3QCQA

Phosphoinositide-dependent kinase-1 (pdk1) kinase domain with 6-(3-amino-1h-indazol-6-yl)-n4-ethyl-2,4-pyrimidinediamine
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
286
structure length
276
Chain Sequence
QPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Structure-Based Design of Potent and Selective 3-Phosphoinositide-Dependent Kinase-1 (PDK1) Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 276
sequence length 286
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3qcqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3qcqA01
3SHEA 4R3RA 4AFEA 4E4MA 2PTKA 3QBNA 4ZJVA 2JFMA 4ZS4A 4GSBA 5BYYA 2UZNA 3NUYA 4OGRA 4BCHA 3ZFMA 4WHZA 2RFDA 3QTSA 2ITZA 2UW9A 4FNYA 1KE8A 5B0XA 4D2RA 1KUTA 3ZO3A 2BZIB 3AC5A 5DEYA 4LFIA 4WOVA 3QUEA 3EYGA 4X2NA 4MWHA 2GHLA 2W4KA 4M69A 3BEGA 4FKSA 4TNDA 1VEBA 1U5RA 3LQ8A 1Q8WA 5E92A 5K5XA 4NJ3A 5BMMA 1CKIA 3QWJA 4NM5A 3V04A 3CS9A 3DLSA 4FT5A 4M69B 4L3LA 3RPVA 5A46A 3AC3A 2BR1A 3QYZA 3MYGA 4AOJA 4FEUA 5GIPE 1LEWA 2X2MA 1TVOA 3LM5A 2Y6MA 4P4CA 4JJRA 4LI5A 3OVVA 2BIYA 2R3FA 3DA6A 4ACGA 3TDVA 4QQ5A 4MEDA 3IK3A 1V0PA 4TPTA 4TW9A 3VRYA 4BRXA 3TKUA 4XG9A 3POOA 4IWOA 2WMAA 4RA5A 4IWDA 4EH6A 3OWJA 4FV3A 3CD8A 5AX3A 5JH6A 2JC6A 5LQFA 4FTUA 4AX8A 1CTPE 2RL5A 1JLUE 4AN3A 5CQWA 3WIGA 4QMNA 4GVAA 3VUHA 4BFMA 4G3CA 4LOOA 2BAJA 2VTHA 4C36A 3BHUA 1M52A 4DEDA 4LV8A 4EOOA 3C7QA 2VWIA 3HMNA 4XV3A 2WGJA 4CV8A 2WTKC 3E62A 2GHGA 3CGOA 2WTCA 3QGYA 5DRDA 4EHVA 3OZ6A 4HOKA 5LVLA 3TACA 3G15A 3CKXA 1CMKE 3V8WA 4YSJA 3BWFA 2BFXA 5D12A 4QTDA 4DFNA 4DA5A 5AAFA 3KU2A 3ZLSA 5K3YA 1Q99A 3HAVA 4LMNA 2GU8A 3UPXA 3ZO4A 4C34A 4DGNA 2ITPA 1OUYA 3N51A 1NA7A 4GK2A 4AG8A 1XHAA 2ITVA 3KMMA 4IM2A 5HE2A 1IEPA 2BTRA 3ZFYA 4C62A 5M09A 4EH5A 2IW8A 2W5AA 5KKRC 3R00A 3PYYA 4RJ6A 5AP6A 4B4LA 4V01A 5HORA 5I9ZA 5LMAA 4KB8A 3PY0A 2I0VA 2AYPA 2C68A 5HGIA 4IWPA 1DS5A 3C4FA 3LPBA 4I1ZA 5C4KA 3T9IA 4IH8A 2VUWA 4X2FA 4F1MA 4YC3A 1O6LA 3Q9YA 5HVJA 5GHVA 2PVLA 3U51A 4CZYB 5B2LA 2UZTA 3OWLA 4FTOA 3RZFA 1XKKA 3OS3A 2OG8A 2CGXA 3UC3A 5LJJA 3QRTA 3BX5A 2OK1A 3ORPA 4C3PA 4N0SA 1QPCA 1ZAOA 4FUYA 4IM0A 1AD5A 5CZHA 2H8HA 5HHWA 5I0BA 3QQGA 4RWIA 2YCQA 3Q60A 4CTCA 3WF7A 3KXZA 5CNOA 4A4XA 3LFCA 2JKKA 5CEKA 5HTCA 3DLZA 1WBVA 2H9VA 4BTFA 3NX8A 1OL7A 4ID7A 2PUPA 2Z7LA 3GXLA 5JZJA 5IKWA 5LMKA 4O2PA 5BUEA 5CEIA 3R9RA 4HZRA 3CTQA 2ZMDA 3DJ7A 4GRBA 5HIBA 3FV8A 5KZ0A 2VV9A 2OKRA 4JX3A 3SQQA 4RVLA 2UZOA 3ODYX 3GU4A 3T9TA 4FKIA 4IZAA 4CSVA 5E9EA 4KIOA 4UB7A 5AV4A 3QQKA 3LLAA 3ZXTA 2BAKA 2LGCA 4M3QA 5CVGA 3N4VA 2HOGA 4TYHA 5AUWA 5E8UA 2OXDA 4ZLYA 3PXZA 1ZY5A 4EEVA 3IW4A 5HZNA 1Q61A 3FLZA 3ORNA 4TYHB 1YVJA 4IM3A 1Z5MA 1UVRA 2YWVA 4E6DA 4D55A 2XK8A 2IO6A 3HA8A 4JI9A 4XOZA 2QURA 1FGKA 3Q6WA 4M97A 5EH0A 4DEHA 4NL0A 2ITXA 3MH0A 2WQEA 4GK3A 3TV6A 3PSDA 3FYKX 1NVQA 3EQGA 4G5JA 4HW7A 3QD4A 3PJ1A 2YAAA 3R7GA 1QPEA 3MN3A 4ZSJA 4YJNA 5AIRA 3SGCA 2W1DA 2X7OA 4YLKA 5CAOA 2O64A 4I22A 4JG7A 4MF0A 2NRYA 4MYGA 4NCTC 3OY3A 3SDJA 3ZLYA 3QKMA 2Y6OA 3IO7A 4MCVA 3DKOA 4L67A 3Q2MA 2GFSA 3KQ7A 4C57A 2F9GA 4HVIA 5HOAA 4D4VA 2YZAA 3A62A 3OWKA 5GNKA 4QMZA 3RHXA 3EH9A 4W4VA 2H6DA 2PZIA 4ASZA 2FB8A 3O96A 3GUBA 4L45A 5HG5A 2O65A 5KMIA 4FEQA 2PVMA 1NT2A 2O5KA 2OLCA 3V5JA 1JPAA 2XIXA 5GIOE 5E91A 2XM9A 3BLHA 4U6RA 4W4WA 2BZJA 4U7ZA 5KMJA 3RPYA 3W2SA 4O0UA 3DBCA 3OEFX 2BRHA 2YM5A 4PPCA 3TTIA 4FV1A 1PXLA 5DGZA 2XNMA 5CF5A 3E64A 3EL7A 3ITZA 3PG3A 1NY3A 1FVTA 4DFZE 4L3PA 2XJ0A 3LHJA 3C0GA 4EKKA 4L53A 4FTNA 3L8VA 4I5MA 2R4BA 4NSTA 5AP7A 3IG7A 2ZM3A 3UP2A 3LMGA 3W8QA 1FMOE 3BZ3A 4AW1A 5IQGA 3RM6A 3LJ1A 4FUXA 2W06A 5L2TA 4FIIA 2LAVA 2VTNA 4CRLA 4WBOA 3I0OA 2CPKE 5HNGA 2X7GA 3BYMA 4G34A 2HWPA 3P78A 4FSMA 3D5WA 2PUNA 1R0PA 4X2GA 3I1AA 5L6OA 1I44A 4PL5A 3Q6UA 4RIYA 3G0EA 5M44A 2RFSA 3PXYA 1RDQE 4FSQA 3EN7A 3WF5A 1YI4A 4YHJA 5J7BA 2W9FB 3ANRA 2ZVAA 3BE2A 3DNDA 5DE2A 2CKOA 4NW5A 4RIYB 4KIKA 1YXSA 3D2IA 4GYGA 4OTRA 3ZOSA 4AZFA 4YLLA 4AA0A 4CFMA 3A61A 1ATPE 4I0RA 4NEUA 5IEYA 1UU9A 2O2UA 4AZSA 1YOLA 4BWPA 4JNWA 4KIKB 4WKQA 1U54A 2JFLA 2XS0A 3FKOA 4YSMA 3UVRA 3ZHPC 4DCEA 4AGDA 4FA2A 3W2OA 3HECA 3HVCA 4O7ZA 3PPJA 2XNEA 5EM7A 2ITYA 1U54B 4FL3A 3FUPA 3G0FA 2J0IA 3F9NA 4MBJA 3WF6A 3EFWA 4O0SA 3UO6A 2YEXA 3F69A 2UZBA 5T3QA 4AF3A 1GZ8A 1J1BA 3FI4A 4A9RA 3LKMA 2E9OA 2C6MA 4AGWA 4DLIA 1OL6A 2ZB0A 4FTTA 5A4TA 5EI8A 2ZJWA 4ZJJA 4ZLZA 1YHSA 4ALUA 5ICPA 4O7TA 4EOIA 4ANQA 3QKLA 4I3ZA 1PXJA 3LXPA 4XG4A 3L9NA 2X39A 3UIMA 4AA5A 1B6CB 2P0CA 5CU4A 3HUCA 5C8NA 3FZRA 5HX8A 5JGDA 1IAJA 3QCYA 3DQXA 3SVVA 2HXLA 3QC4A 4UY9A 4C3FA 4QP9A 3O71A 4IVDA 4Y5QA 3KF7A 3ZSGA 5EDRA 3LFEA 4WSYA 3SW4A 1JAMA 1S9IA 1BLXA 2Z7QA 2W5BA 5EKOA 5B2KA 5E8ZA 3MVMA 5HO7A 2XH5A 4FV9A 3FMEA 5HESA 1XH4A 3FZPA 4YO6A 4FTAA 2XRWA 3RPRA 1YW2A 4F99A 4BDAA 2HELA 2BKKA 2BZKB 3NEWA 2ACXA 4FOBA 3SAYA 3THBA 3ATSA 3KREA 1LEZA 2Q0BA 1O6YA 4GFMA 1J91A 5M51A 1H27A 3ODZX 3C9WA 3UGCA 2PVRA 1J7LA 5EQEA 2ONLA 3OFMA 4FSYA 3R30A 4R5YA 5LARA 4BIDA 2J4ZA 2C6DA 2OIQA 3QTQA 3EFLA 1KV1A 1Q3WA 4K0YA 2J0JA 4O7VA 1PYEA 2PVNA 4H05A 4N4SA 4WT6A 4XMOA 3CXWA 4I21A 4BCQA 4CQGA 3O51A 4RT7A 