WF3A 1BYAA 1A3HA 3SJNA 1LOQA 1KM5A 3IUHA 3U5YA 3NEHA 1DQWA 3H7UA 3RXZA 3A4AA 2XN0A 1WKYA 5AHEA 5C2CA 1X7FA 1QXLA 4AZ5A 4RZ4A 3CIWA 1OM0A 2VR2A 2W27A 1RBAA 2B7QA 1OJXA 2YCLB 4I3GA 1RH9A 3PAOA 2O9RA 3WFZA 3P8IA 2W61A 1V93A 1NDVA 4A3QA 4MGGA 4WUIA 3FS2A 5LGXA 1YE4A 4FK9A 2WNNA 1Q3NA 5CC7A 3THDA 3TTYA 1R2TA 1DTNA 4LTSA 3RRAA 2E9LA 1LM1A 4GNKB 1XUZA 1FWFC 4Q8WA 3RO6A 3P5YA 4ROQA 1T99A 1HT6A 3W7NA 4K7VA 2JEQA 3KL5A 4TVDA 3WJYA 4AAJA 3CHFA 1K8YA 1YMYA 3STEA 3FLUA 3WLJA 5A8OA 2OKTA 3ZVIA 1FWCC 4ZA0A 1DKWA 3VILA 1SMAA 5I0DA 2PS2A 3NQ2A 1EWDA 1K6WA 1UKOA 3GYCA 1I9CB 3URQA 1V03A 1V3HA 1HVXA 3ZR6A 2NLIA 1MUMA 3DG6A 3BJSA 2O92A 2VX6A 4LUJA 2PI6A 1EH9A 3BOXA 4BJHA 3VD9A 1C7SA 4QSFA 2VGGA 1KRBC 2Y89A 1CWYA 1HJXA 3PC0A 1JZ5A 3M0VA 2Q8ZA 3MO4A 1US3A 2C0HA 3TCSA 3LRKA 4XD4A 1A0EA 4YTUA 3LEPA 4FAMA 1JQXA 4LWWA 2BMBA 2PP1A 3CTTA 2A3AA 4TVUA 5IBXA 3ELFA 1RHCA 3AO0A 3LCLA 1ZBWA 1TMHA 3W70A 1NF0A 1MXSA 1GTEA 2CESA 4B2DA 5DT7A 3TSDA 2X2GA 3IRDA 3R79A 4IGHA 4E8DA 2ZX8A 3W7IA 4XVEA 2ZXBA 1MDLA 4BFAA 4AC7C 4D6GA 3VTRA 4BI6A 2B7PA 1QFEA 3W1LA 2W9MA 3WKZA 3UYCA 4FMVA 5HQEA 5HWJA 3V5FA 2XVKA 5G1YA 1C8QA 3G1FA 5REQB 1A5SA 2PTDA 4JQ1A 3UZWA 2YR1A 3VFLA 3MDUA 1QBAA 4PFMA 1P0NA 3M64A 2EG7A 2FFCA 1E1CA 3N2CA 4DZHA 1GQLA 3AXIA 3OVPA 3HN3A 2QHAA 3RR4A 4CNOA 2W62A 2GVLA 3W37A 1W8GA 3VNIA 1VRDA 2VQTA 3AIWA 3URNA 2OSYA 3DHDA 1Q7MA 1F76A 3T0BA 4TTGA 4H6QA 1AL8A 1ITCA 4E2DA 3EMZA 3DI1A 1AQMA 2XDFA 2V6AA 3WH6A 4TX6A 3FJNA 3WFLA 3UVIA 1PUDA 1EDGA 3EB4A 2TPSA 3Q37A 1GCYA 2WO5A 1JFXA 4EE9A 4WJXA 3ARSA 2Y7EA 2GVEA 2Z2AA 3PTMA 4J3XA 3CZKA 1TJ1A 4ZO6A 3T08A 2JF7A 3I68A 3S8HA 1KR1A 3M0KA 4FXRA 2F61A 3HZ3A 2RAGA 3NWRA 3VOFA 3NNTA 1BG4A 4ENLA 5F7UA 1TVPA 1XC4A 1FXQA 1UYQA 3M44A 3KOXA 7REQB 5I7GA 1Z41A 2PF8A 2PWUA 5AC6A 2MNRA 3ARXA 3S9ZA 2X7WA 3FYYA 4UR7A 3FOKA 4NAFA 3P0XA 3GNPA 3ARPA 3EA3A 2VFHA 2YCJA 3MKVA 1KXHA 1Q7QA 3ZT5A 1E9IA 4Q33A 4GNVA 3R8GA 1WXYA 3NQBA 1NELA 3AIBA 3FXYA 4RZBA 4JEJA 3B8TA 1O60A 4WSHA 1LLOA 1TPWA 1RPXA 4MOZA 4PSPA 2OWWA 1JZ8A 5JBFA 3DXIA 1CBGA 3CK5A 1DEDA 3V5CA 5LZLA 1EJVC 1TWZA 3XIMA 3EWBX 4PUNA 3TA9A 2PBGA 5G1TA 2ZWZA 1A3XA 4Z1DA 3L4ZA 3W38A 4K8HA 5F2LA 2VR5A 3OA5A 1E4IA 1K9FA 4KCUA 3NPXA 4NNAA 3IJDA 2NT0A 3UVAA 4N4QA 1AL7A 2R82A 2Y70A 4F8XA 3BG3A 3GDMA 1K70A 3EDKA 4LW7A 2F6XA 2I9UA 5C7VA 1LTDA 5I23A 1W1PA 1UD6A 2X09A 1RCQA 3FAXA 3PF3A 3PY2A 1B3ZA 4A29A 3IIZA 3HMJG 3LBMA 4KGLA 4IIHA 2J7GA 4IJCA 2D24A 4LVDA 5HR6A 1O1HA 3BO9A 3KDNA 3LZ5A 4GH1A 5D02A 3TAKA 3NIYA 3EWXA 3K46A 1R9XA 1XH1A 3O3RA 2EQDA 3R11A 1EYEA 3SGGA 2Z27A 3ZYZA 4UTWC 3AYSA 3UG5A 3W86A 3IUDA 4Z1CA 1KM3A 1XSJA 1DHPA 3AXMA 1H7OA 4UZSA 1QWGA 3MWCA 4LRSA 3UJSA 2REQA 3CUJA 1DP0A 2V9DA 3QGKC 4LEFA 2ZZ2A 4JKKA 3TTOA 4M3PA 1Q5MA 5I06A 2QMJA 2YW4A 2VZSA 2IXUA 2A21A 1OGBA 4NJIA 1H61A 2J7CA 1US0A 4PMUA 2FB3A 3VDBA 4A2RA 2FZMA 5CG0A 4ORIA 2V63A 1ZLPA 3SR7A 3ARTA 1ZPTA 3HF3A 4LGXA 2YOCA 4ZFCA 2ON3A 1CLVA 2QUNA 2I16A 4NZ4A 1ICPA 4HPJA 4Q22A 2X16A 1E1CB 2OT0A 1SFJA 3ARRA 3PBWA 3FJ6A 4JYDA 4AD5A 1ZJBA 3EGJA 2ISDA 3JVAA 5EGRA 1AQFA 5J04A 1PTDA 2D3LA 3VAVA 3CTLA 1H09A 1I4NA 4A2SA 3VNKA 2YL6A 1KBLA 4F0RA 3HFTA 2XPKA 2WVUA 3TJ4A 3UESA 3KBJA 1W3HA 5C5YA 5HPOA 4KCTA 3UETA 1DIDA 1O5XA 4XZLX 2GSHA 1XLJA 2PLJA 1UR0A 2DSZA 3C2EA 1R87A 3GHTA 3ZSTA 3ITCA 4OOUA 2Y61A 2GJXA 1PX3A 2HZGA 4EXBA 4QG8A 1JPHA 1C29A 1JYVA 4XK2A 4H83A 3OLDA 1PZ0A 4R34A 1X1ZA 2WMKA 1FWBC 3R0DA 1RALA 5HNUA 4NJHA 5E9AA 4JIQA 1UWUA 4NAFB 4IPPA 4O10A 1HGWA 3LQLA 1V6UA 3ZT7A 