3QCPA

Qsox from trypanosoma brucei
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
417
structure length
410
Chain Sequence
PRPGLFHLDSSVVDLSGDDFSRVHRVAPLCPWIVLFYNDGCGACRRYASTFSKFAGGLKVEHGKDALQIATAAAVNCASEVDLCRKYDINFVPRLFFFYPRDSCRSNEECGTSSLEHVAFENSHLEVDELESEVRRLVNKHMVVDDSLKERCIDMHFKLYTSKEELVKRSVRFVETTELYATDIAGAFFSAMHYDVSLVGTEPRERLTALEDFVLLVKDSLPSIGADGVVSALESITAERPFTVASWQDAVVKSGIPFDGSPRNVRWRTCRGSSPQYRGFPCGMWLLLHALTVNTPADRNVLEVIQNYIRYFFSCKECRDHFIQFNFSPNEDPVLQLWRAHNNVNARLANVKDGADPLVPKRQFPTLEACTECYDGAGNFIEAHVTGFLKQRYLWDPKAVGLMESNDDLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords QSOX from Trypanosoma brucei (TbQSOX)
publication title The dynamic disulphide relay of quiescin sulphydryl oxidase.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
total genus 122
structure length 410
sequence length 417
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2011-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3qcpA01
4N10A 2HYXA 2WCIA 2FLSA 1EWXA 1JLWA 1SYXA 1GNWA 2AAWA 1FB6A 3LXTA 5IMVA 2PBJA 2H66A 1K0DA 1N8JA 4NXIA 1SYRA 5JCWA 3KH7A 1PX6A 1J08A 3VK9A 5DQSA 5F8BA 2YJHA 3ME8A 1PKZA 2PWJA 4L5OA 4ZBAA 3F4TA 3APQA 4I6XA 4EUYA 4ZXGA 1TK5B 5CRDA 5E4WA 3KCMA 2FUG2 2H0IA 5C04A 4KH7A 5GSSA 2B5XA 2HZFA 4ISDA 1UN2A 2FHEA 3A2WA 4MK3A 2LJAA 2OJLA 3LG6A 1A8YA 3LWAA 2OADA 3NIVA 4IGJA 3HJPA 4I5QA 4KW6A 1AC1A 2NPBA 1GRXA 1XOAA 3GIXA 3CSHA 3CYNA 3KP9A 3GUSA 2OKAA 1SJ6A 2DLXA 4IHUA 1EZKA 4AGSA 2CV4A 3GL5A 3ERFA 3LXZA 3FRCA 1OYJA 3DVWA 5ECKB 2RIIA 4OO5A 5D8IA 2YNXA 4MPGA 3H8QA 2HFDA 4LLRA 1JHBA 2M72A 4TN8A 2H76A 4F0CA 3UAPA 3ZFLA 5HR3A 1WWJA 4L8EA 2LV3A 3IOSA 5A5KA 1AW9A 4F9ZA 2CVKA 2YV7A 1VRSD 3TKQA 3DXBA 1W4VA 2NDOA 1TK0B 2GT5A 1I5GA 2MBTA 2IIYA 4ECBA 1GSEA 4KE3A 2H70A 2IMKA 2H73A 2MMNA 6GSSA 1AIUA 3LORA 1NHYA 1TXXA 1PN9A 4J57E 1U3AA 1XW6A 3F63A 3UL3A 2F3MA 5DCGA 2EIOA 2IWTA 1B8XA 2H1AA 1EGRA 3HA9A 2GZPA 2JZTA 2VLUA 3Q74A 4J56E 5B6MA 3IRAA 4JR4A 2VO4A 3WD6A 4JRRA 2FGXA 1SKSB 2I81A 4K0GA 3QD9A 4XS4A 4Q5FA 22GSA 4XRDA 4WR5A 2X8CA 3EURA 4HUAA 1TRUA 2NTOA 3W6GA 4MH3A 3VWXA 2C80A 1GH2A 3TJBA 2O89A 3GTUA 1ZMAA 2L4QA 4X43A 2JSYA 2OACA 4GTUA 3DEXA 4G19A 3PR8A 5GAPD 3CRUA 3ZIVA 2P31A 2HLSA 11GSA 1LU4A 1GSFA 2HXKA 3ZYWA 4F2IA 5F0GA 3IR4A 1VF1A 4HOJA 4MJEA 4FYBA 4DVCA 4DSQA 3EE2A 3GH6A 3TJJA 4WF4A 20GSA 10GSA 5D9VA 2VCTA 3RBTA 1PD21 2P5QA 2K18A 3QAGA 2KP1A 4WF5A 4JZQA 3HVXA 5A4WA 5CAXA 1QGVA 2I1UA 4Q5NA 4EDZA 1FB0A 1XPVA 2GGTA 4XRAA 1OKTA 2FA4A 3HVVA 6GSVA 4IKHA 2RM5A 2DJ0A 3QAVA 1HD2A 5KN3A 4PNFA 1Z9HA 5CP1A 4V2NA 2MMAA 1T00A 2I9HA 2VCQA 1X5DA 3IK9A 4EO3A 3H4KA 2ES7A 16GSA 4HJMA 5IO0A 2YJ7A 4TVEA 1PSQA 3K8NA 3IHQA 3QAWA 1G7EA 1PKWA 3TUEA 5AIVA 3TOTA 1Q4JA 1M2BA 3LYKA 1JFUA 1PRXA 2RUEA 1SKWB 4Q5QA 3M1GA 2R3XA 3TKSE 2B1LA 4JE1A 2C3TA 2V41A 1YJ6A 1JZRA 2YCDA 2VL3A 4TR4A 4PQ1A 2H1BA 1F6MC 1TJDA 4V2LA 2WFCA 1USBA 3ZMKA 2O85A 1OC9A 4KGIA 5CNWA 5ABRA 2R4VA 1VF4A 4TRXA 2LEGA 1T3BA 3W8SA 1K3YA 1ABAA 3QFBC 3KXOA 2NVLA 3RHCA 2AV4A 1O85A 2MMZA 3C71A 4LL1B 1W89A 1T4YA 3UBLA 3CMIA 5JCGA 5KN2A 4F0BA 3HCZA 1K0NA 1LBKA 2R5GA 4JEDA 4X0XA 3GA4A 3U5RE 3HXSA 1FHEA 4FO5A 3MWHA 4POBA 1YEPA 1FOVA 1YF1A 1AQXA 4D73A 1GULA 5G1KA 1SK0A 3SBCA 2OBKA 3KGKA 2HE3A 2O8VB 5JWRB 3A3TA 1WIKA 4TXOB 2LSTA 3GKNA 2C0EA 3L9VA 1ERTA 1WJKA 2B7JA 3VPQA 2EIRA 1XWAA 1F2EA 5CRHA 1XW9A 1A23A 4HZ2A 5HFIA 2IN3A 3FR3A 1CQGA 2F9SA 5B8AA 3RPNA 2D2ZA 5HQPA 2L4CA 4YAPA 2FWHA 2RUFA 1XWGA 4JU5A 5J5NA 3LJRA 5ELGA 1BEDA 3IK7A 2DSAA 2GS3A 2WDUA 4RI7A 4N0ZA 5F06A 4YAVA 2GTUA 4K7NA 2J23A 1J9BA 1BJXA 3FZ9A 5DJMA 3GURA 3IC4A 4WXTA 1SENA 3ZREA 5LCZA 3IBHA 3IPZA 4PQIA 1GWCA 3IV4A 3HHVA 4YQMA 2IMEA 1HQOA 5ECRB 3HVSA 1MD3A 2DJ2A 1TDIA 4N30A 3VI7A 2XBIA 1SD8A 4MJAA 2IFQB 4ID0A 3P8WA 5DDLA 6GSXA 1R5AA 4OCFA 1T8EB 3DYRA 3GKMA 1ML6A 1U87A 1RW1A 2GQLA 2JZRA 3KD0A 4ECCA 2P5RA 4QQ7A 2HSHA 3I6AA 2FCHA 2YWOA 4TKYA 3SWLA 2E2GA 1F3AA 2GQKA 3F3RA 1K3OA 6GSWA 3C1SA 4GSTA 4LL4B 4FYCA 2RLIA 1K0MA 5ECOB 1XWBA 1Z6NA 1K0AA 2LRNA 3KM6A 4GSSA 3ZVJA 5C00A 5DVBA 1TRSA 1GP1A 5J4UA 1ZL9A 1GTUA 2HZEA 1QMVA 4I97A 1MEKA 5J3RA 2YZUA 4CDOA 3CXGA 5G1LA 2ZUPA 5DCHA 3NOFA 6GSYA 1V58A 4TR0A 2F8FA 7GSSA 5KN1A 1JZWA 1EEJA 1AXDA 4KDUA 3E9JB 3HD5A 4LMVA 1X5EA 1PL1A 3GKXA 1PMTA 4EXJA 3F9UA 4AJ8A 3N9JA 3EU3A 1XBSA 2LJKA 4OWYA 2MBSA 4KSOA 2VUPA 1WOUA 2OE0A 3M8NA 1GSQA 2O7KA 4NWYA 1K3LA 4KCEA 1OAZA 1WPIA 1XVWA 2JSZA 2H71A 1ERWA 4ML1A 2IMFA 1VF3A 4XIHA 2GLRA 1ACVA 3FR9A 1UC7A 4MZCA 1YKAA 3FK8A 4XTSA 3FZ4A 5IOXA 2A2RA 2YWMA 17GSA 4J2FA 4ZIJA 3P2AA 3H79A 5INYA 4HU7A 3TDGA 5D96A 1GSDA 3Q6OA 2VL9A 1DUGA 4GQFA 4TR1B 4KDXA 4TW5A 3V1WA 1GUMA 3APOA 3QPMA 2JL4A 3TRPA 1G0TA 4NAXA 2YANA 5A4VA 1PGTA 4JR6A 4WBRD 4RI6A 3FYGA 3ZTLA 3WT2A 3ISOA 4WR4A 2X99A 3S9FA 1PL2A 4POLA 3F0IA 5EY6A 2B1KA 2CAIA 2V2GA 3L78A 1TKDB 4ZL7A 2WS2A 2K8SA 1SL2B 1HNCA 4EE0A 3ZRDA 4RQXA 5G5FA 5CYYA 4HZ4A 1QK8A 4K1FA 2VM1A 2YWNA 4TXVA 2N5FA 4NPBA 3LEFA 3G7YA 2H1GA 4H86A 3FW2A 3A2XA 4KA0A 3TB2A 3ZITA 1ZYEA 1UA5A 5EVOA 4PUAA 4BWQA 2DIZA 6GSUA 3QMXA 4ZBBA 4PXOA 2CZ2A 1TP9A 3EVIA 3O6TA 2LQOA 4BPYA 1SU9A 1BG5A 3DWVA 2FWFA 2ZNMA 1WE0A 2PVOC 3GYKA 1X9WB 3KMOA 4G9HA 1Z3EA 3GSSA 5H5RA 3G7JA 2LS5A 5DAKA 3ZMLA 4DSSB 1A24A 3A2VA 3Q19A 2L59A 4KDYA 2YP6A 2CX4A 3M9KA 1YDKA 1G6WA 2VCZA 4ZB6A 2ZCTA 2OE1A 2KLXA 1ON4A 3VPTA 2LJRA 3HZ4A 5ECIB 2VLTA 1O81A 5DQYA 2CQ9A 4KCAA 1NHOA 2LNSA 1OE8A 4MH2A 4ECIA 4HU9A 3TOUA 1MDIA 3KJYA 1A2JA 5FT3A 4WKWA 3GV1A 3M9JA 1BAYA 4IQ1A 3LFLA 1JLVA 5G2ZA 4ZBDA 2L6DA 3LQ7A 2QSIA 1ZOFA 1J0FA 4RQRA 5DBQA 5ECNB 5H5QA 3HYPA 1GUHA 2OA7A 4EL1A 2GSQA 3KTBA 2N5AA 1XIYA 4K6XA 1A2LA 4EDYA 3GMFA 3GFKA 1SJZA 4V1Ap 4EKZA 3TRXA 5F05A 4O7HA 3BBYA 2A2SA 3PH9A 2PERA 1EV4A 3FHKA 4PNGA 4NHZA 2YV9A 8GSSA 4ZB9A 2C0GA 4BL7A 3RHBA 2LRCA 2WGRA 3FY7A 4ML6A 1TK8B 4HI7A 4TR1A 2YZHA 3EMXA 3GKKA 5LNKe 2CA8A 1URMA 4K9ZA 1O8WA 1QUWA 1DBYA 2AUVA 3KH9A 4GLTA 5IM9A 1BX9A 1K0OA 5IO2A 1S3AA 3F4RA 3MDKA 3F3QA 1R5PA 2CX3A 1EOHA 2FWEA 3I43A 1V98A 1ERVA 2Z9SA 3IA1A 1A8LA 2B5EA 2YN1A 5FWGA 2TIRA 2YOIA 3DRNA 3IDVA 1C72A 1TU7A 5ECMB 4K7OA 1EEMA 5GZZB 1B9YC 2G2QA 4LMWA 4AJ6A 1QFNA 4F03A 1ILOA 3ZVJD 1A0FA 4BA7A 2YWIA 1V9WA 4P3YB 1M9AA 5ID2B 1WP0A 3CBUA 1Z5YE 5ECPB 2M80A 2R2JA 1XVQA 2N5BA 4L5LA 4LA1A 3OR5A 3O76A 3FEUA 2DC5A 3P90A 4MLYA 2LRTA 1G7OA 4WEYA 4RUVA 3DGQA 3CSJA 5GSTA 1O6JA 5IOWA 3GX0A 1A0RP 3GRXA 5DALB 2PGTA 1QQ2A 3DIEA 4X1UA 5D9WA 1ZGNA 3WGDA 1FW1A 1T4ZA 4XS6A 3TKSC 2K6VA 2K9FA 2LQQA 5IMZA 1GNEA 3U6VA 5D73A 3VWWA 1EP8A 3VURA 3P7XA 1M99A 2ON5A 1TW9A 2A4VA 4IBPA 4MA9A 3UOMA 3DMLA 1XOBA 2DJ3A 1SL1B 2CVBA 1QXHA 2FWGA 4CW9A 3D0ZA 2H01A 5B6NA 5IMDA 2H6YA 1H4OA 3E0UA 2VCXA 19GSA 4MMMA 2IMDA 3O3TA 1SK1A 1EP7A 2HNLA 1CQHA 3US3A 3D5JA 3DVXA 2EC4A 4MPFA 1PX7A 2XBQA 4GF0A 1FG4A 1GTIA 4I8BA 1B4PA 2F8AA 4YQVA 2DMLA 2HT9A 1GLPA 5COHA 2J9HA 1FO5A 2V32A 4IQAA 5HFGA 1ZCPA 1TI1A 3VFIA 4XS1A 1OC3A 4IJIA 1I9DA 1GSSA 1U3IA 2V6KA 3EYTA 4MZBA 3PINA 1X9SB 3M3MA 4IELA 1K0CA 5G5EA 1GSYA 2BMXA 3ME7A 3HKRA 1KNGA 3CTFA 1YEXA 4L0UA 3TJFA 3ZZXA 2L5LA 2XPDA 1X9MB 1Y6EA 4KAEA 1XWKA 3UIWA 2C1YA 3RAZA 2V6OA 1F3BA 1RQMA 2X8GA 3ZLPA 3APSA 4MZWA 3LYPA 3CSIA 4E8EA 2DJJA 5D93A 1XCCA 3EWLA 3EMPA 3AY8A 1DE1A 4TOPA 3QOUA 5IMCA 1ZZYA 3JCML 1OC8A 4XHMA 4Q5RA 1SJIA 1E6BA 4KUNA 4WBJA 1PA3A 4OO4A 1TI3A 3QR6A 1Z7PA 2GDRA 2TRXA 2P0GA 2PVQA 3ZL5A 5A4UA 4XS4B 1Q98A 2H30A 3LSZA 4GRFA 4HQZA 2OBIA 3GTUB 2REMA 3HJMA 4NHWA 1NW2A 2H0GA 1V40A 2IMIA 2BJXA 4YH2A 2DBCA 2GSTA 1FVJA 5DJLA 1GTAA 1Y25A 3GH9A 2FD3A 4MDCA 4GWRA 3F6DA 1A2MA 1M2DA 3DKSA 3ED3A 3FZAA 3KZQA 3KMNA 3F4SA 2C4JA 3A5WA 1XWCA 5DALA 2EIQA 3GSTA 1Z6MA 1AQWA 3TKSA 4OD7A 1THOA 3MNGA 1OKDA 2B7KA 3E3EA 1V2AA 5AN1A 5CRGA 4TXOA 1XFLA 3GX8A 2XHFA 2K8VA 3GN3A 1R4WA 4FIWA 3HJOA 3TCOA 4PX1A 1RK4A 4MCUA 4IN0A 3TRQA 3C73A 4MP4A 1EGOA 3D21A 1MDJA 1G6YA 4L0WA 2R6KA 4PGTA 1T1VA 2DJKA 5LD0A 3TJGA 1M9BA 4OFNA 4KSMA 4IP1A 4I2TA 2H75A 5ECLB 3BJ5A 2H8LA 5ENUA 2C0DA 4OFMA 2MMOA 4NV5A 3C8EA 1XZOA 3FR6A 4ECJA 2QC7A 4YQUA 4QL9A 1AQVA 4XCSA 2CT6A 5IPGA 1MTCA 3UEMA 1SL0B 2XPEA 1X0RA 4POMA 4O5RA 1VGLA 3VWVA 2IL3A 3UMAA 2TRCP 1EV9A 3G9BA 2HRFA 5IMAA 5D9XA 2KP2A 2G0FA 4KX4A 1T7PB 4HS1A 2GZYA 2B3SA 3H93A 1GLQA 4AJ7A 3UVTA 1M0UA 1WRYA 3MSZA 1K0BA 2GT6A 3N5OA 2C3NA 3C1RA 2IFQA 4G2EA 1B9XC 2CZ3A 4IS0A 2B6MA 1TU8A 2QKEA 2AHEA 1OC9B 4MF7A 4MJBA 2FNOA 3TGZA 3F8UA 3D4MA 3QFAC 2JACA 4E8HA 2I4AA 3ERWA 4V1Ag 4F82A 5CRWA 2H19A 1M7TA 3KIJA 2VD0A 2E2MA 4IW9A 4HQSA 4ILFA 2VIMA 2KUCA 2IJYA 1MD4A 4EC0A 5ECSA 5J41A 4OFTA 1KEBA 2DMMA 3KP8A 1R26A 1YQ1A 2PN8A 2JZSA 2C0FA 3M0FA 3NZNA 4D73B 3UJ1A 2IPAA 5HFKA 1O7UA 5AIXA 2FY6A 5CO3A 4MF6A 1WMJA 2GVPA 3I9V2 5JWOB 2WZ9A 3GL3A 1N2AA 2M46A 2L6CA 3BD2A 1M2AA 3QCPA 1H75A 1IYHA 5ECHB 1YZXA 2VM2A 3D4TA 4GSNA 3ZIJA 4QL7A 2R37A 13GSA 1NSWA 4V2MA 3CTGA 2MYGA 2H6ZA 2O87A 2HRNA 3FZ5A 1FAAA 4IP6A 1ERUA 4MJCA 2JADA 2FA8A 5ELAA 5FHIA 3W8JA 2PUKC 3IE3A 2ON7A 1GTBA 5HR2A 4KNDA 1KTEA 3R2QA 2CAQA 2VOCA 4FYUA 3RDWA 2YPMA 3UVHA 1TOFA 3TKPA 2ALBA 1JZOA 5AGYA 1HYUA 2HSYA 5IIZA 4K0NA 1TRVA 1O8XA 3QDNA 3VWUA 5F07A 2VL2C 2NBSA 5H5SA 4K7IA 4BVYA 5IQYA 4TR3A 2BTOT 3TKRA 5CREA 4HJ2A 2LUSA 2DIYA 2C8UA 3L4NA 5G30A 3IXRA 1YY7A 3EINA 3I69A 2MZCA 4ZL8A 4N0VA 3HZ8A 1LJRA 5EPFA 1PQNA 4NMUA 3UBKA 1IYIA 5L71A 4FH8A 1GUKA 4DSRA 1DE2A 1TTZA 1HNBA 2KHPA 2PU9C 3C7MA 2H74A 2GZZA 4MF5A 4JBBA 1ZYQB 3DD3A 2X64A 3UARA 4IJ3A 2HZEB 2XC2A 2PPTA 3EU4A 3G7IA 4NV2A 4I2UA 2DJ1A 3WYWA 2VAFA 1E2YA 3J7Yb 1U6TA 1S3DA 4G10A 2HI7A 2L5OA 4BVXA 2CVDA 3BCIA 2L57A 5D9TA 3VI5A 5J9CA 5GAND 5EL8A 4N11A 2VD1A 1DSBA 5J9BA 2KOKA 1B4QA 1XW5A 3BOAA 2WB9A 1BQ7A 5KN0A 1JZDA 3FKFA 4PURA 4DSSA 2AYTA 3J7Yk 2F51A 4K2DA 1SK2A 2C3QA 1EOGA 4GQCA 4ACSA 2H72A 2AB6A 2GSSA 3KTLA 1TRWA 3MAKA 2VCVA 3F6FA 2B5YA 1F37A 3L9UA 2E7PA 4WETA 2WULA 1AUCA 3ERGA 5IMFA 1HNAA 3IAM2 2PMTA 2AJQB 2GSRA 1V57A 2GQMA 2E0QA 3ZFBA 1B48A 4KB3A 1OE7A 3WGXA 2H1DA 4K8MA 2WJUA 3RPPA 1OVNA 4MABA 2RM6A 1XXUA 1SD9A 3D6IA 1O73A 5IPHA 4AF2A 3KEBA 1X5CA 2QGVA 3HY2A 1MDKA 1Z7RA 3IAS2 1GSUA 5JWQB 9GSSA 3BCKA 2H0HA 4OCEA 1GL8A 4IVFA 4ZB8A 5G31A 3GNJA 2OE3A 1VF2A 4DEJA 3L0HA 2VCWA 3L9SA 2LKUA 5ECQB 2X8HA 3GHAA 5AISA 2I3YA 1U88A 4GXZA 4PUFC 3LGCA 5B7CA 1AAZA 12GSA 1F9MA 4POKA 4ZILA 14GSA 2VL2A 4O92A 2JU5A 4OMVA 3WT1A 3PGTA 1S3CA 6GSTA 4BWSA 5HR0A 1YF0A 4CHSA 4GCIA 4PQHA 5E59A 5JCUA 18GSA 2LNTA 3D22A 1BYEA 1KBNA 2VLVA 3H1NA 5B8BA 2LTKA 4O32A 1ST9A 5KEJA 3VLNA 3Q18A 4EF0A 4HDEA 1YKCA 4HEA2 1NM3A 3TJKA 1THXA 4ZL9A 5HR1A 1FVKA 1SKRB 4ULXA 5ID2A 4EVMA 3WGEA 2H6XA 2V1MA 1R7HA 4Z7XA 2WRTA 3CRTA 1UVZA 3EC3A 5DAKB 3HDCA