2GNLA 3OD6X 4FI1A 4D4YA 3NVMB 3IGOA 4BF2A 5HD4A 2FVDA 2QQ7A 3CY2A 3A2CA 3VQUA 3HZTA 4NM3A 2E9PA 2ESMA 3QRIA 1APME 4LUEA 3R83A 3TI1A 3AD4A 2OJIA 4WG5A 4FG7A 2WIHA 5DT3A 1P4OA 4QD6A 3OW4A 2HCKA 4FTJA 5AR2A 3T3UA 2R2PA 3KMUA 4TL0A 4KBCA 5IA5A 1XJDA 4O27B 4EYJA 4AQCA 3MFSA 3LVPA 3G9LX 3QRUA 4AXAA 2QOBA 4DLJA 3SLSA 4LM5A 3DB6A 3TJCA 4D9TA 5HVYA 1SVHA 5IA4A 4BI2A 3B2WA 4QP7A 2VNYA 4ITIA 4JG8A 2BILB 5H8EA 4NK9A 3WZJA 5C01A 5L2QA 3U54A 1RW8A 4XS2A 4KABA 4L43A 1GZNA 2FSLX 5C8KA 4Q9ZA 5L3AA 4AZTA 4OAVB 2A4LA 3OOGA 4WUAA 3AT2A 3PLSA 4XBRA 2PE2A 4DYMA 5IQFA 2JKOA 2UZVA 3ZONA 3RPOA 4DTKA 1Y91A 1YQJA 3DAJA 3KXNA 3MPAA 3QCQA 2RFNA 3UODA 2QOHA 4QO9A 3ORTA 1YWNA 2XMYA 3P7AA 2OIDA 3IPHA 1FMKA 3PIXA 5FGKA 3H30A 2F49A 4I41A 4U9AA 2XP2A 3LLTA 3BU3A 3U87A 4Y85A 5EW8A 4AWIA 4DT8A 3DU8A 2ZV9A 4JBQA 2BDWA 3Q52A 4I92A 2ITOA 3TV4A 4K9YA 5AP5A 4DGMA 3UZRA 4L3JA 4EZ3A 4UMPA 2RGPA 5BUJA 2P4IA 3HRFA 4G6LA 4JBOA 5TF9A 2XYUA 3TNQB 2C6OA 1X8BA 2Y4IB 2C5VA 4JT3A 1IASA 5FTGA 4K11A 5DR2A 3VULA 3Q04A 5LOHA 4Y83A 1P4FA 4FK6A 2ZDTA 4GS6A 4BGGA 3FSFA 3PXQA 4YPDA 4HYIA 5FXSA 5JGAA 2YERA 4FIEA 1JOWB 5AR8A 5H2UA 3HV6A 1Q62A 3PRIA 3VC4A 3QXOA 3ZU7A 3R01A 5IA0A 2QO9A 3IW5A 3H0ZA 3C4EA 3HUBA 2J0LA 2JGZA 3I7BA 4J8NA 3UG1A 3E92A 3LM0A 4NZWB 4D28A 4HVHA 2YN8A 4U41A 3QRJA 3FXWA 5ITAA 3R2BA 4FV5A 1WBNA 2YJSA 5D11A 3QA8A 5AMNA 1NVRA 2XK9A 1Q4LA 4NFNA 3ZUTA 3HMMA 4CZUA 2OXXA 3B2TA 2BDJA 3HEGA 4DC2A 4PMPA 2ITNA 5L8LA 3FC1X 5BVFA 3FMMA 4G31A 5HCXA 4FKWA 3R2YA 2X6DA 4YJRA 4BDFA 4YU2A 2FSMX 2BAQA 4IADA 2VX3A 4BI0A 2BDFA 3A7IA 4RLKA 1PY5A 4JQ7A 4UN0C 4WO5A 2UW3A 4UV0A 4W8EA 3ZDUA 4ZTNA 4HNIA 4ZZMA 4XP3A 5KMMA 2J5FA 3DZOA 5DFPA 3ZCLA 4GV1A 3HV4A 4RC3A 3FMNA 3Q9WA 5EW9A 4AT5A 3P7CA 2CGVA 2J5EA 3ZBXA 4KIPA 5K4JA 3QXPA 1HCKA 3IW8A 4ZY6A 3VF9A 3C50A 4X3JA 5ANEA 3PDTA 5CQUA 4KSPA 3UIBA 2FSTX 1H1QA 4DN5A 3C51A 5FEDA 5IZFA 1BI7A 2VX1A 4M84A 3PZEA 4OR5A 4BKZA 3COIA 4AE9A 4PP9A 3FQSA 1JKTA 3BV2A 2QR8A 3CJGA 3DB8A 5CSHA 3WZKA 4ZSAA 1DAYA 5HCYA 2R3NA 3F66A 3QLFA 4C37A 2QR7A 3DKCA 3HA6A 2GPHA 4FTIA 3UNZA 4O86A 4Z9LA 3BEAA 1U59A 3HRBA 3QTRA 1H0WA 3C4ZA 5HICA 4KA3A 3QU0A 2SRCA 3TJDA 5DLSA 4CFNA 3CLYA 3DBFA 4JQ8A 1PKGA 3HV3A 4UYNA 4CLJA 3BBTB 4I94A 5HG8A 2XNNA 2R3LA 5AIKA 5DVRA 3BLQA 2QD9A 4HVGA 3SW7A 2W9ZB 4F9AA 3E8CA 2IJMA 4F0GA 1K3AA 3OCGA 4J99A 4EBVA 2F2CB 4GFGA 4ALVA 4ZTMA 4AP7A 4GUEA 4JDJA 4U45A 2BRGA 3OEZA 1R1WA 4C2WA 4HGSA 4S30A 5GZ9A 5AR5A 3P7BA 4JQEA 3BPRA 4D4RA 5AUUA 3QZFA 2WXVA 1SVEA 4EK5A 3VS5A 5IDPA 1W98A 5DYJA 4PV0A 5L2IA 3M2WA 3PE2A 4ZTHA 2I0EA 3G51A 4ASDA 4H1MA 4QP3A 3ZUVA 4WRGA 2OSCA 4MK0A 5FG8A 2WEVA 5I5ZA 4J1RA 5KMOA 1PMEA 4BCKA 2F57A 5AP3A 5J9YA 5A4LA 2YFXA 3WIKA 1OPKA 3AT3A 3DK6A 2RF9A 5BNJA 5L8KA 4C8BA 1PMNA 2EXMA 3KRXA 5AJQA 1FVVA 4AACA 4DGGA 3GP0A 4E8AA 4ZTSA 4FBXA 4TT7A 2WTDA 4Y46A 4IJ9A 4FKOA 3FMLA 3QX4A 5FBNC 4UYAA 4M13A 2PHKA 3LXKA 4FSUA 2WMXA 5M08A 3ALOA 3HRCA 3NNVA 3TIYA 2VTPA 3RVGA 4GT5A 2UVXA 4GIHA 4E5AX 3RWPA 3FKNA 5J95A 2Z7SA 4XG2A 3OF0A 1UU7A 2XEYA 3CTHA 4PTCA 4NTSA 4I93A 4F7LA 2HW7A 4FT3A 4X3FA 1REJA 3BHTA 3NW6A 4BL1A 2VWZA 4C7TA 3NYNA 4PNIA 4X3FB 4WSQA 2B55A 1UU3A 4P5ZA 2OGVA 3A7GA 3F6XA 4DFLA 2ZOQA 1FQ1B 4KRDA 5IUGA 4L00A 4R5SA 1LUFA 2GNFA 3OOMA 3QQHA 5IMXA 5IF1A 4HNFA 4E6QA 4F0IA 2ETKA 5KX8A 4OW8A 3OTUA 4FZFB 4IX5A 4AS0A 3GNIB 3MH1A 2P3GX 3NW7A 4F70A 3D7TA 3DFCB 2REIA 4RC4A 2F2UA 4MH7A 5JSMA 3ATTA 3R63A 4GEOA 4M15A 4RPVA 3L9PA 4MBIA 2W99B 3D7TB 3I60A 3FZTA 3PXFA 5CF4A 1XO2B 3HYHA 5DOSA 4KS8A 4ERKA 3LFNA 2W4JA 1MUOA 4P7EA 5FEEA 4N6YA 4D2WA 2J2IB 5DIAA 5KE0A 2VTQA 1OPLA 2C47A 3IW7A 4LOQA 5ANOA 4F6WA 5JQ5A 3R7UA 4O84A 3NRMA 2DQ7X 5CALA 4NWMA 1WBTA 5FM3A 3SRVB 4ANSA 5C1QB 3P5KA 4IAZA 5E90A 3PJ2A 5CWZA 3GU7A 2WMVA 4EYMA 1HCLA 3F3UA 1M14A 3CCNA 2Z7RA 5ETFA 3ORLA 4FT9A 5FP6A 1KWPA 2B54A 4MD8E 2PMIA 3G2FA 4FVPA 4QNYA 1OL2A 3VW6A 4PP7A 2IN6A 4FGBA 3NGAA 4YPSA 4X2JA 1YOMA 1PXNA 2VO6A 2XKDA 4IB5A 3V5LA 3W33A 3WF9A 4C58A 5IEXA 2V7OA 2WTVA 5JKGA 1Z9XA 5HTBA 3VBXA 5AA8A 4CMTA 3LJ2A 4YJSA 2IW9A 3MFTA 3KULA 3PJ8A 2J0MB 4EOMA 4PNKA 1JBPE 1M7QA 4J71A 3HL7A 3IQ7A 4U0IA 2X7FA 5EYKA 1UWHA 2UZLA 2PVYA 1QPJA 4JXFA 4DGOA 2WHBA 3MPMA 5I9WA 2CKPA 2PYWA 3AQVA 4YTIA 3ROCA 2EWAA 3I5ZA 3IKAA 4FKUA 3ZO2A 4EH8A 1YWVA 4AGCA 5H8GA 4AT3A 5M4IA 4BTKA 1WAKA 4RX5A 3ACJA 4JIKA 3W32A 2QVSE 4UX9A 2QHMA 2HK5A 3ZEWA 3P1AA 4EI4A 4CTBA 4HVSA 2FA2A 4JBPA 2YIWA 3EFJA 2CN5A 3RMFA 1XBCA 2RG5A 4Y73A 4DFXE 3C4CA 3GCPA 2QOKA 3F3WA 5HG9A 4ANBA 4GKIA 4MD9E 2E2BA 3UIUA 5FP5A 2QOFA 3DJ5A 2GHMA 4L68A 4GJ2A 5FRIA 2F7ZE 4ANOA 4YJVA 4ASEA 2XKCA 4EWQA 4FZAB 4ORKA 5CT0A 3NYOA 4EC9A 4KKEA 3RJCA 3VAPA 2YLEA 2V55A 5CXHA 5DR6A 3UVQA 2WD1A 5HG7A 4NU1A 4FSWA 4EOPA 3BQRA 3I5NA 3PA4A 4IEBA 4P2KA 5DG5A 4YP8A 5HNIX 2CN8A 2JIUA 4O0TA 1GIIA 4G3EA 5CZIA 4DG0E 4L01A 4BVUA 2WOUA 4LGGA 1LR4A 2YAKA 3G5DA 1SMHA 5TKDA 4PMTA 1T45A 2PZYA 4JAIA 4O21A 3S2PA 4I0SA 2XIYA 5KBRA 1CDKA 2W1CA 3GQIA 3RALA 3VW8A 4F64A 2BVAA 2ITUA 1EH4A 2ZV8A 2ZAZA 4I23A 4N6ZA 5HO8A 4AW0A 4M8TA 2X0GA 3ZC6A 3DTWA 1OBDA 3V8TA 4E3CA 5DPVA 2B9HA 4RJ5A 2C3IB 4EK8A 4FIJA 2OH4A 