3QCQA

Phosphoinositide-dependent kinase-1 (pdk1) kinase domain with 6-(3-amino-1h-indazol-6-yl)-n4-ethyl-2,4-pyrimidinediamine
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
286
structure length
276
Chain Sequence
QPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Structure-Based Design of Potent and Selective 3-Phosphoinositide-Dependent Kinase-1 (PDK1) Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 276
sequence length 286
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3qcqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3qcqA01
1BL6A 1H0VA 3QCQA 2HENA 3KRJA 3FI2A 5CU2A 3R04A 2Q0NA 3TZ7A 4F09A 1BYGA 5EI2A 5DWRA 2LAVA 4R5SA 4BZOA 1QPJA 2CLXA 2IZSA 2BAQA 3UMXA 4C62A 5AM6A 4E4NA 1J91A 4O7YA 5G6VA 4BZDA 1OKWA 2YCSA 4JR7A 4PDPA 1NXKA 5DOSA 5CNOA 3C51A 2XP2A 4DT9A 3GCQA 2BZJA 3QRUA 4R3CA 3CE3A 5K9IA 2UW5A 2EXMA 3Q9WA 3ZO2A 2UZOA 4I21A 2GNGA 4IVBA 5J1WA 3DZQA 4M15A 4LOOA 2F57A 5FRIA 5FWKK 3COMA 4FIGA 4HYHA 5C27A 4WNMA 4F6UA 3E8NA 5CU0A 3ULZA 4I6QA 5IQIA 5EK7A 2QVSE 2YIYA 5AIRA 1UU9A 1YHWA 5HE2A 3RHXA 1UU7A 4MEDA 3PVBA 5FDXA 5L6WL 3W55A 4MD7E 3H9FA 2C30A 4M7IA 3OP5A 2X7FA 1JQHA 3RPOA 4CV9A 3D94A 3Q4UA 2GTNA 4HOKA 2CKPA 4O7SA 3DZOA 4RSSA 2XK8A 1ZYLA 4ZTNA 4H3PA 4FBXA 3IPHA 2QU6A 1DM2A 4KIKA 3E62A 5M51A 3N4VA 3O2MA 3QTZA 4MBJA 3V6SA 5AP3A 4D4RA 2J51A 5BUIA 3AD4A 3FXZA 4M67A 1OZ1A 4FE2A 2J4ZA 3MV5A 5DG5A 1WBNA 4MD9E 4C2WA 3FC1X 4YSJA 3F3VA 4K8AA 4ZTRA 4QPAA 3QCXA 2X0GA 3EKNA 4YTHA 5DEYA 5M08A 3DY7A 2QCSA 2WU6A 3LE6A 3QQGA 2C69A 4FL2A 4L3JA 4MQ2A 1M2PA 1Z9XA 4RT7A 4XRLA 4AFJA 5JRQA 1O6LA 2GDOA 3D7TB 4GUEA 4H05A 3HA8A 3ZEPA 3CTQA 2JAVA 3LXPA 2BCJA 4I6FA 4BGQA 5CSWA 2BDFA 3CXWA 4OW8A 2UZNA 3ZBFA 1H07A 3Q3BA 3WF8A 2XYUA 4FT0A 4KKGA 2B52A 3EKKA 4ZOGA 3WIGA 4U81A 5J79A 4FV1A 4AZWA 4DGNA 4XOZA 3BHHA 3FMLA 3S4QA 1H27A 3R02A 2WNTA 3MGYA 2XK3A 4MF0A 3SXRA 4XG3A 4AN9A 1O9UA 1QPCA 3FSKA 2C6OA 5E1EA 4QYGA 4Z3VA 5IH6A 3D5WA 5FBOA 1ZZ2A 4AS0A 5LVMA 3R7YA 5EYKA 3DK3A 4O86A 5IA1A 4TYGA 5I3OA 3F82A 3I0QA 2OJGA 3G2FA 3UVRA 2BFYA 2DYLA 2J90A 3FZSA 4U5JA 4N70A 3OC1A 3MPAA 2ONLA 2J50A 3OOMA 4OTPA 4HPTE 2XA4A 5ITAA 4BRXA 2I0HA 1WVXA 4IJ9A 3D14A 1GZ8A 3QCSA 1YKRA 2W4JA 3IW7A 3IDPA 1SNUA 2E2BA 4L6QA 5ANOA 5IUIA 4NM5A 5HG8A 2CNUA 3A4OX 2FYSA 5HE0A 3PJ8A 4FYOA 1OM1A 3KU2A 1M17A 2NRYA 4MKCA 5TR6A 2A4LA 5JGDA 5CY3A 3SVVA 4C7TA 2C6KA 3E93A 5EHYA 4QMSA 3QD2B 2ZOQA 1TQMA 1JBPE 4Y72A 4RC2A 3QD0A 3OT3A 1R3CA 4I6BA 4F6WA 5J5TA 1GIJA 5J1VA 2XF0A 1NY3A 4JR3A 5FEDA 5JKGA 4KINA 1M7QA 1OKZA 1TQPA 1WBPA 5EDQA 3EN9A 3KL8A 1RW8A 3KFAA 5LWNA 4AZFA 3IQ7A 2PZIA 4ANBA 3NZ0A 3F3TA 4J52A 3HV4A 4UB7A 5HQ0A 3A99A 