chains in the Genus database with same CATH superfamily
4N10A 2HYXA 2WCIA 2FLSA 1EWXA 1JLWA 1SYXA 1GNWA 2AAWA 1FB6A 3LXTA 5IMVA 2PBJA 2H66A 1K0DA 1N8JA 4NXIA 1SYRA 5JCWA 3KH7A 1PX6A 1J08A 3VK9A 5DQSA 5F8BA 4Z2UA 2YJHA 3ME8A 1PKZA 2PWJA 4L5OA 4ZBAA 3F4TA 3APQA 4K2XA 4I6XA 4K5RA 4EUYA 4ZXGA 1TK5B 5CRDA 5E4WA 3KCMA 2FUG2 2H0IA 5C04A 4KH7A 5GSSA 2B5XA 2HZFA 4ISDA 1UN2A 2FHEA 3A2WA 4MK3A 2LJAA 2OJLA 3LG6A 1A8YA 3LWAA 2OADA 3NIVA 4IGJA 3HJPA 4I5QA 4KW6A 1AC1A 2NPBA 1GRXA 1XOAA 3GIXA 4G0IA 3CSHA 3CYNA 3KP9A 3GUSA 2OKAA 1SJ6A 2DLXA 4IHUA 1EZKA 4AGSA 2CV4A 3GL5A 3ERFA 3LXZA 3FRCA 1OYJA 3DVWA 1ZYNA 5ECKB 2RIIA 4OO5A 5D8IA 2YNXA 4MPGA 3H8QA 2HFDA 4LLRA 1JHBA 2M72A 4TN8A 2H76A 4F0CA 3UAPA 3ZFLA 5HR3A 1WWJA 4L8EA 2LV3A 3IOSA 5A5KA 1AW9A 4F9ZA 2CVKA 2YV7A 1VRSD 3TKQA 3DXBA 1W4VA 2NDOA 1TK0B 2GT5A 1I5GA 2MBTA 2IIYA 4ECBA 1GSEA 4YKFA 4KE3A 2H70A 2IMKA 2H73A 2MMNA 6GSSA 1AIUA 3LORA 1NHYA 1TXXA 2R0PA 1PN9A 4J57E 1U3AA 5KOWA 1XW6A 3F63A 3UL3A 2F3MA 5DCGA 2EIOA 2IWTA 1B8XA 2H1AA 1EGRA 3HA9A 2GZPA 2JZTA 2VLUA 3Q74A 4J56E 5B6MA 3IRAA 4JR4A 2VO4A 3WD6A 4JRRA 2FGXA 1SKSB 2I81A 4K0GA 3QD9A 4XS4A 4Q5FA 22GSA 2X49A 4XRDA 4WR5A 2X8CA 3EURA 4HUAA 1TRUA 2NTOA 3W6GA 4MH3A 3VWXA 2C80A 1GH2A 3TJBA 2O89A 3GTUA 1ZMAA 2L4QA 4X43A 2JSYA 2OACA 4GTUA 3DEXA 4G19A 3PR8A 5GAPD 3CRUA 3ZIVA 2P31A 2HLSA 11GSA 1LU4A 1GSFA 2HXKA 3ZYWA 4F2IA 5F0GA 3IR4A 1VF1A 4HOJA 4MJEA 4FYBA 4DVCA 4DSQA 3EE2A 3GH6A 3PPUA 3TJJA 4WF4A 20GSA 10GSA 5D9VA 2VCTA 3RBTA 1PD21 2P5QA 2K18A 3QAGA 2KP1A 4WF5A 4JZQA 3HVXA 5A4WA 5CAXA 1QGVA 2I1UA 4Q5NA 4EDZA 1FB0A 1XPVA 2GGTA 4XRAA 1OKTA 2FA4A 3HVVA 6GSVA 4IKHA 2RM5A 2DJ0A 3QAVA 1HD2A 5KN3A 4PNFA 1Z9HA 5CP1A 4V2NA 2MMAA 1T00A 2I9HA 2VCQA 1X5DA 3IK9A 4EO3A 3H4KA 2ES7A 16GSA 3IHGA 4HJMA 5IO0A 2YJ7A 4TVEA 1PSQA 2QA2A 3K8NA 3IHQA 3QAWA 1G7EA 1PKWA 3TUEA 5AIVA 3TOTA 1Q4JA 1M2BA 3LYKA 1JFUA 1PRXA 2RUEA 1SKWB 4Q5QA 3M1GA 2R3XA 3TKSE 2B1LA 4JE1A 2C3TA 2V41A 1YJ6A 1JZRA 2YCDA 2VL3A 4TR4A 4PQ1A 2H1BA 1F6MC 1TJDA 4V2LA 2WFCA 1USBA 3ZMKA 2O85A 1OC9A 4KGIA 1PN0A 5CNWA 5ABRA 2R4VA 1VF4A 4TRXA 2LEGA 1T3BA 3W8SA 1K3YA 1ABAA 3QFBC 3KXOA 2NVLA 3RHCA 3FMWA 2AV4A 1O85A 2MMZA 3C71A 4LL1B 1W89A 1T4YA 2DKIA 3UBLA 3CMIA 5JCGA 5KN2A 4F0BA 3HCZA 4O5QA 1K0NA 1LBKA 2R5GA 4JEDA 4X0XA 3GA4A 3U5RE 3HXSA 1FHEA 4FO5A 3MWHA 4POBA 1YEPA 1FOVA 1YF1A 1AQXA 4D73A 1GULA 5G1KA 1SK0A 3SBCA 2OBKA 3KGKA 2HE3A 2O8VB 5JWRB 3A3TA 1WIKA 4TXOB 2LSTA 3GKNA 2C0EA 3L9VA 1ERTA 1WJKA 2B7JA 3VPQA 2EIRA 1XWAA 1F2EA 5CRHA 1XW9A 1A23A 4HZ2A 5HFIA 2IN3A 3FR3A 4G0KA 1CQGA 2F9SA 5B8AA 3RPNA 2HSMA 2D2ZA 5HQPA 2L4CA 4YAPA 2FWHA 2RUFA 1XWGA 4JU5A 5J5NA 3LJRA 5ELGA 1BEDA 3IK7A 2DSAA 2GS3A 2WDUA 4RI7A 4N0ZA 5F06A 4YAVA 2GTUA 5BMUA 4K7NA 2J23A 1J9BA 1BJXA 3FZ9A 5DJMA 3GURA 3IC4A 2HRAA 4WXTA 1SENA 3ZREA 5LCZA 3IBHA 3IPZA 4PQIA 1GWCA 3IV4A 3HHVA 4YQMA 2IMEA 1HQOA 5ECRB 3HVSA 1MD3A 2DJ2A 1TDIA 4N30A 3VI7A 2XBIA 1SD8A 4MJAA 2IFQB 4ID0A 3P8WA 5DDLA 1ZYPA 6GSXA 1R5AA 4OCFA 1T8EB 3DYRA 3GKMA 1ML6A 1U87A 1RW1A 2GQLA 2JZRA 3KD0A 3IC8A 4ECCA 2P5RA 4QQ7A 2HSHA 3I6AA 5KOXA 2FCHA 2YWOA 4TKYA 4HSCX 3SWLA 2E2GA 1F3AA 2GQKA 3F3RA 1K3OA 6GSWA 3C1SA 4GSTA 4LL4B 4FYCA 2RLIA 1K0MA 5ECOB 1XWBA 1Z6NA 1K0AA 2LRNA 3KM6A 4GSSA 3ZVJA 5C00A 5DVBA 1TRSA 1GP1A 5J4UA 1ZL9A 1GTUA 2HZEA 1QMVA 4I97A 4EIPA 1MEKA 5J3RA 2YZUA 4CDOA 3CXGA 5G1LA 2ZUPA 5DCHA 3NOFA 6GSYA 1V58A 4TR0A 2F8FA 7GSSA 5KN1A 1JZWA 1EEJA 1AXDA 4KDUA 3E9JB 3HD5A 4LMVA 1X5EA 1PL1A 3GKXA 1PMTA 4EXJA 3F9UA 4AJ8A 3MYDA 3N9JA 3EU3A 3CQFA 1XBSA 2LJKA 4OWYA 2MBSA 4KSOA 2VUPA 1WOUA 2OE0A 3M8NA 1GSQA 2O7KA 4NWYA 1K3LA 4KCEA 1OAZA 4CY8A 1WPIA 1XVWA 2JSZA 2H71A 1ERWA 4ML1A 2IMFA 1VF3A 4XIHA 2GLRA 1ACVA 4USSA 3FR9A 1UC7A 4MZCA 1YKAA 3FK8A 4XTSA 3FZ4A 5IOXA 2A2RA 2YWMA 17GSA 4J2FA 4ZIJA 3P2AA 3H79A 5INYA 4HU7A 3TDGA 5D96A 1GSDA 4BL7B 3Q6OA 2VL9A 1DUGA 4GQFA 2X4AA 4TR1B 4KDXA 4TW5A 3V1WA 1GUMA 3APOA 3QPMA 2JL4A 3TRPA 1G0TA 4NAXA 2YANA 5A4VA 1PGTA 4JR6A 4WBRD 4RI6A 4BVYB 4Z2RA 3FYGA 3ZTLA 3WT2A 2DKHA 3ISOA 4WR4A 2X99A 3S9FA 1PL2A 4POLA 3F0IA 5EY6A 2B1KA 2CAIA 2V2GA 3L78A 1TKDB 4ZL7A 2WS2A 2K8SA 1SL2B 1HNCA 3A5IA 4EE0A 3ZRDA 5BRTA 4RQXA 5G5FA 5CYYA 4HZ4A 1QK8A 4K1FA 2HRKA 2VM1A 2YWNA 4TXVA 2N5FA 4NPBA 3LEFA 3G7YA 2H1GA 4H86A 3FW2A 3A2XA 4KA0A 3TB2A 3ZITA 1M3IA 1ZYEA 1UA5A 4PUAA 5EVOA 4BWQA 2DIZA 6GSUA 3QMXA 4ZBBA 4PXOA 2CZ2A 1TP9A 3EVIA 3O6TA 2LQOA 4BPYA 1SU9A 1BG5A 3DWVA 2FWFA 4PTSA 2ZNMA 1WE0A 2PVOC 3GYKA 1X9WB 3KMOA 4G9HA 1Z3EA 3GSSA 5H5RA 3G7JA 2LS5A 5DAKA 3ZMLA 4DSSB 1A24A 3A2VA 3Q19A 2L59A 4KDYA 2YP6A 2CX4A 3M9KA 1YDKA 1G6WA 4X4JA 2VCZA 4ZB6A 2ZCTA 2OE1A 2KLXA 1ON4A 3VPTA 2LJRA 3HZ4A 5ECIB 2VLTA 1O81A 5DQYA 2CQ9A 4KCAA 4EIQA 1NHOA 2LNSA 4K5SA 1OE8A 4MH2A 4ECIA 4HU9A 3TOUA 1MDIA 3KJYA 1A2JA 5FT3A 4WKWA 3GV1A 3M9JA 1BAYA 4IQ1A 3LFLA 1JLVA 5G2ZA 4ZBDA 2L6DA 3LQ7A 2QSIA 1ZOFA 1J0FA 4RQRA 5DBQA 5ECNB 4KF9A 5H5QA 3HYPA 1GUHA 2OA7A 4EL1A 2GSQA 3KTBA 2N5AA 1XIYA 4K6XA 1A2LA 4EDYA 3GMFA 3GFKA 1SJZA 4V1Ap 4EKZA 3TRXA 5F05A 4O7HA 3BBYA 2A2SA 3PH9A 2PERA 1EV4A 3FHKA 4PNGA 4NHZA 2YV9A 8GSSA 4ZB9A 2C0GA 4BL7A 3RHBA 2LRCA 2WGRA 3FY7A 4ML6A 1TK8B 4HI7A 4TR1A 2YZHA 3EMXA 3GKKA 5LNKe 2CA8A 1URMA 4K9ZA 1O8WA 1QUWA 1DBYA 2AUVA 3KH9A 4GLTA 5IM9A 1BX9A 1K0OA 5IO2A 1S3AA 3F4RA 3MDKA 3F3QA 1R5PA 2CX3A 1EOHA 2FWEA 3I43A 1V98A 1ERVA 2Z9SA 3IA1A 1A8LA 2B5EA 2YN1A 5FWGA 2TIRA 2YOIA 3DRNA 3IDVA 1M3JA 1C72A 1TU7A 5ECMB 4K7OA 1EEMA 5GZZB 1B9YC 2G2QA 4LMWA 4AJ6A 1QFNA 4F03A 1ILOA 4ICYA 3ZVJD 1A0FA 4BA7A 2YWIA 1V9WA 4P3YB 1M9AA 5ID2B 1WP0A 3CBUA 1Z5YE 5ECPB 2M80A 2R2JA 1XVQA 2N5BA 4L5LA 4LA1A 3OR5A 3O76A 3FEUA 2DC5A 3P90A 4MLYA 2LRTA 1G7OA 4WEYA 4RUVA 3DGQA 3CSJA 5GSTA 1O6JA 5IOWA 3GX0A 1A0RP 3GRXA 5DALB 2PGTA 1QQ2A 3DIEA 4X1UA 5D9WA 1ZGNA 3WGDA 1FW1A 1T4ZA 4XS6A 3TKSC 2K6VA 2K9FA 2LQQA 5IMZA 1GNEA 3U6VA 5D73A 3VWWA 1EP8A 3VURA 3P7XA 1M99A 2ON5A 1TW9A 2A4VA 4IBPA 4MA9A 3MIXA 3UOMA 3DMLA 1XOBA 2DJ3A 1SL1B 3LW9A 2CVBA 1QXHA 2FWGA 4CW9A 3D0ZA 2H01A 5B6NA 5IMDA 2H6YA 1H4OA 3E0UA 2VCXA 19GSA 4MMMA 2IMDA 3O3TA 4YKGA 1SK1A 1EP7A 2HNLA 1CQHA 3US3A 3D5JA 3DVXA 4FQUA 2EC4A 4MPFA 1PX7A 2XBQA 4GF0A 1FG4A 1GTIA 4I8BA 1B4PA 2F8AA 4YQVA 2DMLA 2HT9A 2A2PA 1GLPA 5COHA 2J9HA 1FO5A 2V32A 4IQAA 5HFGA 1ZCPA 1TI1A 3VFIA 4XS1A 1OC3A 4IJIA 1I9DA 1GSSA 1U3IA 2V6KA 3EYTA 4MZBA 3PINA 1X9SB 3M3MA 4IELA 1XG8A 1K0CA 3EPTA 5G5EA 1GSYA 2BMXA 4CY6A 3ME7A 3HKRA 1KNGA 2QA1A 3CTFA 1YEXA 4L0UA 3TJFA 3ZZXA 2L5LA 2XPDA 1X9MB 1Y6EA 4BIKA 3HVNA 4KAEA 1XWKA 3UIWA 2C1YA 4O5UA 3RAZA 2V6OA 1F3BA 1RQMA 2X8GA 3ZLPA 3APSA 4MZWA 3LYPA 3CSIA 4E8EA 2DJJA 5D93A 1XCCA 3EWLA 3EMPA 1S3RA 3AY8A 1DE1A 4TOPA 3R3EA 3QOUA 5IMCA 1ZZYA 3JCML 1OC8A 4XHMA 4Q5RA 1SJIA 1E6BA 4KUNA 4WBJA 1PA3A 4OO4A 1TI3A 3QR6A 1Z7PA 2GDRA 2TRXA 2P0GA 2PVQA 3ZL5A 5A4UA 4XS4B 1Q98A 2H30A 3LSZA 4GRFA 4HQZA 2OBIA 3GTUB 2REMA 3HJMA 4NHWA 1NW2A 2H0GA 2R0GA 1V40A 2IMIA 2BJXA 4YH2A 2DBCA 2GSTA 1FVJA 5DJLA 1GTAA 1Y25A 3GH9A 2FD3A 4MDCA 4GWRA 3F6DA 1A2MA 1M2DA 3DKSA 3ED3A 3FZAA 3KZQA 3KMNA 3F4SA 2C4JA 3A5WA 1XWCA 5DALA 2EIQA 3GSTA 1Z6MA 1AQWA 3TKSA 4OD7A 1THOA 3MNGA 1OKDA 2B7KA 3E3EA 1V2AA 5AN1A 5CRGA 4TXOA 1XFLA 3GX8A 2XHFA 2K8VA 3GN3A 1R4WA 4FIWA 3HJOA 3TCOA 4PX1A 1RK4A 4MCUA 4IN0A 3TRQA 3C73A 4MP4A 1EGOA 3D21A 1MDJA 4MNNA 1G6YA 4L0WA 2R6KA 4PGTA 1T1VA 2DJKA 5LD0A 2UZ8A 3TJGA 1M9BA 4OFNA 4KSMA 4IP1A 4I2TA 2H75A 5ECLB 3BJ5A 2H8LA 5ENUA 2C0DA 4OFMA 2MMOA 4NV5A 3C8EA 1XZOA 3FR6A 4ECJA 2QC7A 4YQUA 4QL9A 1AQVA 4XCSA 2CT6A 5IPGA 1MTCA 3UEMA 1SL0B 2XPEA 1X0RA 4POMA 4O5RA 1VGLA 3VWVA 2IL3A 3UMAA 2A4HA 2TRCP 1EV9A 3G9BA 2HRFA 5IMAA 5D9XA 2KP2A 2G0FA 4KX4A 4Z2TA 1T7PB 4HS1A 4A5PA 2GZYA 1FOHA 2B3SA 3H93A 1GLQA 4AJ7A 3UVTA 1M0UA 1WRYA 3MSZA 1K0BA 2GT6A 3N5OA 2C3NA 3C1RA 2IFQA 4G2EA 1B9XC 2CZ3A 4IS0A 2B6MA 1TU8A 2QKEA 2AHEA 1OC9B 1PFOA 4MF7A 4MJBA 2FNOA 3TGZA 3F8UA 3D4MA 3QFAC 2JACA 4E8HA 2I4AA 3ERWA 4V1Ag 4F82A 5CRWA 2H19A 1M7TA 4BVXB 3KIJA 2VD0A 2E2MA 4IW9A 4HQSA 4ILFA 2VIMA 2KUCA 2IJYA 1MD4A 4EC0A 5ECSA 5J41A 4OFTA 1KEBA 2DMMA 3KP8A 1R26A 1YQ1A 2PN8A 2JZSA 2C0FA 3M0FA 3NZNA 4D73B 3UJ1A 2IPAA 5HFKA 1O7UA 5AIXA 2FY6A 5CO3A 4MF6A 1WMJA 2GVPA 3I9V2 5JWOB 2WZ9A 4G0LA 3GL3A 1N2AA 2M46A 2L6CA 3BD2A 1M2AA 3QCPA 1H75A 1IYHA 5ECHB 1YZXA 