4CKRA 5CS6A 3A8XA 3TWJA 4DH8A 5IMEA 2R9SA 5EM6A 5ETIA 1PXMA 3OUKA 1Q41A 4CYJA 4S31A 1P5EA 3V5QA 1OZ1A 4HGEA 5C03A 2BKZA 5C9CA 2G2HA 1KOBA 3HLLA 5M57A 2JIIA 1BMKA 1OI9A 1Y8GA 3CBLA 5EM5A 3WZEA 5A6NA 4R78A 5BVEA 5AFVA 4QT1A 4F65A 5J7HA 4M0ZA 3EKKA 2QO2A 4FG8A 3C13A 4M68A 2XKFA 2Z2WA 1M17A 5AEPA 5LVOA 5ETAA 3DBEA 1NW1A 2YM7A 3FQEA 4LL5A 3D94A 1BL6A 5L6PA 2VWWA 5H3QA 4Z3VA 3NLBA 3K2LA 4H39A 5CSWA 3R22A 1REKA 4PDPA 5DMZA 2E9UA 3MS9A 4ASXA 4C35A 4EH3A 5CI6A 3UMXA 4PDSA 2QOLA 4IIRA 1LP4A 3KK9A 1XH5A 4GH2A 3F2NA 4C3RA 2PUIA 1JNKA 4R8QA 4QMOA 3ZMMA 4BCIA 4ZZNA 4HGLA 4O6LA 3P23A 3BHYA 5DI1A 5HVKA 3TCPA 3RPSA 3CQUA 2C3KA 3BYVA 3PPKA 1DAWA 3MTFA 2VGPA 5CU2A 2A2AA 4QMTA 4YJQA 4EK6A 2EXCX 3WYXA 4L9IA 1M7NA 1GY3A 4JL9A 4R6VA 4Z7HA 4Y72A 2OF2A 2PVKA 4EOJA 3K54A 2GQRA 4CT2A 4KKGA 2V62A 1Y6BA 2C6TA 4OTHA 5BUIA 4HPTE 1OKWA 2BIKB 2HZNA 2PMOX 3QTZA 5LWMA 3UNKA 3E63A 3Q4UA 3QHRA 4S34A 5GJGA 4DEGA 4USFA 3CGFA 3IOKA 3OCTA 2YLFA 5H8BA 3H4JA 4E4NA 1E1XA 1OIUA 3PRFA 4LYNA 4IB1A 1PJKA 4XCUA 4UWYA 4ANLA 1P14A 2PSQA 3ZDIA 3R8LA 4NM7A 4CG9A 5IQAA 3LFFA 4KAOA 2P55A 3JPVA 1OVEA 4A4OA 3E5AA 2XBJA 4LV5A 4BCFA 3D5VA 5CU0A 1PKDA 2I40A 3BYOA 3BLRA 3W16A 3IDBA 3F7ZA 2W1GA 3R73A 2VX0A 5EHLA 3B8QA 1QL6A 3DY7A 3H0YA 4I6HA 1MRUA 3AC2A 2QO7A 2R64A 4F9YA 1URCA 3GCUA 3ZO1A 4E5BA 2BPMA 5J87A 3DAKA 3KXGA 1F5QA 4A9UA 3FLSA 4CEGA 4YURA 3PLAE 4DH5A 5FWKK 2HENA 1PXPA 3LFAA 4W4XA 4BDHA 2JDOA 4LUDA 3TEIA 3FMKA 2CNVA 3UZPA 5LVMA 2VTRA 3CQEA 4GU6A 4QP2A 4DH3A 3MW1A 2OFVA 4KKHA 4O38A 3JYAA 2QU5A 1H4LA 4K1BA 5FLFA 2V22A 4G3DA 3I6UA 4YJPA 4BKJA 3VUTA 1ZYCA 4U44A 5AV1A 2B7AA 2X4FA 3R8MA 4D0WA 5CNNA 4EQUA 3U6HA 1PHKA 3NUPA 3VBQA 2XIZA 5HLPA 1MQBA 1PYXA 3V6RA 3VUGA 4H1JA 3ZTXA 1GZOA 2X9FA 3A7JA 2AC3A 3D14A 3R1QA 4I5HA 2C5YA 1JQHA 3SG9A 3V8SA 2CLQA 4BDBA 1JKSA 3G6GA 2C0IA 4TXCA 3F5PA 4QMLA 4JAJA 4BDKA 2E9VA 3PE1A 4RIXA 4FTLA 2VWUA 5EKNA 3LFBA 3NMUF 4ZTLA 2C1BA 3GCSA 4BTJA 4F6SA 1VYZA 4F0FA 2H34A 1YOJA 2IZUA 2F7EE 2NP8A 3DAEA 3PY3A 4CCUA 3ULZA 5HBJA 4FTKA 5IQDA 3E93A 2NPQA 4BCJA 5AA9A 2G2IA 4GJ3A 5DNRA 1P2AA 1V0OA 3W8LA 3ZBFA 1H01A 5CEMA 3FI3A 3AC1A 4AA4A 4RVTA 1ZMUA 4HCUA 4IVCA 5AR3A 3GU6A 5A6OA 5CSPA 4PMMA 5CVFA 3BYSA 5DRBA 2W0JA 3CPCA 3DGKA 2VGOA 2VTTA 2FGIA 2WPAA 4MAOA 5F1ZA 5FXQA 4BZDA 3NS9A 4FV7A 1YKRA 4QQJA 5M06A 4K8AA 3BWJA 3DT1A 3NSZA 5IG1A 4IAAA 3ZM9A 4DH1A 4OBPA 4U43A 5M4FA 3HMOA 3RNYA 3GEQA 2YJRA 3KRRA 4MNEA 3NAXA 4DT9A 4UBAA 2IVTA 4GCJA 4RX8A 4NCTA 4O7NA 1V1KA 3QTWA 3LQ5A 4PQNA 5CVHA 4U40A 2C5NA 4MNEB 4QP4A 4HCTA 2Z8CA 3WYYA 5IISA 4NKAA 3ERKA 3MWUA 2QCSA 4O96A 4X6RA 3MTLA 5ACBC 4FEWA 2BFYA 3QCXA 4MBLA 1FOTA 1KSWA 3ACKA 2ONLC 1W84A 3HV5A 3QLGA 5A3XA 4A06A 3FMHA 5AUTA 2OJ9A 1FGIA 2YM8A 2A19B 4QPSA 3REPA 3COMA 3LXNA 4M7IA 5D7AA 3RAHA 3DK7A 4I24A 3F88A 1H1RA 2X4ZA 3NAYA 1YDSE 2C0TA 3FPMA 4M66A 3UOJA 3EN5A 3ELJA 4R77A 2HY0A 1DI8A 2HAKA 3Q2JA 5JK3A 2VO3A 4XG6A 4Q9SA 4GU9A 5D7VA 4UXQA 4EORA 2X2LA 4AOIA 3NVKI 4HJOA 4F4PA 5LVNA 1ZRZA 5CI7A 3ORIA 1IG1A 1XH7A 3EYHA 4BCOA 3UO5A 3VS1A 4JVGA 4GYIA 2JIVA 4P90A 3MVJA 3UNJA 3ZSIA 3LXLA 2VWVA 3C0HA 4M14A 4YBJA 3UZTA 5EYMA 4ENXA 4F9CA 1WBPA 4FC0A 2DWBA 3VBYA 1VZOA 3VRZA 3MY5A 4M0YA 4XUFA 3PVGA 4D2TA 5JRQA 3GFWA 2IG7A 2W1EA 1Z57A 5A4EA 4F09A 4CFUA 2YDIA 3CIKA 5K9IA 4EH7A 2W1ZA 5IQEA 5J9ZA 4CKIA 2XB7A 4N57A 3U4WA 4FSNA 3ZH8A 2R3IA 3ETAA 3O23A 3P9JA 3HMIA 4CVAA 2WQMA 3FWQA 3FLYA 4IX4A 3FZOA 5AV2A 5DT0A 3JY0A 4Q5EA 4WNPA 2JLDA 1ZMWA 2GS6A 3EL8A 2Z60A 3GI3A 3MSSA 4IB3A 4FKLA 3MVHA 4FKJA 3VBWA 4RWLA 4DFUA 2IVVA 2B53A 1WBOA 4NM0A 5JMSA 4JDKA 4YJUA 4O91A 1QCFA 2QI8A 1K2PA 1GZKA 2GTNA 2J7TA 2J90A 3AGMA 3NCZA 4G1WA 4HZSA 4E7WA 1H24A 4H3BA 3BHHA 5IUIA 4FV6A 3GC0A 3LCTA 5CT7A 1ZLTA 2UZDA 3COKA 2WQBA 5JN2A 2ETMA 2P2HA 2VWBA 4TNBA 2FSOX 2X6EA 3BCEA 3F2AA 1OMWA 1GAGA 2ZM4A 3LFSA 4II5A 3JVSA 2FH9A 3A8WA 2V5QA 4R7HA 3O8TA 4O0WA 5CAVA 2UW5A 4I0TA 1BI8A 1Q8YA 2R0UA 3UJGA 2QODA 4HYUA 3HDMA 1UNHA 3NYVA 4O7YA 5AR7A 5DWRA 2CJMA 4DTBA 4FOCA 2R7BA 3RM7A 3MH2A 4APPA 2UVZA 3ORMA 4B8MA 2HYYA 5AAEA 3BBWA 3FLQA 4L42A 4C02A 3PXKA 3RTPA 2ZV2A 4K2RA 1ZOHA 4IDVA 4QMVA 4XP2A 4BC6A 1OB3A 2PY3A 3SV0A 4G3GA 1PMVA 5HLNA 4BGHA 2WMUA 4L44A 1E9HA 1BX6A 2RG6A 4IQ6A 4IDTA 4RX9A 4WG3A 4QOXA 4U42A 2Q83A 4XYFA 4IW0A 4IAKA 5EYDA 3RZBA 1KE6A 4IZ5A 5M53A 1GIJA 3AD5A 3HNGA 3VS7A 3EQIA 4A9SA 3D15A 2C30A 5FTOA 5KUPA 2C5OA 2BROA 5J8IA 2I1MA 4W9WA 5HKMA 1YI6A 5EQYA 4QTEA 5IEVA 5JFVA 1TKIA 4PRJA 5ANKA 5M55A 2W5HA 2W4OA 4QMYA 1ZYLA 4BHZA 4CV9A 4O1PA 1Q3DA 3Q4ZA 4AZEA 3ORKA 4MTAA 2GCDA 5BVKA 4FG9A 3WF8A 4CKJA 4DFBA 5AX9A 2XF0A 3L9MA 5AWMA 4QNAA 3QQLA 4ANMA 1SZMA 5GZ8A 3WBLA 2WIPA 4KWPA 4YR8A 5BQ0A 3EB0A 4U79A 2CMWA 4DTAA 3O17A 4G16A 2G15A 2XK6A 1OPJA 5K5NA 3LOKA 5M4CA 3AG9A 3ZSHA 2BTSA 4R3PA 5JFSA 3H9OA 5FEQA 2QLUA 4RFYA 2XJ2A 1LPUA 1IR3A 3L1SA 3BV3A 3QTIA 3RCDA 2QLQA 4KD1A 3U8WA 4C33A 5E7RA 3GFEA 4XRLA 2OJFE 5A4QA 3V01A 4NW6A 3JS2A 3FPQA 4DEEA 3OC1A 2G9XA 1WBWA 3MESA 1ZWSA 2WB8A 3SG8A 1R78A 3CD3A 3KN6A 3LCSA 5HE0A 4F63A 4AZWA 3SX9A 4EC8A 2JKQA 2VRXA 3ORXA 4F1OA 2WELA 4PWNA 4EOKA 4FZ6A 2W96B 1WVWA 4F7SA 