2VTIA 4FT5A 2V0DA 3FZOA 4I4FA 4YSMA 4UMTA 3DDQA 3FQSA 3PXRA 3VWAA 4EHGA 3OWKA 2NPQA 3FXWA 2FSTX 4YPSA 3H3CA 1FMOE 1FMKA 5KE0A 3TG1A 4GK2A 4F0IA 1W84A 2ZMCA 2V62A 4GRBA 4N4SA 4YTFA 2BDWA 2OZOA 3DAKA 1V1KA 3PVUA 4IDTA 4QNYA 3KXMA 4UBAA 5CI6A 4EKLA 3ZRKA 2OK1A 2Z8CA 3CP9A 3O96A 4IWDA 3MY5A 3E8CA 4OTFA 4YJRA 4JS8A 3TKUA 2PE1A 2PMLX 4XMOA 3TEIA 1A9UA 3CKXA 3VBTA 4BHZA 3HDNA 1H1RA 2HZ4A 1CSNA 4YZMA 2R3IA 5LCJA 1IR3A 3QXPA 4IC7A 4X6QC 5L2IA 3OBGA 4I24A 2Y6MA 4G6NA 4P90A 3ZLXA 4ZSGA 1GZKA 1XBCA 2YERA 3AG9A 3R1QA 3ZUTA 5CXZA 2AYPA 4GFGA 5E9EA 4F7NA 1KE8A 1YVJA 4OAVB 2HCKA 2J5FA 2R3GA 4R3RA 3AC4A 3RWPA 4LUEA 2RGPA 4ZLZA 2WQBA 3G9LX 4G5JA 1P2AA 2UVYA 4ITIA 4NM3A 3VN9A 2CPKE 3JUHA 5CF4A 2W1ZA 5ANJA 2C5OA 2AUHA 4DTKA 3AT4A 4EH5A 5BNJA 3QTWA 4F0FA 3GU6A 2UZWE 1OL1A 3FC2A 3FLSA 3GU4A 4AA4A 3HV7A 4HW7A 2O63A 4D28A 5JFVA 4EK4A 4X2NA 5AP0A 2HOGA 1XH7A 4IX6A 3DBCA 2WQEA 4L8MA 4G1WA 4KKEA 2C5YA 4BC6A 4YHFA 4O7NA 2PPQA 1BI8A 2IWIA 4GCJA 1JSVA 5AJQA 2Z02A 3AGLA 3C4CA 1FINA 4RIXA 3C4EA 4M84A 3MY1A 3AC5A 4D4SA 4N6YA 5JN2A 4MX9A 3ZLSA 4M3QA 4BCMA 3MA6A 3VAPA 4CCBA 4AW2A 4YC6A 3VJOA 5L4QA 3GEQA 2W99B 4FV8A 4X3FA 1VJYA 4ASXA 3D4QA 5IA0A 4HPUE 5J9LA 5CF8A 3ZRLA 4CKRA 3TIYA 5C26A 5LMAA 2VTPA 2ITVA 1PJKA 2JAMA 4C61A 1Q8ZA 2C5NA 3ALNA 2H9VA 4HGTA 5HGIA 2BROA 3H4JA 3L9NA 3F61A 3T3UA 4EOLA 5KMOA 3BEGA 4V01A 3T8OA 4IM2A 2YABA 4F9AA 3V5JA 1H24A 5DI1A 4CLIA 5KNJA 3E92A 1VEBA 3EZRA 5JEBA 4FKGA 3NWWA 2QHNA 1OMWA 2R0UA 2XK6A 3EQRA 2FUMA 4IAZA 4RX7A 5AWMA 1EH4A 3DKCA 3E88A 4X0MA 3T9TA 1OPLA 2H34A 3IKAA 2KULA 4MBLA 4ANSA 4MQ1A 4BCOA 3RPRA 2W1HA 4EOKA 4DFUA 1Q8WA 3CQEA 3AT2A 1HOWA 2R2PA 4UMQA 3D7ZA 2WHBA 5D10A 3R7GA 2WQNA 4QP7A 3MY0A 3NUYA 3GOKA 5HEZA 3ZS5A 2CKOA 1DAYA 1IASA 5JZNA 2PVNA 4C35A 4PL3A 1IAJA 2ERZE 3MB7A 2Z2WA 3QA8A 2OXXA 3UE4A 3H30A 5F20A 1JSUA 1WBVA 1BMKA 2QLUA 3HV3A 5DIAA 4RZVA 5E8XA 5H2UA 5AUTA 4CD0A 3LOKA 2XKDA 4LFIA 1YDSE 2QNJA 4KRDA 1P14A 4OT5A 4MNEA 4G34A 3FE3A 3F7ZA 4FKIA 5LVPA 5BPYA 3WF5A 3VBQA 3P7CA 3WZDA 4HVDA 3ZCLA 4DLJA 5HU9A 3DXQA 3O8TA 3UG2A 3KK8A 3CR0A 3UP2A 4YURA 5I9YA 3P4KA 4CMTA 5EM7A 5CSPA 1M2QA 3TTIA 4DGGA 4U3YA 4O81A 3SV0A 4FI1A 5EHOA 1OUYA 4GMYA 2VNWA 3MJ1A 4Y5QA 3UPZA 2ITTA 3N9XA 5M06A 2J6MA 4LMNA 3DA6A 1GOLA 4EK8A 1B38A 2BHHA 5CU4A 4E4LA 2GNJA 3SG9A 5KZIA 3IDCA 4ASDA 4CFNA 5FM2A 3F2NA 2CKEA 4ACDA 4WUAA 2P55A 4PNIA 4K2RA 4G3GA 5CTPA 1WBTA 4G3CA 4MXYA 3U54A 5C01A 1ZMWA 4KBAA 5C8NA 3THBA 5AV1A 5BVFA 4IAYA 4YJVA 2WMSA 2XNMA 3FLQA 5M55A 3V5QA 2CNVA 3W8QA 4ZY4A 2YM7A 4D0WA 5L2WA 3VRYA 1U54A 1G8SA 4DA5A 4O7RA 3DAEA 3F3WA 3OUKA 1UV5A 5DMZA 2XNBA 4H36A 4U79A 5GZ8A 4HYSA 3MFTA 3GCUA 4L46A 4WNPA 