4CQ8A 4FALA 3W26A 4HJWA 1UH2A 4EK7A 3VX1A 1W5QA 3DX5A 4H6RA 1KKOA 1TX2A 3GG8A 3HBLA 4Q8QA 1EWEA 5K9CA 5FJTA 2Y8VA 1A49A 3VABA 1LRTA 1T7LA 4AHOA 1RV8A 4DELA 3MMDA 1I2NA 4XAPA 3C3NA 4PL1A 3M0MA 4OE7A 3E5BA 3AMCA 2A2IA 3GG0A 3PK7A 1DXEA 5HATA 3M07A 4H9VA 4W9TA 3TOPA 1XW8A 1OG6A 4QTGA 3HIJA 2V38A 3R13A 3ZT6A 3PJWA 1B5TA 3EKGA 4Q7NA 2BB0A 4NVTA 4C5YA 3GM8A 1M03A 2FB2A 1K8ZA 3HG3A 4XIAA 3UWYA 4Y90A 4Z1YA 1LUCA 4INFA 4O50A 3IIOA 4H7CA 3THUA 4DO7A 4HYVA 1ENUA 3A3XA 1BD0A 3CPRA 1TJRA 5BOEA 5IDZA 1TPVA 3M46A 4I6KA 2BGQA 4O1BA 1AA1B 1YTDA 4WHBA 1EP3A 1XIDA 3GNOA 1FFQA 1GPFA 2WVVB 4B4HA 2YKKA 2IKGA 1KTNA 5EPDA 2AL2A 2X2YA 2ZZ6A 5BCAA 2VWTA 3WMSA 4BQ5A 1PBGA 4O16A 4K39A 2XN1A 4W84A 3ABQA 1NWTA 4PCNA 3LERA 3UY8A 2FVKA 3W6YA 4RNJA 5D8ZA 4V28A 4GINA 3KE0A 4O53A 5E0KA 3AISA 3NZPA 2NUWA 4NF7A 2PZNA 3SB0A 3L21A 2WHMA 3P67A 1D3GA 4WKAA 4L9YA 3C52A 1FWEC 3IS4A 3CUIA 4BWLC 4LS1A 1DWIM 2WCAA 1U5VA 1KW1A 3WMCA 4G56A 3EX4A 3ZR4A 1MW3A 4IQEA 3DHPA 1CTNA 3SECA 4RXFA 4US5A 3UZYA 1QJWA 1OB0A 3KRZA 3RM4A 5C6MA 3EX3A 4ZXLA 1XS2A 1BHGA 3S2CA 5G5IA 7A3HA 3ZVHB 1Q4WA 2EHHA 1CGYA 3R5EA 3WDRA 2WSRA 3RCMA 4HMCA 1A53A 2DQXA 1E6SM 1DV7A 1ML1A 3WBEA 1CNVA 3THAA 4FR6A 4C6KA 4TXEA 2Y63A 4QDPA 1FWGC 1XSKA 3BURA 4JNYA 4LV9A 3SCNA 2VENA 4GFSA 3LGGA 5C54A 1CLKA 5T9CE 2VO5A 2WV8A 4QP0A 1XYAA 1XIJA 3R94A 3SCTA 3LQGA 3WBWA 3G8RA 2BSLA 3KBSA 1OFQA 2AAMA 5LA0A 4QJ1A 1EJWC 2VM8A 1SW7A 2G8ZA 3DFYA 2UY3A 2NVCA 4H9UA 3K4DA 3LUTA 2X0HA 5JQ9A 1JAEA 4N4PA 3NZ1A 2XSXA 3G77A 5A6KA 3CL7A 2BNJA 5JIWA 4ZEPA 2JGQA 4FR1A 2YBVA 5CEWA 3RYSA 2HSAA 5A6BD 1DJNA 2V82A 4LCRA 2EPKX 5HQLA 4S3CA 3AXXA 3UG3A 1MW1A 4QLLA 4R9XA 1PTGA 1S2VA 3QV9A 1REQB 3ITYA 3STFA 4EKJA 1ZSXA 1MW0A 4BQ3A 4JTQA 2Q09A 4OBTA 3QOMA 1BXNA 2R6OA 4K38A 4O11A 2OSXA 2R1MA 1H0IA 1O5QA 2XH2A 3BAIA 3KLLA 4X2RA 4HPHA 4FIRA 4XISA 3AWNA 1CXFA 3UZZA 1Z48A 3F2CA 1EP1A 3LHZA 1QI3A 3ZQ9A 1BGAA 4DAFA 1E0UA 4FP1A 1BF2A 1N2VA 2AKMA 1JF6A 1OSEA 3MBFA 1W2PA 2EXOA 3GH7A 3T0CA 2VFFA 1I2RA 3LK6A 4HOZA 3T6CA 1GEHA 1MMFA 1UMLA 2BG5A 2OTDA 1H1ZA 1MQPA 1TZZA 1GVYA 4IFOA 2AMGA 4PMNA 1XIHA 2HBVA 5LHFA 4ML4A 3H6OA 4DYEA 2VEKA 1BKSA 1OFBA 4ZO9A 5FCZA 2EPMX 5AYYA 1ZCCA 2WMHA 1XI3A 4IIDA 5GJMA 2VVSA 2Y4SA 3MI6A 7TAAA 3MV11 3BH4A 1OABA 2D1ZA 2AL2B 5AY7A 2OLHA 1NDYA 4PTVA 1J18A 4LB4A 4Q8VA 1T8QA 2KAUC 3EOLA 1YPXA 4DYJA 3WLHA 1JI2A 1U1HA 6ENLA 3H7RA 3VK5A 1FWIC 2OFJA 1WXJA 4C65A 5E0FA 2CPUA 2Y88A 3W7LA 5D32A 2CWXA 4YCOA 1E6PA 4KEZA 4W8LA 4NJKA 2CERA 3QY7A 3L4UA 2JF6A 1FH7A 3R2GA 1R7AA 4DN1A 3O05A 1AH3A 2WSQA 3S6TA 2C0AA 4D6IA 2VC9A 4LVGA 4JTHA 2DFAA 3JZUA 1D7FA 4J1OA 3EXTA 1G5AA 3ZWTA 4IFKB 1XLFA 3WJZA 3D3FA 2EG6A 3TK7A 3UWZA 4CVWA 4GCAA 3UT0A 4M6VA 3N12A 2YBUA 1EYWA 1J11A 3B03A 4QJ4B 3RJXA 5JBDA 4UUIA 2FIQA 4UZUA 3R43A 4YCPA 4HNUA 4WY0F 1SFLA 4MADA 5FAJA 5EBAA 3QV7A 1JXKA 4DUVA 4QE5A 2YA1A 1D9EA 1S2WA 1XPGA 3U2ZA 4Z17A 2G4JA 3ITOA 3VIMA 1PO9A 3TROA 1I2PA 3B3DA 4ALDA 3QPYA 4W5UA 1TCMA 4IX0A 3VIFA 4L56A 2HE5A 3QHNA 1LZOA 4JTKA 1QPOA 4UTTA 1HL9A 3ITVA 3O15A 3KX6A 3BGAA 3BCFA 3VCNA 3A47A 1Q6OA 3WQFA 3UR2A 2WNWA 4GIEA 1RJQA 3M0ZA 4QFUA 1J93A 4KW2A 1W9XA 4OUEA 4XTIA 2X40A 3TDFA 3H2AA 1EC7A 3QSRA 3E9AA 2G37A 3NQ7A 1EJXC 1UCWA 3GRIA 1RUSA 2E6DA 1HG3A 3WF1A 4XBJA 3JR2A 4PC8A 3KUMA 3PM6A 2ABAA 3S42A 3REQB 3AS3A 1VEMA 1QCWA 2NXHA 1IEIA 3WK2A 3WH5A 5BOOA 4PA8A 2CU0A 5JBEA 4ZQNA 2PGRA 3ZJ6A 2ZXQA 2HE8A 2PE4A 2CLFA 4U10A 4WX2A 1JCJA 4C6PA 4PUDA 1JPKA 1F7BA 2XTKA 3DESA 2JK2A 2PDBA 4OJYA 1YW1A 1S5NA 7XIMA 