3DXNA 4IMYA 4UXLA 2WAJA 3TN8A 3HKOA 4DHFA 1M2QA 2BUJA 3AT4A 3GU8A 4TWNA 4WNOA 2CCHA 4FKRA 4NIFA 2CNQA 5DHJA 3UVPA 1W83A 4OTFA 5EHYA 1ZXEA 4L6QA 1ZYJA 4FX3A 1T46A 2A27A 4J53A 4PL4A 4XEYA 4ZTRA 4E5WA 4NIFB 2XCKA 2AUHA 2CNUA 3W2CA 3E8EA 2WMRA 2I0HA 2J9MA 3VBTA 3VUKA 2B0QA 3VS4A 3BGPA 2UUEA 2YWPA 5HNBA 3UO4A 4ZY4A 3GC7A 5IH4A 3R9DA 1QMZA 2R3HA 3MJ1A 3FXZA 3WZUA 2RSVA 5JEBA 3D2KA 2RFEA 3LFDA 3FHRA 3R1YA 1JSTA 5CANA 2XIRA 3AXWA 3MY0A 4EZ5A 3KXXA 5A54A 3K3JA 3V5PA 2YISA 4RWKA 5HEZA 5KZIA 5FXRA 3R71A 5AAGA 3TUDA 4TYGA 4TWOA 2PL0A 1TQPA 2AC5A 4X21A 2IWIA 4D1SA 3C4WA 4A9TA 2R3PA 2W1IA 4MXYA 3G90X 4UMQA 5L2SA 2R3JA 2OF4A 5J5TA 4YTFA 2VTAA 4ZIMA 4C0TA 3MB7A 2WTWA 3PWDA 2XKEA 5E8SA 1ZZLA 3QUDA 2QNJA 2P2IA 1QPDA 2V7AA 3A99A 3OY1A 3ZM4A 4E4LA 3EMGA 3MDYA 1XH6A 3QWKA 4U8ZA 4D1XA 4RSSA 5JFXA 2ERKA 3UQCA 1UWJA 4EWHA 4F7NA 4OTDA 4PF4A 5KCVA 2VWXA 3I4BA 3WILA 1G8AA 3D5UA 2BZHB 3LCOA 2VTOA 3P4KA 4IFGA 2ZV7A 5HBEA 2GNHA 4E6CA 4ZK5A 4YZ9A 4RLLA 4MQ2A 4IXPA 2UW7A 3Q4TA 4ZZOA 1CKPA 5KHWA 4BDIA 5CF8A 5BMSA 3SXSA 4R7BA 4IAFA 2QC6A 5EDQA 3OUNB 3MFUA 2YM6A 1OIYA 3KRJA 2PK9A 4DE4A 4YO4A 4GKHA 5FBOA 5CSVA 3W10A 3CE3A 5I9VA 2YDJA 1W0XC 3S3IA 1URWA 1GNGA 4MX9A 4YNEA 2ETRA 4DINA 3C1XA 4YHFA 2GNIA 1YDRE 2JDVA 3DFAA 3KCFA 5AADA 4O0VA 4F08A 3P08A 3QQJA 2CDZA 4CXAA 4O7RA 4PPAA 3C5UA 5J1WA 3FI8A 2Y9QA 2PULA 4L8MA 4FVQA 2YDKA 4PTGA 4WG4A 3H9RA 2X2KA 4B6LA 3VS2A 5DN3A 2OWBA 3OT8A 1SNUA 3BELA 3VIDA 5DT4A 5F95A 3UMWA 4C61A 4UZHA 3A60A 3MIAA 4O6EA 2F7XE 3TV7A 3WOWA 4D5KA 4QMSA 5J79A 5KHXA 4R7IA 3EZRA 3FC2A 4DEAA 3R9HA 3GOKA 2OU7A 3AOXA 2VO7A 4BCGA 2IZTA 3IDCA 3AMAA 2XEZA 3MBLA 3VJNA 3HAMA 3ANQA 4G6NA 1YHWA 2C0OA 3I79A 4X2KA 3E7VA 4O22A 3EQBA 4FVRA 3U55A 4MQ1A 3MI9A 4WNMA 3BU6A 5C27A 2C69A 2E9NA 2QONA 3AGLA 4U81A 5DBXA 4CMUA 3KY2A 3KVWA 2ZYBA 4YHTA 4EBWA 5E4HA 3GCQA 5JFWA 5ANJA 3VN9A 4EOQA 5IDNA 3FJQE 1A06A 1R39A 4APCA 4BYIA 5J5SA 2VZ6A 5E8XA 4HVDA 3KC3A 4GMYA 5I9YA 4ACCA 2CKEA 1PF8A 3Q53A 2B4SB 3O2MA 4QP8A 2QU6A 4O0RA 4F7JA 4KNBA 5EHOA 2UZEA 1YXVA 3WZDA 2VWYA 4X6QC 5ANDA 4AU8A 1UKHA 2PWLA 1ZZ2A 2NRUA 3MJ2A 4TWPA 3S00A 3FDNA 1IA9A 3E8DA 4ZY5A 2XRUA 1ZARA 5M56A 5DEWA 5F4NA 3Q9ZA 4BDEA 4FNXA 4B99A 2UZUE 5HCZA 3QGWA 2J50A 3D4QA 2BMCA 4D4SA 4ERWA 3GGFA 5AP4A 5FUTA 1U4DA 3FSKA 1G8SA 4FSRA 4QYFA 4JS8A 3I81A 4WA9A 2PUUA 4BBFA 1R0EA 3DXQA 3OW3A 3PA5A 4YZMA 3M42A 5G6VA 3EQDA 1PXIA 2G1TA 3OCBA 4OUCA 5T6KA 3WI6A 3CJFA 4EUUA 1JVPP 4FKQA 1OKYA 4RIWA 4ITHA 4X7QA 3VF8A 1W7HA 1MRYA 4CRSA 3KULB 2C6KA 5HE3A 5HX6A 4QMPA 3FI2A 3R8PA 4O82A 2ZM1A 4QPMA 1H26A 3QRKA 2B52A 4RIWB 5AUXA 4ZP5A 5EYCA 2QG5A 5IA3A 1FPUA 3FL5A 4W8DA 3ZFXA 5EW3A 3VQHA 3S1HA 4OTIA 4BB4A 4FEXA 4H3QA 2O3PA 2EVAA 2WTJA 3O7LD 2XJ1A 3F3TA 3RCJA 3E8NA 3T3VA 3E3BX 4C4GA 3KFAA 5CTPA 4DAWA 1FINA 3RINA 3F61A 4OLIA 4QP1A 5HTIA 3BRBA 4FV4A 4RJ8A 4KBKA 4BDJA 4F1TA 3EOCA 3P86A 3H10A 5T68A 3W1FA 3PVBA 4K6ZA 4TN6A 2HZIA 3PXRA 1UNLA 4EJNA 3GB2A 4BWXA 2EB3A 3GVUA 3CR0A 3VUDA 2YABA 1V0BA 4RJ4A 4YZNA 3V6SA 2YIQA 1FBNA 2P33A 2YM3A 3CEKA 4RX7A 4FV0A 3EIDA 5GJFA 4FSTA 2XNPA 4QTAA 3SXRA 3UOKA 5F9EA 3DOGA 4LRMA 1JKKA 3EQPA 4ACDA 2HZ0A 3F5XA 3HP5A 3COHA 3NUNA 3MVLA 3OHTA 4BCMA 5ANIA 3UYTA 3LMHA 4DG2E 4A07A 4WBBB 4B0GA 4BKYA 4RA4A 2I0YA 3VO3A 5FDXA 1TQIA 4ZSEA 5HIDA 4I5CA 2YM4A 5L6WL 2OW3A 4GT3A 5H9BA 2PE0A 2XK4A 2JKMA 3R7VA 1KE9A 5CLPA 3R0TA 4O0XA 1XBBA 3A7HA 2C6EA 3AMBA 4C4FA 3POZA 4GUBA 2XNOA 5A14A 1ERKA 4GL9A 2J6MA 1AGWA 3L8XA 3O8PA 5L4QA 3H3CA 4OTPA 2ERZE 5F20A 3F5GA 4YZCA 4KSQA 5HO6A 5CF6A 5JGBA 3TKIA 4FTCA 4FTRA 4HCVA 1IRKA 3K5VA 5GJDA 2JEDA 4NH1A 3EFKA 2GNGA 3CPBA 3QD2B 4DG3E 3R1SA 3NPCA 4IHPA 4K18A 3MV5A 2W1HA 4FIFA 2YZLA 2GQGA 5BYZA 4HGTA 2VD5A 3NNXA 2QOIA 4JRNA 2UVYA 2O8YA 5IQCA 3EWHA 5BVDA 1DI9A 3DV3A 4BBEA 3TDWA 4ITJA 4IACA 4Y95A 5LMKC 4TYEA 4BI1A 3PZHA 2GQSA 3UOHA 2CSNA 2VU3A 3EQFA 2WTIA 3D5XA 3R9OA 3IGGA 3MIYA 4H36A 4CD0A 4MXZA 3R02A 1PXKA 1J7UA 3EN4A 3MA6A 4FIHA 4QMQA 1GOLA 5CAUA 5I4NA 4ZJIA 1Q97A 2OJJA 3C4XA 1OL5A 2CGWA 3KXHA 3OCSA 3PWYA 4OBOA 3ZC5A 4RQVA 4FGRA 2C5XA 5L8JA 3UQGA 4FT0A 4FZ7A 2IZSA 2WZJA 3UQFA 2OFUA 1STCE 3ET7A 2WMQA 4BWKA 5J1VA 4OBQA 4ARKA 4CMOA 3SOAA 1JKLA 4MHAA 3RHKA 4WIHA 3KN5A 4QP6A 3FXXA 3P79A 5EFQA 3AMYA 4IZ7A 4DBXA 4QYHA 2H96A 4BDGA 4UWCA 5E8VA 4AW5A 2ZB1A 2B1PA 3U6IA 2QKRA 3N4UA 4F9WA 4V0GA 3K3IA 2WTKB 4CNHA 3G9NA 3KB7A 3L8PA 3Q5ZA 4V0GB 1YDTE 3BGZA 3VHKA 4I6BA 4EK4A 4IC7A 3R6XA 2J0KA 1Y6AA 2JAVA 2WU7A 2JDSA 4MXCA 3RAWA 5EI2A 4RFMA 3UDBA 2JD5A 2Z02A 1KOAA 3DBQA 3KCKA 2XM8A 4AN9A 5JQ8A 3QF9A 2B9IA 3DBDA 3QUPA 3NWWA 4EQMA 4NKSA 4DEBA 1NVSA 2C1AA 3F7WA 3IONA 3QYWA 4TYIA 4J98A 3F82A 3FYJX 2ITQA 4NFMA 5FDPA 3QD0A 3HMPA 2EU9A 3U9CA 5KKRB 1OIRA 4KBAA 4BIEA 4WD5A 5L2WA 5JRSA 4ZS0A 4UMTA 4IB0A 3FAAA 3R8UA 5IQBA 2ZMCA 3PIZA 1CSNA 4M67A 4FTQA 4W4YA 3MPTA 4Y5HA 4USEA 3JR1A 4JX7A 2Y7JA 4EHZA 3MGYA 4JR3A 3LAUA 3D9VA 4G6OA 1OUKA 4J96A 3D83A 5EI6A 2OZOA 3T8OA 3O50A 5AM6A 5ACKA 4C38A 1BL7A 1BKXA 4QTBA 4BY9E 3F3ZA 4D9UA 3PPZA 2O0UA 3VVHA 3L9LA 4MKCA 1CM8A 4FZDB 1F3MC 1OKZA 4XX9A 4IJPA 1UA2A 4CT1A 3ZZEA 4UMUA 4XNEA 4XLVA 2YIXA 