3NUAA 3KMMA 4J53A 4W9WA 1J7LA 4E26A 4QQTA 3A7JA 2VV9A 2OWBA 4MNFA 3AD5A 3E63A 5F95A 4B6LA 2ITNA 4EH4A 3DQWA 4QP6A 2R7IA 4TNDA 2HXQA 4P5ZA 1RDQE 3R8MA 4BIBA 5JQ5A 2QKRA 5BUEA 1KUTA 4PTGA 3R8ZA 2OZAA 2WMWA 4IIRA 1Q41A 3FZTA 4EH8A 4QMNA 3HMOA 4CGAA 2IPXA 3IOKA 3ZUUA 4E4XA 4BGHA 5HLPA 4BCKA 1PRYA 1G3NA 5A14A 2C68A 4S31A 2I40A 2B1PA 3R28A 4NT4A 3Q9YA 4DH7A 3TUBA 3IW8A 4RQKA 4R7BA 2GS6A 1ZRZA 5BUJA 5HNGA 3C7QA 2A19B 4J8NA 4ZTHA 4ZK5A 5EQPA 1Q97A 5GNKA 3BBWA 2O0UA 2Z7RA 3EL8A 3FLWA 4O0UA 2ZV9A 1T45A 5DVRA 4RVTA 3EL7A 4X21A 4ZTQA 4ANNA 3P79A 3HDMA 3U6JA 2XB7A 3MVLA 4JNWA 3O0GA 3FAAA 3FLNC 2B53A 4FIFA 1BKXA 1JKLA 4PPCA 4U97A 5CSHA 4BCHA 4KBCA 1KE9A 4E93A 4F7LA 5D7AA 3BQCA 1AQ1A 4FTLA 5CAOA 2BAJA 4FTTA 2PMIA 2YWVA 4MWIA 2VWBA 1FBNA 2VWYA 3RKBA 4D4VA 3FI8A 2XNOA 4O0RA 4GJ3A 3P9JA 3G5DA 4CRSA 3ODYX 5L8KA 4ZSEA 2EXCX 2J0LA 4FMQA 4EOPA 3PYYA 1YHVA 3GC0A 3MJ2A 4IZYA 4V0GB 4I22A 5A9UA 1H0WA 4JQ8A 2ITPA 5CNNA 1XHAA 4KIPA 2NP8A 4UMRA 5AP7A 1IRKA 4PMSA 4J71A 4XNEA 3MIAA 3G90X 1CKIA 5CT0A 2XM8A 4D4YA 5IEVA 1DI8A 2BTRA 1UU8A 3UO4A 4IX4A 3BYVA 3OBJA 4QD6A 5D12A 4RC4A 4OAUC 3V3VA 4AW0A 3F3ZA 4GK4A 1WBOA 3R7UA 5BVEA 5KMLA 3V5TA 3MTLA 5LVOA 5KKRB 3LXNA 4LL5A 4YC3A 2QI8A 2OFUA 3AMBA 4U40A 4LUDA 3N4TA 5JSMA 2VRXA 3DNDA 3ZEWA 3LZBA 3DFAA 2G9XA 3OXZA 4GEOA 3VULA 4F9YA 1JWHA 3LLAA 3RM7A 3EOCA 4B7TA 5CVHA 3QGYA 3HA6A 1RE8A 2WOTA 4AGWA 5CWZA 5GINE 5EW3A 1FVTA 4JX3A 4PMTA 3IO7A 3UVQA 4TYHA 4CTCA 2CCIA 2X9FA 3BELA 2GHMA 3R1SA 1REKA 4GT3A 2JDOA 5HOAA 2QOCA 4W4YA 4AF3A 3NMUF 1IG1A 2XNNA 1BUHA 3PVGA 3COKA 2ETMA 3EYHA 3GC8A 3UZTA 4JBOA 4YJQA 2GQSA 2W0JA 4JG8A 4L3LA 3AD6A 3ZYAA 1XWSA 4RG0A 2IW8A 4L3PA 1NVQA 2YWPA 4EHZA 2IW6A 4RJ7A 4YR8A 4DF3A 2CGWA 2BPMA 2QO7A 4YLKA 4K11A 3UBDA 4TN6A 2W96B 1YXUA 3KEXA 4YJPA 3VBXA 5DT4A 2Z60A 2VTHA 2PZRA 3F9NA 3QU0A 5EI8A 5K5XA 5EYDA 2B4SB 5IQCA 4L01A 3A7HA 5HO6A 4GKHA 5HVJA 3UIMA 5JQ8A 3D2IA 4C3FA 4UXQA 4UZHA 4XUFA 2C1BA 2VTMA 2GMXA 3F3UA 4D9UA 3LPBA 2OICA 4E7WA 3DNEA 3DT1A 5LWMA 2QOFA 2YIWA 3BYOA 3NGAA 3NLBA 4DH3A 5E8YA 5DRDA 5EM8A 5LMBA 2UZEA 3ZXTA 4O96A 3RMFA 4IB0A 3NAYA 3BE9A 4JL9A 5AR4A 4CFMA 2I7QA 4IXPA 4EL9A 4FKTA 3QALE 4O21A 2YN8A 3I5ZA 3OY1A 5ETFA 5HBHA 3ORMA 4RPVA 2OF2A 3LFFA 1GZOA 2GQGA 3HYHA 5E8VA 1T46A 4MXCA 3IW6A 4CYIA 4RIYB 2BVAA 2GNHA 1LPUA 5E92A 4GUBA 2ZDUA 4BR3A 3R7EA 4NJDA 4DG0E 5AR5A 4YP8A 1YWNA 2P4IA 2RFSA 2QONA 4JJRA 3RTPA 4BWKA 2W5HA 3ULIA 5IISA 3QQJA 3ACKA 3ENMA 4XHKB 1H1WA 1YW2A 3SXSA 3QYWA 3UC3A 2EUFB 3P7AA 5I3RA 3V5WA 1B6CB 2PZ5A 3ZONA 5KMMA 1H1SA 4XBRA 3Q04A 4Z55A 2XJ0A 3ZOSA 1U5RA 2RFNA 3ANQA 3TCPA 2Y4IB 4ZS4A 3EQDA 2W06A 3MPMA 2YA9A 5E90A 5I4NA 2OJIA 4QMUA 3GGFA 4I41A 2YCFA 2C3LA 3AXWA 5HU3A 3TZ9A 3U4UA 4LRKA 4UWYA 3IG7A 4FG7A 4D2WA 2VWWA 3FL5A 3PE1A 3DB8A 1FQ1B 1F0QA 2EB3A 3JY9A 4PDSA 2WTWA 2GU8A 1L3RE 4RFZA 3AC1A 4ARKA 2J0KA 2V7OA 3I60A 1CMKE 3AMYA 2OU7A 4QMVA 3WYYA 4CV8A 3QRJA 1R0EA 4GU9A 4M0YA 2I1MA 4RVKA 4K6ZA 3PSDA 2F2UA 4MXOA 4FF8A 1AD5A 4UYAA 4D2RA 1G8AA 2QOIA 2A1AB 4G2FA 2ITOA 4IZAA 3KXNA 4HVHA 3L9MA 2CN8A 1JKKA 3OTUA 3ORKA 4YJNA 3W2PA 3F2AA 5AP4A 3OS3A 2GNLA 3BWJA 2C47A 4FT7A 2XIZA 1XKKA 2Z7LA 4M69B 3ACJA 3TV7A 3SDJA 4EH6A 3OWPA 2UZDA 3QRKA 4CFXA 3PP0A 5J9ZA 3HL7A 1WZYA 1A48A 2IG7A 3IGOA 2BRHA 3MVMA 4PF4A 4JBVA 2DUVA 2UVZA 2C3KA 2XUUA 2HIWA 4BTFA 3PA3A 1VR2A 2J9MA 2UW7A 3EFJA 4C34A 3EIDA 5IEXA 5BYZA 3KULA 4W4XA 2Z7QA 4F99A 2F7ZE 2CGXA 1H00A 4AZSA 4U43A 3QX2A 4HCVA 2EVAA 2ITZA 4GKIA 1DS5A 2R3OA 1H26A 4R6VA 5CEIA 5CVFA 2BZHB 4QP3A 4JIKA 1H08A 4F9WA 5A6NA 3FYKX 1URWA 1SMHA 4DCEA 4ASZA 5EOLA 4IDVA 1MRYA 4FEXA 1YWRA 3Q4TA 4G6LA 2WQOA 4IB1A 4DFXE 4KWPA 3L9PA 1ZWSA 2QG5A 5L2TA 3UIUA 4ZSLA 5HIBA 2WXVA 2XIKA 4I4EA 1PXOA 2WMVA 2R3HA 3FWQA 4D55A 2HY81 4DH1A 4FSUA 4HYIA 4JRVA 2PVKA 4LMUA 5CX9A 1J1BA 3KVWA 1XH4A 1Y57A 5FD2A 4D1ZA 4EOJA 1H1QA 3HEGA 3Q4CA 3ZLYA 4K77A 4MYGA 3U9CA 4AZVA 3R71A 4U45A 3QHRA 1Q61A 3PSCA 4OT6A 4TWCA 5HI2A 3TNQB 4YUQA 3HV5A 4ZLOA 4I5PA 5IEYA 3N4UA 2PWLA 4M13A 3UP7A 4QMLA 2ITWA 4QMZA 3LAUA 5J8IA 2UZBA 5AV0A 3LJ1A 5BQ0A 3WARA 4JDIA 3AOXA 3ZO1A 3EFLA 2OBJA 3UNJA 3NW5A 4NCTC 5J7BA 3QBNA 3JY0A 4RIWA 2PVMA 3C5IA 3HRBA 2B9IA 4N0SA 5H8EA 3ZSIA 4PMPA 3FBVA 1PXJA 5AIKA 3R30A 2X6EA 3S2PA 1SNXA 4ACCA 1Y91A 4YO4A 2F2CB 3ZM9A 3PTGA 5HX6A 3FKLA 3KRRA 2O2UA 4L9IA 4Q5EA 1Q5KA 1Q99A 3UJGA 4FZAB 2R5TA 2AC5A 3R63A 1Z5MA 4FV6A 4NW6A 3F5PA 5FXQA 3COIA 4CXAA 5L8LA 2IJMA 1ZOEA 3EQPA 3KQ7A 5CT7A 3TL8A 3W2QA 3W16A 3ZZWA 4F1MA 5DBXA 3COHA 2W17A 3RINA 4YU2A 1REJA 3IONA 5BMSA 2PVHA 4D1XA 2QKWB 2OFVA 3F88A 2PMOX 4FODA 3U6IA 4DN5A 4RWKA 4ZZOA 2XYNA 4D2SA 4BB4A 1YXXA 2J0JA 4U3ZA 3PY1A 1W8CA 4FZDB 3NS9A 4GFMA 3FEGA 3NCGA 1RJBA 4G31A 2X2KA 1WVYA 2UZUE 3R9OA 4BDDA 5LXMA 3DTCA 3ZC6A 2IVUA 1L8TA 3QQFA 5BYLA 5ANKA 1JOWB 1KE5A 2OH0E 3F7WA 4DFYA 4Z7GA 2IO6A 2QOHA 3ROYA 3PRFA 1QCFA 5C1QB 4UN0C 4FV4A 4WD5A 2O65A 3IK3A 4O7TA 4OTDA 3R01A 3R1YA 3GCVA 4TY1A 5I9VA 4XCUA 3L8VA 1H1PA 5FEQA 4WBBB 2BKZA 2SRCA 4BICA 2RFDA 2V7AA 4LL0A 4KIKB 5KMJA 2IW9A 1I44A 2IZUA 3SAYA 4FEVA 1V0PA 2XJ2A 1M14A 2VU3A 4QNAA 4GT4A 4RRVA 5H3QA 4BCFA 5AM7A 5AEPA 5AAFA 3FZRA 3NUSA 4KBKA 5IKWA 3R9HA 2FB8A 4TRLA 4OBPA 3UZPA 3FMDA 4QMPA 4FTNA 3SX9A 3VUHA 1GAGA 5C4LA 4D5HA 3QAME 2YM4A 1GIIA 2WTJA 3D7TA 4FVPA 4RLLA 3W2OA 4PRJA 1ZYCA 4EH7A 2J0IA 4YTIA 4U9AA 4K9YA 4YJSA 4IACA 3R22A 5AX3A 3R8LA 2GTMA 