2VM2A 3D4TA 4GSNA 3ZIJA 4QL7A 2R37A 2R0CA 13GSA 1NSWA 4V2MA 3CTGA 2MYGA 2H6ZA 2O87A 2HRNA 3FZ5A 1FAAA 4IP6A 1ERUA 4MJCA 2JADA 2FA8A 5ELAA 5FHIA 3W8JA 2PUKC 3IE3A 2ON7A 1GTBA 5HR2A 4KNDA 1KTEA 3R2QA 2CAQA 2VOCA 4FYUA 3RDWA 2YPMA 3UVHA 1TOFA 3TKPA 2ALBA 1JZOA 5AGYA 1HYUA 2HSYA 5IIZA 4K0NA 1TRVA 1O8XA 3QDNA 3VWUA 5F07A 2VL2C 2NBSA 5H5SA 4K7IA 4BVYA 5IQYA 4TR3A 2BTOT 3TKRA 5CREA 4HJ2A 2LUSA 2DIYA 2C8UA 3L4NA 5G30A 3IXRA 1YY7A 3EINA 3I69A 2MZCA 4ZL8A 4N0VA 3HZ8A 1LJRA 5EPFA 1PQNA 4NMUA 3UBKA 1IYIA 5L71A 4FH8A 1GUKA 4DSRA 1DE2A 1TTZA 1HNBA 2KHPA 2PU9C 3C7MA 2H74A 2GZZA 4MF5A 4JBBA 1ZYQB 3DD3A 2X64A 3UARA 4IJ3A 2HZEB 2XC2A 2PPTA 3EU4A 3G7IA 4NV2A 4I2UA 2DJ1A 3WYWA 2VAFA 1E2YA 3J7Yb 1U6TA 1S3DA 4G10A 2HI7A 2L5OA 4BVXA 2CVDA 3BCIA 2L57A 5D9TA 3VI5A 5J9CA 5GAND 5EL8A 4N11A 2VD1A 1DSBA 5J9BA 2KOKA 1B4QA 1XW5A 3BOAA 2WB9A 1BQ7A 5KN0A 1JZDA 3FKFA 4PURA 4DSSA 2AYTA 3J7Yk 2F51A 4K2DA 1SK2A 2C3QA 1EOGA 4GQCA 4ACSA 2H72A 2AB6A 2GSSA 3KTLA 1TRWA 3MAKA 2VCVA 3F6FA 2B5YA 1F37A 3L9UA 2E7PA 4WETA 2WULA 1AUCA 3ERGA 5IMFA 1HNAA 3IAM2 2PMTA 2AJQB 2GSRA 1V57A 2GQMA 2E0QA 3ZFBA 1B48A 4KB3A 1OE7A 3WGXA 2H1DA 4K8MA 2WJUA 3RPPA 1OVNA 4MABA 2RM6A 1XXUA 1SD9A 3D6IA 1O73A 5IPHA 4AF2A 3KEBA 1X5CA 2QGVA 3HY2A 1MDKA 1Z7RA 3IAS2 1GSUA 5JWQB 9GSSA 3BCKA 2H0HA 4OCEA 1GL8A 4IVFA 4ZB8A 5G31A 3GNJA 2OE3A 1VF2A 4DEJA 3L0HA 2VCWA 3L9SA 2LKUA 5ECQB 2X8HA 3GHAA 5AISA 2I3YA 1U88A 4GXZA 4PUFC 3LGCA 5B7CA 1AAZA 12GSA 1F9MA 4POKA 4ZILA 14GSA 2VL2A 4O92A 2JU5A 4OMVA 3WT1A 3PGTA 1S3CA 6GSTA 4BWSA 5HR0A 1YF0A 4CHSA 4GCIA 4PQHA 5E59A 5JCUA 18GSA 2LNTA 3D22A 1BYEA 1KBNA 2VLVA 3H1NA 5B8BA 2LTKA 4O32A 1ST9A 5KEJA 3VLNA 3Q18A 4EF0A 4HDEA 1YKCA 4HEA2 1NM3A 3TJKA 1THXA 4ZL9A 5HR1A 1FVKA 1SKRB 4ULXA 5ID2A 4EVMA 3WGEA 2H6XA 2V1MA 1R7HA 4Z7XA 2WRTA 3CRTA 1UVZA 3EC3A 5DAKB 3HDCA
chains in the Genus database with same CATH topology
4N10A 2HYXA 2WCIA 2FLSA 1EWXA 1JLWA 1SYXA 1GNWA 2AAWA 1FB6A 3LXTA 5IMVA 2PBJA 2H66A 1K0DA 1N8JA 4NXIA 1SYRA 5JCWA 3KH7A 1PX6A 1J08A 3VK9A 5DQSA 5F8BA 4Z2UA 2YJHA 3ME8A 1PKZA 2PWJA 4L5OA 4ZBAA 3F4TA 3APQA 4K2XA 4I6XA 4K5RA 4EUYA 4ZXGA 1TK5B 5CRDA 5E4WA 3KCMA 2FUG2 2H0IA 5C04A 4KH7A 5GSSA 2B5XA 2HZFA 4ISDA 1UN2A 2FHEA 3A2WA 4MK3A 2LJAA 2OJLA 3LG6A 1A8YA 3LWAA 2OADA 3NIVA 4IGJA 3HJPA 4I5QA 4KW6A 1AC1A 2NPBA 1GRXA 1XOAA 3GIXA 4G0IA 3CSHA 3CYNA 3KP9A 3GUSA 2OKAA 1SJ6A 2DLXA 4IHUA 1EZKA 4AGSA 2CV4A 3GL5A 3ERFA 3LXZA 3FRCA 1OYJA 3DVWA 1ZYNA 5ECKB 2RIIA 4OO5A 5D8IA 2YNXA 4MPGA 3H8QA 2HFDA 4LLRA 1JHBA 2M72A 4TN8A 2H76A 4F0CA 3UAPA 3ZFLA 5HR3A 1WWJA 4L8EA 2LV3A 3IOSA 5A5KA 1AW9A 4F9ZA 2CVKA 2YV7A 1VRSD 3TKQA 3DXBA 1W4VA 2NDOA 1TK0B 2GT5A 1I5GA 2MBTA 2IIYA 4ECBA 1GSEA 4YKFA 4KE3A 2H70A 2IMKA 2H73A 2MMNA 6GSSA 1AIUA 3LORA 1NHYA 1TXXA 2R0PA 1PN9A 4J57E 1U3AA 5KOWA 1XW6A 3F63A 3UL3A 2F3MA 5DCGA 2EIOA 2IWTA 1B8XA 2H1AA 1EGRA 3HA9A 2GZPA 2JZTA 2VLUA 3Q74A 4J56E 5B6MA 3IRAA 4JR4A 2VO4A 3WD6A 4JRRA 2FGXA 1SKSB 2I81A 4K0GA 3QD9A 4XS4A 4Q5FA 22GSA 2X49A 4XRDA 4WR5A 2X8CA 3EURA 4HUAA 1TRUA 2NTOA 3W6GA 4MH3A 3VWXA 2C80A 1GH2A 3TJBA 2O89A 3GTUA 1ZMAA 2L4QA 4X43A 2JSYA 2OACA 4GTUA 3DEXA 4G19A 3PR8A 5GAPD 3CRUA 3ZIVA 2P31A 2HLSA 11GSA 1LU4A 1GSFA 2HXKA 3ZYWA 4F2IA 5F0GA 3IR4A 1VF1A 4HOJA 4MJEA 4FYBA 4DVCA 4DSQA 3EE2A 3GH6A 3PPUA 3TJJA 4WF4A 20GSA 10GSA 5D9VA 2VCTA 3RBTA 1PD21 2P5QA 2K18A 3QAGA 2KP1A 4WF5A 4JZQA 3HVXA 5A4WA 5CAXA 1QGVA 2I1UA 4Q5NA 4EDZA 1FB0A 1XPVA 2GGTA 4XRAA 1OKTA 2FA4A 3HVVA 6GSVA 4IKHA 2RM5A 2DJ0A 3QAVA 1HD2A 5KN3A 4PNFA 1Z9HA 5CP1A 4V2NA 2MMAA 1T00A 2I9HA 2VCQA 1X5DA 3IK9A 4EO3A 3H4KA 2ES7A 16GSA 3IHGA 4HJMA 5IO0A 2YJ7A 4TVEA 1PSQA 2QA2A 3K8NA 3IHQA 3QAWA 1G7EA 1PKWA 3TUEA 5AIVA 3TOTA 1Q4JA 1M2BA 3LYKA 1JFUA 1PRXA 2RUEA 1SKWB 4Q5QA 3M1GA 2R3XA 3TKSE 2B1LA 4JE1A 2C3TA 2V41A 1YJ6A 1JZRA 2YCDA 2VL3A 4TR4A 4PQ1A 2H1BA 1F6MC 1TJDA 4V2LA 2WFCA 1USBA 3ZMKA 2O85A 1OC9A 4KGIA 1PN0A 5CNWA 5ABRA 2R4VA 1VF4A 4TRXA 2LEGA 1T3BA 3W8SA 1K3YA 1ABAA 3QFBC 3KXOA 2NVLA 3RHCA 3FMWA 2AV4A 1O85A 2MMZA 3C71A 4LL1B 1W89A 1T4YA 2DKIA 3UBLA 3CMIA 5JCGA 5KN2A 4F0BA 3HCZA 4O5QA 1K0NA 1LBKA 2R5GA 4JEDA 4X0XA 3GA4A 3U5RE 3HXSA 1FHEA 4FO5A 3MWHA 4POBA 1YEPA 1FOVA 1YF1A 1AQXA 4D73A 1GULA 5G1KA 1SK0A 3SBCA 2OBKA 3KGKA 2HE3A 2O8VB 5JWRB 3A3TA 1WIKA 4TXOB 2LSTA 3GKNA 2C0EA 3L9VA 1ERTA 1WJKA 2B7JA 3VPQA 2EIRA 1XWAA 1F2EA 5CRHA 1XW9A 1A23A 4HZ2A 5HFIA 2IN3A 3FR3A 4G0KA 1CQGA 2F9SA 5B8AA 3RPNA 2HSMA 2D2ZA 5HQPA 2L4CA 4YAPA 2FWHA 2RUFA 1XWGA 4JU5A 5J5NA 3LJRA 5ELGA 1BEDA 3IK7A 2DSAA 2GS3A 2WDUA 4RI7A 4N0ZA 5F06A 4YAVA 2GTUA 5BMUA 4K7NA 2J23A 1J9BA 1BJXA 3FZ9A 5DJMA 3GURA 3IC4A 2HRAA 4WXTA 1SENA 3ZREA 5LCZA 3IBHA 3IPZA 4PQIA 1GWCA 3IV4A 3HHVA 4YQMA 2IMEA 1HQOA 5ECRB 3HVSA 1MD3A 2DJ2A 1TDIA 4N30A 3VI7A 2XBIA 1SD8A 4MJAA 2IFQB 4ID0A 3P8WA 5DDLA 1ZYPA 6GSXA 1R5AA 4OCFA 1T8EB 3DYRA 3GKMA 1ML6A 1U87A 1RW1A 2GQLA 2JZRA 3KD0A 3IC8A 4ECCA 2P5RA 4QQ7A 2HSHA 3I6AA 5KOXA 2FCHA 2YWOA 4TKYA 3SWLA 2E2GA 1F3AA 2GQKA 3F3RA 1K3OA 6GSWA 3C1SA 4GSTA 4LL4B 4FYCA 2RLIA 1K0MA 5ECOB 1XWBA 1Z6NA 1K0AA 2LRNA 3KM6A 4GSSA 3ZVJA 5C00A 5DVBA 1TRSA 1GP1A 5J4UA 1ZL9A 1GTUA 2HZEA 1QMVA 4I97A 4EIPA 1MEKA 5J3RA 2YZUA 4CDOA 3CXGA 5G1LA 2ZUPA 5DCHA 3NOFA 6GSYA 1V58A 4TR0A 2F8FA 7GSSA 5KN1A 1JZWA 1EEJA 1AXDA 4KDUA 3E9JB 3HD5A 4LMVA 1X5EA 1PL1A 3GKXA 1PMTA 4EXJA 3F9UA 4AJ8A 3MYDA 3N9JA 3EU3A 1XBSA 2LJKA 4OWYA 2MBSA 4KSOA 2VUPA 1WOUA 2OE0A 3M8NA 1GSQA 2O7KA 4NWYA 1K3LA 4KCEA 1OAZA 4CY8A 1WPIA 1XVWA 2JSZA 2H71A 1ERWA 4ML1A 2IMFA 1VF3A 4XIHA 2GLRA 1ACVA 4USSA 3FR9A 1UC7A 4MZCA 1YKAA 3FK8A 4XTSA 3FZ4A 5IOXA 2A2RA 2YWMA 17GSA 4J2FA 4ZIJA 3P2AA 3H79A 5INYA 4HU7A 3TDGA 5D96A 1GSDA 4BL7B 3Q6OA 2VL9A 1DUGA 4GQFA 2X4AA 4TR1B 4KDXA 4TW5A 3V1WA 1GUMA 3APOA 3QPMA 2JL4A 3TRPA 1G0TA 4NAXA 2YANA 5A4VA 1PGTA 4JR6A 4WBRD 4RI6A 4BVYB 4Z2RA 3FYGA 3ZTLA 3WT2A 2DKHA 3ISOA 4WR4A 2X99A 3S9FA 1PL2A 4POLA 3F0IA 5EY6A 2B1KA 2CAIA 2V2GA 3L78A 1TKDB 4ZL7A 2WS2A 2K8SA 1SL2B 1HNCA 3A5IA 4EE0A 3ZRDA 5BRTA 4RQXA 5G5FA 5CYYA 4HZ4A 1QK8A 4K1FA 2HRKA 2VM1A 2YWNA 4TXVA 2N5FA 4NPBA 3LEFA 3G7YA 2H1GA 4H86A 3FW2A 3A2XA 4KA0A 3TB2A 3ZITA 1ZYEA 1UA5A 4PUAA 5EVOA 4BWQA 2DIZA 6GSUA 3QMXA 4ZBBA 4PXOA 2CZ2A 1TP9A 3EVIA 3O6TA 2LQOA 4BPYA 1SU9A 1BG5A 3DWVA 2FWFA 4PTSA 2ZNMA 1WE0A 2PVOC 3GYKA 1X9WB 3KMOA 4G9HA 1Z3EA 3GSSA 5H5RA 3G7JA 2LS5A 5DAKA 3ZMLA 4DSSB 1A24A 3A2VA 3Q19A 2L59A 4KDYA 2YP6A 2CX4A 3M9KA 1YDKA 1G6WA 4X4JA 2VCZA 4ZB6A 2ZCTA 2OE1A 2KLXA 1ON4A 3VPTA 2LJRA 3HZ4A 5ECIB 2VLTA 1O81A 5DQYA 2CQ9A 4KCAA 4EIQA 1NHOA 2LNSA 4K5SA 1OE8A 4MH2A 4ECIA 4HU9A 3TOUA 1MDIA 3KJYA 1A2JA 5FT3A 4WKWA 3GV1A 3M9JA 1BAYA 4IQ1A 3LFLA 1JLVA 5G2ZA 4ZBDA 2L6DA 3LQ7A 2QSIA 1ZOFA 1J0FA 4RQRA 5DBQA 5ECNB 4KF9A 5H5QA 3HYPA 1GUHA 2OA7A 4EL1A 2GSQA 3KTBA 2N5AA 1XIYA 4K6XA 1A2LA 4EDYA 3GMFA 3GFKA 1SJZA 4V1Ap 4EKZA 3TRXA 5F05A 4O7HA 3BBYA 2A2SA 3PH9A 2PERA 1EV4A 3FHKA 4PNGA 4NHZA 2YV9A 8GSSA 4ZB9A 2C0GA 4BL7A 3RHBA 2LRCA 2WGRA 3FY7A 4ML6A 1TK8B 4HI7A 4TR1A 2YZHA 3EMXA 3GKKA 5LNKe 2CA8A 1URMA 4K9ZA 1O8WA 1QUWA 1DBYA 2AUVA 3KH9A 4GLTA 5IM9A 1BX9A 1K0OA 5IO2A 1S3AA 3F4RA 3MDKA 3F3QA 1R5PA 2CX3A 1EOHA 2FWEA 3I43A 1V98A 1ERVA 2Z9SA 3IA1A 1A8LA 2B5EA 2YN1A 5FWGA 2TIRA 2YOIA 3DRNA 3IDVA 1C72A 1TU7A 5ECMB 4K7OA 1EEMA 5GZZB 1B9YC 2G2QA 4LMWA 4AJ6A 1QFNA 4F03A 1ILOA 4ICYA 3ZVJD 1A0FA 4BA7A 2YWIA 1V9WA 4P3YB 1M9AA 5ID2B 1WP0A 3CBUA 1Z5YE 5ECPB 2M80A 2R2JA 1XVQA 2N5BA 4L5LA 4LA1A 3OR5A 3O76A 3FEUA 2DC5A 3P90A 4MLYA 2LRTA 1G7OA 4WEYA 4RUVA 3DGQA 3CSJA 5GSTA 1O6JA 5IOWA 3GX0A 1A0RP 3GRXA 5DALB 2PGTA 1QQ2A 3DIEA 4X1UA 5D9WA 1ZGNA 3WGDA 1FW1A 1T4ZA 4XS6A 3TKSC 2K6VA 2K9FA 2LQQA 5IMZA 1GNEA 3U6VA 5D73A 3VWWA 1EP8A 3VURA 3P7XA 1M99A 2ON5A 1TW9A 2A4VA 4IBPA 4MA9A 3MIXA 3UOMA 3DMLA 1XOBA 2DJ3A 1SL1B 3LW9A 2CVBA 1QXHA 2FWGA 4CW9A 3D0ZA 2H01A 5B6NA 5IMDA 2H6YA 1H4OA 3E0UA 2VCXA 19GSA 4MMMA 2IMDA 3O3TA 4YKGA 1SK1A 1EP7A 2HNLA 1CQHA 3US3A 3D5JA 3DVXA 4FQUA 2EC4A 4MPFA 1PX7A 2XBQA 4GF0A 1FG4A 1GTIA 4I8BA 1B4PA 2F8AA 4YQVA 2DMLA 2HT9A 2A2PA 1GLPA 5COHA 2J9HA 1FO5A 2V32A 4IQAA 5HFGA 1ZCPA 1TI1A 3VFIA 4XS1A 1OC3A 4IJIA 1I9DA 1GSSA 1U3IA 2V6KA 3EYTA 4MZBA 3PINA 1X9SB 3M3MA 4IELA 1K0CA 3EPTA 5G5EA 1GSYA 2BMXA 4CY6A 3ME7A 3HKRA 1KNGA 2QA1A 3CTFA 1YEXA 4L0UA 3TJFA 3ZZXA 2L5LA 2XPDA 1X9MB 1Y6EA 4KAEA 1XWKA 3UIWA 2C1YA 4O5UA 3RAZA 2V6OA 1F3BA 1RQMA 2X8GA 3ZLPA 3APSA 4MZWA 3LYPA 3CSIA 4E8EA 2DJJA 5D93A 1XCCA 3EWLA 3EMPA 3AY8A 1DE1A 4TOPA 3R3EA 3QOUA 5IMCA 1ZZYA 3JCML 1OC8A 4XHMA 4Q5RA 1SJIA 1E6BA 4KUNA 4WBJA 1PA3A 4OO4A 1TI3A 3QR6A 1Z7PA 2GDRA 2TRXA 2P0GA 2PVQA 3ZL5A 5A4UA 4XS4B 1Q98A 2H30A 3LSZA 4GRFA 4HQZA 2OBIA 3GTUB 2REMA 3HJMA 4NHWA 1NW2A 2H0GA 2R0GA 1V40A 2IMIA 2BJXA 4YH2A 2DBCA 2GSTA 1FVJA 5DJLA 1GTAA 1Y25A 3GH9A 2FD3A 4MDCA 4GWRA 3F6DA 1A2MA 1M2DA 3DKSA 3ED3A 3FZAA 3KZQA 3KMNA 3F4SA 2C4JA 3A5WA 1XWCA 5DALA 2EIQA 3GSTA 1Z6MA 1AQWA 3TKSA 4OD7A 1THOA 3MNGA 1OKDA 2B7KA 3E3EA 1V2AA 5AN1A 5CRGA 4TXOA 1XFLA 3GX8A 2XHFA 2K8VA 3GN3A 1R4WA 4FIWA 3HJOA 3TCOA 4PX1A 1RK4A 4MCUA 4IN0A 3TRQA 3C73A 4MP4A 1EGOA 3D21A 1MDJA 4MNNA 1G6YA 4L0WA 2R6KA 4PGTA 1T1VA 2DJKA 5LD0A 2UZ8A 3TJGA 1M9BA 4OFNA 4KSMA 4IP1A 4I2TA 2H75A 5ECLB 3BJ5A 2H8LA 5ENUA 2C0DA 4OFMA 2MMOA 4NV5A 3C8EA 1XZOA 3FR6A 4ECJA 2QC7A 4YQUA 4QL9A 1AQVA 4XCSA 2CT6A 5IPGA 1MTCA 3UEMA 1SL0B 2XPEA 1X0RA 4POMA 4O5RA 1VGLA 3VWVA 2IL3A 3UMAA 2A4HA 2TRCP 1EV9A 3G9BA 2HRFA 5IMAA 5D9XA 2KP2A 2G0FA 4KX4A 