3Q5IA 4OTQA 3IOPA 4L7FA 4XP0A 1WVXA 2Q0NA 2R0IA 4IZYA 4O7WA 4O7SA 2PZRA 4DF3A 2GTMA 3LW0A 1OL1A 2GS2A 3BI6A 3CKWA 5DH3A 5K4IA 3PIYA 3QQUA 3TT0A 2RIOA 5D9HA 3ZLWA 4ZLOA 3LQ3A 3EQRA 3IECA 4QYYA 4RZWA 2ITWA 4BBMA 2OBJA 3BKBA 3RAIA 2KULA 3IW6A 4J52A 3FY2A 3TM0A 1B38A 1YWRA 4J8MA 3GCVA 2JBPA 2R3RA 4RIXB 4RZVA 4XV1A 1PMUA 3G6HA 4CG8A 3TNWA 4FV8A 4XBUA 2WEIA 2C6LA 5HD7A 3NIEA 4G9CA 5DA3A 3RGFA 5A4CA 1H1SA 4FKPA 4AN2A 4BTMA 1XQZA 4Z16A 3SD0A 3FEGA 4L46A 4F6UA 4K77A 4BDDA 4FV2A 3QALE 3VHEA 4XG7A 3W18A 2V0DA 4ONAA 1PW2A 5ETCA 1OKVA 4U80A 2HXQA 4USDA 1RQQA 4KUJA 4AT4A 2OO8X 4FODA 4OTWA 2EUFB 1G5SA 3KL8A 3LIJA 4NTTA 4G5PA 1YXUA 3ZUUA 3OROA 2FYSA 1UU8A 5AP1A 3BIZA 2PVJA 3R1NA 4BDCA 4NUSA 3E7OA 3TUBA 3RAKA 3WE8A 4YZDA 1F0QA 3VS3A 2B9FA 3WARA 3OWPA 5CEOA 5LVPA 2A0CX 3H9FA 2CHLA 4R1VA 4MF1A 2GNJA 3TUCA 4BIBA 5EOLA 3W55A 4FICA 3TZMA 4AZVA 2JDRA 3V3VA 3PY1A 4XHKB 2VTLA 1L8TA 4G3FA 4RJ3A 2XNBA 3BHVA 3ENMA 3QZIA 5AP0A 4Q5HA 5I3OA 4G17A 1XH9A 4UALA 2QHNA 4B9DA 5AP2A 2JDTA 3D7ZA 2X1NA 4L7SA 3W2PA 5IH5A 3SA0A 4FF8A 2R3MA 4FYNA 3FY0A 4YBKA 3ZRKA 4AE6A 5CY3A 5KMNA 4NYEA 4ZMFA 1IA8A 4J97A 3QC9A 4H3PA 5BVNA 1WZYA 3V5WA 4AW2A 3QFVA 3N4TA 4BR3A 1B39A 5AM7A 3A4OX 5LWNA 3FE3A 4EHEA 1U46A 2XYNA 2IPXA 1UV5A 5IUHA 3PJ3A 4TZRA 2XCHA 2GSFA 2VAGA 4FL1A 4RJ7A 5I3RA 4XG8A 5EQPA 5EG3A 4ANNA 1Y57A 4ZMEA 5F94A 4EH4A 2OI4X 3CY3A 4RC2A 4KINA 4YGAA 4CCBA 5BX0A 1SNXA 3JUHA 1MP8A 2WOTA 3TZ7A 3U4UA 3TL8A 4GG5A 2OJGA 3P0MA 3I7CA 2R5TA 4O0YA 5BYLA 4RG0A 4KS7A 3QD3A 3R21A 4JDHA 3R7OA 3TKHA 3QHWA 4IVAA 4UZDA 3II5A 3NUSA 4FMQA 4C4JA 4E1ZA 5C4LA 4AGUA 5B7VA 4CFFA 2FO0A 2YCFA 2DUVA 1XR1A 2VN9A 4DITA 2IVUA 3NIZA 4JG6A 3UTOA 3FHIA 5M4UA 4LMUA 4OT5A 4ALWA 4EK3A 3GC8A 3LCDA 3QAME 3K5UA 1PXOA 3NZ0A 2WU6A 2Y0AA 5AUYA 5TT7A 4C4HA 4L52A 3OXIA 2HY81 5DR9A 3A4PA 5FD2A 5ANGA 2OIBA 5IQHA 1WMKA 3W2QA 4IANA 1YXTA 4IFCA 1BYGA 3E88A 5C8MA 1ZOGA 3NUXA 2GFCA 4E73A 4WRSA 2F4JA 3VUIA 4EH9A 2Y4PA 3BU5A 3EHAA 3PVWA 3UPZA 2XA4A 4IE9A 4QYGA 4QQTA 4IAYA 4YJTA 2NNWB 3PP1A 4ZXTA 3NR9A 4V04A 4MVFA 2UW4A 3NUUA 3QA0A 2PMLX 4H58A 3HGKA 5GINE 4J95A 3RP9A 4O81A 5LXMA 3NDMA 4PDOA 3W2RA 2PZ5A 1YXXA 4TWCA 3KRLA 4MXOA 4C4EA 3O0GA 1J3HA 2PVFA 3QTXA 4D2PA 3EN9A 3KKVA 2DS1A 1H1WA 4DGLC 4JLCA 4PPBA 5HIEA 4FKVA 2FUMA 5CASA 4OT6A 2CCIA 4QPAA 4D58A 4DH7A 1M2RA 4YJOA 4CFWA 5HQ0A 3KA0A 3FLNC 3FZ1A 2UW8A 5FM2A 4YTCA 2UW6A 2Y4IC 1WBSA 3DXPA 2DYLA 4RQKA 4RVMA 3KGAA 2GDOA 3WE4A 3C5IA 4TY1A 1ZY4A 2XVDA 2CKQA 4QMWA 4DEIA 3S95A 4FK3A 3M11A 1BUHA 4IX3A 5KMLA 3KXMA 4EUTA 4FKGA 4ZOGA 4DCAA 3VUMA 5HE1A 2WMTA 5K0KA 4BZOA 3R8VA 4LGHA 3UE4A 5I9XA 4LQMA 1A48A 1Q8ZA 2A1AB 5LCKA 2VNWA 4ZSLA 1JSVA 3TZ8A 5B2MA 4PDYA 3EJ1A 2IZRA 3RI1A 2YCRA 5EOBA 4BN1A 3JVRA 2VTSA 1FVRA 3IDPA 5D41A 2WKMA 4EKLA 4ZAUA 2WMWA 3EQCA 3ENHA 1JSUA 3FMDA 3LJ0A 3QZHA 5IA2A 3AD6A 2YIRA 2CGUA 2X9EA 3EZVA 4S2ZA 5KBQA 3KRWA 4FSZA 2X8IA 3QZGA 3B8RA 1Q24A 1M2PA 2R3GA 3MA3A 3NCGA 5CU6A 5FTQA 3RK5A 2G01A 2C3LA 3CTJA 2UZWE 3GENA 4HYHA 4EZ7A 1A9UA 4I5PA 3GOPA 4JBVA 5EK7A 3GC9A 3CQWA 3RNIA 4B7TA 3DPKA 3DS6A 3ZRLA 5EDPA 4BZNA 5GZAA 2BRBA 2WMSA 4QMUA 2OH0E 4HYSA 4MNFA 4QRCA 5LCJA 3DDPA 5IA1A 1ZOEA 2X8DA 4ACHA 3PA3A 3HDNA 3Q4CA 3SC1A 5D10A 3QKKA 3E3PA 3OBGA 3IS5A 4E6AA 3EN6A 3M1SA 3AC8A 3SOCA 1VYWA 4LRJA 5JZNA 1IAHA 2WQNA 4U3ZA 2IVSA 3GQLA 2BCJA 5G1XA 4D5HA 1DM2A 4U5JA 3R8ZA 3CSVA 4TKSA 2HWOA 3PP0A 3NW5A 4E93A 3TZ9A 5CAQA 4GFOA 4U3YA 3V51A 1ZMVA 4GVJA 5HBHA 2R3QA 2JBOA 2PU8A 3MH3A 3TIZA 3UP7A 5K0XA 4YC6A 3RK9A 3ZRMA 3NNUA 4EQCA 1R3CA 5CENA 4CZTA 4CLIA 5TO8A 3KMWA 4EL9A 2XZSA 3BGQA 1K9AA 2WMBA 4D2SA 3LMIA 3CC6A 3DNEA 4XOYA 2XK3A 3AC4A 4RFZA 5C26A 4HPUE 4FL2A 4C59A 1AQ1A 3PFQA 4YTHA 4CFVA 4UMRA 4M12A 2XBAA 4Z7GA 5JT2A 3OP5A 2CLXA 3OG7A 4OTGA 2C4GA 4WUNA 5FQDC 4PUZA 4FR4A 4RIOA 4QMMA 3E87A 4IAIA 4OAUC 2PPQA 3NNWA 3PUPA 4O2ZA 1Q5KA 3TTJA 4EOLA 2B9JA 5CEQA 2BRMA 3CP9A 2OZAA 2WQOA 3ORZA 4LGDA 4LOPA 4R1YA 1WVYA 3RK7A 3TG1A 1O6KA 4I4FA 4DFYA 4FYOA 3BYUA 3N9XA 4LG4A 3R9NA 3PJCA 2JAMA 1L3RE 4CQEA 3PG1A 4LL0A 3OXZA 2OZAB 3ZZWA 2VTMA 1GIHA 4D0XA 3S0OA 1W82A 4AUAA 3RWQA 4C4IA 4YNOA 2BHHA 5CX9A 4E4XA 4GG7A 3DK3A 4BHNA 3RBWA 4FIGA 4WNKA 4D2VA 4I6FA 4P5QA 5AR4A 1SM2A 4AOTA 4YZBA 5IQIA 3KK8A 4QYEA 1H8FA 5BPYA 2UW0A 4Y8DA 3DQWA 3O7LB 1MRVA 3TNIA 4NJDA 4JDIA 3OTVA 1H07A 2WFYA 5D1JA 4V05A 1G3NA 1OITA 1J1CA 3OT3A 3ULIA 4BGQA 5KMKA 1OM1A 2C3JA 2BHEA 4W9XA 3OMVA 4GW8A 1YI3A 5TR6A 3QTUA 2ITTA 3ZEPA 3LFQA 3ZXZA 4O7LA 5M07A 5CSXA 4O83A 2KTYA 2XIKA 1WFCA 1H0VA 4KRCA 2WO6A 4UEUA 4XRJA 5TOZA 2XUUA 4QMXA 2VO0A 1SVGA 1KE7A 2PZPA 3DJ6A 3HX4A 1OBGA 1H1PA 1PRYA 3Q32A 3L8SA 3FL4A 3ZYAA 4X3FC 4IBMA 1XH8A 3KVXA 4C2VA 3I0QA 4PTEA 2HW6A 4DBNA 4S33A 1H28A 4XH6A 3ZLXA 3R7EA 1H25A 2BRNA 2W7XA 2YIYA 4TTHB 2R3OA 5AV3A 3R28A 2VTIA 1ND4A 4U97A 3U9NA 4CFXA 4FKTA 4BICA 4RWJA 3GT8A 4J7BA 1Y8YA 2IW6A 4N70A 2PMNX 3OBJA 3A7FA 4XG3A 2WNTA 4PMSA 5J9LA 3R04A 5KNJA 4Q2AA 2W05A 3HP2A 4CYIA 3NUAA 3FBVA 3MFRA 5HI2A 1KV2A 5E8TA 3KEXA 2X8EA 4KIQA 3ZS5A 4YC8A 2UV2A 2R7IA 2YHVA 3BQCA 4XJ0A 4IC8A 5CU3A 3UOLA 1WCCA 3DKGA 3JY9A 4QQCA 2G2FA 1RJBA 