3TKIA 3UOKA 4EK3A 3IW4A 4CCUA 2J5EA 4ZTSA 3C50A 3KB7A 3TNPC 1YHSA 4U80A 5HVKA 2YIRA 5AR7A 2PVLA 2R3MA 4B8LA 2UW9A 2A0CX 4ZZMA 2X6DA 4BGGA 3MH0A 4G16A 4Y8DA 4ZMEA 2VN9A 2PMNX 3GU8A 4DGMA 3RNIA 4F08A 3PXFA 4RX8A 3A2CA 4D5KA 2JDVA 2PUPA 5IZFA 1XO2B 2DWBA 3PVWA 5AUYA 2C0IA 2I6LA 4UMUA 1LEZA 2FH9A 3GENA 5HNBA 3CJGA 4I0RA 4IB5A 5TO8A 5LCKA 3BQRA 4O7LA 3HLLA 2ZM1A 3LFSA 4TYEA 3RPVA 1Q8UA 4O91A 4AOJA 4L42A 5H9BA 2YLFA 3NW7A 5JT2A 3FI3A 1W83A 3HAVA 5I5ZA 5KUPA 3QTIA 4AG8A 3FMEA 4EK5A 3C5UA 3D0EA 4FIJA 3O17A 5H8GA 5CF5A 2BIYA 3CS9A 5HCXA 4EQUA 4F1TA 4FIIA 2XIYA 4EOOA 4Y46A 3B8QA 3VS6A 2ZM3A 3G6GA 3D9VA 3NIZA 3OXTA 3UPXA 4XYFA 3BRBA 3PA5A 4JG6A 2VTQA 4CFWA 3JYAA 4CQGA 5CEMA 1GIHA 2ETRA 4TT7A 4ACMA 4BVUA 2XNGA 3RVGA 3MDYA 5KCVA 3R7IA 4XP0A 4BCNA 2WPAA 3CCNA 1E9HA 1SZMA 2HWOA 3KREA 1MQ4A 3QZIA 5AV3A 4BCGA 2O5KA 4DGLC 4DG3E 5IA2A 3G0FA 3C4ZA 4TZRA 5EW9A 5T6KA 1ZXEA 2VO7A 3VS3A 3C0GA 4MH7A 4WUNA 4YZ9A 5CYIA 5GJDA 3VRZA 3BU6A 3MBLA 4F1OA 3I6WA 4PDOA 4FC0A 2QHMA 4LQMA 1YXVA 1YDRE 4LV5A 3NNWA 4QO9A 4EOSA 5IPJA 3PIZA 3QUDA 3U4WA 2WZJA 5B2KA 2W5BA 3UTOA 3VS7A 4EUTA 2X2LA 3EMGA 3QWKA 4FK3A 3DK7A 4O1PA 3OEZA 3UGCA 4AQCA 3ORIA 2JKMA 4MF1A 5I9ZA 4P7EA 4PV0A 2IZTA 2WMUA 2ONLC 2YDIA 3BYMA 4YJUA 5AR3A 4R1VA 5ACBC 3ATTA 3OOGA 3PG3A 3P1AA 1R0PA 1Y8GA 5CS6A 5LJJA 2I0EA 3FV8A 3VUDA 5J7HA 5IQEA 3ZFXA 2WEVA 2BR1A 3A60A 3LIJA 1P4FA 4FEQA 4TW9A 4M12A 4USEA 3KKVA 3NNVA 5FGKA 2VNYA 3MTFA 2PTKA 4E6CA 5DT3A 4X2JA 4MD8E 4B99A 5EDPA 5KO1A 3LMGA 1DI9A 3CEKA 1KE7A 4I92A 4F4PA 4DBXA 2YISA 4O0TA 2R3NA 4EBWA 5HNIX 1J7IA 3POOA 2UW0A 4CFVA 5DR2A 3LQ3A 3I7BA 4QPSA 3ORLA 4R77A 3BLRA 3DK6A 2JKKA 4O0XA 4U44A 3QZFA 2OJFE 3D5UA 4U7ZA 4AGDA 3FQHA 4ITJA 3JVRA 4BF2A 1OPKA 3DB6A 3QWJA 4IH8A 4BDKA 4E8AA 3BHYA 3BX5A 4CSVA 5IG1A 3SRVB 5EQYA 3OXIA 3QD4A 4K0YA 4MTAA 4R1YA 4XV3A 2QG7A 4IEBA 4WRGA 1BX6A 5J95A 4H58A 4OTQA 2X39A 3KGAA 3PFQA 3BYUA 4G9RA 4RA4A 3V51A 3W33A 4AXAA 3CGOA 4FK6A 4OTRA 4PTEA 3E7VA 4BTMA 2V55A 4HVGA 3O8PA 4MAOA 2JFMA 3ZFYA 1PMEA 3CLYA 3KN5A 3B2WA 1OI9A 4GSBA 3FMMA 5HTCA 3MN3A 5IQDA 1YRPA 5CAQA 4U6RA 4CZUA 4JVGA 1XBBA 4IJPA 2QOOA 1W98A 3HX4A 2RF9A 4U41A 3UIBA 4BFMA 2ERKA 5C03A 3EH9A 4UYNA 5T68A 3V01A 4JAIA 1CKJA 4RIXB 4E6DA 4GG5A 1UWHA 3ITZA 3A8WA 3IS5A 4RJ3A 1E1VA 3SOCA 4AU8A 2CLQA 3QHWA 2B54A 3VUIA 4LGHA 4WG4A 4C33A 3NVMB 2PHKA 3NIEA 4X3FB 4ANMA 4BBEA 4R3PA 4S33A 3FQEA 5IA3A 1OL7A 2C3JA 3KXZA 4TYIA 5AA9A 3SW7A 4H3BA 2CNQA 3DDPA 2PZYA 3LHJA 3OCBA 3QTSA 3P08A 3AC3A 2YLEA 1TKIA 1JKTA 3MH1A 3POZA 3FPMA 4RIOA 4A06A 4HCUA 2ACXA 3ZBXA 4BZNA 1G5SA 1VYZA 5M56A 1XH8A 3BWFA 4AFEA 1ZY5A 2R0IA 4NM0A 1PKDA 4EI4A 3L8XA 3QYZA 4LOPA 3OWLA 