4KH2A 5HNTA 3CGTA 2ZUUA 4DX3A 1R3VA 3FNDA 4O1CA 2J8FA 4WDTA 4IT1A 2E25A 2I5IA 4CVUA 3N25A 1IYXA 1W32A 2XGBA 5DQPA 2QJNA 4DJDC 5EMJA 1VFMA 1EBHA 4N9BA 3B04A 1FY6A 3B4UA 1FXPA 4ZB5A 3IJQA 1F6YA 3GWQA 2D0GA 2A7PA 1B0IA 1GKRA 4EPKA 4C1KA 3SJ3A 1H49A 1JYXA 4H1ZA 2FGBA 3BWWA 4NP7A 4Y2WA 4HA3A 3WK1A 1LWJA 4M19A 5LNVA 4O1FA 3KS6A 2FZDA 1O95A 4Y9MA 5MKGB 1D3CA 4AIUA 3KVLA 4Q4KA 4JIRA 1A4MA 2A6NA 1F6KA 1D7KA 1YTKA 2UWFA 1HL8A 3PTQA 4CQAA 1DJQA 4IPIA 1UIOA 2DORA 5RUBA 4FXJA 4JCMA 3TYEA 1SJCA 4H7ZA 3OBEA 3PVFA 3UA4A 1N8WA 2DP3A 4I7WA 4MB1A 1NOFA 3EBVA 1M7OA 1TZ7A 1JEZA 1XIEA 2C1IA 4KWSA 3T40A 5DMYA 3MHFA 4LVBA 3IJ6A 4YYFA 4LYRA 1ZTVA 3QZEA 4H9YA 4JTEA 4PN2A 2I1OA 4QITA 1JVNA 1SQ7A 3EPNA 2CLOA 4Y7EA 1K03A 4GY1A 3E6EA 3GTHA 2V8ZA 4MKVA 4MKNA 3AZTA 4GQBA 2OZ0A 2Z1WA 1S2CA 2P76A 1OADA 8XIMA 1XQLA 4O1AA 4IMGA 3E0LA 3GZ3A 3WO8A 4I5XA 3EPMA 1NP2A 2FVLA 3QLLA 3NFUA 3NZGA 1R9ZA 5FEZA 3EZ4A 3MDWA 1BTMA 3CJPA 3ITGA 1DJGA 4WIWA 3NM1A 2UBPC 4UNIA 2DW6A 3G5EA 3QBUA 1PWLA 2DUXA 3L4WA 4JQ3A 2VCAA 4ZSUA 2WSYA 4GVFA 3GG1A 1Q6CA 5E70A 4DBUA 2NVDA 4MLJA 1JUKA 4BI7A 1TV8A 1M01A 4K8EA 3AHVA 1QOQA 5D2YA 2BXVA 2ZQ0A 2CZEA 3EDFA 4LCQA 1IWAA 4HSOA 1CENA 1KXTA 3L65A 5A6MA 4WVXA 5H1WA 2QJHA 2PGEA 4XO7A 4AY7A 1GOMA 1E43A 2A3BA 1GZJA 3SFWA 2ZXDA 3PZIA 4MWAB 3ANUA 1LP6A 3TYDA 4D8ZA 1QHPA 5J5RA 3WD0A 1CT5A 5LNWA 2QUUA 2GSJA 4RJEA 4AB4A 1C93A 3HURA 3LHTA 1B54A 1C8YA 3ZMRA 3W7DA 1S39A 1KGXA 4DAIA 2OQLA 1JRCA 2R1KA 3TW6A 4OTKA 1F05A 1TE6A 1WDRA 2QCCA 4FPSA 2VX7A 4RPQA 4WGXA 3TIMA 4YVXA 3BZGA 1JCLA 1P6WA 4MTVA 5GQBA 5TIMA 4NSBA 4NXKA 3VNLA 4C1LA 2KX9A 1U83A 1DHKA 4NNCA 1VHCA 2C91A 4B9YA 4GA8A 4WJ8A 1W1ZA 5FEPA 2QAFA 1TV7A 4CCCA 5EU9A 2F38A 4YTTA 4IIGA 4Z2LA 1LLZA 5FJRA 3VINA 4UNLA 1UWQA 3LN3A 2V3DA 3CWHA 3LNMA 4CEXC 3AMGA 1UIPA 4D6HA 1PYMA 1Q6LA 3QR1A 1UH3A 1MRQA 3PSVA 4WEVX 4DPPA 4A21A 3M16A 2AKZA 3DFQA 3G1YA 3UPBA 5CPQA 3E2SA 2C15A 3F03K 3CL8A 4B5TA 3K8KA 4HA1A 4F0LA 3BZJA 1A50A 2J7FA 4MSSA 4RW3A 5LIUX 4P7NA 1XP3A 2YB1A 3JUGA 3C2VA 3WFAA 3WLOA 1E4LA 3LXCA 3P84A 4RUBA 2DZVA 5AC4A 3CZJA 4M6PA 4AWTA 3TYAA 4AZIA 3TV8A 4N7QA 3SN4A 4JTGA 5FF0A 2XVNA 2V2CA 4ZB0A 5EY5A 2VZUA 4QG9A 1VD6A 3M0XA 4UTWA 5I5RA 1VPXA 4XKYA 1BFNA 3MB9A 1GZ1A 4CN4A 1UKPA 1QTWA 5LIWX 2OCZA 3S5YA 5F4WA 2DT3A 4U3CA 5IXEA 3W73A 3GYEA 3ZWSA 2YW3A 3QY8A 5HUPA 3ZXWA 3UXKA 5ABHA 2JE8A 1W1A1 4F40A 2HEJA 3RM8A 1YDOA 1ICSA 5U4NA 2QV4A 3E0FA 3GLCA 1HW6A 1OT1A 4LVAA 3IVTA 3E0IA 1MW2A 1FUYA 1J0YA 1WO2A 2VDHA 4PFHA 4MJMA 5ECVA 3SQLA 3DGBA 1UOKA 2OU4A 3KOYA 2O9TA 4XZWA 3R6IA 3F5KA 1B3XA 1GOQA 1S1RA 3IARA 3F5JA 4R7OA 3L23A 5D8WA 1V0NA 3G1RA 4QR6A 3G6MA 4X9YA 4FO4A 2CHOA 3AI0A 3S83A 1FBAA 2HPIA 4E2OA 4HPGA 3NYDA 3FYOA 2BY0A 3TN4A 1EEPA 4HA0A 3UWUA 3QR3A 3A3HA 2H3DA 1ICQA 4R27A 3HB9A 5DMLA 2GUUA 3VNJA 3LTYA 4FA3A 3VD5A 6A3HA 3UXDA 2XVPA 5AC7A 1XKJA 4JCLA 1BQCA 4NAEA 1JZ6A 3S47A 1S5TA 2PDQA 1E56A 4ORMA 4EWND 5HMSA 3L0NA 2DZXA 4CNTA 3XISA 2CBVA 3B8UA 5IOBA 3HGRA 2X05A 1M04A 4WR3A 5A95A 2NX3A 4D9PA 1F73A 1KBJA 2DT1A 5BW6A 3IAPA 1AZ1A 1TJPA 3I7QA 2IQTA 4R33A 3MUZ1 4YJ5A 4ZQMA 1Z44A 3L66A 3BMVA 4D6FA 5B80A 3QTPA 2DZWA 1PVNA 4FNRA 4C6LA 4ACZA 4CN6A 1E6ZA 1E1FA 4JTCA 1MEIA 5D04C 1JDAA 1AK5A 1KGUA 4Q8OA 4RXGA 3TLLA 5CPOA 1FTXA 4GYPC 4UTLA 2DZTA 3POHA 4DUXA 1VGAA 4V1YA 3O16A 2HMCA 3OG2A 2IPJA 3KWXA 2DZBA 1LRQA 3QR0A 3M0HA 3SCOA 3I3EA 1A0CA 1X1NA 2H8ZA 4I5UA 2O9OA 2GUYA 4X2PA 4U31A 3CS2A 4BF9A 1EPVA 2X1TA 1V3JA 1AJ0A 4J3ZA 2P3ZA 3W75A 3VKAA 3ID7A 5AYZA 5C55A 