2QKWB 1XBAA 4S32A 2YA9A 3C0IA 3D0EA 4ACMA 4D1ZA 4EONA 1OIQA 1SYKA 3R7IA 5HU3A 3DKFA 1HOWA 3DTCA 3LCKA 4IWQA 3QL8A 2XNGA 3FLWA 3FZSA 1I09A 3O8UA 4RGJA 2QG7A 3R7YA 4FEVA 4FTMA 3SXFA 1YRPA 3DDQA 3TNHA 5IPJA 3QX2A 2EXEA 5AUZA 2O63A 1UNGA 4GIIA 4A9YA 2GMXA 3OXTA 3SKCA 4AFJA 2GS7A 3LE6A 2OXYA 2R3KA 1H08A 1XWSA 3EKNA 4PL3A 5IU2A 2BALA 1OGUA 1W8CA 4F9BA 5E1SA 3S4QA 3EQHA 3FQHA 5A9UA 4FNZA 4I20A 2YACA 1RE8A 5AV0A 1CKJA 5HLWA 4TRLA 3PTGA 3F5UA 4RBLA 4ENYA 1VJYA 4MD7E 4Z55A 1MQ4A 1VR2A 3ALNA 2ZDUA 4JRVA 4IX6A 4CGAA 4XV9A 1NXKA 3FKLA 4RRVA 3UBDA 3HV7A 3PSCA 2W1FA 3GBZA 2PE1A 4ZTQA 3MY1A 4YLJA 3GU5A 4QTCA 3VS0A 4FE2A 4X0MA 2Y8OA 3RKBA 4PX6A 3TNPC 5EM8A 3VNTA 5TE0A 3Q9XA 2C6IA 4BCNA 4YUQA 1H00A 3MB6A 4NT4A 5E8YA 4O1OA 4EH2A 5IH6A 3G33A 4EHGA 1OECA 4GK4A 3QCSA 3Q3BA 3VJOA 4E20A 3PVUA 2VTJA 3PSBA 1ZYSA 3SRVA 5KO1A 1U5QA 1TQMA 2EB2A 4I6QA 4E26A 4YMJA 5I9UA 3F2RA 3DCVA 3QQFA 2J51A 1E1VA 5CXZA 2QOOA 5HU9A 3ID6C 1O9UA 2HZ4A 4FNWA 4PY1A 4XV2A 2QOQA 3BE9A 5CEPA 4AAAA 1GJOA 3FMJA 4R3CA 4JR7A 4JOAA 1Q8TA 2RKUA 3JXWA 4G2FA 4A7CA 1YHVA 5E1EA 3UYSA 5BVWA 3VS6A 2PVHA 5AUVA 2X81A 4EOSA 2I7QA 1J7IA 4TYJA 4XLIA 4A4LA 4JIAA 3ROYA 3TXOA 4BYJA 3UG2A 5LMBA 2JITA 3NYXA 4I4EA 5CAPA 2W17A 3KF4A 1JWHA 4MXAA 3V5TA 4ZEGA 3U6JA 2OICA 3UIXA 1S9JA 3VBVA 4B8LA 3I6WA 1KE5A 4MXXA 4G9RA 4LRKA 4RMZA 4UWBA 5BVOA 2QOCA 4IVBA 3DZQA 2YITA 2I6LA 4K33A 4RVKA 3LZBA 2HIWA 1ZYDA 5E8WA 1UKIA 3VWAA 4MWIA 5CYIA 3F3VA 4ZSGA 1Q8UA 3UC4A 4FT7A 2YCSA 4BCPA 2NO3A 4EJ7A 3Q96A 4GT4A 2XK7A
chains in the Genus database with same CATH superfamily
3SHEA 4R3RA 4AFEA 4E4MA 2PTKA 3QBNA 4ZJVA 2JFMA 4ZS4A 4GSBA 5BYYA 2UZNA 3NUYA 4OGRA 4BCHA 3ZFMA 4WHZA 2RFDA 3QTSA 2ITZA 2UW9A 4FNYA 1KE8A 5B0XA 4D2RA 1KUTA 3ZO3A 2BZIB 3AC5A 5DEYA 4LFIA 4WOVA 3QUEA 3EYGA 4X2NA 4MWHA 2GHLA 2W4KA 4M69A 3BEGA 4FKSA 4TNDA 1VEBA 1U5RA 3LQ8A 1Q8WA 5E92A 5K5XA 4NJ3A 5BMMA 1CKIA 3QWJA 4NM5A 3V04A 3CS9A 3DLSA 4FT5A 4M69B 4L3LA 3RPVA 5A46A 3AC3A 2BR1A 3QYZA 3MYGA 4AOJA 4FEUA 5GIPE 1LEWA 2X2MA 1TVOA 3LM5A 2Y6MA 4P4CA 4JJRA 4LI5A 3OVVA 2BIYA 2R3FA 3DA6A 4ACGA 3TDVA 4QQ5A 4MEDA 3IK3A 1V0PA 4TPTA 4TW9A 3VRYA 4BRXA 3TKUA 4XG9A 3POOA 4IWOA 2WMAA 4RA5A 4IWDA 4EH6A 3OWJA 4FV3A 3CD8A 5AX3A 5JH6A 2JC6A 5LQFA 4FTUA 2A98A 4AX8A 1CTPE 2RL5A 1JLUE 4AN3A 5CQWA 3WIGA 4QMNA 4GVAA 3VUHA 4BFMA 4G3CA 4LOOA 2BAJA 2VTHA 4C36A 3BHUA 1M52A 4DEDA 4LV8A 4EOOA 3C7QA 2VWIA 3HMNA 4XV3A 2WGJA 4CV8A 2WTKC 3E62A 2GHGA 3CGOA 2WTCA 3QGYA 5DRDA 4EHVA 3OZ6A 4HOKA 5LVLA 3TACA 3G15A 3CKXA 1CMKE 3V8WA 4YSJA 3BWFA 2BFXA 5D12A 4QTDA 4DFNA 4DA5A 5AAFA 3KU2A 3ZLSA 5K3YA 1Q99A 3HAVA 4LMNA 2GU8A 3UPXA 3ZO4A 4C34A 4DGNA 2ITPA 1OUYA 3N51A 1NA7A 4GK2A 4AG8A 1XHAA 2ITVA 3KMMA 4IM2A 5HE2A 1IEPA 2BTRA 3ZFYA 4C62A 5M09A 4EH5A 2IW8A 2W5AA 5KKRC 3R00A 3PYYA 4RJ6A 5AP6A 4B4LA 4V01A 5HORA 5I9ZA 5LMAA 4KB8A 3PY0A 2I0VA 2AYPA 2C68A 5HGIA 4IWPA 1DS5A 3C4FA 3LPBA 4I1ZA 5C4KA 3T9IA 4IH8A 2VUWA 4X2FA 4F1MA 4YC3A 1O6LA 3Q9YA 5HVJA 5GHVA 2PVLA 3U51A 4CZYB 5B2LA 2UZTA 3OWLA 4FTOA 3RZFA 1XKKA 3OS3A 2OG8A 2CGXA 3UC3A 5LJJA 3QRTA 3BX5A 2OK1A 3ORPA 4C3PA 4N0SA 1QPCA 1ZAOA 4FUYA 4IM0A 1AD5A 5CZHA 2H8HA 5HHWA 5I0BA 3QQGA 4RWIA 2YCQA 3Q60A 4CTCA 3WF7A 3KXZA 5CNOA 4A4XA 3LFCA 2JKKA 5CEKA 5HTCA 3DLZA 1WBVA 2H9VA 4BTFA 3NX8A 1OL7A 4ID7A 2PUPA 2Z7LA 3GXLA 5JZJA 5IKWA 5LMKA 4O2PA 5BUEA 5CEIA 3R9RA 4HZRA 3CTQA 2ZMDA 3DJ7A 4GRBA 5HIBA 3FV8A 3KIOC 5KZ0A 2VV9A 2OKRA 4JX3A 3SQQA 4RVLA 2UZOA 3ODYX 3GU4A 3T9TA 4FKIA 4IZAA 4CSVA 5E9EA 4KIOA 4UB7A 5AV4A 3QQKA 3LLAA 3ZXTA 2BAKA 2LGCA 4M3QA 5CVGA 3N4VA 2HOGA 4TYHA 5AUWA 5E8UA 2OXDA 4ZLYA 3PXZA 1ZY5A 4EEVA 3IW4A 5HZNA 1Q61A 3FLZA 3ORNA 4TYHB 1YVJA 4IM3A 1Z5MA 1UVRA 2YWVA 4E6DA 4D55A 2XK8A 2IO6A 3HA8A 4JI9A 4XOZA 2QURA 1FGKA 3Q6WA 4M97A 5EH0A 4DEHA 4NL0A 1G8KA 2ITXA 3MH0A 2WQEA 4GK3A 3TV6A 3PSDA 3FYKX 1NVQA 3EQGA 4G5JA 4HW7A 3QD4A 3PJ1A 2YAAA 3R7GA 1QPEA 3MN3A 4ZSJA 4YJNA 5AIRA 3SGCA 2W1DA 2X7OA 4YLKA 5CAOA 2O64A 4I22A 4JG7A 4MF0A 2NRYA 4MYGA 4NCTC 3OY3A 3SDJA 3ZLYA 3QKMA 2Y6OA 3IO7A 4MCVA 3DKOA 4L67A 3Q2MA 2GFSA 3KQ7A 4C57A 2F9GA 4HVIA 5HOAA 4D4VA 2YZAA 3A62A 3OWKA 5GNKA 4QMZA 3RHXA 3EH9A 4W4VA 2H6DA 2PZIA 4ASZA 2FB8A 3O96A 3GUBA 4L45A 5HG5A 2O65A 5KMIA 4FEQA 2PVMA 1NT2A 2O5KA 2OLCA 3V5JA 1JPAA 2XIXA 5GIOE 5E91A 2XM9A 3BLHA 4U6RA 4W4WA 2BZJA 4U7ZA 5KMJA 3RPYA 3W2SA 4O0UA 3DBCA 3OEFX 2BRHA 2YM5A 4PPCA 3TTIA 4FV1A 1PXLA 5DGZA 2XNMA 5CF5A 3E64A 3EL7A 3ITZA 3PG3A 1NY3A 1FVTA 4DFZE 4L3PA 2XJ0A 3LHJA 3C0GA 4EKKA 4L53A 4FTNA 3L8VA 4I5MA 2R4BA 4NSTA 5AP7A 3IG7A 2ZM3A 3UP2A 3LMGA 3W8QA 1FMOE 3BZ3A 4AW1A 5IQGA 3RM6A 3LJ1A 4FUXA 2W06A 5L2TA 4FIIA 2LAVA 2VTNA 4CRLA 4WBOA 3I0OA 2CPKE 5HNGA 4DHIB 2X7GA 3BYMA 4G34A 2HWPA 3P78A 4FSMA 3D5WA 2PUNA 1R0PA 4X2GA 3I1AA 5L6OA 1I44A 4PL5A 3Q6UA 4RIYA 3G0EA 5M44A 2RFSA 3PXYA 1RDQE 4FSQA 3EN7A 3WF5A 1YI4A 4YHJA 5J7BA 2W9FB 3ANRA 2ZVAA 3BE2A 3DNDA 5DE2A 2CKOA 4NW5A 4RIYB 4KIKA 1YXSA 3D2IA 4GYGA 4OTRA 3ZOSA 4AZFA 4YLLA 4AA0A 4CFMA 3A61A 1ATPE 4I0RA 4NEUA 5IEYA 1UU9A 2O2UA 4AZSA 1YOLA 4BWPA 4JNWA 4KIKB 4WKQA 1U54A 2JFLA 2XS0A 3FKOA 4YSMA 3UVRA 3ZHPC 