4ZY5A 1JKSA 5KBRA 4ANQA 4RC3A 3ZSGA 5A46A 4AOIA 3NVKI 1YXTA 2UV2A 3Q2JA 1U46A 4FKSA 5KHXA 4XG2A 3PP1A 5C8KA 2HK5A 3JXWA 2CDZA 3RM6A 3ORXA 3R83A 4WA9A 1PHKA 2YJSA 3C0IA 4QMWA 3ALOA 5M4FA 4HVSA 3PJ1A 1UWJA 5K4JA 4LOQA 3H9OA 4PWNA 1OIYA 2UW3A 4RJ5A 1KWPA 4FVRA 2E9NA 1W7HA 3VS4A 3C9WA 4DEHA 2XBJA 4KSPA 4BTKA 4QPMA 4BI1A 3PIXA 3UYSA 3PXKA 5D11A 4X3FC 4E20A 3ZM4A 2BZKB 3V5LA 3DJ6A 3MSSA 4QP1A 4CEGA 5AUWA 4DLIA 5AAEA 2E9OA 5M53A 2BMCA 3FMNA 5F1ZA 5FXRA 2WMQA 4Q5HA 2UW4A 4IADA 1B39A 4EHVA 4TKSA 4ZMFA 3AT3A 4PQNA 4E73A 1UKHA 2OGVA 4EC9A 4FVQA 4EZ7A 2G15A 2YM3A 3HP2A 3PJ3A 4AACA 4I5HA 4F0GA 3KRWA 5IDPA 1PY5A 4WG5A 3WZJA 5HBJA 2X1NA 3TN8A 4O0YA 5JFSA 3HMIA 4BIEA 3KVXA 3BIZA 3TUCA 3LKMA 3RNYA 1ZZLA 4QMTA 2XNEA 4UXLA 2XNPA 4JBQA 4YLJA 3R0TA 4KABA 5CAUA 3QRTA 4DH8A 2H96A 2HZNA 5I9WA 2BUJA 2VTTA 3TWJA 4DEIA 2WTKB 3PY0A 2W1CA 4ACGA 3Q53A 5FBNC 2W9FB 2XKEA 4FGBA 2VTLA 4AW1A 2CGVA 4YLLA 2QR7A 3LFBA 2JLDA 4YJTA 2A27A 4BKYA 3A7FA 5J9YA 4UWBA 2YIQA 4JT3A 4RFYA 4AWIA 5HO8A 4ERWA 2P3GX 4MWHA 4DC2A 3RCJA 3V6RA 1U54B 4Z7HA 4CG8A 3QZHA 5IH4A 3BEAA 3FY0A 2X2MA 3PZEA 3R2BA 5ACKA 1V0BA 1VZOA 5JRSA 3QFVA 3GUBA 2BZIB 4O0WA 1NVSA 5EKOA 2X4FA 4EYJA 3OFMA 4FT9A 4HGLA 3FL4A 4NU1A 4I23A 3FYJX 4F9CA 4XX9A 1KOAA 3MPTA 2OZAB 4NTTA 4H1MA 5CALA 3VS1A 3HMNA 4YTCA 2DQ7X 3EWHA 4QMMA 4CMUA 4L44A 2QOQA 3PXYA 3VHEA 2EXEA 1PXMA 2ZM4A 3P0MA 4UWCA 4UMPA 5K4IA 2UZLA 2NNWB 1FGIA 4A9YA 3GXLA 3IW5A 3TZ8A 2QOLA 2UW6A 3P7BA 4W8EA 4DHFA 2BDJA 4AOTA 2WB8A 5B2MA 3FI4A 3BU5A 3BBTB 4R7HA 4AZEA 4L53A 2WTKC 1OGUA 2BAKA 3VQHA 2BTSA 3JS2A 3OHTA 4GS6A 4FKPA 4LM5A 3ATSA 3KF4A 4F7JA 4GG7A 3RPSA 4EHEA 1PXLA 4OTHA 4IBMA 3PZHA 3SW4A 4LGDA 5EKNA 2J2IB 4K1BA 2C6DA 5HZNA 4M8TA 3FHRA 3MH3A 5TKDA 5E8WA 3CTHA 5AV4A 1XR1A 4ZSJA 4AN3A 4Q9ZA 4FKJA 4LV8A 1PXPA 4O0SA 4F63A 4F70A 3F69A 2XJ1A 4ZAUA 4NJ3A 2YM8A 1OVEA 3E3BX 2WTDA 4PPAA 4DTAA 5FTQA 5GZAA 3H0ZA 4FKWA 4KAOA 3ZH8A 2Y0AA 3HV6A 3TV6A 4AT5A 3NRMA 3TT0A 4BCIA 4ERKA 2G01A 4XG6A 1ZYSA 4I94A 4ZS0A 1WCCA 3QQKA 2C4GA 3KXGA 4CT1A 3DJ7A 4AAAA 2H6DA 2WU7A 3VQUA 4BDHA 2ITXA 3MS9A 2JDRA 5TE0A 5AADA 1NA7A 3DPKA 4GVJA 3W1FA 3W2RA 5GHVA 4D2TA 4CYJA 4ZJIA 4BI2A 5JH6A 3E64A 3HRCA 1OIUA 4NH1A 1Q3DA 4YHJA 4AUAA 4FKRA 2QO9A 3W18A 3S95A 2B0QA 3E8DA 4FSQA 4E5BA 4BYJA 1NT2A 2UZVA 5CEOA 2OLCA 4CQEA 4CZTA 4E6QA 3U8WA 1Q62A 4NIFA 4FV9A 2C6TA 2W9ZB 5HG9A 5IDNA 2BFXA 4HCTA 4QQJA 4CT2A 3SGCA 3OROA 3OD6X 3T9IA 4EORA 2WMBA 1YWVA 4Z9LA 2GHLA 5CSXA 2VTRA 1E1XA 3W8LA 3KCFA 4EBVA 4N57A 4DINA 1ZARA 4FZ7A 3DJ5A 4XOYA 3PJ2A 5EM5A 2BRGA 5M4CA 1J7UA 2XKFA 2P2HA 4CTBA 2XCKA 4P2KA 4FUXA 3KY2A 4O84A 3P86A 1GNGA 2C0TA 2ZMDA 3PPZA 3LFQA 3H0YA 4BDBA 