2KZHA 2PDFA 2TAAA 1JZ4A 2Y7GA 2D2HA 3IJ7A 5E0CA 1F3EA 3ME3A 4FI4A 2P10A 1DL3A 3AIRA 2WCSA 2AMXA 3WBYA 1PDZA 3ZLHA 1CX9A 2NQLA 5GJPA 2X30A 4LYQA 3BW2A 3AICA 1IZKA 1FCQA 3EOOA 3C0LA 3MWAA 1GQIA 2OGJA 1PCWA 4JXCA 3TJXA 5CBBA 4IM4A 1EC9A 3JW7A 5A6AA 2W91A 3M0JA 4CQBA 3C86A 1IEVA 5D2WA 3DYMA 4IQLA 4N2YA 4NL1A 1RR2A 4WXYA 4Z0SA 3Q65A 3U3HA 5AYXA 4RDWA 2HV5A 3W1NA 3AHYA 1ZJIA 3W7EA 3S5NA 1Y8BA 3RPMA 5LIYX 4C6IA 1N7KA 2J47A 3E49A 4C5ZA 2QYGA 2G0WA 3H21A 4MDPA 1XYLA 3W71A 4PTMA 4L6DA 1WXZA 1KBKA 3VIOA 3R7MA 5F1VA 2BZNA 3N2TA 4LY4A 1IF2A 1RY0A 4QS5A 5CJNA 4REQA 4XZMX 3BSHA 1XBVA 4GNJA 1F8MA 4W87A 1FWAC 4IH3A 3A23A 3H7VA 3DFHA 4H6KA 3RDKA 2J75A 2CLHA 2L5HA 4ZSTA 5FJUA 4GUGA 1B3WA 1DJXA 2ONEA 3UXIA 4DO5A 3A6OA 6REQA 1JULA 3K8MA 5I3DA 2NW0A 4BWLA 3WF2A 3GFYA 3CYVA 4L4PA 5EFDA 1R38A 5AKQA 2VYOA 5D2TA 1EP2A 1TV4A 1LBMA 3UXAA 3H2NA 1YRRA 4FX7A 4B4FA 1W3LA 1PHQA 3E74A 2O9PA 4GGHA 3OO2A 4FNSA 3TN6A 2ISWA 2Q8LA 4DBSA 5KINA 1ZS2A 1V08A 3R12A 4A3RA 3NJ3A 1BYDA 3GY1A 3OJGA 1OCNA 1VEPA 4N9CA 4DWSC 4IXXA 2GGIA 2NLYA 1AW5A 5EMLA 3T81A 1H4PA 2WBGA 1SVDA 3SQSA 4Q7IA 4FOUA 1WDDA 5BU9A 2WKGA 4JR5A 4CQCA 1UQZA 4UCFA 4PMJA 4ZVJA 4DJED 4UTKA 1A5CA 3C3UA 4GYJA 4MM1A 1E72M 4MF4A 4FIQA 4HB7A 5A1AA 5E9XA 1J9YA 7ODCA 1LL4A 3U7BA 4KF1A 1TWDA 4HSNA 2WMIA 1WNOA 3RG6A 1Q63A 4W7VA 1WDWA 3ENLA 2OVLA 4HQVA 4TMCA 1T0OA 2FKPA 5DLCA 3WUBA 4ZTXA 1IE7C 3PP7A 1JG9A 3SY5A 1KFJA 3TFCA 1M3UA 2F8QA 3BAJA 3ORWA 3E2QA 4GIYA 3I65A 3RLGA 3QFWA 3T4CA 2WC3A 1ONWA 3L5MA 4HTYA 3WD4A 1FP8A 2GZXA 3KOWA 3R1ZA 3VOJA 3CIXA 3OQEA 2E0PA 3KFTA 2CKRA 1OFAA 2HS6A 4LAOA 3VGBA 5AB3A 3VX0A 1JNDA 4RV3A 3GU1A 4PUKA 4NYYA 3GC4A 5CJ5A 1G01A 5K9DA 1LJYA 3UY7A 3CZ8A 3W01A 1E4NA 1J2WA 2XN2A 5I03A 2WYSA 1A5NC 2GUBA 2ZTJA 3GVQA 3GC2A 3N13A 2H3BA 4X22A 1KQYA 4UB9A 3VDCA 3K5XA 4WXZA 4BEQA 2OX1A 1ISXA 3SRHA 1TB3A 2YYTA 3LX9A 1V7AA 1Y65A 4JN6A 1KCLA 5CGMA 2VUYA 2GJRA 4S3AA 3SSJA 3CQIA 3QYQA 3BMXA 2A7RA 4LV4A 1AMKA 4QDMA 1UASA 3BDKA 4DI8A 4FNTA 4Q3MA 3NSXA 5BMXA 3MMWA 3KTCA 1UWTA 5FJJA 4W93A 1VFUA 2V3GA 2DIJA 2PBOA 4U5IA 1ZCOA 4X0VA 4GIAA 1N55A 3FJ4A 1UBPC 4I7VA 3KAOA 2QCDA 4H9XA 3S2MA 4LAZA 1S3HA 2E09A 2ZIDA 4REQB 1JD7A 3PUGA 4F9DA 4ONVA 3NOEA 2PWHA 3MTWA 4GI8A 1M9HA 2W66A 3RNDA 4B15A 4FOJA 4B5NA 1O6IA 2G3IA 3ARUA 3TZFA 1XGZA 2ZVRA 2YYUA 1KR0A 2RDWA 4GQRA 3CWOX 4CD7A 3TEVA 1HJVA 1CXHA 1W9BM 3LRLA 4A8NA 2WMJA 4JQ4A 3RUBL 3A4JA 2E6YA 1UH4A 2VC6A 2E67A 2JIEA 2HQAA 3F2DA 3ZFHA 4JTFA 3FW6A 3R89A 4XBSA 1YADA 2QVHA 3LGDA 4JFUA 4UFJA 3HQOA 3CLMA 4PMRA 3TP4A 2HISA 2WZIA 4QG6A 4N0RA 2PDWA 3V3WA 4XG1A 2Y8UA 4AZ7A 3QEZA 3A64A 1D2KA 3CV6A 1SJAA 3ALFA 3OOQA 5CPTA 5FJPA 5JXQA 4GY0A 4IG2B 2BX7A 5EMUA 3O6YX 3WENA 3RITA 4ZQOA 2QPXA 1EO5A 1VBUA 1YX1A 3PB2A 3BAXA 2D2JA 3B9OA 1UWSA 3AUJA 1WCGA 2BFGA 2IQ0A 1A5OC 3ZLGA 3EMCA 2PTZA 3TOYA 3C2RA 4XZIA 4Y9PA 1NJJA 1JIBA 2RDUA 2NQJA 4PEEA 3S1UA 3M5YA 4B3KA 3UFYA 2QDEA 3CHDA 4M1BA 2VZVA 3JRKA 1IT7A 1NOUA 4X9SA 2PP3A 4MB5A 4JFWA 3VYLA 3UWQA 3S9IA 2VC7A 4LNYA 2EEXA 2PDIA 3M47A 1JUBA 5DRIA 2V5BA 2X41A 4Y8FA 2VOTA 3VI2A 1FHVA 3N2BA 4QNEA 4MY1A 5AC8A 5E1QA 2WHJA 2D20A 4RZ6A 3W1UA 1RBOB 1UMYA 1KFWA 2XG9A 1IXQA 1B31A 2G4FA 3AMDA 1P6CA 2RDTA 2F2HA 3HPFA 4WZHA 1J5SA 4NG3A 1LBLA 8XIAA 4TX8A 4DJDA 4F0KA 2VP8A 6XIMA 1I1XA 1R2SA 2D0FA 1Z42A 1WB0A 4FX6M 4I7UA 2XZ9A 3CQHA 5XIMA 2VKZG 1IIGA 3NCOA 1PIIA 2V67A 1AD4A 2BBFA 5C8BB 3OB8A 1UD2A 4PTNA 1TELA 4ECLA 2CHRA 1PKMA 4CD4A 4M51A 1GWJA 2V81A 4AH7A 1MRAA 1W3JA 3QQWA 4WGHA 1C9DA 4MVAA 