4Z2TA 1T7PB 4HS1A 4A5PA 2GZYA 1FOHA 2B3SA 3H93A 1GLQA 4AJ7A 3UVTA 1M0UA 1WRYA 3MSZA 1K0BA 2GT6A 3N5OA 2C3NA 3C1RA 2IFQA 4G2EA 1B9XC 2CZ3A 4IS0A 2B6MA 1TU8A 2QKEA 2AHEA 1OC9B 4MF7A 4MJBA 2FNOA 3TGZA 3F8UA 3D4MA 3QFAC 2JACA 4E8HA 2I4AA 3ERWA 4V1Ag 4F82A 5CRWA 2H19A 1M7TA 4BVXB 3KIJA 2VD0A 2E2MA 4IW9A 4HQSA 4ILFA 2VIMA 2KUCA 2IJYA 1MD4A 4EC0A 5ECSA 5J41A 4OFTA 1KEBA 2DMMA 3KP8A 1R26A 1YQ1A 2PN8A 2JZSA 2C0FA 3M0FA 3NZNA 4D73B 3UJ1A 2IPAA 5HFKA 1O7UA 5AIXA 2FY6A 5CO3A 4MF6A 1WMJA 2GVPA 3I9V2 5JWOB 2WZ9A 4G0LA 3GL3A 1N2AA 2M46A 2L6CA 3BD2A 1M2AA 3QCPA 1H75A 1IYHA 5ECHB 1YZXA 2VM2A 3D4TA 4GSNA 3ZIJA 4QL7A 2R37A 2R0CA 13GSA 1NSWA 4V2MA 3CTGA 2MYGA 2H6ZA 2O87A 2HRNA 3FZ5A 1FAAA 4IP6A 1ERUA 4MJCA 2JADA 2FA8A 5ELAA 5FHIA 3W8JA 2PUKC 3IE3A 2ON7A 1GTBA 5HR2A 4KNDA 1KTEA 3R2QA 2CAQA 2VOCA 4FYUA 3RDWA 2YPMA 3UVHA 1TOFA 3TKPA 2ALBA 1JZOA 5AGYA 1HYUA 2HSYA 5IIZA 4K0NA 1TRVA 1O8XA 3QDNA 3VWUA 5F07A 2VL2C 2NBSA 5H5SA 4K7IA 4BVYA 5IQYA 4TR3A 2BTOT 3TKRA 5CREA 4HJ2A 2LUSA 2DIYA 2C8UA 3L4NA 5G30A 3IXRA 1YY7A 3EINA 3I69A 2MZCA 4ZL8A 4N0VA 3HZ8A 1LJRA 5EPFA 1PQNA 4NMUA 3UBKA 1IYIA 5L71A 4FH8A 1GUKA 4DSRA 1DE2A 1TTZA 1HNBA 2KHPA 2PU9C 3C7MA 2H74A 2GZZA 4MF5A 4JBBA 1ZYQB 3DD3A 2X64A 3UARA 4IJ3A 2HZEB 2XC2A 2PPTA 3EU4A 3G7IA 4NV2A 4I2UA 2DJ1A 3WYWA 2VAFA 1E2YA 3J7Yb 1U6TA 1S3DA 4G10A 2HI7A 2L5OA 4BVXA 2CVDA 3BCIA 2L57A 5D9TA 3VI5A 5J9CA 5GAND 5EL8A 4N11A 2VD1A 1DSBA 5J9BA 2KOKA 1B4QA 1XW5A 3BOAA 2WB9A 1BQ7A 5KN0A 1JZDA 3FKFA 4PURA 4DSSA 2AYTA 3J7Yk 2F51A 4K2DA 1SK2A 2C3QA 1EOGA 4GQCA 4ACSA 2H72A 2AB6A 2GSSA 3KTLA 1TRWA 3MAKA 2VCVA 3F6FA 2B5YA 1F37A 3L9UA 2E7PA 4WETA 2WULA 1AUCA 3ERGA 5IMFA 1HNAA 3IAM2 2PMTA 2AJQB 2GSRA 1V57A 2GQMA 2E0QA 3ZFBA 1B48A 4KB3A 1OE7A 3WGXA 2H1DA 4K8MA 2WJUA 3RPPA 1OVNA 4MABA 2RM6A 1XXUA 1SD9A 3D6IA 1O73A 5IPHA 4AF2A 3KEBA 1X5CA 2QGVA 3HY2A 1MDKA 1Z7RA 3IAS2 1GSUA 5JWQB 9GSSA 3BCKA 2H0HA 4OCEA 1GL8A 4IVFA 4ZB8A 5G31A 3GNJA 2OE3A 1VF2A 4DEJA 3L0HA 2VCWA 3L9SA 2LKUA 5ECQB 2X8HA 3GHAA 5AISA 2I3YA 1U88A 4GXZA 4PUFC 3LGCA 5B7CA 1AAZA 12GSA 1F9MA 4POKA 4ZILA 14GSA 2VL2A 4O92A 2JU5A 4OMVA 3WT1A 3PGTA 1S3CA 6GSTA 4BWSA 5HR0A 1YF0A 4CHSA 4GCIA 4PQHA 5E59A 5JCUA 18GSA 2LNTA 3D22A 1BYEA 1KBNA 2VLVA 3H1NA 5B8BA 2LTKA 4O32A 1ST9A 5KEJA 3VLNA 3Q18A 4EF0A 4HDEA 1YKCA 4HEA2 1NM3A 3TJKA 1THXA 4ZL9A 5HR1A 1FVKA 1SKRB 4ULXA 5ID2A 4EVMA 3WGEA 2H6XA 2V1MA 1R7HA 4Z7XA 2WRTA 3CRTA 1UVZA 3EC3A 5DAKB 3HDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N10 A;  2HYX A;  2WCI A;  2FLS A;  1EWX A;  1JLW A;  1SYX A;  1GNW A;  2AAW A;  1FB6 A;  3LXT A;  5IMV A;  2PBJ A;  2H66 A;  1K0D A;  1N8J A;  4NXI A;  1SYR A;  5JCW A;  3KH7 A;  1PX6 A;  1J08 A;  3VK9 A;  5DQS A;  5F8B A;  2YJH A;  3ME8 A;  1PKZ A;  2PWJ A;  4L5O A;  4ZBA A;  3F4T A;  3APQ A;  4I6X A;  4EUY A;  4ZXG A;  1TK5 B;  5CRD A;  5E4W A;  3KCM A;  2FUG 2;  2H0I A;  5C04 A;  4KH7 A;  5GSS A;  2B5X A;  2HZF A;  4ISD A;  1UN2 A;  2FHE A;  3A2W A;  4MK3 A;  2LJA A;  2OJL A;  3LG6 A;  1A8Y A;  3LWA A;  2OAD A;  3NIV A;  4IGJ A;  3HJP A;  4I5Q A;  4KW6 A;  1AC1 A;  2NPB A;  1GRX A;  1XOA A;  3GIX A;  3CSH A;  3CYN A;  3KP9 A;  3GUS A;  2OKA A;  1SJ6 A;  2DLX A;  4IHU A;  1EZK A;  4AGS A;  2CV4 A;  3GL5 A;  3ERF A;  3LXZ A;  3FRC A;  1OYJ A;  3DVW A;  5ECK B;  2RII A;  4OO5 A;  5D8I A;  2YNX A;  4MPG A;  3H8Q A;  2HFD A;  4LLR A;  1JHB A;  2M72 A;  4TN8 A;  2H76 A;  4F0C A;  3UAP A;  3ZFL A;  5HR3 A;  1WWJ A;  4L8E A;  2LV3 A;  3IOS A;  5A5K A;  1AW9 A;  4F9Z A;  2CVK A;  2YV7 A;  1VRS D;  3TKQ A;  3DXB A;  1W4V A;  2NDO A;  1TK0 B;  2GT5 A;  1I5G A;  2MBT A;  2IIY A;  4ECB A;  1GSE A;  4KE3 A;  2H70 A;  2IMK A;  2H73 A;  2MMN A;  6GSS A;  1AIU A;  3LOR A;  1NHY A;  1TXX A;  1PN9 A;  4J57 E;  1U3A A;  1XW6 A;  3F63 A;  3UL3 A;  2F3M A;  5DCG A;  2EIO A;  2IWT A;  1B8X A;  2H1A A;  1EGR A;  3HA9 A;  2GZP A;  2JZT A;  2VLU A;  3Q74 A;  4J56 E;  5B6M A;  3IRA A;  4JR4 A;  2VO4 A;  3WD6 A;  4JRR A;  2FGX A;  1SKS B;  2I81 A;  4K0G A;  3QD9 A;  4XS4 A;  4Q5F A;  22GS A;  4XRD A;  4WR5 A;  2X8C A;  3EUR A;  4HUA A;  1TRU A;  2NTO A;  3W6G A;  4MH3 A;  3VWX A;  2C80 A;  1GH2 A;  3TJB A;  2O89 A;  3GTU A;  1ZMA A;  2L4Q A;  4X43 A;  2JSY A;  2OAC A;  4GTU A;  3DEX A;  4G19 A;  3PR8 A;  5GAP D;  3CRU A;  3ZIV A;  2P31 A;  2HLS A;  11GS A;  1LU4 A;  1GSF A;  2HXK A;  3ZYW A;  4F2I A;  5F0G A;  3IR4 A;  1VF1 A;  4HOJ A;  4MJE A;  4FYB A;  4DVC A;  4DSQ A;  3EE2 A;  3GH6 A;  3TJJ A;  4WF4 A;  20GS A;  10GS A;  5D9V A;  2VCT A;  3RBT A;  1PD2 1;  2P5Q A;  2K18 A;  3QAG A;  2KP1 A;  4WF5 A;  4JZQ A;  3HVX A;  5A4W A;  5CAX A;  1QGV A;  2I1U A;  4Q5N A;  4EDZ A;  1FB0 A;  1XPV A;  2GGT A;  4XRA A;  1OKT A;  2FA4 A;  3HVV A;  6GSV A;  4IKH A;  2RM5 A;  2DJ0 A;  3QAV A;  1HD2 A;  5KN3 A;  4PNF A;  1Z9H A;  5CP1 A;  4V2N A;  2MMA A;  1T00 A;  2I9H A;  2VCQ A;  1X5D A;  3IK9 A;  4EO3 A;  3H4K A;  2ES7 A;  16GS A;  4HJM A;  5IO0 A;  2YJ7 A;  4TVE A;  1PSQ A;  3K8N A;  3IHQ A;  3QAW A;  1G7E A;  1PKW A;  3TUE A;  5AIV A;  3TOT A;  1Q4J A;  1M2B A;  3LYK A;  1JFU A;  1PRX A;  2RUE A;  1SKW B;  4Q5Q A;  3M1G A;  2R3X A;  3TKS E;  2B1L A;  4JE1 A;  2C3T A;  2V41 A;  1YJ6 A;  1JZR A;  2YCD A;  2VL3 A;  4TR4 A;  4PQ1 A;  2H1B A;  1F6M C;  1TJD A;  4V2L A;  2WFC A;  1USB A;  3ZMK A;  2O85 A;  1OC9 A;  4KGI A;  5CNW A;  5ABR A;  2R4V A;  1VF4 A;  4TRX A;  2LEG A;  1T3B A;  3W8S A;  1K3Y A;  1ABA A;  3QFB C;  3KXO A;  2NVL A;  3RHC A;  2AV4 A;  1O85 A;  2MMZ A;  3C71 A;  4LL1 B;  1W89 A;  1T4Y A;  3UBL A;  3CMI A;  5JCG A;  5KN2 A;  4F0B A;  3HCZ A;  1K0N A;  1LBK A;  2R5G A;  4JED A;  4X0X A;  3GA4 A;  3U5R E;  3HXS A;  1FHE A;  4FO5 A;  3MWH A;  4POB A;  1YEP A;  1FOV A;  1YF1 A;  1AQX A;  4D73 A;  1GUL A;  5G1K A;  1SK0 A;  3SBC A;  2OBK A;  3KGK A;  2HE3 A;  2O8V B;  5JWR B;  3A3T A;  1WIK A;  4TXO B;  2LST A;  3GKN A;  2C0E A;  3L9V A;  1ERT A;  1WJK A;  2B7J A;  3VPQ A;  2EIR A;  1XWA A;  1F2E A;  5CRH A;  1XW9 A;  1A23 A;  4HZ2 A;  5HFI A;  2IN3 A;  3FR3 A;  1CQG A;  2F9S A;  5B8A A;  3RPN A;  2D2Z A;  5HQP A;  2L4C A;  4YAP A;  2FWH A;  2RUF A;  1XWG A;  4JU5 A;  5J5N A;  3LJR A;  5ELG A;  1BED A;  3IK7 A;  2DSA A;  2GS3 A;  2WDU A;  4RI7 A;  4N0Z A;  5F06 A;  4YAV A;  2GTU A;  4K7N A;  2J23 A;  1J9B A;  1BJX A;  3FZ9 A;  5DJM A;  3GUR A;  3IC4 A;  4WXT A;  1SEN A;  3ZRE A;  5LCZ A;  3IBH A;  3IPZ A;  4PQI A;  1GWC A;  3IV4 A;  3HHV A;  4YQM A;  2IME A;  1HQO A;  5ECR B;  3HVS A;  1MD3 A;  2DJ2 A;  1TDI A;  4N30 A;  3VI7 A;  2XBI A;  1SD8 A;  4MJA A;  2IFQ B;  4ID0 A;  3P8W A;  5DDL A;  6GSX A;  1R5A A;  4OCF A;  1T8E B;  3DYR A;  3GKM A;  1ML6 A;  1U87 A;  1RW1 A;  2GQL A;  2JZR A;  3KD0 A;  4ECC A;  2P5R A;  4QQ7 A;  2HSH A;  3I6A A;  2FCH A;  2YWO A;  4TKY A;  3SWL A;  2E2G A;  1F3A A;  2GQK A;  3F3R A;  1K3O A;  6GSW A;  3C1S A;  4GST A;  4LL4 B;  4FYC A;  2RLI A;  1K0M A;  5ECO B;  1XWB A;  1Z6N A;  1K0A A;  2LRN A;  3KM6 A;  4GSS A;  3ZVJ A;  5C00 A;  5DVB A;  1TRS A;  1GP1 A;  5J4U A;  1ZL9 A;  1GTU A;  2HZE A;  1QMV A;  4I97 A;  1MEK A;  5J3R A;  2YZU A;  4CDO A;  3CXG A;  5G1L A;  2ZUP A;  5DCH A;  3NOF A;  6GSY A;  1V58 A;  4TR0 A;  2F8F A;  7GSS A;  5KN1 A;  1JZW A;  1EEJ A;  1AXD A;  4KDU A;  3E9J B;  3HD5 A;  4LMV A;  1X5E A;  1PL1 A;  3GKX A;  1PMT A;  4EXJ A;  3F9U A;  4AJ8 A;  3N9J A;  3EU3 A;  1XBS A;  2LJK A;  4OWY A;  2MBS A;  4KSO A;  2VUP A;  1WOU A;  2OE0 A;  3M8N A;  1GSQ A;  2O7K A;  4NWY A;  1K3L A;  4KCE A;  1OAZ A;  1WPI A;  1XVW A;  2JSZ A;  2H71 A;  1ERW A;  4ML1 A;  2IMF A;  1VF3 A;  4XIH A;  2GLR A;  1ACV A;  3FR9 A;  1UC7 A;  4MZC A;  1YKA A;  3FK8 A;  4XTS A;  3FZ4 A;  5IOX A;  2A2R A;  2YWM A;  17GS A;  4J2F A;  4ZIJ A;  3P2A A;  3H79 A;  5INY A;  4HU7 A;  3TDG A;  5D96 A;  1GSD A;  3Q6O A;  2VL9 A;  1DUG A;  4GQF A;  4TR1 B;  4KDX A;  4TW5 A;  3V1W A;  1GUM A;  3APO A;  3QPM A;  2JL4 A;  3TRP A;  1G0T A;  4NAX A;  2YAN A;  5A4V A;  1PGT A;  4JR6 A;  4WBR D;  4RI6 A;  3FYG A;  3ZTL A;  3WT2 A;  3ISO A;  4WR4 A;  2X99 A;  3S9F A;  1PL2 A;  4POL A;  3F0I A;  5EY6 A;  2B1K A;  2CAI A;  2V2G A;  3L78 A;  1TKD B;  4ZL7 A;  2WS2 A;  2K8S A;  1SL2 B;  1HNC A;  4EE0 A;  3ZRD A;  4RQX A;  5G5F A;  5CYY A;  4HZ4 A;  1QK8 A;  4K1F A;  2VM1 A;  2YWN A;  4TXV A;  2N5F A;  4NPB A;  3LEF A;  3G7Y A;  2H1G A;  4H86 A;  3FW2 A;  3A2X A;  4KA0 A;  3TB2 A;  3ZIT A;  1ZYE A;  1UA5 A;  5EVO A;  4PUA A;  4BWQ A;  2DIZ A;  6GSU A;  3QMX A;  4ZBB A;  4PXO A;  2CZ2 A;  1TP9 A;  3EVI A;  3O6T A;  2LQO A;  4BPY A;  1SU9 A;  1BG5 A;  3DWV A;  2FWF A;  2ZNM A;  1WE0 A;  2PVO C;  3GYK A;  1X9W B;  3KMO A;  4G9H A;  1Z3E A;  3GSS A;  5H5R A;  3G7J A;  2LS5 A;  5DAK A;  3ZML A;  4DSS B;  1A24 A;  3A2V A;  3Q19 A;  2L59 A;  4KDY A;  2YP6 A;  2CX4 A;  3M9K A;  1YDK A;  1G6W A;  2VCZ A;  4ZB6 A;  2ZCT A;  2OE1 A;  2KLX A;  1ON4 A;  3VPT A;  2LJR A;  3HZ4 A;  5ECI B;  2VLT A;  1O81 A;  5DQY A;  2CQ9 A;  4KCA A;  1NHO A;  2LNS A;  1OE8 A;  4MH2 A;  4ECI A;  4HU9 A;  3TOU A;  1MDI A;  3KJY A;  1A2J A;  5FT3 A;  4WKW A;  3GV1 A;  3M9J A;  1BAY A;  4IQ1 A;  3LFL A;  1JLV A;  5G2Z A;  4ZBD A;  2L6D A;  3LQ7 A;  2QSI A;  1ZOF A;  1J0F A;  4RQR A;  5DBQ A;  5ECN B;  5H5Q A;  3HYP A;  1GUH A;  2OA7 A;  4EL1 A;  2GSQ A;  3KTB A;  2N5A A;  1XIY A;  4K6X A;  1A2L A;  4EDY A;  3GMF A;  3GFK A;  1SJZ A;  4V1A p;  4EKZ A;  3TRX A;  5F05 A;  4O7H A;  3BBY A;  2A2S A;  3PH9 A;  2PER A;  1EV4 A;  3FHK A;  4PNG A;  4NHZ A;  2YV9 A;  8GSS A;  4ZB9 A;  2C0G A;  4BL7 A;  3RHB A;  2LRC A;  2WGR A;  3FY7 A;  4ML6 A;  1TK8 B;  4HI7 A;  4TR1 A;  2YZH A;  3EMX A;  3GKK A;  5LNK e;  2CA8 A;  1URM A;  4K9Z A;  1O8W A;  1QUW A;  1DBY A;  2AUV A;  3KH9 A;  4GLT A;  5IM9 A;  1BX9 A;  1K0O A;  5IO2 A;  1S3A A;  3F4R A;  3MDK A;  3F3Q A;  1R5P A;  2CX3 A;  1EOH A;  2FWE A;  3I43 A;  1V98 A;  1ERV A;  2Z9S A;  3IA1 A;  1A8L A;  2B5E A;  2YN1 A;  5FWG A;  2TIR A;  2YOI A;  3DRN A;  3IDV A;  1C72 A;  1TU7 A;  5ECM B;  4K7O A;  1EEM A;  5GZZ B;  1B9Y C;  2G2Q A;  4LMW A;  4AJ6 A;  1QFN A;  4F03 A;  1ILO A;  3ZVJ D;  1A0F A;  4BA7 A;  2YWI A;  1V9W A;  4P3Y B;  1M9A A;  5ID2 B;  1WP0 A;  3CBU A;  1Z5Y E;  5ECP B;  2M80 A;  2R2J A;  1XVQ A;  2N5B A;  4L5L A;  4LA1 A;  3OR5 A;  3O76 A;  3FEU A;  2DC5 A;  3P90 A;  4MLY A;  2LRT A;  1G7O A;  4WEY A;  4RUV A;  3DGQ A;  3CSJ A;  5GST A;  1O6J A;  5IOW A;  3GX0 A;  1A0R P;  3GRX A;  5DAL B;  2PGT A;  1QQ2 A;  3DIE A;  4X1U A;  5D9W A;  1ZGN A;  3WGD A;  1FW1 A;  1T4Z A;  4XS6 A;  3TKS C;  2K6V A;  2K9F A;  2LQQ A;  5IMZ A;  1GNE A;  3U6V A;  5D73 A;  3VWW A;  1EP8 A;  3VUR A;  3P7X A;  1M99 A;  2ON5 A;  1TW9 A;  2A4V A;  4IBP A;  4MA9 A;  3UOM A;  3DML A;  1XOB A;  2DJ3 A;  1SL1 B;  2CVB A;  1QXH A;  2FWG A;  4CW9 A;  3D0Z A;  2H01 A;  5B6N A;  5IMD A;  2H6Y A;  1H4O A;  3E0U A;  2VCX A;  19GS A;  4MMM A;  2IMD A;  3O3T A;  1SK1 A;  1EP7 A;  2HNL A;  1CQH A;  3US3 A;  3D5J A;  3DVX A;  2EC4 A;  4MPF A;  1PX7 A;  2XBQ A;  4GF0 A;  1FG4 A;  1GTI A;  4I8B A;  1B4P A;  2F8A A;  4YQV A;  2DML A;  2HT9 A;  1GLP A;  5COH A;  2J9H A;  1FO5 A;  2V32 A;  4IQA A;  5HFG A;  1ZCP A;  1TI1 A;  3VFI A;  4XS1 A;  1OC3 A;  4IJI A;  1I9D A;  1GSS A;  1U3I A;  2V6K A;  3EYT A;  4MZB A;  3PIN A;  1X9S B;  3M3M A;  4IEL A;  1K0C A;  5G5E A;  1GSY A;  2BMX A;  3ME7 A;  3HKR A;  1KNG A;  3CTF A;  1YEX A;  4L0U A;  3TJF A;  3ZZX A;  2L5L A;  2XPD A;  1X9M B;  1Y6E A;  4KAE A;  1XWK A;  3UIW A;  2C1Y A;  3RAZ A;  2V6O A;  1F3B A;  1RQM A;  2X8G A;  3ZLP A;  3APS A;  4MZW A;  3LYP A;  3CSI A;  4E8E A;  2DJJ A;  5D93 A;  1XCC A;  3EWL A;  3EMP A;  3AY8 A;  1DE1 A;  4TOP A;  3QOU A;  5IMC A;  1ZZY A;  3JCM L;  1OC8 A;  4XHM A;  4Q5R A;  1SJI A;  1E6B A;  4KUN A;  4WBJ A;  1PA3 A;  4OO4 A;  1TI3 A;  3QR6 A;  1Z7P A;  2GDR A;  2TRX A;  2P0G A;  2PVQ A;  3ZL5 A;  5A4U A;  4XS4 B;  1Q98 A;  2H30 A;  3LSZ A;  4GRF A;  4HQZ A;  2OBI A;  3GTU B;  2REM A;  3HJM A;  4NHW A;  1NW2 A;  2H0G A;  1V40 A;  2IMI A;  2BJX A;  4YH2 A;  2DBC A;  2GST A;  1FVJ A;  5DJL A;  1GTA A;  1Y25 A;  3GH9 A;  2FD3 A;  4MDC A;  4GWR A;  3F6D A;  1A2M A;  1M2D A;  3DKS A;  3ED3 A;  3FZA A;  3KZQ A;  3KMN A;  3F4S A;  2C4J A;  3A5W A;  1XWC A;  5DAL A;  2EIQ A;  3GST A;  1Z6M A;  1AQW A;  3TKS A;  4OD7 A;  1THO A;  3MNG A;  1OKD A;  2B7K A;  3E3E A;  1V2A A;  5AN1 A;  5CRG A;  4TXO A;  1XFL A;  3GX8 A;  2XHF A;  2K8V A;  3GN3 A;  1R4W A;  4FIW A;  3HJO A;  3TCO A;  4PX1 A;  1RK4 A;  4MCU A;  4IN0 A;  3TRQ A;  3C73 A;  4MP4 A;  1EGO A;  3D21 A;  1MDJ A;  1G6Y A;  4L0W A;  2R6K A;  4PGT A;  1T1V A;  2DJK A;  5LD0 A;  3TJG A;  1M9B A;  4OFN A;  4KSM A;  4IP1 A;  4I2T A;  2H75 A;  5ECL B;  3BJ5 A;  2H8L A;  5ENU A;  2C0D A;  4OFM A;  2MMO A;  4NV5 A;  3C8E A;  1XZO A;  3FR6 A;  4ECJ A;  2QC7 A;  4YQU A;  4QL9 A;  1AQV A;  4XCS A;  2CT6 A;  5IPG A;  1MTC A;  3UEM A;  1SL0 B;  2XPE A;  1X0R A;  4POM A;  4O5R A;  1VGL A;  3VWV A;  2IL3 A;  3UMA A;  2TRC P;  1EV9 A;  3G9B A;  2HRF A;  5IMA A;  5D9X A;  2KP2 A;  2G0F A;  4KX4 A;  1T7P B;  4HS1 A;  2GZY A;  2B3S A;  3H93 A;  1GLQ A;  4AJ7 A;  3UVT A;  1M0U A;  1WRY A;  3MSZ A;  1K0B A;  2GT6 A;  3N5O A;  2C3N A;  3C1R A;  2IFQ A;  4G2E A;  1B9X C;  2CZ3 A;  4IS0 A;  2B6M A;  1TU8 A;  2QKE A;  2AHE A;  1OC9 B;  4MF7 A;  4MJB A;  2FNO A;  3TGZ A;  3F8U A;  3D4M A;  3QFA C;  2JAC A;  4E8H A;  2I4A A;  3ERW A;  4V1A g;  4F82 A;  5CRW A;  2H19 A;  1M7T A;  3KIJ A;  2VD0 A;  2E2M A;  4IW9 A;  4HQS A;  4ILF A;  2VIM A;  2KUC A;  2IJY A;  1MD4 A;  4EC0 A;  5ECS A;  5J41 A;  4OFT A;  1KEB A;  2DMM A;  3KP8 A;  1R26 A;  1YQ1 A;  2PN8 A;  2JZS A;  2C0F A;  3M0F A;  3NZN A;  4D73 B;  3UJ1 A;  2IPA A;  5HFK A;  1O7U A;  5AIX A;  2FY6 A;  5CO3 A;  4MF6 A;  1WMJ A;  2GVP A;  3I9V 2;  5JWO B;  2WZ9 A;  3GL3 A;  1N2A A;  2M46 A;  2L6C A;  3BD2 A;  1M2A A;  3QCP A;  1H75 A;  1IYH A;  5ECH B;  1YZX A;  2VM2 A;  3D4T A;  4GSN A;  3ZIJ A;  4QL7 A;  2R37 A;  13GS A;  1NSW A;  4V2M A;  3CTG A;  2MYG A;  2H6Z A;  2O87 A;  2HRN A;  3FZ5 A;  1FAA A;  4IP6 A;  1ERU A;  4MJC A;  2JAD A;  2FA8 A;  5ELA A;  5FHI A;  3W8J A;  2PUK C;  3IE3 A;  2ON7 A;  1GTB A;  5HR2 A;  4KND A;  1KTE A;  3R2Q A;  2CAQ A;  2VOC A;  4FYU A;  3RDW A;  2YPM A;  3UVH A;  1TOF A;  3TKP A;  2ALB A;  1JZO A;  5AGY A;  1HYU A;  2HSY A;  5IIZ A;  4K0N A;  1TRV A;  1O8X A;  3QDN A;  3VWU A;  5F07 A;  2VL2 C;  2NBS A;  5H5S A;  4K7I A;  4BVY A;  5IQY A;  4TR3 A;  2BTO T;  3TKR A;  5CRE A;  4HJ2 A;  2LUS A;  2DIY A;  2C8U A;  3L4N A;  5G30 A;  3IXR A;  1YY7 A;  3EIN A;  3I69 A;  2MZC A;  4ZL8 A;  4N0V A;  3HZ8 A;  1LJR A;  5EPF A;  1PQN A;  4NMU A;  3UBK A;  1IYI A;  5L71 A;  4FH8 A;  1GUK A;  4DSR A;  1DE2 A;  1TTZ A;  1HNB A;  2KHP A;  2PU9 C;  3C7M A;  2H74 A;  2GZZ A;  4MF5 A;  4JBB A;  1ZYQ B;  3DD3 A;  2X64 A;  3UAR A;  4IJ3 A;  2HZE B;  2XC2 A;  2PPT A;  3EU4 A;  3G7I A;  4NV2 A;  4I2U A;  2DJ1 A;  3WYW A;  2VAF A;  1E2Y A;  3J7Y b;  1U6T A;  1S3D A;  4G10 A;  2HI7 A;  2L5O A;  4BVX A;  2CVD A;  3BCI A;  2L57 A;  5D9T A;  3VI5 A;  5J9C A;  5GAN D;  5EL8 A;  4N11 A;  2VD1 A;  1DSB A;  5J9B A;  2KOK A;  1B4Q A;  1XW5 A;  3BOA A;  2WB9 A;  1BQ7 A;  5KN0 A;  1JZD A;  3FKF A;  4PUR A;  4DSS A;  2AYT A;  3J7Y k;  2F51 A;  4K2D A;  1SK2 A;  2C3Q A;  1EOG A;  4GQC A;  4ACS A;  2H72 A;  2AB6 A;  2GSS A;  3KTL A;  1TRW A;  3MAK A;  2VCV A;  3F6F A;  2B5Y A;  1F37 A;  3L9U A;  2E7P A;  4WET A;  2WUL A;  1AUC A;  3ERG A;  5IMF A;  1HNA A;  3IAM 2;  2PMT A;  2AJQ B;  2GSR A;  1V57 A;  2GQM A;  2E0Q A;  3ZFB A;  1B48 A;  4KB3 A;  1OE7 A;  3WGX A;  2H1D A;  4K8M A;  2WJU A;  3RPP A;  1OVN A;  4MAB A;  2RM6 A;  1XXU A;  1SD9 A;  3D6I A;  1O73 A;  5IPH A;  4AF2 A;  3KEB A;  1X5C A;  2QGV A;  3HY2 A;  1MDK A;  1Z7R A;  3IAS 2;  1GSU A;  5JWQ B;  9GSS A;  3BCK A;  2H0H A;  4OCE A;  1GL8 A;  4IVF A;  4ZB8 A;  5G31 A;  3GNJ A;  2OE3 A;  1VF2 A;  4DEJ A;  3L0H A;  2VCW A;  3L9S A;  2LKU A;  5ECQ B;  2X8H A;  3GHA A;  5AIS A;  2I3Y A;  1U88 A;  4GXZ A;  4PUF C;  3LGC A;  5B7C A;  1AAZ A;  12GS A;  1F9M A;  4POK A;  4ZIL A;  14GS A;  2VL2 A;  4O92 A;  2JU5 A;  4OMV A;  3WT1 A;  3PGT A;  1S3C A;  6GST A;  4BWS A;  5HR0 A;  1YF0 A;  4CHS A;  4GCI A;  4PQH A;  5E59 A;  5JCU A;  18GS A;  2LNT A;  3D22 A;  1BYE A;  1KBN A;  2VLV A;  3H1N A;  5B8B A;  2LTK A;  4O32 A;  1ST9 A;  5KEJ A;  3VLN A;  3Q18 A;  4EF0 A;  4HDE A;  1YKC A;  4HEA 2;  1NM3 A;  3TJK A;  1THX A;  4ZL9 A;  5HR1 A;  1FVK A;  1SKR B;  4ULX A;  5ID2 A;  4EVM A;  3WGE A;  2H6X A;  2V1M A;  1R7H A;  4Z7X A;  2WRT A;  3CRT A;  1UVZ A;  3EC3 A;  5DAK B;  3HDC A; 
#chains in the Genus database with same CATH topology
 4N10 A;  2HYX A;  2WCI A;  2FLS A;  1EWX A;  1JLW A;  1SYX A;  1GNW A;  2AAW A;  1FB6 A;  3LXT A;  5IMV A;  2PBJ A;  2H66 A;  1K0D A;  1N8J A;  4NXI A;  1SYR A;  5JCW A;  3KH7 A;  1PX6 A;  1J08 A;  3VK9 A;  5DQS A;  5F8B A;  4Z2U A;  2YJH A;  3ME8 A;  1PKZ A;  2PWJ A;  4L5O A;  4ZBA A;  3F4T A;  3APQ A;  4K2X A;  4I6X A;  4K5R A;  4EUY A;  4ZXG A;  1TK5 B;  5CRD A;  5E4W A;  3KCM A;  2FUG 2;  2H0I A;  5C04 A;  4KH7 A;  5GSS A;  2B5X A;  2HZF A;  4ISD A;  1UN2 A;  2FHE A;  3A2W A;  4MK3 A;  2LJA A;  2OJL A;  3LG6 A;  1A8Y A;  3LWA A;  2OAD A;  3NIV A;  4IGJ A;  3HJP A;  4I5Q A;  4KW6 A;  1AC1 A;  2NPB A;  1GRX A;  1XOA A;  3GIX A;  4G0I A;  3CSH A;  3CYN A;  3KP9 A;  3GUS A;  2OKA A;  1SJ6 A;  2DLX A;  4IHU A;  1EZK A;  4AGS A;  2CV4 A;  3GL5 A;  3ERF A;  3LXZ A;  3FRC A;  1OYJ A;  3DVW A;  1ZYN A;  5ECK B;  2RII A;  4OO5 A;  5D8I A;  2YNX A;  4MPG A;  3H8Q A;  2HFD A;  4LLR A;  1JHB A;  2M72 A;  4TN8 A;  2H76 A;  4F0C A;  3UAP A;  3ZFL A;  5HR3 A;  1WWJ A;  4L8E A;  2LV3 A;  3IOS A;  5A5K A;  1AW9 A;  4F9Z A;  2CVK A;  2YV7 A;  1VRS D;  3TKQ A;  3DXB A;  1W4V A;  2NDO A;  1TK0 B;  2GT5 A;  1I5G A;  2MBT A;  2IIY A;  4ECB A;  1GSE A;  4YKF A;  4KE3 A;  2H70 A;  2IMK A;  2H73 A;  2MMN A;  6GSS A;  1AIU A;  3LOR A;  1NHY A;  1TXX A;  2R0P A;  1PN9 A;  4J57 E;  1U3A A;  5KOW A;  1XW6 A;  3F63 A;  3UL3 A;  2F3M A;  5DCG A;  2EIO A;  2IWT A;  1B8X A;  2H1A A;  1EGR A;  3HA9 A;  2GZP A;  2JZT A;  2VLU A;  3Q74 A;  4J56 E;  5B6M A;  3IRA A;  4JR4 A;  2VO4 A;  3WD6 A;  4JRR A;  2FGX A;  1SKS B;  2I81 A;  4K0G A;  3QD9 A;  4XS4 A;  4Q5F A;  22GS A;  2X49 A;  4XRD A;  4WR5 A;  2X8C A;  3EUR A;  4HUA A;  1TRU A;  2NTO A;  3W6G A;  4MH3 A;  3VWX A;  2C80 A;  1GH2 A;  3TJB A;  2O89 A;  3GTU A;  1ZMA A;  2L4Q A;  4X43 A;  2JSY A;  2OAC A;  4GTU A;  3DEX