4DEBA 4E4MA 4E3CA 2ZVAA 3FMKA 4C4EA 3KMUA 4GW8A 4ANLA 2RKUA 4QMQA 4QP8A 4WNOA 4WT6A 2VAGA 3RCDA 2GSFA 4CLJA 3NYVA 2IZRA 3ENHA 3PWDA 3R2YA 3WBLA 1BLXA 3W32A 5KKRC 4JIAA 1TQIA 4I20A 2PZPA 2PVRA 3I6UA 4C4JA 3VBWA 3R8PA 4AP7A 4FOCA 5A4EA 4FT3A 2VWUA 2LGCA 1J3HA 2HELA 3CBLA 5HX8A 3OTVA 3TJCA 2V22A 3E8EA 2OKRA 3FZ1A 3NYOA 3WE8A 3LFAA 2X8DA 3LCDA 4DE4A 1WVWA 2VO3A 3BLHA 4IX3A 2PVFA 2YCRA 3PXQA 4QQ5A 4WOVA 5HD4A 3AC8A 2VZ6A 5D41A 2ITYA 3OCGA 3DU8A 4C37A 2YM6A 4JDKA 3VUGA 4MCVA 2YDKA 5AMNA 5EYCA 4RLKA 2PULA 4FV5A 5HE3A 3HUCA 4HZSA 4RVLA 3ELJA 1APME 2YJRA 3LQ5A 4J1RA 2WFYA 4RQVA 4QQCA 4O7WA 3GOPA 3SG8A 5CASA 4Q2AA 3KCKA 4CKJA 3QC4A 3GQIA 4U42A 1K9AA 5E8UA 5T3QA 3E3PA 5BVWA 4FL3A 4RBLA 2C6EA 3A7IA 5DNRA 3QLFA 5FUTA 2B7AA 3MI9A 4P5QA 2CJMA 1ZYDA 1ZLTA 1ZAOA 4XG9A 4HNFA 2OXDA 3NCZA 4KA3A 1YI3A 4BDAA 4BKZA 5D7VA 3EN7A 4O82A 4IMYA 4C58A 5A4QA 3VF8A 5CI7A 3LW0A 3JPVA 3QTQA 3NNXA 4CFUA 4O7VA 5F4NA 5ANDA 2R3RA 5FDPA 2J0MB 2YCQA 3W2SA 4R5YA 3TIZA 1CDKA 3ZU7A 4D58A 2ETKA 3I79A 4OTGA 2J7TA 4C4GA 4DFBA 3VHKA 3WI6A 2CCHA 3UO5A 4QTDA 3A4PA 3VJNA 4F7SA 3HAMA 5LMKA 4FA2A 3AGMA 3ERKA 3I4BA 4FTOA 1PXNA 3EN6A 2I0VA 2R3PA 2ZYBA 4EZ5A 3HMPA 3WYXA 1MUOA 2GS2A 3PLSA 1PMVA 3AC2A 4J98A 3UOHA 1ATPE 4IAAA 5HHWA 3D15A 5DHJA 2BRBA 5C8MA 4AX8A 1AGWA 3H10A 1QPEA 3QKMA 2ESMA 3O7LD 4J99A 2B9JA 2F7EE 1H8FA 4NUSA 4YZDA 4BWXA 4BDIA 3QTRA 4ID7A 4YBKA 5BVNA 2QLQA 4QMXA 5DEWA 5HTIA 2G1TA 3GU5A 4UX9A 2XEYA 4WKQA 3IECA 2YDJA 3RZBA 4YMJA 4XRJA 3RZFA 5CAPA 2W5AA 3RALA 3O71A 2VO0A 4ENYA 2Y4IC 4BKJA 3FSFA 3PIYA 5L2SA 2WMXA 4BYIA 2WIHA 2OXYA 4XBUA 1HCLA 3A7GA 4NWMA 2JBOA 4BDJA 1BL7A 5HD7A 2PY3A 3VW6A 5E8SA 3HVCA 4ZLYA 4NCTA 3F2RA 1OB3A 2Y7JA 5B7VA 3R9NA 2IN6A 2JKOA 4FV7A 5HIEA 2JDSA 4X3JA 4DFZE 2VX1A 4IB3A 4EH2A 2F9GA 2OJ9A 4FNZA 3UG1A 3KULB 2CMWA 3O7LB 4JQEA 3V8SA 4C2VA 4HVIA 2IVTA 3CJFA 5BYYA 1ZMVA 5M07A 1IA8A 3LMHA 3UC4A 2E9VA 5HLWA 2DS1A 5EHLA 4A7CA 4E5AX 3MFUA 4EC8A 5IH5A 2JIVA 4GL9A 2C3IB 3TDVA 4FEWA 3QZGA 4USDA 4JXFA 3S0OA 3GI3A 2ITQA 3LCOA 4FKVA 3OZ6A 3RHKA 3R8VA 3KN6A 5CU6A 5ANIA 1SVEA 1BI7A 5DN3A 5AX9A 4XG4A 3QXOA 4A4XA 5AAGA 5LQFA 3GVUA 5L2QA 5JMSA 4QTBA 1MQBA 2WKMA 3CQUA 1JNKA 4BBFA 4NL0A 3SHEA 2X81A 1CKPA 3Q4ZA 5JGBA 4R8QA 2CGUA 2BILB 4FSRA 4NFMA 2VWXA 4O6EA 4PPBA 1UVRA 2QO2A 3EQHA 5LARA 3DXNA 4PY1A 4A4OA 3OWJA 2XS0A 3PPKA 4IHPA 2VWVA 4FG8A 5IA4A 4ASEA 3SA0A 3WIKA 1M2RA 4NZWB 5C9CA 4L67A 5M57A 4LYNA 2YZLA 3CKWA 3UOLA 4FICA 3QUEA 3NX8A 2PVJA 3Q52A 4PUZA 4TYJA 5DR6A 4L68A 3UQGA 3ZXZA 2XRUA 3FHIA 2X4ZA 4XV2A 1OITA 4YC8A 3ETAA 4FV3A 3ROCA 4YJOA 5CEPA 4RIWB 2PE2A 5C4KA 5IF1A 4E1ZA 2OF4A 3BHTA 2Q0BA 4F6SA 3F66A 4FTQA 3LM0A 4NYEA 