1QHZA 1TCDA 4J7RA 1OZMA 2XWEA 4QAWA 2ACSA 3FGCA 4U2ZA 4GHRA 3NO3A 2VXNA 3NAVA 2HXUA 3I7SA 1KO0A 1CGXA 1XHGA 3VMOA 1P1MA 4O17A 4HPNA 3M43A 2DZPA 1N8FA 1QASA 1Z9AA 2NVAA 4EIVA 4TIMA 2ZZ4A 3FEMA 3TTQA 5FF7A 2CXGA 2IMRA 2GVGA 1DIKA 4LUSB 3CZGA 4QSHA 4O0QA 1FDJA 3RPDA 4EP8C 3N3MA 4U28A 4L4OA 1MXDA 4Q4MA 4O28A 5BROA 3OLGA 2J77A 2O0TA 4LUIA 3SZ8A 1MVYA 2OG9A 4O57A 2WWDA 3V1HA 3OLIA 4I9AA 4OOZA 3GHRA 3NL6A 3AZRA 2VCBA 4TR9A 4IHCA 3D3AA 4PTDA 4Q4RA 4A3UA 3W4RA 4MWAE 2BHYA 5K4ZA 3BLDA 3CUFA 1XGEA 2YBTA 3PBGA 4DO6A 6XIAA 5LHEA 3BAYA 3I7RA 3ANYA 3M5XA 2ISFA 4C7DA 5DY3A 4IGSA 5M5DA 5GNXA 3TR2A 3FHQA 3G1HA 2J9YA 5CSUA 3PBMA 3SRKA 3ZS4A 2UY4A 1G7UA 1DWHM 4LVFA 3IK4A 2I57A 3LTPA 4ERIA 1OZQA 2J9ZA 2VRKA 4HGXA 2YL5A 4MG4A 4AVOA 4ZZ9A 5CPSA 1AJ2A 2E1WA 2YCEA 2PDJA 1P0BA 2ZUSA 1I45A 4JTTA 3APTA 2QIIA 4LUTB 1UKQA 1C90A 1AW2A 3IJ9A 1G7VA 3IRSA 1HKJA 3V5OA 4DXKA 3CC1A 3WQVA 2AGKA 4W85A 3PZVA 3TE9A 3G18A 3YPIA 1CI1A 3VGGA 4IMAA 1LOSA 6ALDA 2OSWA 4CD5A 4GO9A 2V5JA 3UG4A 2E4TA 2WHKA 4JKMA 3BQ5A 4I6VA 2CLMA 1KGWA 3FIGA 5CH9A 2CZ5A 5BMWA 1QWKA 1HKMA 5FKYA 4MUZA 2P3EA 5ECUA 2OX4A 1C9WA 1XM3A 4S3EA 2OB3A 4GISA 3QRHA 4UR9A 2CZVA 4O1EA 3V35A 5FJIA 2O55A 5D2XA 3PWIA 1AUSL 2PF0A 4PBGA 1E15A 5HULA 3QZ6A 1RBLA 4KRTA 1ECEA 3INPA 4MNMA 1QAPA 4F79A 4WSJA 4Y8EA 1XD0A 2ZE3A 4F4RA 3IGHX 3FJLA 2C16A 4UC5A 3WLSA 1FFRA 1E5JA 5LXEA 3GR4A 4M82A 3QZAA 3G8EA 1QPQA 5C2GA 3NQEA 1GGOA 4X3ZA 1F9CA 3NG3A 4LY8A 4C7GA 1KXQA 3H26A 3MW7A 3W82A 3L5LA 5FA5A 5ABFA 1EUNA 3W84A 5G4HC 4K37A 3CV1A 3O1NA 1XGDA 2QZRA 2YA2A 4EXQA 4M7TA 1XQKA 2WCGA 2OYMA 1XIMA 2WVSA 1WYIA 3PAJA 2MUCA 1BPLB 2W79A 5A6SA 2Z0IA 2FVMA 5DXXA 3F4WA 4JYEA 3HJZA 3VC5A 1VZWA 2B4GA 2OEMA 1J12A 3SW6A 4LC8A 1FCBA 1P0DA 3GDTA 1DORA 3B8VA 1BLIA 4L61A 5C9XA 5DFAA 5F4SA 1GVSA 4JTUA 3F5LA 3BLPX 2PU1A 1UWIA 1G4SA 3W3OA 1FRBA 1YNQA 3H2OA 4LS0A 5EMMA 4X61A 3VGEA 2V2HA 1ZNNA 2POTA 2GJLA 1JNEA 4HVXA 2VR4A 1RD5A 1YHTA 1A3WA 1JAKA 2PAJA 4EVZA 3IJ8A 1R3WA 4JZ5A 2A5HA 1H41A 3WEOA 4H8VA 3QKZA 5AECA 3PJUA 4HA4A 1TZ9A 4ML9A 2XM1A 5HNNA 1VIWA 1HNYA 3NO5A 3ONBA 1J0JA 3MJMA 4KERA 2GPTA 3KZPA 1L6WA 4K36A 2ZA1A 1FHDA 3SUWA 1EGMA 1HX0A 1FWNA 3S2LA 3VKKA 3S2JA 3APYA 2QULA 4PTWA 5D33A 3KWSA 1FKXA 5TQLA 3PZMA 3UWVA 1NIUA 2I7GA 1JCNA 3CM4A 3SUTA 2A0NA 2ZWYA 4XZNX 3S3GA 4IMEA 1BYCA 1GG0A 4RE2A 4AD4A 2H9AA 1F8IA 3PZGA 3WEMA 4DWSD 3AMLA 4JD4A 1WDQA 4LPCA 5FAGA 1ISWA 2VOMA 1L2QA 3GK0A 4TUFA 5A2AA 3PTKA 5FI8A 3U6WA 4UFKA 1VFOA 1LROA 1TWSA 1FOBA 1UP3A 1SGJA 3N3TA 1KNWA 3V0TA 1W1B1 4G9PA 1R85A 1SO6A 3C0JA 4PCPA 2ZZ7A 4BS0A 2ZA2A 4JTRA 1U1UA 4L1XA 2CBUA 2O7SA 2ZTKA 5BRQA 3S6OA 6TAAA 4ROPA 2F84A 2CLKA 2B31A 2OLAA 5HJYA 4QEHA 3QQ1A 1V6XA 4F0HA 3PZNA 2D73A 4XQ6A 2VTFA 4Q8NA 1AJZA 1MUCA 2QUMA 3BQ6A 2PU0A 4DVOA 1XCWA 3VZYA 3DKLA 4PBFA 1R0MA 4LYPA 5KZDA 1WE5A 1FDZA 4QCEA 2E6FA 3ISIX 2YLLA 1VAHA 4FNUA 3KRSA 4GYPA 3N15A 4KWOA 4QBXA 1KQZA 4E2VA 1PYFA 1ME7A 1W3TA 5CBIA 1OD0A 4WKHA 1A47A 1UZDA 3RK8A 2INZA 1K4GA 2BDQA 3C8FA 3DC0A 1FHLA 1VEOA 3QSTA 1JXJA 3WLKX 3W2UA 1XKYA 1F4AA 4S2BA 4ILSA 3CYJA 3TZNA 3OZMA 4HCLA 5LSMA 2IKHA 4DLMA 3C2YA 3LG3A 3IAQA 4JTSA 4EXAA 4Z2HA 1QNSA 3OGSA 3W2MA 4PSRA 4GMEA 1NWRA 1LORA 4S3JA 4Y6GA 1VBGA 3SM0A 1OBAA 4Y96A 2C3ZA 4U4MA 3MKKA 3W83A 4CEUC 3LLFA 3H4WA 2VX5A 1OC5A 2VELA 5CPMA 1XX1A 4AZHA 5E6YA 1UA3A 3KBMA 1ESWA 5MHBA 4MZ1A 1QO5A 2JQXA 3W2LA 4HNCA 3WD3A 5TAOA 4A8LA 4LANA 1R3QA 1QK0A 3CZEA 1HL2A 1HXJA 1RZMA 2YIHA 3WNKA 3EPOA 1XYMA 5EMYA 1TVLA 3DGRA 5LKYA 1PTAA 2AGTA 