A;  4G19 A;  3PR8 A;  5GAP D;  3CRU A;  3ZIV A;  2P31 A;  2HLS A;  11GS A;  1LU4 A;  1GSF A;  2HXK A;  3ZYW A;  4F2I A;  5F0G A;  3IR4 A;  1VF1 A;  4HOJ A;  4MJE A;  4FYB A;  4DVC A;  4DSQ A;  3EE2 A;  3GH6 A;  3PPU A;  3TJJ A;  4WF4 A;  20GS A;  10GS A;  5D9V A;  2VCT A;  3RBT A;  1PD2 1;  2P5Q A;  2K18 A;  3QAG A;  2KP1 A;  4WF5 A;  4JZQ A;  3HVX A;  5A4W A;  5CAX A;  1QGV A;  2I1U A;  4Q5N A;  4EDZ A;  1FB0 A;  1XPV A;  2GGT A;  4XRA A;  1OKT A;  2FA4 A;  3HVV A;  6GSV A;  4IKH A;  2RM5 A;  2DJ0 A;  3QAV A;  1HD2 A;  5KN3 A;  4PNF A;  1Z9H A;  5CP1 A;  4V2N A;  2MMA A;  1T00 A;  2I9H A;  2VCQ A;  1X5D A;  3IK9 A;  4EO3 A;  3H4K A;  2ES7 A;  16GS A;  3IHG A;  4HJM A;  5IO0 A;  2YJ7 A;  4TVE A;  1PSQ A;  2QA2 A;  3K8N A;  3IHQ A;  3QAW A;  1G7E A;  1PKW A;  3TUE A;  5AIV A;  3TOT A;  1Q4J A;  1M2B A;  3LYK A;  1JFU A;  1PRX A;  2RUE A;  1SKW B;  4Q5Q A;  3M1G A;  2R3X A;  3TKS E;  2B1L A;  4JE1 A;  2C3T A;  2V41 A;  1YJ6 A;  1JZR A;  2YCD A;  2VL3 A;  4TR4 A;  4PQ1 A;  2H1B A;  1F6M C;  1TJD A;  4V2L A;  2WFC A;  1USB A;  3ZMK A;  2O85 A;  1OC9 A;  4KGI A;  1PN0 A;  5CNW A;  5ABR A;  2R4V A;  1VF4 A;  4TRX A;  2LEG A;  1T3B A;  3W8S A;  1K3Y A;  1ABA A;  3QFB C;  3KXO A;  2NVL A;  3RHC A;  3FMW A;  2AV4 A;  1O85 A;  2MMZ A;  3C71 A;  4LL1 B;  1W89 A;  1T4Y A;  2DKI A;  3UBL A;  3CMI A;  5JCG A;  5KN2 A;  4F0B A;  3HCZ A;  4O5Q A;  1K0N A;  1LBK A;  2R5G A;  4JED A;  4X0X A;  3GA4 A;  3U5R E;  3HXS A;  1FHE A;  4FO5 A;  3MWH A;  4POB A;  1YEP A;  1FOV A;  1YF1 A;  1AQX A;  4D73 A;  1GUL A;  5G1K A;  1SK0 A;  3SBC A;  2OBK A;  3KGK A;  2HE3 A;  2O8V B;  5JWR B;  3A3T A;  1WIK A;  4TXO B;  2LST A;  3GKN A;  2C0E A;  3L9V A;  1ERT A;  1WJK A;  2B7J A;  3VPQ A;  2EIR A;  1XWA A;  1F2E A;  5CRH A;  1XW9 A;  1A23 A;  4HZ2 A;  5HFI A;  2IN3 A;  3FR3 A;  4G0K A;  1CQG A;  2F9S A;  5B8A A;  3RPN A;  2HSM A;  2D2Z A;  5HQP A;  2L4C A;  4YAP A;  2FWH A;  2RUF A;  1XWG A;  4JU5 A;  5J5N A;  3LJR A;  5ELG A;  1BED A;  3IK7 A;  2DSA A;  2GS3 A;  2WDU A;  4RI7 A;  4N0Z A;  5F06 A;  4YAV A;  2GTU A;  5BMU A;  4K7N A;  2J23 A;  1J9B A;  1BJX A;  3FZ9 A;  5DJM A;  3GUR A;  3IC4 A;  2HRA A;  4WXT A;  1SEN A;  3ZRE A;  5LCZ A;  3IBH A;  3IPZ A;  4PQI A;  1GWC A;  3IV4 A;  3HHV A;  4YQM A;  2IME A;  1HQO A;  5ECR B;  3HVS A;  1MD3 A;  2DJ2 A;  1TDI A;  4N30 A;  3VI7 A;  2XBI A;  1SD8 A;  4MJA A;  2IFQ B;  4ID0 A;  3P8W A;  5DDL A;  1ZYP A;  6GSX A;  1R5A A;  4OCF A;  1T8E B;  3DYR A;  3GKM A;  1ML6 A;  1U87 A;  1RW1 A;  2GQL A;  2JZR A;  3KD0 A;  3IC8 A;  4ECC A;  2P5R A;  4QQ7 A;  2HSH A;  3I6A A;  5KOX A;  2FCH A;  2YWO A;  4TKY A;  4HSC X;  3SWL A;  2E2G A;  1F3A A;  2GQK A;  3F3R A;  1K3O A;  6GSW A;  3C1S A;  4GST A;  4LL4 B;  4FYC A;  2RLI A;  1K0M A;  5ECO B;  1XWB A;  1Z6N A;  1K0A A;  2LRN A;  3KM6 A;  4GSS A;  3ZVJ A;  5C00 A;  5DVB A;  1TRS A;  1GP1 A;  5J4U A;  1ZL9 A;  1GTU A;  2HZE A;  1QMV A;  4I97 A;  4EIP A;  1MEK A;  5J3R A;  2YZU A;  4CDO A;  3CXG A;  5G1L A;  2ZUP A;  5DCH A;  3NOF A;  6GSY A;  1V58 A;  4TR0 A;  2F8F A;  7GSS A;  5KN1 A;  1JZW A;  1EEJ A;  1AXD A;  4KDU A;  3E9J B;  3HD5 A;  4LMV A;  1X5E A;  1PL1 A;  3GKX A;  1PMT A;  4EXJ A;  3F9U A;  4AJ8 A;  3MYD A;  3N9J A;  3EU3 A;  3CQF A;  1XBS A;  2LJK A;  4OWY A;  2MBS A;  4KSO A;  2VUP A;  1WOU A;  2OE0 A;  3M8N A;  1GSQ A;  2O7K A;  4NWY A;  1K3L A;  4KCE A;  1OAZ A;  4CY8 A;  1WPI A;  1XVW A;  2JSZ A;  2H71 A;  1ERW A;  4ML1 A;  2IMF A;  1VF3 A;  4XIH A;  2GLR A;  1ACV A;  4USS A;  3FR9 A;  1UC7 A;  4MZC A;  1YKA A;  3FK8 A;  4XTS A;  3FZ4 A;  5IOX A;  2A2R A;  2YWM A;  17GS A;  4J2F A;  4ZIJ A;  3P2A A;  3H79 A;  5INY A;  4HU7 A;  3TDG A;  5D96 A;  1GSD A;  4BL7 B;  3Q6O A;  2VL9 A;  1DUG A;  4GQF A;  2X4A A;  4TR1 B;  4KDX A;  4TW5 A;  3V1W A;  1GUM A;  3APO A;  3QPM A;  2JL4 A;  3TRP A;  1G0T A;  4NAX A;  2YAN A;  5A4V A;  1PGT A;  4JR6 A;  4WBR D;  4RI6 A;  4BVY B;  4Z2R A;  3FYG A;  3ZTL A;  3WT2 A;  2DKH A;  3ISO A;  4WR4 A;  2X99 A;  3S9F A;  1PL2 A;  4POL A;  3F0I A;  5EY6 A;  2B1K A;  2CAI A;  2V2G A;  3L78 A;  1TKD B;  4ZL7 A;  2WS2 A;  2K8S A;  1SL2 B;  1HNC A;  3A5I A;  4EE0 A;  3ZRD A;  5BRT A;  4RQX A;  5G5F A;  5CYY A;  4HZ4 A;  1QK8 A;  4K1F A;  2HRK A;  2VM1 A;  2YWN A;  4TXV A;  2N5F A;  4NPB A;  3LEF A;  3G7Y A;  2H1G A;  4H86 A;  3FW2 A;  3A2X A;  4KA0 A;  3TB2 A;  3ZIT A;  1M3I A;  1ZYE A;  1UA5 A;  4PUA A;  5EVO A;  4BWQ A;  2DIZ A;  6GSU A;  3QMX A;  4ZBB A;  4PXO A;  2CZ2 A;  1TP9 A;  3EVI A;  3O6T A;  2LQO A;  4BPY A;  1SU9 A;  1BG5 A;  3DWV A;  2FWF A;  4PTS A;  2ZNM A;  1WE0 A;  2PVO C;  3GYK A;  1X9W B;  3KMO A;  4G9H A;  1Z3E A;  3GSS A;  5H5R A;  3G7J A;  2LS5 A;  5DAK A;  3ZML A;  4DSS B;  1A24 A;  3A2V A;  3Q19 A;  2L59 A;  4KDY A;  2YP6 A;  2CX4 A;  3M9K A;  1YDK A;  1G6W A;  4X4J A;  2VCZ A;  4ZB6 A;  2ZCT A;  2OE1 A;  2KLX A;  1ON4 A;  3VPT A;  2LJR A;  3HZ4 A;  5ECI B;  2VLT A;  1O81 A;  5DQY A;  2CQ9 A;  4KCA A;  4EIQ A;  1NHO A;  2LNS A;  4K5S A;  1OE8 A;  4MH2 A;  4ECI A;  4HU9 A;  3TOU A;  1MDI A;  3KJY A;  1A2J A;  5FT3 A;  4WKW A;  3GV1 A;  3M9J A;  1BAY A;  4IQ1 A;  3LFL A;  1JLV A;  5G2Z A;  4ZBD A;  2L6D A;  3LQ7 A;  2QSI A;  1ZOF A;  1J0F A;  4RQR A;  5DBQ A;  5ECN B;  4KF9 A;  5H5Q A;  3HYP A;  1GUH A;  2OA7 A;  4EL1 A;  2GSQ A;  3KTB A;  2N5A A;  1XIY A;  4K6X A;  1A2L A;  4EDY A;  3GMF A;  3GFK A;  1SJZ A;  4V1A p;  4EKZ A;  3TRX A;  5F05 A;  4O7H A;  3BBY A;  2A2S A;  3PH9 A;  2PER A;  1EV4 A;  3FHK A;  4PNG A;  4NHZ A;  2YV9 A;  8GSS A;  4ZB9 A;  2C0G A;  4BL7 A;  3RHB A;  2LRC A;  2WGR A;  3FY7 A;  4ML6 A;  1TK8 B;  4HI7 A;  4TR1 A;  2YZH A;  3EMX A;  3GKK A;  5LNK e;  2CA8 A;  1URM A;  4K9Z A;  1O8W A;  1QUW A;  1DBY A;  2AUV A;  3KH9 A;  4GLT A;  5IM9 A;  1BX9 A;  1K0O A;  5IO2 A;  1S3A A;  3F4R A;  3MDK A;  3F3Q A;  1R5P A;  2CX3 A;  1EOH A;  2FWE A;  3I43 A;  1V98 A;  1ERV A;  2Z9S A;  3IA1 A;  1A8L A;  2B5E A;  2YN1 A;  5FWG A;  2TIR A;  2YOI A;  3DRN A;  3IDV A;  1M3J A;  1C72 A;  1TU7 A;  5ECM B;  4K7O A;  1EEM A;  5GZZ B;  1B9Y C;  2G2Q A;  4LMW A;  4AJ6 A;  1QFN A;  4F03 A;  1ILO A;  4ICY A;  3ZVJ D;  1A0F A;  4BA7 A;  2YWI A;  1V9W A;  4P3Y B;  1M9A A;  5ID2 B;  1WP0 A;  3CBU A;  1Z5Y E;  5ECP B;  2M80 A;  2R2J A;  1XVQ A;  2N5B A;  4L5L A;  4LA1 A;  3OR5 A;  3O76 A;  3FEU A;  2DC5 A;  3P90 A;  4MLY A;  2LRT A;  1G7O A;  4WEY A;  4RUV A;  3DGQ A;  3CSJ A;  5GST A;  1O6J A;  5IOW A;  3GX0 A;  1A0R P;  3GRX A;  5DAL B;  2PGT A;  1QQ2 A;  3DIE A;  4X1U A;  5D9W A;  1ZGN A;  3WGD A;  1FW1 A;  1T4Z A;  4XS6 A;  3TKS C;  2K6V A;  2K9F A;  2LQQ A;  5IMZ A;  1GNE A;  3U6V A;  5D73 A;  3VWW A;  1EP8 A;  3VUR A;  3P7X A;  1M99 A;  2ON5 A;  1TW9 A;  2A4V A;  4IBP A;  4MA9 A;  3MIX A;  3UOM A;  3DML A;  1XOB A;  2DJ3 A;  1SL1 B;  3LW9 A;  2CVB A;  1QXH A;  2FWG A;  4CW9 A;  3D0Z A;  2H01 A;  5B6N A;  5IMD A;  2H6Y A;  1H4O A;  3E0U A;  2VCX A;  19GS A;  4MMM A;  2IMD A;  3O3T A;  4YKG A;  1SK1 A;  1EP7 A;  2HNL A;  1CQH A;  3US3 A;  3D5J A;  3DVX A;  4FQU A;  2EC4 A;  4MPF A;  1PX7 A;  2XBQ A;  4GF0 A;  1FG4 A;  1GTI A;  4I8B A;  1B4P A;  2F8A A;  4YQV A;  2DML A;  2HT9 A;  2A2P A;  1GLP A;  5COH A;  2J9H A;  1FO5 A;  2V32 A;  4IQA A;  5HFG A;  1ZCP A;  1TI1 A;  3VFI A;  4XS1 A;  1OC3 A;  4IJI A;  1I9D A;  1GSS A;  1U3I A;  2V6K A;  3EYT A;  4MZB A;  3PIN A;  1X9S B;  3M3M A;  4IEL A;  1XG8 A;  1K0C A;  3EPT A;  5G5E A;  1GSY A;  2BMX A;  4CY6 A;  3ME7 A;  3HKR A;  1KNG A;  2QA1 A;  3CTF A;  1YEX A;  4L0U A;  3TJF A;  3ZZX A;  2L5L A;  2XPD A;  1X9M B;  1Y6E A;  4BIK A;  3HVN A;  4KAE A;  1XWK A;  3UIW A;  2C1Y A;  4O5U A;  3RAZ A;  2V6O A;  1F3B A;  1RQM A;  2X8G A;  3ZLP A;  3APS A;  4MZW A;  3LYP A;  3CSI A;  4E8E A;  2DJJ A;  5D93 A;  1XCC A;  3EWL A;  3EMP A;  1S3R A;  3AY8 A;  1DE1 A;  4TOP A;  3R3E A;  3QOU A;  5IMC A;  1ZZY A;  3JCM L;  1OC8 A;  4XHM A;  4Q5R A;  1SJI A;  1E6B A;  4KUN A;  4WBJ A;  1PA3 A;  4OO4 A;  1TI3 A;  3QR6 A;  1Z7P A;  2GDR A;  2TRX A;  2P0G A;  2PVQ A;  3ZL5 A;  5A4U A;  4XS4 B;  1Q98 A;  2H30 A;  3LSZ A;  4GRF A;  4HQZ A;  2OBI A;  3GTU B;  2REM A;  3HJM A;  4NHW A;  1NW2 A;  2H0G A;  2R0G A;  1V40 A;  2IMI A;  2BJX A;  4YH2 A;  2DBC A;  2GST A;  1FVJ A;  5DJL A;  1GTA A;  1Y25 A;  3GH9 A;  2FD3 A;  4MDC A;  4GWR A;  3F6D A;  1A2M A;  1M2D A;  3DKS A;  3ED3 A;  3FZA A;  3KZQ A;  3KMN A;  3F4S A;  2C4J A;  3A5W A;  1XWC A;  5DAL A;  2EIQ A;  3GST A;  1Z6M A;  1AQW A;  3TKS A;  4OD7 A;  1THO A;  3MNG A;  1OKD A;  2B7K A;  3E3E A;  1V2A A;  5AN1 A;  5CRG A;  4TXO A;  1XFL A;  3GX8 A;  2XHF A;  2K8V A;  3GN3 A;  1R4W A;  4FIW A;  3HJO A;  3TCO A;  4PX1 A;  1RK4 A;  4MCU A;  4IN0 A;  3TRQ A;  3C73 A;  4MP4 A;  1EGO A;  3D21 A;  1MDJ A;  4MNN A;  1G6Y A;  4L0W A;  2R6K A;  4PGT A;  1T1V A;  2DJK A;  5LD0 A;  2UZ8 A;  3TJG A;  1M9B A;  4OFN A;  4KSM A;  4IP1 A;  4I2T A;  2H75 A;  5ECL B;  3BJ5 A;  2H8L A;  5ENU A;  2C0D A;  4OFM A;  2MMO A;  4NV5 A;  3C8E A;  1XZO A;  3FR6 A;  4ECJ A;  2QC7 A;  4YQU A;  4QL9 A;  1AQV A;  4XCS A;  2CT6 A;  5IPG A;  1MTC A;  3UEM A;  1SL0 B;  2XPE A;  1X0R A;  4POM A;  4O5R A;  1VGL A;  3VWV A;  2IL3 A;  3UMA A;  2A4H A;  2TRC P;  1EV9 A;  3G9B A;  