4DCEA 4AGDA 4FA2A 3W2OA 3HECA 3HVCA 4O7ZA 3PPJA 2XNEA 5EM7A 2ITYA 1U54B 4FL3A 3FUPA 3G0FA 2J0IA 3F9NA 4MBJA 3WF6A 3EFWA 4O0SA 3UO6A 2YEXA 3F69A 2UZBA 5T3QA 4AF3A 1GZ8A 1J1BA 3FI4A 4A9RA 3LKMA 2E9OA 2C6MA 4AGWA 4DLIA 1OL6A 2ZB0A 4FTTA 5A4TA 5EI8A 2ZJWA 1TFFA 4ZJJA 4ZLZA 1YHSA 4ALUA 5ICPA 4O7TA 4EOIA 4ANQA 3QKLA 4I3ZA 3NFFB 1PXJA 3LXPA 4XG4A 3L9NA 2X39A 3UIMA 4AA5A 1B6CB 2P0CA 5CU4A 3HUCA 5C8NA 3FZRA 5HX8A 5JGDA 1IAJA 3QCYA 3DQXA 3SVVA 2HXLA 3QC4A 4UY9A 4C3FA 4QP9A 3O71A 4IVDA 4Y5QA 3KF7A 3ZSGA 5EDRA 3LFEA 4WSYA 3SW4A 1JAMA 1S9IA 1BLXA 2Z7QA 2W5BA 5EKOA 5B2KA 2AEGA 5E8ZA 3MVMA 5HO7A 2XH5A 4FV9A 3FMEA 5HESA 1XH4A 3FZPA 4YO6A 4FTAA 2XRWA 3RPRA 1YW2A 4F99A 4BDAA 2HELA 2BKKA 2BZKB 3NEWA 2ACXA 4FOBA 3SAYA 3THBA 3ATSA 3KREA 1LEZA 2Q0BA 1O6YA 1VLRA 3W0SA 4GFMA 1J91A 5M51A 1H27A 3ODZX 3C9WA 3UGCA 2PVRA 1J7LA 5EQEA 2ONLA 3OFMA 4FSYA 3R30A 4R5YA 5LARA 4BIDA 2J4ZA 2C6DA 2OIQA 3QTQA 3EFLA 1KV1A 1Q3WA 4QDVA 4K0YA 2J0JA 4O7VA 1PYEA 2PVNA 4H05A 4N4SA 4WT6A 4XMOA 3CXWA 4I21A 4BCQA 4CQGA 3O51A 4RT7A 2GNLA 3OD6X 4FI1A 4D4YA 3NVMB 3IGOA 4BF2A 5HD4A 2FVDA 2QQ7A 3CY2A 3A2CA 3VQUA 3HZTA 4NM3A 2E9PA 2ESMA 3QRIA 1APME 4LUEA 3R83A 3TI1A 3AD4A 2OJIA 4WG5A 4FG7A 2WIHA 5DT3A 1P4OA 4QD6A 3OW4A 2HCKA 4FTJA 5AR2A 3T3UA 2R2PA 3KMUA 4TL0A 4KBCA 5IA5A 1XJDA 4O27B 4EYJA 4AQCA 3MFSA 3LVPA 3G9LX 3QRUA 4AXAA 2QOBA 4DLJA 3SLSA 4LM5A 3DB6A 3TJCA 4D9TA 5HVYA 1SVHA 5IA4A 4BI2A 3B2WA 4QP7A 2VNYA 4ITIA 4JG8A 2BILB 5H8EA 4NK9A 3WZJA 5C01A 5L2QA 3U54A 1RW8A 4XS2A 4KABA 4L43A 1GZNA 2FSLX 5C8KA 4Q9ZA 5L3AA 4AZTA 4OAVB 2A4LA 3OOGA 4WUAA 3AT2A 3PLSA 4XBRA 2PE2A 4DYMA 5IQFA 2JKOA 2UZVA 3ZONA 3RPOA 4DTKA 1Y91A 1YQJA 3DAJA 3KXNA 3MPAA 3QCQA 2RFNA 3UODA 2QOHA 4QO9A 3ORTA 1YWNA 2XMYA 3P7AA 2OIDA 3IPHA 1FMKA 3PIXA 5FGKA 4AQKA 3H30A 2F49A 4I41A 4U9AA 2XP2A 3LLTA 4QEBA 3BU3A 3U87A 4Y85A 5EW8A 4AWIA 4DT8A 3DU8A 2ZV9A 4JBQA 2BDWA 3Q52A 4I92A 2ITOA 3TV4A 4K9YA 5AP5A 4DGMA 3UZRA 4L3JA 4EZ3A 4UMPA 2RGPA 5BUJA 2P4IA 3HRFA 4G6LA 4JBOA 5TF9A 2XYUA 2XANA 3TNQB 2C6OA 1X8BA 2Y4IB 2C5VA 4JT3A 1IASA 5FTGA 4K11A 5DR2A 3VULA 3Q04A 5LOHA 4Y83A 1P4FA 4FK6A 2ZDTA 4GS6A 4BGGA 3FSFA 3PXQA 4YPDA 4HYIA 5FXSA 5JGAA 2YERA 4FIEA 1JOWB 5AR8A 5H2UA 3HV6A 1Q62A 3PRIA 3VC4A 3QXOA 3ZU7A 3R01A 5IA0A 2QO9A 3IW5A 3H0ZA 3C4EA 3HUBA 2J0LA 2JGZA 3I7BA 4J8NA 3UG1A 3E92A 3LM0A 4NZWB 4D28A 4HVHA 2YN8A 4U41A 3QRJA 3FXWA 5ITAA 3R2BA 4FV5A 1WBNA 2YJSA 5D11A 3QA8A 5AMNA 1NVRA 2XK9A 1Q4LA 4NFNA 3ZUTA 3HMMA 4CZUA 2OXXA 3B2TA 2BDJA 3HEGA 4DC2A 4PMPA 2ITNA 5L8LA 3FC1X 5BVFA 3FMMA 4G31A 5HCXA 4FKWA 3R2YA 2X6DA 4YJRA 4BDFA 4YU2A 1ST4A 2FSMX 2BAQA 4IADA 2VX3A 4BI0A 2BDFA 3A7IA 4RLKA 1PY5A 4JQ7A 4UN0C 4WO5A 2UW3A 4UV0A 4W8EA 3ZDUA 4ZTNA 4HNIA 4ZZMA 4XP3A 5KMMA 4DHJA 2J5FA 3DZOA 5DFPA 3ZCLA 4GV1A 3HV4A 4RC3A 3FMNA 3Q9WA 5EW9A 4AT5A 3P7CA 2CGVA 2J5EA 3ZBXA 4KIPA 5K4JA 3QXPA 1HCKA 3IW8A 4ZY6A 3VF9A 3C50A 4X3JA 5ANEA 3PDTA 5CQUA 4KSPA 3UIBA 2FSTX 1H1QA 4DN5A 3C51A 5FEDA 5IZFA 1BI7A 2VX1A 4M84A 3PZEA 4OR5A 4BKZA 3COIA 4AE9A 4PP9A 3FQSA 1JKTA 3BV2A 2QR8A 3CJGA 3DB8A 5CSHA 3WZKA 4ZSAA 1DAYA 5HCYA 2R3NA 3F66A 3QLFA 4O4CA 4C37A 2QR7A 3DKCA 3HA6A 2GPHA 4FTIA 3UNZA 4O86A 4Z9LA 3BEAA 1U59A 3HRBA 3QTRA 1H0WA 3C4ZA 5HICA 4KA3A 3QU0A 2SRCA 3TJDA 5DLSA 4CFNA 3CLYA 3DBFA 4JQ8A 1PKGA 3HV3A 4UYNA 4CLJA 3BBTB 4I94A 5HG8A 2XNNA 2R3LA 5AIKA 5DVRA 3BLQA 2QD9A 4HVGA 3SW7A 2W9ZB 4F9AA 3E8CA 2IJMA 4F0GA 1K3AA 3OCGA 4J99A 4EBVA 2F2CB 4GFGA 4ALVA 4ZTMA 4AP7A 4GUEA 4JDJA 4U45A 2BRGA 3OEZA 1R1WA 4C2WA 4HGSA 4S30A 5GZ9A 5AR5A 3P7BA 4JQEA 1W2DA 3BPRA 4D4RA 3QZFA 2WXVA 5AUUA 1SVEA 2X0QA 4O4FA 4EK5A 3VS5A 5IDPA 1W98A 5DYJA 4PV0A 2XAOA 5L2IA 3M2WA 3PE2A 4ZTHA 2I0EA 3G51A 4ASDA 4H1MA 4QP3A 3ZUVA 4WRGA 2OSCA 4MK0A 5FG8A 3PUFC 2WEVA 5I5ZA 4J1RA 5KMOA 1PMEA 4BCKA 2F57A 5AP3A 5J9YA 5A4LA 2YFXA 3WIKA 1OPKA 3AT3A 3DK6A 2RF9A 5BNJA 5L8KA 4C8BA 1PMNA 2EXMA 3KRXA 5AJQA 1FVVA 4AACA 4DGGA 3GP0A 4E8AA 4ZTSA 4FBXA 4TT7A 2WTDA 4Y46A 4IJ9A 4FKOA 3FMLA 3QX4A 5FBNC 4UYAA 4M13A 2PHKA 3LXKA 4FSUA 2WMXA 5M08A 3ALOA 3HRCA 3NNVA 3TIYA 2VTPA 3RVGA 4GT5A 2UVXA 4GIHA 4E5AX 3RWPA 3PFYA 3FKNA 5J95A 2Z7SA 4XG2A 3OF0A 1UU7A 2XEYA 3CTHA 4PTCA 4NTSA 4I93A 4F7LA 2HW7A 4FT3A 4X3FA 1REJA 3BHTA 3NW6A 4BL1A 2VWZA 4C7TA 3NYNA 4PNIA 4X3FB 4WSQA 2B55A 1UU3A 4P5ZA 2OGVA 3A7GA 3F6XA 4DFLA 2ZOQA 1FQ1B 4KRDA 5IUGA 4L00A 4R5SA 1LUFA 2GNFA 1ST0A 3OOMA 3QQHA 5IMXA 5IF1A 4HNFA 4E6QA 4F0IA 2ETKA 5KX8A 4OW8A 3OTUA 4FZFB 4IX5A 4AS0A 3GNIB 3MH1A 2P3GX 3NW7A 4F70A 3D7TA 3DFCB 2REIA 4RC4A 2F2UA 4MH7A 5JSMA 3ATTA 3R63A 4GEOA 4M15A 4RPVA 3L9PA 4MBIA 2W99B 3D7TB 3I60A 3FZTA 3PXFA 5CF4A 1XO2B 3HYHA 5DOSA 4KS8A 4ERKA 3LFNA 2W4JA 1MUOA 4P7EA 5FEEA 4N6YA 4D2WA 2J2IB 5DIAA 5KE0A 2VTQA 1OPLA 2C47A 3IW7A 4LOQA 5ANOA 4F6WA 5JQ5A 3R7UA 4O84A 3NRMA 2DQ7X 5CALA 4NWMA 1WBTA 5FM3A 3SRVB 4ANSA 5C1QB 3P5KA 4IAZA 5E90A 3PJ2A 5CWZA 3GU7A 2WMVA 4EYMA 1HCLA 3F3UA 1M14A 3CCNA 2Z7RA 5ETFA 3ORLA 4FT9A 5FP6A 1KWPA 2B54A 4MD8E 2PMIA 3G2FA 4FVPA 4QNYA 1OL2A 3VW6A 4PP7A 2IN6A 4FGBA 3NGAA 5BV3A 4YPSA 4X2JA 1YOMA 1PXNA 2VO6A 2XKDA 4IB5A 3V5LA 3W33A 3WF9A 