4GZJA 3LZ3A 3ONCA 4ZE4A 4GJIA 4RX0A 1BTCA 3PBYA 2VZOA 2P0OA 2G96A 3LPPA 4M81A 1TPC1 3QYSA 3MANA 3NTYA 3QJAA 5AFDA 5KZ6A 4GUJA 5C0QA 1W1IE 4HNLA 1EO7A 5A6LA 1VFSA 4BCEA 3E2RA 3FEQA 6PTDA 1GW9A 5DANA 4DYKA 3M5VA 1AODA 2XFWA 4AQLA 1JCYA 1UUOA 4FF7A 5H6HA 1EGZA 1F3XA 1UB3A 3CU2A 3VU2A 3CB8A 1YBQA 4W7UA 5ABTA 2GVYA 2QMKA 5HMFA 3H24A 5M2FX 4IIEA 2V5KA 1K3UA 3GVVA 1M1BA 3QXBA 3P62A 4F66A 1YDVA 4H41A 4NX0A 1LQAA 2XHYA 3MP5A 1BVZA 3RLVA 3LHUA 3AIUA 1F07A 1NF7A 1CGUA 3WJWA 3SGUA 4GQ0A 1JFHA 3URAA 3WLIA 3IV3A 2QPUA 3GVGA 3E02A 2CLEA 2CW6A 3VCRA 3MU7A 3NZQA 2H9AB 2FGLA 3BSMA 2VT0A 3HMCA 1E71M 3LA4A 1NFGA 1XLDA 1MNSA 3DAQA 4DWSA 1OFEA 3VM5A 2XIOA 2DJLA 5E6ZA 4XZ9A 1DQUA 4S39A 3DFOA 5HWMA 3EWYA 1XPYA 1QNOA 5HNRA 1V02E 1P6BA 3GBDA 3AWOA 2PDMA 3K4WA 1PDYA 1SPQA 3VNMA 3H22A 2Q71A 1PEZA 1OEPA 4TV6A 2WSPA 3FXGA 3O6AA 3IIXA 3NA8A 3PWAA 1PWMA 4J3SA 3QV6A 3V16A 3W00A 3N9KA 4JS3A 4LFYA 4WSKA 2O4MA 4C6FA 1GONA 3S2NA 4AZCA 2I56A 3LS9A 1RLCL 3ZOAA 1KLYA 4AC1X 3ABXA 3W7KA 2BV9A 1E4MM 2YX0A 3CUZA 1ZBVA 2BOFX 1FWRA 3B0YA 1ADDA 5I3GA 3L0KA 1PL9A 1TSIA 4ZENA 3K30A 2GSEA 3KHDA 4M29A 5T91A 3W7RA 3EWCA 2BY1A 3RX3A 4EOUA 1E3ZA 1WOAA 4AD0A 4C6NA 4UQCA 3KW3A 3WQGA 2ZXAA 3A4WA 1VHNA 5AHMA 1D8WA 1QO2A 3L68A 4UFHA 4WDXA 4LU0A 4MY9A 1EJSC 1KV8A 4C1NB 4GXMA 1TV2A 1ZENA 1TQXA 2QF8A 4Q7BA 3QC0A 5D4YA 5JMUA 1H5YA 3A21A 2VMFA 1R46A 2R1PA 1E6NA 3VUPA 3IWPA 3COTA 2VUNA 4JQAA 2X1IA 4C60A 1CLXA 4RR4A 3ABSA 1XLIA 3Q67A 5KZMA 3M1ZA 2XSBA 2J9XA 3A9IA 3QMTA 1X6NA 1ADOA 3HFYA 1U1JA 2PC8A 4O12A 5CJMA 1UC5A 1IEQA 3G1SA 1IXOA 4NZ5A 4FB7A 4BI5A 4GCXA 4E4UA 3W29A 3HPXA 3TXZA 3VGFA 1TR1A 4JDYA 1MO0A 4BKNA 3DUGA 1HN1A 4HMDA 2GK1A 4ADUA 4ZODA 2HNHA 1E3XA 5G4EA 1L6SA 1EA0A 3LPGA 4HIBA 4L7ZA 5CAKA 2Z1SA 1L6FA 1TIWA 2D2OA 2WLYA 1TKKA 3LM3A 3AS2A 1TA3B 5HQMA 4XSLA 4AY8A 4ZQRA 3KVMA 1ODUA 4S3GA 4D1JA 2QUVA 1GHSA 3QGVA 3TQVA 4JEQA 1WQ5A 1VCVA 1R9YA 5A69A 3RR1A 1X1OA 3W81A 4QCFA 1Q6FA 3CAKA 1GKPA 2E6AA 4AW7A 1E0XA 3MZNA 4EF8A 2UZ9A 2VEGA 3H4GA 4I9TA 1V8EA 2DSUA 2VFIA 3L0GA 3UR5A 2G3FA 3L12A 1SZGA 1ITUA 2BODX 1MEWA 1OF8A 2XFYA 1MI3A 3ALGA 4IJRA 2IPWA 2OT1A 3MS8A 3VCCA 4JIPA 3RPTA 1RQHA 3DOPA 3WELA 1AH0A 1AVAA 1AQHA 4M1RA 5BRBA 3BVJA 3DERA 4JX5A 1TR9A 2OOGA 3Q58A 3GIQA 2Y0FA 4J3UA 4HOXA 3AS1A 5A8QA 4ZXOA 3LPFA 3NVDA 3PPHA 5HOSA 1WZLA 1JPDX 2QCFA 2V5LA 2HRWA 2HWGA 1Q6DA 4PUWA 3WQPA 4H19A 1R3SA 4J2MA 2H90A 4DIAA 3MV01 1FWSA 3U7VA 5XINA 5CZTA 3NDYA 3UU0A 3A24A 4WY0A 1S3TC 2V3FA 2Q01A 4IZGA 3M6DA 1C8VA 2YPIA 2VEIA 3LNPA 3LTSA 1HFBA 3LMZA 3LXAA 3GR8A 4R85A 4AFYA 4IPLA 4G8TA 1Q8AA 1JZ7A 3RGTA 3SSZA 5BXSA 3FN9A 4LEQA 1L9WA 1VJZA 4QIUA 3IPWA 2VHLA 2PMQA 2YXGA 4E3VA 1JZ2A 4GYFA 5M03A 1Q6GA 3LV5A 3A3WA 3GC5A 4DO4A 2C13A 3AXKA 4FEZA 4HK6A 4B90A 4O0ZA 2NZLA 3SAZA 4NUWA 2QKFA 2AAAA 1W8SA 4QLKA 3PZOA 4B3ZA 1RAKA 1LYXA 1GOOA 5D38A 1OIFA 3S9YA 2B81A 3QKEA 4O18A 2R8WA 4E38A 2I5QA 3SBFA 4F48A 1IGWA 5T26A 3AYVA 3USZA 3GX9A 4P7LA 5BYWA 4W7WA 2PDXA 1WZMA 4DNMA 4XWUA 1P7TA 3B9EA 4D6DA 1BSLA 3EDDA 1KRAC 4G6CA 1F3WA 4B9ZA 4IP7A 2OYKA 2BGSA 4K3ZA 2PCQA 4KEUA 3E0VA 4HSHA 4HD5A 2WHLA 3W22A 2WZTA 4R7WA 1WAUA 4NASA 1NVMA 1XG4A 4PCTA 4IMDA 3DCPA 1JCMP 3M7SA 2OZ3A 2BVDA 1XLAA 3F4NA 4NYUA 4M6QA 4OQVA 1WKFA 3OZPA 4GD0A 2CEQA 1TPUA 4PGLA 2Y7FA 4MZ8A 1LDCA 4X63A 1FCUA 4H8UA 2GJPA 3N6HA 3NR0A 3DHUA 3JZEA 2NQ5A 1Y5VA 3GO2A 3LSBA 5CXPA 1CGTA 4A8IA 4RNFA 3N9RA 5C7HA 4K1GA 4HU0A 2FTYA 5CC5A 3WNPA 1VF8A 3NXLA 8TIMA 1Q45A 1SR0A 4YPJA 1Q6EA 2PEVA 2FPTA 5C71A 3RLHA 