2HRF A;  5IMA A;  5D9X A;  2KP2 A;  2G0F A;  4KX4 A;  4Z2T A;  1T7P B;  4HS1 A;  4A5P A;  2GZY A;  1FOH A;  2B3S A;  3H93 A;  1GLQ A;  4AJ7 A;  3UVT A;  1M0U A;  1WRY A;  3MSZ A;  1K0B A;  2GT6 A;  3N5O A;  2C3N A;  3C1R A;  2IFQ A;  4G2E A;  1B9X C;  2CZ3 A;  4IS0 A;  2B6M A;  1TU8 A;  2QKE A;  2AHE A;  1OC9 B;  1PFO A;  4MF7 A;  4MJB A;  2FNO A;  3TGZ A;  3F8U A;  3D4M A;  3QFA C;  2JAC A;  4E8H A;  2I4A A;  3ERW A;  4V1A g;  4F82 A;  5CRW A;  2H19 A;  1M7T A;  4BVX B;  3KIJ A;  2VD0 A;  2E2M A;  4IW9 A;  4HQS A;  4ILF A;  2VIM A;  2KUC A;  2IJY A;  1MD4 A;  4EC0 A;  5ECS A;  5J41 A;  4OFT A;  1KEB A;  2DMM A;  3KP8 A;  1R26 A;  1YQ1 A;  2PN8 A;  2JZS A;  2C0F A;  3M0F A;  3NZN A;  4D73 B;  3UJ1 A;  2IPA A;  5HFK A;  1O7U A;  5AIX A;  2FY6 A;  5CO3 A;  4MF6 A;  1WMJ A;  2GVP A;  3I9V 2;  5JWO B;  2WZ9 A;  4G0L A;  3GL3 A;  1N2A A;  2M46 A;  2L6C A;  3BD2 A;  1M2A A;  3QCP A;  1H75 A;  1IYH A;  5ECH B;  1YZX A;  2VM2 A;  3D4T A;  4GSN A;  3ZIJ A;  4QL7 A;  2R37 A;  2R0C A;  13GS A;  1NSW A;  4V2M A;  3CTG A;  2MYG A;  2H6Z A;  2O87 A;  2HRN A;  3FZ5 A;  1FAA A;  4IP6 A;  1ERU A;  4MJC A;  2JAD A;  2FA8 A;  5ELA A;  5FHI A;  3W8J A;  2PUK C;  3IE3 A;  2ON7 A;  1GTB A;  5HR2 A;  4KND A;  1KTE A;  3R2Q A;  2CAQ A;  2VOC A;  4FYU A;  3RDW A;  2YPM A;  3UVH A;  1TOF A;  3TKP A;  2ALB A;  1JZO A;  5AGY A;  1HYU A;  2HSY A;  5IIZ A;  4K0N A;  1TRV A;  1O8X A;  3QDN A;  3VWU A;  5F07 A;  2VL2 C;  2NBS A;  5H5S A;  4K7I A;  4BVY A;  5IQY A;  4TR3 A;  2BTO T;  3TKR A;  5CRE A;  4HJ2 A;  2LUS A;  2DIY A;  2C8U A;  3L4N A;  5G30 A;  3IXR A;  1YY7 A;  3EIN A;  3I69 A;  2MZC A;  4ZL8 A;  4N0V A;  3HZ8 A;  1LJR A;  5EPF A;  1PQN A;  4NMU A;  3UBK A;  1IYI A;  5L71 A;  4FH8 A;  1GUK A;  4DSR A;  1DE2 A;  1TTZ A;  1HNB A;  2KHP A;  2PU9 C;  3C7M A;  2H74 A;  2GZZ A;  4MF5 A;  4JBB A;  1ZYQ B;  3DD3 A;  2X64 A;  3UAR A;  4IJ3 A;  2HZE B;  2XC2 A;  2PPT A;  3EU4 A;  3G7I A;  4NV2 A;  4I2U A;  2DJ1 A;  3WYW A;  2VAF A;  1E2Y A;  3J7Y b;  1U6T A;  1S3D A;  4G10 A;  2HI7 A;  2L5O A;  4BVX A;  2CVD A;  3BCI A;  2L57 A;  5D9T A;  3VI5 A;  5J9C A;  5GAN D;  5EL8 A;  4N11 A;  2VD1 A;  1DSB A;  5J9B A;  2KOK A;  1B4Q A;  1XW5 A;  3BOA A;  2WB9 A;  1BQ7 A;  5KN0 A;  1JZD A;  3FKF A;  4PUR A;  4DSS A;  2AYT A;  3J7Y k;  2F51 A;  4K2D A;  1SK2 A;  2C3Q A;  1EOG A;  4GQC A;  4ACS A;  2H72 A;  2AB6 A;  2GSS A;  3KTL A;  1TRW A;  3MAK A;  2VCV A;  3F6F A;  2B5Y A;  1F37 A;  3L9U A;  2E7P A;  4WET A;  2WUL A;  1AUC A;  3ERG A;  5IMF A;  1HNA A;  3IAM 2;  2PMT A;  2AJQ B;  2GSR A;  1V57 A;  2GQM A;  2E0Q A;  3ZFB A;  1B48 A;  4KB3 A;  1OE7 A;  3WGX A;  2H1D A;  4K8M A;  2WJU A;  3RPP A;  1OVN A;  4MAB A;  2RM6 A;  1XXU A;  1SD9 A;  3D6I A;  1O73 A;  5IPH A;  4AF2 A;  3KEB A;  1X5C A;  2QGV A;  3HY2 A;  1MDK A;  1Z7R A;  3IAS 2;  1GSU A;  5JWQ B;  9GSS A;  3BCK A;  2H0H A;  4OCE A;  1GL8 A;  4IVF A;  4ZB8 A;  5G31 A;  3GNJ A;  2OE3 A;  1VF2 A;  4DEJ A;  3L0H A;  2VCW A;  3L9S A;  2LKU A;  5ECQ B;  2X8H A;  3GHA A;  5AIS A;  2I3Y A;  1U88 A;  4GXZ A;  4PUF C;  3LGC A;  5B7C A;  1AAZ A;  12GS A;  1F9M A;  4POK A;  4ZIL A;  14GS A;  2VL2 A;  4O92 A;  2JU5 A;  4OMV A;  3WT1 A;  3PGT A;  1S3C A;  6GST A;  4BWS A;  5HR0 A;  1YF0 A;  4CHS A;  4GCI A;  4PQH A;  5E59 A;  5JCU A;  18GS A;  2LNT A;  3D22 A;  1BYE A;  1KBN A;  2VLV A;  3H1N A;  5B8B A;  2LTK A;  4O32 A;  1ST9 A;  5KEJ A;  3VLN A;  3Q18 A;  4EF0 A;  4HDE A;  1YKC A;  4HEA 2;  1NM3 A;  3TJK A;  1THX A;  4ZL9 A;  5HR1 A;  1FVK A;  1SKR B;  4ULX A;  5ID2 A;  4EVM A;  3WGE A;  2H6X A;  2V1M A;  1R7H A;  4Z7X A;  2WRT A;  3CRT A;  1UVZ A;  3EC3 A;  5DAK B;  3HDC A; 
#chains in the Genus database with same CATH homology
 4N10 A;  2HYX A;  2WCI A;  2FLS A;  1EWX A;  1JLW A;  1SYX A;  1GNW A;  2AAW A;  1FB6 A;  3LXT A;  5IMV A;  2PBJ A;  2H66 A;  1K0D A;  1N8J A;  4NXI A;  1SYR A;  5JCW A;  3KH7 A;  1PX6 A;  1J08 A;  3VK9 A;  5DQS A;  5F8B A;  4Z2U A;  2YJH A;  3ME8 A;  1PKZ A;  2PWJ A;  4L5O A;  4ZBA A;  3F4T A;  3APQ A;  4K2X A;  4I6X A;  4K5R A;  4EUY A;  4ZXG A;  1TK5 B;  5CRD A;  5E4W A;  3KCM A;  2FUG 2;  2H0I A;  5C04 A;  4KH7 A;  5GSS A;  2B5X A;  2HZF A;  4ISD A;  1UN2 A;  2FHE A;  3A2W A;  4MK3 A;  2LJA A;  2OJL A;  3LG6 A;  1A8Y A;  3LWA A;  2OAD A;  3NIV A;  4IGJ A;  3HJP A;  4I5Q A;  4KW6 A;  1AC1 A;  2NPB A;  1GRX A;  1XOA A;  3GIX A;  4G0I A;  3CSH A;  3CYN A;  3KP9 A;  3GUS A;  2OKA A;  1SJ6 A;  2DLX A;  4IHU A;  1EZK A;  4AGS A;  2CV4 A;  3GL5 A;  3ERF A;  3LXZ A;  3FRC A;  1OYJ A;  3DVW A;  1ZYN A;  5ECK B;  2RII A;  4OO5 A;  5D8I A;  2YNX A;  4MPG A;  3H8Q A;  2HFD A;  4LLR A;  1JHB A;  2M72 A;  4TN8 A;  2H76 A;  4F0C A;  3UAP A;  3ZFL A;  5HR3 A;  1WWJ A;  4L8E A;  2LV3 A;  3IOS A;  5A5K A;  1AW9 A;  4F9Z A;  2CVK A;  2YV7 A;  1VRS D;  3TKQ A;  3DXB A;  1W4V A;  2NDO A;  1TK0 B;  2GT5 A;  1I5G A;  2MBT A;  2IIY A;  4ECB A;  1GSE A;  4YKF A;  4KE3 A;  2H70 A;  2IMK A;  2H73 A;  2MMN A;  6GSS A;  1AIU A;  3LOR A;  1NHY A;  1TXX A;  2R0P A;  1PN9 A;  4J57 E;  1U3A A;  5KOW A;  1XW6 A;  3F63 A;  3UL3 A;  2F3M A;  5DCG A;  2EIO A;  2IWT A;  1B8X A;  2H1A A;  1EGR A;  3HA9 A;  2GZP A;  2JZT A;  2VLU A;  3Q74 A;  4J56 E;  5B6M A;  3IRA A;  4JR4 A;  2VO4 A;  3WD6 A;  4JRR A;  2FGX A;  1SKS B;  2I81 A;  4K0G A;  3QD9 A;  4XS4 A;  4Q5F A;  22GS A;  2X49 A;  4XRD A;  4WR5 A;  2X8C A;  3EUR A;  4HUA A;  1TRU A;  2NTO A;  3W6G A;  4MH3 A;  3VWX A;  2C80 A;  1GH2 A;  3TJB A;  2O89 A;  3GTU A;  1ZMA A;  2L4Q A;  4X43 A;  2JSY A;  2OAC A;  4GTU A;  3DEX A;  4G19 A;  3PR8 A;  5GAP D;  3CRU A;  3ZIV A;  2P31 A;  2HLS A;  11GS A;  1LU4 A;  1GSF A;  2HXK A;  3ZYW A;  4F2I A;  5F0G A;  3IR4 A;  1VF1 A;  4HOJ A;  4MJE A;  4FYB A;  4DVC A;  4DSQ A;  3EE2 A;  3GH6 A;  3PPU A;  3TJJ A;  4WF4 A;  20GS A;  10GS A;  5D9V A;  2VCT A;  3RBT A;  1PD2 1;  2P5Q A;  2K18 A;  3QAG A;  2KP1 A;  4WF5 A;  4JZQ A;  3HVX A;  5A4W A;  5CAX A;  1QGV A;  2I1U A;  4Q5N A;  4EDZ A;  1FB0 A;  1XPV A;  2GGT A;  4XRA A;  1OKT A;  2FA4 A;  3HVV A;  6GSV A;  4IKH A;  2RM5 A;  2DJ0 A;  3QAV A;  1HD2 A;  5KN3 A;  4PNF A;  1Z9H A;  5CP1 A;  4V2N A;  2MMA A;  1T00 A;  2I9H A;  2VCQ A;  1X5D A;  3IK9 A;  4EO3 A;  3H4K A;  2ES7 A;  16GS A;  3IHG A;  4HJM A;  5IO0 A;  2YJ7 A;  4TVE A;  1PSQ A;  2QA2 A;  3K8N A;  3IHQ A;  3QAW A;  1G7E A;  1PKW A;  3TUE A;  5AIV A;  3TOT A;  1Q4J A;  1M2B A;  3LYK A;  1JFU A;  1PRX A;  2RUE A;  1SKW B;  4Q5Q A;  3M1G A;  2R3X A;  3TKS E;  2B1L A;  4JE1 A;  2C3T A;  2V41 A;  1YJ6 A;  1JZR A;  2YCD A;  2VL3 A;  4TR4 A;  4PQ1 A;  2H1B A;  1F6M C;  1TJD A;  4V2L A;  2WFC A;  1USB A;  3ZMK A;  2O85 A;  1OC9 A;  4KGI A;  1PN0 A;  5CNW A;  5ABR A;  2R4V A;  1VF4 A;  4TRX A;  2LEG A;  1T3B A;  3W8S A;  1K3Y A;  1ABA A;  3QFB C;  3KXO A;  2NVL A;  3RHC A;  3FMW A;  2AV4 A;  1O85 A;  2MMZ A;  3C71 A;  4LL1 B;  1W89 A;  1T4Y A;  2DKI A;  3UBL A;  3CMI A;  5JCG A;  5KN2 A;  4F0B A;  3HCZ A;  4O5Q A;  1K0N A;  1LBK A;  2R5G A;  4JED A;  4X0X A;  3GA4 A;  3U5R E;  3HXS A;  1FHE A;  4FO5 A;  3MWH A;  4POB A;  1YEP A;  1FOV A;  1YF1 A;  1AQX A;  4D73 A;  1GUL A;  5G1K A;  1SK0 A;  3SBC A;  2OBK A;  3KGK A;  2HE3 A;  2O8V B;  5JWR B;  3A3T A;  1WIK A;  4TXO B;  2LST A;  3GKN A;  2C0E A;  3L9V A;  1ERT A;  1WJK A;  2B7J A;  3VPQ A;  2EIR A;  1XWA A;  1F2E A;  5CRH A;  1XW9 A;  1A23 A;  4HZ2 A;  5HFI A;  2IN3 A;  3FR3 A;  4G0K A;  1CQG A;  2F9S A;  5B8A A;  3RPN A;  2HSM A;  2D2Z A;  5HQP A;  2L4C A;  4YAP A;  2FWH A;  2RUF A;  1XWG A;  4JU5 A;  5J5N A;  3LJR A;  5ELG A;  1BED A;  3IK7 A;  2DSA A;  2GS3 A;  2WDU A;  4RI7 A;  4N0Z A;  5F06 A;  4YAV A;  2GTU A;  5BMU A;  4K7N A;  2J23 A;  1J9B A;  1BJX A;  3FZ9 A;  5DJM A;  3GUR A;  3IC4 A;  2HRA A;  4WXT A;  1SEN A;  3ZRE A;  5LCZ A;  3IBH A;  3IPZ A;  4PQI A;  1GWC A;  3IV4 A;  3HHV A;  4YQM A;  2IME A;  1HQO A;  5ECR B;  3HVS A;  1MD3 A;  2DJ2 A;  1TDI A;  4N30 A;  3VI7 A;  2XBI A;  1SD8 A;  4MJA A;  2IFQ B;  4ID0 A;  3P8W A;  5DDL A;  1ZYP A;  6GSX A;  1R5A A;  4OCF A;  1T8E B;  3DYR A;  3GKM A;  1ML6 A;  1U87 A;  1RW1 A;  2GQL A;  2JZR A;  3KD0 A;  3IC8 A;  4ECC A;  2P5R A;  4QQ7 A;  2HSH A;  3I6A A;  5KOX A;  2FCH A;  2YWO A;  4TKY A;  3SWL A;  2E2G A;  1F3A A;  2GQK A;  3F3R A;  1K3O A;  6GSW A;  3C1S A;  4GST A;  4LL4 B;  4FYC A;  2RLI A;  1K0M A;  5ECO B;  1XWB A;  1Z6N A;  1K0A A;  2LRN A;  3KM6 A;  4GSS A;  3ZVJ A;  5C00 A;  5DVB A;  1TRS A;  1GP1 A;  5J4U A;  1ZL9 A;  1GTU A;  2HZE A;  1QMV A;  4I97 A;  4EIP A;  1MEK A;  5J3R A;  2YZU A;  4CDO A;  3CXG A;  5G1L A;  2ZUP A;  5DCH A;  3NOF A;  6GSY A;  1V58 A;  4TR0 A;  2F8F A;  7GSS A;  5KN1 A;  1JZW A;  1EEJ A;  1AXD A;  4KDU A;  3E9J B;  3HD5 A;  4LMV A;  1X5E A;  1PL1 A;  3GKX A;  1PMT A;  4EXJ A;  3F9U A;  4AJ8 A;  3MYD A;  3N9J A;  3EU3 A;  1XBS A;  2LJK A;  4OWY A;  2MBS A;  4KSO A;  2VUP A;  1WOU A;  2OE0 A;  3M8N A;  1GSQ A;  2O7K A;  4NWY A;  1K3L A;  4KCE A;  1OAZ A;  4CY8 A;  1WPI A;  1XVW A;  2JSZ A;  2H71 A;  1ERW A;  4ML1 A;  2IMF A;  1VF3 A;  4XIH A;  2GLR A;  1ACV A;  4USS A;  3FR9 A;  1UC7 A;  4MZC A;  1YKA A;  3FK8 A;  4XTS A;  3FZ4 A;  5IOX A;  2A2R A;  2YWM A;  17GS A;  4J2F A;  4ZIJ A;  3P2A A;  