4C58A 5IEXA 2V7OA 2WTVA 5JKGA 1Z9XA 5HTBA 3VBXA 5AA8A 4CMTA 3LJ2A 4YJSA 2IW9A 3MFTA 3KULA 3PJ8A 2J0MB 4EOMA 4PNKA 1JBPE 1M7QA 4J71A 3HL7A 3IQ7A 4U0IA 4FJVA 2X7FA 5EYKA 1UWHA 2UZLA 2PVYA 1QPJA 4JXFA 4DGOA 2WHBA 3MPMA 5I9WA 2CKPA 2PYWA 3AQVA 4YTIA 3ROCA 2EWAA 3I5ZA 3IKAA 4FKUA 3ZO2A 4EH8A 1YWVA 4AGCA 5H8GA 4AT3A 5M4IA 1XMLA 4BTKA 1WAKA 4RX5A 3ACJA 4JIKA 3W32A 2QVSE 4UX9A 2QHMA 2HK5A 3ZEWA 3P1AA 4EI4A 4CTBA 4HVSA 2FA2A 4JBPA 2YIWA 3EFJA 2CN5A 3RMFA 1XBCA 2RG5A 4Y73A 4DFXE 3C4CA 3GCPA 2QOKA 3F3WA 5HG9A 4ANBA 4GKIA 4MD9E 2E2BA 2XALA 3UIUA 5FP5A 2QOFA 3DJ5A 2GHMA 4L68A 4GJ2A 5FRIA 2F7ZE 4ANOA 4YJVA 4ASEA 2XKCA 4EWQA 4FZAB 4ORKA 5CT0A 3NYOA 4EC9A 4KKEA 3RJCA 3VAPA 2YLEA 2V55A 5CXHA 5DR6A 3UVQA 2WD1A 5HG7A 4NU1A 4FSWA 4EOPA 3BQRA 3I5NA 3PA4A 4IEBA 4P2KA 5DG5A 4YP8A 5HNIX 2CN8A 2JIUA 4O0TA 1GIIA 4G3EA 5CZIA 4DG0E 4L01A 4BVUA 2WOUA 4LGGA 1LR4A 3AKLA 2YAKA 3G5DA 1SMHA 5TKDA 4PMTA 1T45A 2PZYA 4JAIA 4O21A 3S2PA 4I0SA 2XIYA 5KBRA 1CDKA 2W1CA 3GQIA 3RALA 3VW8A 4F64A 2BVAA 2ITUA 1EH4A 2ZV8A 2ZAZA 4I23A 4N6ZA 5HO8A 4AW0A 4M8TA 2X0GA 3ZC6A 3DTWA 1OBDA 3V8TA 4E3CA 5DPVA 2B9HA 4RJ5A 2C3IB 4EK8A 4FIJA 4AXDA 2OH4A 4CKRA 5CS6A 3A8XA 3TWJA 4DH8A 5IMEA 2R9SA 5EM6A 5ETIA 1PXMA 3OUKA 1Q41A 4CYJA 4S31A 1P5EA 3V5QA 1OZ1A 4HGEA 5C03A 2BKZA 5C9CA 2G2HA 1KOBA 3HLLA 5M57A 3TMOA 2JIIA 1BMKA 1OI9A 1Y8GA 3CBLA 5EM5A 3WZEA 5A6NA 4I6LA 5BVEA 4R78A 5AFVA 4QT1A 4F65A 5J7HA 4M0ZA 3EKKA 2QO2A 4FG8A 3C13A 4M68A 2XKFA 2Z2WA 1M17A 5AEPA 5LVOA 5ETAA 3DBEA 1NW1A 2YM7A 3FQEA 4LL5A 3D94A 1BL6A 5L6PA 2VWWA 5H3QA 4Z3VA 3NLBA 3K2LA 4H39A 5CSWA 3R22A 3TYKA 1REKA 4PDPA 5DMZA 2E9UA 3MS9A 4ASXA 4C35A 4EH3A 5CI6A 3UMXA 4PDSA 2QOLA 4IIRA 1LP4A 3KK9A 1XH5A 4GH2A 3F2NA 4C3RA 2PUIA 1JNKA 4R8QA 4QMOA 3ZMMA 4BCIA 4ZZNA 4HGLA 4O6LA 3W0PA 3P23A 3BHYA 5DI1A 5HVKA 3TCPA 3RPSA 3CQUA 2C3KA 3BYVA 3PPKA 1DAWA 3MTFA 2VGPA 5CU2A 2A2AA 4QMTA 4YJQA 4EK6A 3P5JC 2EXCX 3WYXA 4L9IA 1M7NA 1GY3A 4JL9A 3BLAA 4R6VA 4Z7HA 4Y72A 2OF2A 2PVKA 4EOJA 3K54A 2GQRA 4CT2A 4KKGA 2V62A 1Y6BA 2C6TA 4OTHA 5BUIA 4HPTE 1OKWA 2BIKB 2HZNA 2PMOX 3QTZA 5LWMA 3UNKA 3E63A 3Q4UA 3QHRA 4S34A 5GJGA 4DEGA 4USFA 3CGFA 3IOKA 3OCTA 2YLFA 5H8BA 3H4JA 4E4NA 1E1XA 1OIUA 3PRFA 4LYNA 4IB1A 1PJKA 4XCUA 4UWYA 4ANLA 1P14A 2PSQA 3ZDIA 3R8LA 4NM7A 4CG9A 5IQAA 3LFFA 4KAOA 2P55A 3JPVA 1OVEA 4A4OA 3E5AA 2XBJA 4LV5A 4BCFA 3D5VA 5CU0A 1PKDA 2I40A 3BYOA 3BLRA 3W16A 3IDBA 3F7ZA 2W1GA 3R73A 2VX0A 5EHLA 3B8QA 1QL6A 3DY7A 3H0YA 4I6HA 1MRUA 3AC2A 2QO7A 2R64A 4F9YA 1URCA 3GCUA 3ZO1A 4E5BA 2BPMA 5J87A 3DAKA 3KXGA 1F5QA 4A9UA 3FLSA 4CEGA 4YURA 3PLAE 4DH5A 3NFGB 5FWKK 2HENA 1PXPA 3LFAA 4W4XA 4BDHA 2JDOA 4LUDA 3TEIA 3FMKA 2CNVA 3UZPA 5LVMA 2VTRA 3CQEA 4GU6A 4QP2A 4DH3A 3MW1A 2OFVA 4KKHA 4O38A 3JYAA 2QU5A 1H4LA 4K1BA 5FLFA 2V22A 4G3DA 3I6UA 4YJPA 4BKJA 3VUTA 1ZYCA 4U44A 5AV1A 2B7AA 2X4FA 3R8MA 4D0WA 5CNNA 4EQUA 3U6HA 1PHKA 3NUPA 3VBQA 2XIZA 5HLPA 1MQBA 1PYXA 3V6RA 3VUGA 4H1JA 3ZTXA 1GZOA 2X9FA 3A7JA 2AC3A 3D14A 3R1QA 4I5HA 2C5YA 1JQHA 3SG9A 3V8SA 2CLQA 4BDBA 1JKSA 3G6GA 2C0IA 4TXCA 3F5PA 4QMLA 4JAJA 4BDKA 2E9VA 3PE1A 4RIXA 4FTLA 2VWUA 5EKNA 3LFBA 3NMUF 4ZTLA 2C1BA 3GCSA 4BTJA 4F6SA 1VYZA 4F0FA 2H34A 1YOJA 2IZUA 2F7EE 2NP8A 3DAEA 3PY3A 4CCUA 3ULZA 5HBJA 4FTKA 5IQDA 3E93A 2NPQA 4BCJA 5AA9A 2G2IA 4LV7A 4GJ3A 5DNRA 1P2AA 1V0OA 3W8LA 3ZBFA 1H01A 5CEMA 3FI3A 3AC1A 4AA4A 4RVTA 1ZMUA 4HCUA 4IVCA 5AR3A 3GU6A 5A6OA 5CSPA 4PMMA 5CVFA 3BYSA 4DDIA 5DRBA 2W0JA 3CPCA 3DGKA 2VGOA 2VTTA 2FGIA 2WPAA 4MAOA 5F1ZA 5FXQA 4BZDA 3NS9A 4FV7A 1YKRA 4QQJA 4LDTA 4K8AA 3BWJA 3DT1A 3NSZA 5IG1A 4IAAA 3ZM9A 4DH1A 5M06A 4OBPA 4U43A 5M4FA 3HMOA 3RNYA 3GEQA 2YJRA 3KRRA 4MNEA 3NAXA 4DT9A 4UBAA 2IVTA 4GCJA 4RX8A 4NCTA 4O7NA 1V1KA 3QTWA 3LQ5A 4PQNA 5CVHA 4U40A 2C5NA 4MNEB 4QP4A 4HCTA 2Z8CA 3WYYA 5IISA 4NKAA 3ERKA 3MWUA 2QCSA 4O96A 4X6RA 3MTLA 5ACBC 4FEWA 2BFYA 3QCXA 4MBLA 1FOTA 1KSWA 3ACKA 2ONLC 1W84A 3HV5A 3QLGA 5A3XA 4A06A 3FMHA 5AUTA 2OJ9A 1FGIA 2YM8A 2A19B 4QPSA 3REPA 3COMA 3LXNA 4M7IA 5D7AA 3RAHA 3DK7A 4I24A 3F88A 1H1RA 2X4ZA 3NAYA 1YDSE 2C0TA 3FPMA 4M66A 3UOJA 3EN5A 3ELJA 4R77A 2HY0A 1DI8A 2HAKA 3Q2JA 5JK3A 2VO3A 4XG6A 4Q9SA 4GU9A 5D7VA 4UXQA 4EORA 2X2LA 4AOIA 4AXFA 4HJOA 4F4PA 5LVNA 3NVKI 1ZRZA 5CI7A 3ORIA 3AKKA 1IG1A 1XH7A 3EYHA 4BCOA 3UO5A 3VS1A 4JVGA 4GYIA 2JIVA 4P90A 3MVJA 3UNJA 3ZSIA 3LXLA 2VWVA 3C0HA 4M14A 4YBJA 3UZTA 4F78A 5EYMA 4ENXA 4F9CA 4AXEA 1WBPA 4FC0A 2DWBA 3VBYA 1VZOA 3VRZA 3MY5A 4M0YA 4XUFA 3PVGA 4D2TA 5JRQA 3GFWA 2IG7A 2W1EA 1Z57A 5A4EA 4F09A 4CFUA 2YDIA 3CIKA 5K9IA 4EH7A 2W1ZA 5IQEA 5J9ZA 4CKIA 2NYAA 2XB7A 4N57A 3U4WA 4FSNA 3ZH8A 2R3IA 3ETAA 3O23A 3P9JA 3HMIA 2XARA 4CVAA 2WQMA 3FWQA 3W0MA 3FLYA 4IX4A 3FZOA 5AV2A 5DT0A 3JY0A 4Q5EA 4WNPA 2JLDA 1ZMWA 2GS6A 3EL8A 2Z60A 3GI3A 3MSSA 4IB3A 4FKLA 3MVHA 4FKJA 3VBWA 4RWLA 4DFUA 2IVVA 2B53A 1WBOA 4NM0A 5JMSA 4JDKA 1XMMA 4YJUA 4O91A 1QCFA 2QI8A 1K2PA 1GZKA 2GTNA 2J7TA 2J90A 3AGMA 3NCZA 4G1WA 4HZSA 4E7WA 1H24A 4H3BA 3UDSA 3BHHA 5IUIA 2XAMA 4FV6A 3GC0A 3LCTA 5CT7A 1ZLTA 2UZDA 3COKA 2WQBA 5JN2A 2ETMA 2P2HA 2VWBA 4TNBA 2FSOX 2X6EA 3BCEA 3F2AA