1WKDA 4J35A 4R9OA 4QRNA 4BZYA 1JQVA 4R7JA 1EZWA 3P3BA 3SDOA 2XINA 1T5AA 3NDOA 3SQMA 5AZ0A 5K3VA 4G7FA 5CLTA 4WOZA 2J27A 2DT0A 1R2RA 4BHYA 3VM7A 1QHOA 3DFSA 4WF7A 2J78A 3CUHA 4CN1A 1BXCA 1DPMA 4KKXA 4KCWA 2BOGX 3AXHA 4G7EA 3NDZA 2QEZA 4PMDA 3NSMA 2QJGA 3CLWA 1WDSA 3ARQA 3AYTA 3ITLA 3FX4A 3TNBA 1K77A 1PE1A 1V79A 4HNTA 1NEYA 2HVMA 3LCFA 4J28A 1RJRA 1XYBA 4MPQA 2V3EA 1D8CA 3KBVA 3O2LA 1TTIA 1J6PA 3USBA 1PKNA 3LDVA 2HXTA 4M8UA 4DPQA 4HYWA 3MI2A 4Z08A 4NNBA 2POZA 1RA0A 2TRSA 3GTXA 3ATZA 4G1KA 3ZLFA 3WJSA 1TREA 2VDGA 3UQNA 1WUFA 1XLKA 3FHAA 1Z69A 1NP0A 2FFIA 1I60A 2C71A 1V3MA 3BSGA 2DSVA 3VOCA 3L4TA 2D3NA 3I6RA 2QJMA 4IJBA 4FS9A 4WY0B 2ODOA 1KBBA 3CUXA 3THQA 1LBFA 2ZDRA 4S38A 5A3HA 3OVGA 2YL8A 1E0WA 1ME9A 5TD4A 1IQ8A 3V36A 2YGYA 1Z6KA 3GE7A 3D6NA 3ZSSA 4H9ZA 2DGAA 4IL2A 4HYRA 3L2LA 4DY1A 2R1NA 2DIEA 5CSSA 2WJFA 3BCDA 1H62A 3UERA 4ICCX 3CZLA 1YXCA 1GPWA 3QY6A 4NZFA 1C8XA 3C2FA 4XAFA 4J5NA 1XICA 2QCGA 1HKKA 4HU4A 4YTRA 4DQWA 4CU8A 2XM2A 3FSTA 3OVQA 3BE7A 1W3KA 1GVQA 4ADTA 3EKLA 3RMJA 5C9WA 3C0QA 2QAPA 4HP5A 1UD8A 3B9NA 3SIMA 5G2WA 1MQQA 1F4HA 4A6GA 4XVDA 1QNVA 4XKMA 1P1XA 3T8QA 3BC9A 1JYNA 4LJ3A 3P61A 2Y6ZA 4UOZA 5BZAA 5AZ1A 2REQB 2PLCA 4H3DA 4O52A 3A22A 1F2JA 2ZUWA 1XYFA 3PNUA 1Y0EA 4M56A 1Q6QA 1IXPA 1XINA 3GXPA 2ZBTA 2FZBA 3HO8A 3OODA 2YFOA 2RGLA 4PULA 2W4XA 1KWGA 1I6NA 2ESCA 1W17A 4OGZA 4Q4OA 4Q8UA 4IX2A 5CPLA 1DJYA 1IZCA 2YL9A 2GQAA 3GKFA 1IWBA 2WNQA 1QI5A 4OFCA 1KRCC 3C61A 1B2YA 4AZGA 1PB0A 3WMLA 3AALA 2ZX6A 3O6DA 3THCA 3U2CA 1ITXA 3W53A 4AIOA 3NGFA 4GPNA 2R14A 2IQDA 4Q6JA 2ISVA 3L4XA 4JHZA 3TTEA 1UD4A 3WJXA 2Z29A 3PANA 2PDLA 3KCOA 2WZMA 1K02A 4UR8A 5J5DA 2ZUVA 4IF2A 4RKAA 2YXOA 1OCJA 3K1DA 3EOUA 4GXPA 3VIGA 3TX9A 4B16A 1SUXA 2OWXA 3CPGA 2ZRZA 4AHPA 4ERAA 3P14A 1H63A 1H11A 4Q8PA 3BLLA 4JTIA 1YXDA 3EX6A 3B0VC 5HBFA 1LWHA 4XAZA 4AIBA 3EEZA 2E7FA 2GJXB 2J74A 2VVNA 4M24A 1A5MC 1RPKA 5BXTA 2NSXA 3LLXA 3GW0A 4LQ1A 3VC6A 4QISA 1S5WA 4O14A 4QJ3B 1IWPA 1L2UA 5IDIA 3EDEA 3CV7A 4EF9A 4D8LA 1V0KA 3CH9A 5A2CA 4LX4A 3PPGA 3PUEA 3W24A 3O7UA 3BLKA 1HJQA 3FKRA 1KWKA 3WN6A 5KEZA 3WNLA 4LNCA 1TJ0A 4BQ2A 3AU2A 1GHRA 1R6WA 2OXNA 1S2UA 1ZJAA 2FTPA 2IW0A 4GY7A 3TJLA 3O8AA 2RKXA 4KRUA 3UNDA 1SO3A 1M53A 3EWZA 1ZAJA 1LF1A 2CC0A 4AG0A 3WQWA 3ITTA 2BHZA 2J7BA 3G1XA 3A5VA 2Z1VA 4ATWA 2YCLA 3QGAC 4LXFA 1TUXA 9CGTA 1FA2A 1R30A 4IQJA 1L0PA 2SFPA 3QFEA 3LHVA 4KWUA 4DF2A 1O68A 3VA8A 1F61A 1W3IA 3EAUA 4BR1A 3RILA 1H5VA 4JX6A 4N02A 5EBUA 3F4DA 3AAMA 4PE8A 4TV5A 2NWRA 2WK2A 4HMNA 1V0MA 4L1WA 1OFOA 3H12A 4UFIA 3K1GA 1UP2A 4GACA 3UJRA 1DWGM 3W85A 1H2JA 4P5UA 1X39A 1Q85A 3II1A 1LUCB 3M7WA 3CHEA 4YHGA 1LL7A 1RVKA 3DC8A 3T9PA 5LNSA 3WUFA 4Z42C 2GFTA 3L9CA 2FZ8A 1T96A 2QQ6A 1HJUA 4NI3A 3WBXA 2F7FA 3GD6A 2HNEA 2IPGA 3FY1A 4CNUA 1DXFA 4LH8A 1UR1A 2A4AA 2J6XA 4J27A 4OBRA 3LI1A 2ZE0A 4IP5A 3UD6A 1JL8A 2CHNA 3P0WA 3DFNA 3BG9A 4P8XA 1FX6A 1OF6A 4NI8A 1NM9A 2ZZ5A 3GTFA 4JFVA 3GKAA 1E6RA 2WZEA 1TYGA 4MB4A 1TRIA 2J25A 1VYRA 1XLMA 3U0HA 2VX4A 3I6EA 1VPQA 1ZBKA 2OWCA 2CZFA 1JGIA 2V30A 1HKVA 2V0TA 3G2GA 1XV8A 4PMXA 5CAHA 3W7CA 4H8HA 3T4WA 3WLLA 3NQ8A 4O19A 4AIEA 4B2DD 1NFPA 1OHLA 2PWDA 1EJ7L 1OX4A 4GVGA 3KBNA 3QVQA 5K4XA 3G0SA 5BU6A 1A5KC 2Y5JA 1N82A 1GVEA 3BLFA 4UQAA 4E6MA 3L4VA 1UOZA 3N29A 1QBBA 3KRUA 4LUYA 3MC5A 3VOIA 2A85A 3WQ6A 1GVFA 4PBEA 5REQA 4AXKA 2EBNA 5FF4A 4W86A 5ABGA 3TMQA 1L8NA 2JKPA 3GS6A 3MVTA 2EKGA 1UG6A 3LCGA 4ZQPA 3P74A 1XC6A 3TYCA 2YCKX 1H0GA 4B5SA 4LYKA 3TSBA 1NDZA 2GQ9A 3M9YA 3WNOA 5GJNA 3I4EA 