3H79 A;  5INY A;  4HU7 A;  3TDG A;  5D96 A;  1GSD A;  4BL7 B;  3Q6O A;  2VL9 A;  1DUG A;  4GQF A;  2X4A A;  4TR1 B;  4KDX A;  4TW5 A;  3V1W A;  1GUM A;  3APO A;  3QPM A;  2JL4 A;  3TRP A;  1G0T A;  4NAX A;  2YAN A;  5A4V A;  1PGT A;  4JR6 A;  4WBR D;  4RI6 A;  4BVY B;  4Z2R A;  3FYG A;  3ZTL A;  3WT2 A;  2DKH A;  3ISO A;  4WR4 A;  2X99 A;  3S9F A;  1PL2 A;  4POL A;  3F0I A;  5EY6 A;  2B1K A;  2CAI A;  2V2G A;  3L78 A;  1TKD B;  4ZL7 A;  2WS2 A;  2K8S A;  1SL2 B;  1HNC A;  3A5I A;  4EE0 A;  3ZRD A;  5BRT A;  4RQX A;  5G5F A;  5CYY A;  4HZ4 A;  1QK8 A;  4K1F A;  2HRK A;  2VM1 A;  2YWN A;  4TXV A;  2N5F A;  4NPB A;  3LEF A;  3G7Y A;  2H1G A;  4H86 A;  3FW2 A;  3A2X A;  4KA0 A;  3TB2 A;  3ZIT A;  1ZYE A;  1UA5 A;  4PUA A;  5EVO A;  4BWQ A;  2DIZ A;  6GSU A;  3QMX A;  4ZBB A;  4PXO A;  2CZ2 A;  1TP9 A;  3EVI A;  3O6T A;  2LQO A;  4BPY A;  1SU9 A;  1BG5 A;  3DWV A;  2FWF A;  4PTS A;  2ZNM A;  1WE0 A;  2PVO C;  3GYK A;  1X9W B;  3KMO A;  4G9H A;  1Z3E A;  3GSS A;  5H5R A;  3G7J A;  2LS5 A;  5DAK A;  3ZML A;  4DSS B;  1A24 A;  3A2V A;  3Q19 A;  2L59 A;  4KDY A;  2YP6 A;  2CX4 A;  3M9K A;  1YDK A;  1G6W A;  4X4J A;  2VCZ A;  4ZB6 A;  2ZCT A;  2OE1 A;  2KLX A;  1ON4 A;  3VPT A;  2LJR A;  3HZ4 A;  5ECI B;  2VLT A;  1O81 A;  5DQY A;  2CQ9 A;  4KCA A;  4EIQ A;  1NHO A;  2LNS A;  4K5S A;  1OE8 A;  4MH2 A;  4ECI A;  4HU9 A;  3TOU A;  1MDI A;  3KJY A;  1A2J A;  5FT3 A;  4WKW A;  3GV1 A;  3M9J A;  1BAY A;  4IQ1 A;  3LFL A;  1JLV A;  5G2Z A;  4ZBD A;  2L6D A;  3LQ7 A;  2QSI A;  1ZOF A;  1J0F A;  4RQR A;  5DBQ A;  5ECN B;  4KF9 A;  5H5Q A;  3HYP A;  1GUH A;  2OA7 A;  4EL1 A;  2GSQ A;  3KTB A;  2N5A A;  1XIY A;  4K6X A;  1A2L A;  4EDY A;  3GMF A;  3GFK A;  1SJZ A;  4V1A p;  4EKZ A;  3TRX A;  5F05 A;  4O7H A;  3BBY A;  2A2S A;  3PH9 A;  2PER A;  1EV4 A;  3FHK A;  4PNG A;  4NHZ A;  2YV9 A;  8GSS A;  4ZB9 A;  2C0G A;  4BL7 A;  3RHB A;  2LRC A;  2WGR A;  3FY7 A;  4ML6 A;  1TK8 B;  4HI7 A;  4TR1 A;  2YZH A;  3EMX A;  3GKK A;  5LNK e;  2CA8 A;  1URM A;  4K9Z A;  1O8W A;  1QUW A;  1DBY A;  2AUV A;  3KH9 A;  4GLT A;  5IM9 A;  1BX9 A;  1K0O A;  5IO2 A;  1S3A A;  3F4R A;  3MDK A;  3F3Q A;  1R5P A;  2CX3 A;  1EOH A;  2FWE A;  3I43 A;  1V98 A;  1ERV A;  2Z9S A;  3IA1 A;  1A8L A;  2B5E A;  2YN1 A;  5FWG A;  2TIR A;  2YOI A;  3DRN A;  3IDV A;  1C72 A;  1TU7 A;  5ECM B;  4K7O A;  1EEM A;  5GZZ B;  1B9Y C;  2G2Q A;  4LMW A;  4AJ6 A;  1QFN A;  4F03 A;  1ILO A;  4ICY A;  3ZVJ D;  1A0F A;  4BA7 A;  2YWI A;  1V9W A;  4P3Y B;  1M9A A;  5ID2 B;  1WP0 A;  3CBU A;  1Z5Y E;  5ECP B;  2M80 A;  2R2J A;  1XVQ A;  2N5B A;  4L5L A;  4LA1 A;  3OR5 A;  3O76 A;  3FEU A;  2DC5 A;  3P90 A;  4MLY A;  2LRT A;  1G7O A;  4WEY A;  4RUV A;  3DGQ A;  3CSJ A;  5GST A;  1O6J A;  5IOW A;  3GX0 A;  1A0R P;  3GRX A;  5DAL B;  2PGT A;  1QQ2 A;  3DIE A;  4X1U A;  5D9W A;  1ZGN A;  3WGD A;  1FW1 A;  1T4Z A;  4XS6 A;  3TKS C;  2K6V A;  2K9F A;  2LQQ A;  5IMZ A;  1GNE A;  3U6V A;  5D73 A;  3VWW A;  1EP8 A;  3VUR A;  3P7X A;  1M99 A;  2ON5 A;  1TW9 A;  2A4V A;  4IBP A;  4MA9 A;  3MIX A;  3UOM A;  3DML A;  1XOB A;  2DJ3 A;  1SL1 B;  3LW9 A;  2CVB A;  1QXH A;  2FWG A;  4CW9 A;  3D0Z A;  2H01 A;  5B6N A;  5IMD A;  2H6Y A;  1H4O A;  3E0U A;  2VCX A;  19GS A;  4MMM A;  2IMD A;  3O3T A;  4YKG A;  1SK1 A;  1EP7 A;  2HNL A;  1CQH A;  3US3 A;  3D5J A;  3DVX A;  4FQU A;  2EC4 A;  4MPF A;  1PX7 A;  2XBQ A;  4GF0 A;  1FG4 A;  1GTI A;  4I8B A;  1B4P A;  2F8A A;  4YQV A;  2DML A;  2HT9 A;  2A2P A;  1GLP A;  5COH A;  2J9H A;  1FO5 A;  2V32 A;  4IQA A;  5HFG A;  1ZCP A;  1TI1 A;  3VFI A;  4XS1 A;  1OC3 A;  4IJI A;  1I9D A;  1GSS A;  1U3I A;  2V6K A;  3EYT A;  4MZB A;  3PIN A;  1X9S B;  3M3M A;  4IEL A;  1K0C A;  3EPT A;  5G5E A;  1GSY A;  2BMX A;  4CY6 A;  3ME7 A;  3HKR A;  1KNG A;  2QA1 A;  3CTF A;  1YEX A;  4L0U A;  3TJF A;  3ZZX A;  2L5L A;  2XPD A;  1X9M B;  1Y6E A;  4KAE A;  1XWK A;  3UIW A;  2C1Y A;  4O5U A;  3RAZ A;  2V6O A;  1F3B A;  1RQM A;  2X8G A;  3ZLP A;  3APS A;  4MZW A;  3LYP A;  3CSI A;  4E8E A;  2DJJ A;  5D93 A;  1XCC A;  3EWL A;  3EMP A;  3AY8 A;  1DE1 A;  4TOP A;  3R3E A;  3QOU A;  5IMC A;  1ZZY A;  3JCM L;  1OC8 A;  4XHM A;  4Q5R A;  1SJI A;  1E6B A;  4KUN A;  4WBJ A;  1PA3 A;  4OO4 A;  1TI3 A;  3QR6 A;  1Z7P A;  2GDR A;  2TRX A;  2P0G A;  2PVQ A;  3ZL5 A;  5A4U A;  4XS4 B;  1Q98 A;  2H30 A;  3LSZ A;  4GRF A;  4HQZ A;  2OBI A;  3GTU B;  2REM A;  3HJM A;  4NHW A;  1NW2 A;  2H0G A;  2R0G A;  1V40 A;  2IMI A;  2BJX A;  4YH2 A;  2DBC A;  2GST A;  1FVJ A;  5DJL A;  1GTA A;  1Y25 A;  3GH9 A;  2FD3 A;  4MDC A;  4GWR A;  3F6D A;  1A2M A;  1M2D A;  3DKS A;  3ED3 A;  3FZA A;  3KZQ A;  3KMN A;  3F4S A;  2C4J A;  3A5W A;  1XWC A;  5DAL A;  2EIQ A;  3GST A;  1Z6M A;  1AQW A;  3TKS A;  4OD7 A;  1THO A;  3MNG A;  1OKD A;  2B7K A;  3E3E A;  1V2A A;  5AN1 A;  5CRG A;  4TXO A;  1XFL A;  3GX8 A;  2XHF A;  2K8V A;  3GN3 A;  1R4W A;  4FIW A;  3HJO A;  3TCO A;  4PX1 A;  1RK4 A;  4MCU A;  4IN0 A;  3TRQ A;  3C73 A;  4MP4 A;  1EGO A;  3D21 A;  1MDJ A;  4MNN A;  1G6Y A;  4L0W A;  2R6K A;  4PGT A;  1T1V A;  2DJK A;  5LD0 A;  2UZ8 A;  3TJG A;  1M9B A;  4OFN A;  4KSM A;  4IP1 A;  4I2T A;  2H75 A;  5ECL B;  3BJ5 A;  2H8L A;  5ENU A;  2C0D A;  4OFM A;  2MMO A;  4NV5 A;  3C8E A;  1XZO A;  3FR6 A;  4ECJ A;  2QC7 A;  4YQU A;  4QL9 A;  1AQV A;  4XCS A;  2CT6 A;  5IPG A;  1MTC A;  3UEM A;  1SL0 B;  2XPE A;  1X0R A;  4POM A;  4O5R A;  1VGL A;  3VWV A;  2IL3 A;  3UMA A;  2A4H A;  2TRC P;  1EV9 A;  3G9B A;  2HRF A;  5IMA A;  5D9X A;  2KP2 A;  2G0F A;  4KX4 A;  4Z2T A;  1T7P B;  4HS1 A;  4A5P A;  2GZY A;  1FOH A;  2B3S A;  3H93 A;  1GLQ A;  4AJ7 A;  3UVT A;  1M0U A;  1WRY A;  3MSZ A;  1K0B A;  2GT6 A;  3N5O A;  2C3N A;  3C1R A;  2IFQ A;  4G2E A;  1B9X C;  2CZ3 A;  4IS0 A;  2B6M A;  1TU8 A;  2QKE A;  2AHE A;  1OC9 B;  4MF7 A;  4MJB A;  2FNO A;  3TGZ A;  3F8U A;  3D4M A;  3QFA C;  2JAC A;  4E8H A;  2I4A A;  3ERW A;  4V1A g;  4F82 A;  5CRW A;  2H19 A;  1M7T A;  4BVX B;  3KIJ A;  2VD0 A;  2E2M A;  4IW9 A;  4HQS A;  4ILF A;  2VIM A;  2KUC A;  2IJY A;  1MD4 A;  4EC0 A;  5ECS A;  5J41 A;  4OFT A;  1KEB A;  2DMM A;  3KP8 A;  1R26 A;  1YQ1 A;  2PN8 A;  2JZS A;  2C0F A;  3M0F A;  3NZN A;  4D73 B;  3UJ1 A;  2IPA A;  5HFK A;  1O7U A;  5AIX A;  2FY6 A;  5CO3 A;  4MF6 A;  1WMJ A;  2GVP A;  3I9V 2;  5JWO B;  2WZ9 A;  4G0L A;  3GL3 A;  1N2A A;  2M46 A;  2L6C A;  3BD2 A;  1M2A A;  3QCP A;  1H75 A;  1IYH A;  5ECH B;  1YZX A;  2VM2 A;  3D4T A;  4GSN A;  3ZIJ A;  4QL7 A;  2R37 A;  2R0C A;  13GS A;  1NSW A;  4V2M A;  3CTG A;  2MYG A;  2H6Z A;  2O87 A;  2HRN A;  3FZ5 A;  1FAA A;  4IP6 A;  1ERU A;  4MJC A;  2JAD A;  2FA8 A;  5ELA A;  5FHI A;  3W8J A;  2PUK C;  3IE3 A;  2ON7 A;  1GTB A;  5HR2 A;  4KND A;  1KTE A;  3R2Q A;  2CAQ A;  2VOC A;  4FYU A;  3RDW A;  2YPM A;  3UVH A;  1TOF A;  3TKP A;  2ALB A;  1JZO A;  5AGY A;  1HYU A;  2HSY A;  5IIZ A;  4K0N A;  1TRV A;  1O8X A;  3QDN A;  3VWU A;  5F07 A;  2VL2 C;  2NBS A;  5H5S A;  4K7I A;  4BVY A;  5IQY A;  4TR3 A;  2BTO T;  3TKR A;  5CRE A;  4HJ2 A;  2LUS A;  2DIY A;  2C8U A;  3L4N A;  5G30 A;  3IXR A;  1YY7 A;  3EIN A;  3I69 A;  2MZC A;  4ZL8 A;  4N0V A;  3HZ8 A;  1LJR A;  5EPF A;  1PQN A;  4NMU A;  3UBK A;  1IYI A;  5L71 A;  4FH8 A;  1GUK A;  4DSR A;  1DE2 A;  1TTZ A;  1HNB A;  2KHP A;  2PU9 C;  3C7M A;  2H74 A;  2GZZ A;  4MF5 A;  4JBB A;  1ZYQ B;  3DD3 A;  2X64 A;  3UAR A;  4IJ3 A;  2HZE B;  2XC2 A;  2PPT A;  3EU4 A;  3G7I A;  4NV2 A;  4I2U A;  2DJ1 A;  3WYW A;  2VAF A;  1E2Y A;  3J7Y b;  1U6T A;  1S3D A;  4G10 A;  2HI7 A;  2L5O A;  4BVX A;  2CVD A;  3BCI A;  2L57 A;  5D9T A;  3VI5 A;  5J9C A;  5GAN D;  5EL8 A;  4N11 A;  2VD1 A;  1DSB A;  5J9B A;  2KOK A;  1B4Q A;  1XW5 A;  3BOA A;  2WB9 A;  1BQ7 A;  5KN0 A;  1JZD A;  3FKF A;  4PUR A;  4DSS A;  2AYT A;  3J7Y k;  2F51 A;  4K2D A;  1SK2 A;  2C3Q A;  1EOG A;  4GQC A;  4ACS A;  2H72 A;  2AB6 A;  2GSS A;  3KTL A;  1TRW A;  3MAK A;  2VCV A;  3F6F A;  2B5Y A;  1F37 A;  3L9U A;  2E7P A;  4WET A;  2WUL A;  1AUC A;  3ERG A;  5IMF A;  1HNA A;  3IAM 2;  2PMT A;  2AJQ B;  2GSR A;  1V57 A;  2GQM A;  2E0Q A;  3ZFB A;  1B48 A;  4KB3 A;  1OE7 A;  3WGX A;  2H1D A;  4K8M A;  2WJU A;  3RPP A;  1OVN A;  4MAB A;  2RM6 A;  1XXU A;  1SD9 A;  3D6I A;  1O73 A;  5IPH A;  4AF2 A;  3KEB A;  1X5C A;  2QGV A;  3HY2 A;  1MDK A;  1Z7R A;  3IAS 2;  1GSU A;  5JWQ B;  9GSS A;  3BCK A;  2H0H A;  4OCE A;  1GL8 A;  4IVF A;  4ZB8 A;  5G31 A;  3GNJ A;  2OE3 A;  1VF2 A;  4DEJ A;  3L0H A;  2VCW A;  3L9S A;  2LKU A;  5ECQ B;  2X8H A;  3GHA A;  5AIS A;  2I3Y A;  1U88 A;  4GXZ A;  4PUF C;  3LGC A;  5B7C A;  1AAZ A;  12GS A;  1F9M A;  4POK A;  4ZIL A;  14GS A;  2VL2 A;  4O92 A;  2JU5 A;  4OMV A;  3WT1 A;  3PGT A;  1S3C A;  6GST A;  4BWS A;  5HR0 A;  1YF0 A;  4CHS A;  4GCI A;  4PQH A;  5E59 A;  5JCU A;  18GS A;  2LNT A;  3D22 A;  1BYE A;  1KBN A;  2VLV A;  3H1N A;  5B8B A;  2LTK A;  4O32 A;  1ST9 A;  5KEJ A;  3VLN A;  3Q18 A;  4EF0 A;  4HDE A;  1YKC A;  4HEA 2;  1NM3 A;  3TJK A;  1THX A;  4ZL9 A;  5HR1 A;  1FVK A;  1SKR B;  4ULX A;  5ID2 A;  4EVM A;  3WGE A;  2H6X A;  2V1M A;  1R7H A;  4Z7X A;  2WRT A;  3CRT A;  1UVZ A;  3EC3 A;  5DAK B;  3HDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...