4DJEC 2YFNA 2V5DA 2HJPA 4FXSA 4FF5A 1J6OA 4K2SA 1I0DA 4UMCA 4UFLA 4S2CA 3MA8A 1J5TA 2FGZA 2YJQA 5FSEC 1IIHA 2A3CA 4Z2KA 2WANA 1SZRA 4QHRA 2WQPA 5CGQA 5BXRA 1RA5A 4GI6A 4E0CA 3ARYA 3RIKA 4DBEA 2WJEA 1JJKA 1SW3A 2GOUA 4FX8A 1R3RA 1FWHC 1QNPA 1I0BA 4AUBA 3R4IA 1RQEA 1BKHA 4MWAC 5E09A 1RSCA 3W72A 2J88A 3L7RA 1IGSA 4W8AA 1J01A 2DU2A 4S3DA 3HPAA 3BOFA 4Y9AA 3ARWA 2VEMA 4YLWA 5A6BA 2PUZA 2Z7KA 3CQJA 3TCEA 1R3TA 5D05A 3LBCA 4U2YA 2XH0A 5LA1A 2Z28A 7REQA 2GLKA 3G1VA 1SM9A 4V33A 3S46A 4ZB2A 1CB2A 4Y9NA 4LS2A 3KP1A 4J4KA 4I9JA 3WH9A 3TR9A 4NQ1A 5H8UA 3QW3A 1NWSA 1TPDA 4GBUA 4MAZA 2XH7A 1BWKA 4G5DA 2Z7GA 4CCEA 2GGJA 1YIXA 4GYKA 1XRSA 2VI0A 4DBDA 3CQ0A 5TF0A 3M0YA 2W5FA 3OEXA 4D72A 1DWJM 1H7PA 2E8ZA 5I3IA 3BMWA 3UF9A 1G67A 2V5CA 3GHUA 3KM8A 1G4EA 2R94A 5LIKX 4HNVA 3U2OA 1TPB1 1CYGA 3V0SA 3LMYA 4RCXA 2Z1BA 4F2BA 4PZVA 5CLWA 1UZ1A 3P60A 4RNIA 3BTNA 2HTMA 4L80A 2PDCA 3PB0A 1QOXA 1AMYA 1X8FA 3RX2A 2GYIA 3TMLA 2NT1A 4AVNA 1ZZMA 3PS7A 4LRTA 3AU6A 1TV3A 5FEWA 1RK6A 4HU8A 1IT8A 3MMTA 4KS0A 2BY2A 4UQ9A 3B0UX 3XINA 3OW1A 3N6JA 1SYTA 2EPLX 5I78A 1HUVA 4KRZA 2VL4A 4FLQA 4LAMA 4QX4A 3MYPA 1YLVA 3RO8A 5LNUA 3HQPA 2DZAA 3OA3A 1Z8AA 4UOQA 1JPMA 1TQJA 3KCLA 4DF1A 2BASA 3CUGA 4FNQA 2Y85A 2VGBA 2WZHA 3CHCA 3UYIA 5DRCA 3HGJA 1BQGA 4KCVA 4WK9A 3I6TA 2DW7A 2C1GA 1PKYA 3BG5A 1CEOA 2P8BA 3GXTA 1YEYA 1UWAA 1TMQA 5E5CA 2C18A 1E73M 2P50A 1OX4B 4A35A 1DJWA 3WMBA 1EBGA 1Z3NA 4YHEA 3PBUA 5A8NA 3IACA 2CLPA 1SSGA 4X0NA 5FL1A 4O0KA 2VQUA 3ZR5A 4A4AA 3FK4A 2YDAA 3HTWA 2XISA 2CXEA 3NSNA 1XFCA 1P0KA 1QNQA 3L67A 1X6LA 5F2GA 3D5HA 1ZUAX 2J13A 3GQYA 1J96A 4IICA 1VQTA 1VCFA 3GB6A 3PZQA 1BVNP 3ABZA 1TUFA 4KETA 5DXYA 1HJSA 3FDKA 4FZIA 3GXFA 1MDRA 1ISVA 4XD3A 1NOWA 1OFRA 3MQTA 5I3KA 1XBZA 1LG1A 1KD0A 4RW5A 4QE1A 2YLAA 3E38A 4YS1A 3W25A 4HJFA 5M1TA 3TWAA 3IUIA 2ZICA 4PB5A 1O7AA 1TV5A 3B06A 5DCDA 2QUTA 4ZOBA 2CETA 1PCKA 3F1QA 3WZ0E 4GZEA 1TPH1 1R5YA 1KA9F 4DWDA 2W0UA 2JALA 4L9ZA 1J0HA 3P7YA 2FTWA 5CPNA 1PZ3A 3UWWA 5BOFA 4Q8MA 1UUMA 5AVNA 1D3HA 1LWIA 1K7XA 1H1YA 4FLSA 1DJZA 3T2OA 3B9DA 1S38A 1BG9A 4MZYA 3ICJA 3VIJA 3WG6A 4V2XA 2GGGA 3W1AA 3WH7A 1MQRA 1G9HA 4G2DA 2BVTA 1B3YA 2E28A 4H8NA 1V0LA 3CB3A 3IGSA 3QF0A 2I17A 5FL0A 4UBPC 3ZJ8A 3AC0A 3M41A 2J8TA 1ALDA 4LOCA 4UMBA 4MYAA 1EDQA 1SJDA 3GAYA 3C2OA 3E0WA 3CEUA 5H91A 4JGDA 2QDGA 4B5WA 3AS0A 3S1VA 4DB7A 1DIOA 4ZE5A 4HHMA 5I02A 4JIHA 2G95A 4TX9A 3LYEA 4KFNA 3TC3A 4Z2GA 4GO8A 3B0PA 3VNZA 3CXOA 1IXNA 3R8HA 3TWBA 1C7TA 5LA2A 1V6WA 1GJPA 4JIEA 1MEHA 1E1EA 4BEUA 5DBTA 1J79A 1K6AA 1MWOA 2EPOA 3MCNA 4ERGA 4Y9OA 1XLCA 1E6QM 4AVFA 1G69A 2GQ3A 2PDHA 4AD3A 4DUOA 1TVNA 3M0LA 3HQNA 1XDJA 2QCEA 2NUXA 4GIRA 3GU9A 3O06A 2G3JA 1C92A 4U5KA 2WVTA 4EWJA 4L9XA 1W9PA 2W92A 4XD5A 3MUIA 1QI0A 4GJJA 2Y2WA 1NU5A 4FLRA 3EB3A 4UCGA 1KC7A 4KQNA 4GJ1A 3PWGA 2BTMA 2QR6A 3OVRA 5I79A 3WQEA 2FZ9A 1PHWA 1TPEA 2XJ7A 5EKYA 4JICA 3W7JA 1ISZA 4XZBA 4NILA 3TTSA 1BWLA 1JI1A 5LYRA 4I8DA 3GDBA 4JY9A 1UPPA 2DSKA 4J2PA 4E8GA 2WVVA 2DV0A 5HMEA 4DF0A 3B8SA 3HG2A 1V51A 3NQMA 3EX1A 4CUCA 4U3AA 1XJBA 1OC6A 1U22A 4RPPA 3SUVA 4C90A 3MZ2A 5C9ZA 2XU2A 5FEXA 3BL3A 3SY1A 2PLKA 2EGZA 2W63A 5C9RA 1FCVA 3N17A 2W3ZA 3FFSA 1EFZA 3FA5A 3PBVA 4L6HA 1UKTA 2V68A 3EYPA 2AQVA 1EDTA 3K4AA 3WNNA 2V69A 3CNYA 2GVJA 3CO8A 2BLEA 4H2CA 2CYGA 1ZAIA 4J9JA 3E12A 1EL3A 3NVTA 1QT1A 3NOYA 3FA4A 3OU8A 5DMNA 1N8IA 1PIGA 4AD2A 3OZYA 5TNVA 3GNNA 5CG7A 4QGCA 4TOQA 1Y7VA 3HU7A 4WOQA 4UTJA 4US5D 4GXWA 4LBSA 2UY5A 3OBAA 4D2JA 3WLRA 1V6VA 4CNPA 3LBOA