5CQUA 1JAMA 3MH2A 5AUVA 4ZIMA 4RX5A 5ANEA 2GQRA 3QLGA 3SQQA 3UOJA 5M4IA 3VNTA 3FY2A 4BDFA 2JD5A 2XIRA 4HZRA 2W1FA 2A2AA 4YZCA 5IQHA 2YAAA 1V0OA 5A4CA 3O50A 4XG7A 2FSOX 3QQLA 5EFQA 3WZEA 5A54A 5FP6A 5GJGA 3RGFA 4QMOA 4RX9A 1FOTA 2ZB1A 5CU3A 5EYMA 2RFEA 5DLSA 3KRLA 2WTIA 4UZDA 2WOUA 1PW2A 2WEIA 2XEZA 5KHWA 4J95A 3Q9ZA 1SVHA 2XKCA 4O1OA 4TWOA 4BI0A 3C0HA 1OBGA 2XK9A 3SC1A 5I0BA 3MW1A 1QL6A 3ANRA 2C5VA 2VGOA 3ZUVA 2OW3A 2R3JA 4JAJA 2PUNA 3UODA 2BRMA 3L1SA 1XJDA 4PNKA 5GIOE 2B9FA 3RAHA 1Q3WA 4LGGA 3KA0A 2OI4X 2PUIA 3ZMMA 3UMWA 1WMKA 3GNIB 4I93A 3VO3A 1OPJA 3VUMA 2CKQA 3G9NA 3ZSHA 3S3IA 3ID6C 2JIIA 3ZLWA 4V05A 1ZOHA 2XVDA 5AP2A 4GIIA 1Y6BA 3TNWA 4I0SA 5BX0A 3R1NA 3DKFA 5LOHA 3MVJA 5M44A 3VBYA 4FKUA 3ORPA 2UW8A 4XP3A 4RWIA 1XBAA 3QL8A 3RAIA 1IAHA 3PA4A 1WBWA 3DLSA 1FGKA 4E6AA 4IWOA 5KMIA 4CFFA 2QR8A 2IVSA 4C57A 1OBDA 2VX0A 4FUYA 3DTWA 4ACHA 3HKOA 1URCA 4ITHA 4XLIA 4YNEA 3QD3A 2VX3A 2HW7A 3QF9A 1CTPE 1YDTE 2Z7SA 1LP4A 4MXAA 5M4UA 4S34A 4GFOA 4PL5A 3WF9A 1SVGA 4JBPA 4QYFA 3D5XA 5A4LA 4JG7A 3GFEA 1J1CA 3VS2A 3PE2A 4IZ7A 1JVPP 3V5PA 3PPJA 4RWLA 4YBJA 5AV2A 3N51A 5K3YA 3Q6WA 3T3VA 5IUHA 3QC9A 4V04A 2RIOA 2R3QA 1OL2A 2HWPA 4BDEA 3QKLA 3QCYA 3TV4A 1LR4A 2VWZA 1OUKA 3W10A 1VYWA 2W7XA 3BYSA 3KXHA 1PXKA 2YACA 5HBEA 3ORZA 4O83A 3QKKA 4CG9A 4USFA 5L3AA 4AT3A 2XZSA 3WE4A 4FYNA 3FZPA 4G9CA 3QTUA 4DEDA 1O6YA 3II5A 3NUXA 2C1AA 5IQFA 4KD1A 5D9HA 4DEGA 4IX5A 4JDHA 2XIXA 3EN5A 3DBQA 4DFLA 4A9RA 4E5WA 2R3FA 2YHVA 2HAKA 3Q2MA 4M68A 5LVLA 3P78A 4AT4A 4O27B 4AA5A 5EM6A 2RG6A 4S30A 4EJNA 1LEWA 4C4HA 4FOBA 4YO6A 2REIA 4W8DA 4D0XA 1IA9A 2H8HA 3RP9A 2GFCA 2W4KA 4UY9A 4CRLA 3U9NA 5CZIA 4KIOA 4Y85A 3TDWA 2HY0A 4LRMA 2W1IA 1GZNA 2Y6OA 3NR9A 5J87A 3UO6A 2XH5A 3CD3A 5E4HA 4ORKA 2FSLX 4ALWA 3MVHA 4MK0A 2G2IA 2JC6A 2Y8OA 3M1SA 2OJJA 3NEWA 3KC3A 4DT8A 3TI1A 3BHUA 5E8ZA 2ZJWA 4EEVA 5FXSA 3Q60A 3EQFA 4MXZA 3MA3A 4QTCA 4YHTA 2C0OA 5CLPA 3R7OA 1STCE 3ODZX 1Y6AA 4NTSA 4YZBA 4WHZA 4Q9SA 2JFLA 1Y8YA 4TWNA 4F64A 5JFXA 2IVVA 3CGFA 4LI5A 3O23A 4RZWA 3EB0A 1H28A 4GVAA 4OTWA 3I5NA 3G6HA 3R00A 3LFEA 4G3DA 5J5SA 1UU3A 1X8BA 2WGJA 3VUKA 4MXXA 2X8EA 4JQ7A 4X2GA 5ANGA 2QD9A 4KRCA 3GP0A 3DLZA 5D1JA 4DG2E 4IC8A 4FTKA 4FSZA 4DBNA 3U55A 4K33A 2EB2A 3OW4A 4L45A 2R3LA 5DPVA 3EQIA 1KE6A 3DBFA 2PU8A 5FTGA 4FKLA 4QMYA 4TXCA 1W0XC 1RQQA 2PE0A 3DAJA 4IWPA 3M2WA 1Q24A 5IA5A 5AFVA 5B0XA 5CZHA 1KOBA 2R7BA 4BDCA 2QURA 4A4LA 3CPBA 4G5PA 4XEYA 3VBVA 4IAIA 2WQMA 4DCAA 3SLSA 1W82A 2BRNA 4IZ5A 4AN2A 3SRVA 4C4FA 4ZSAA 3RBWA 4IM0A 5CANA 2XRWA 4FSMA 3LCKA 4EJ7A 1ZY4A 4XP2A 4IFCA 3UDBA 3W2CA 4WIHA 1TVOA 3HECA 4OLIA 4OUCA 2O64A 3Q9XA 4MVFA 4C8BA 4G17A 5CEKA 2GNFA 3DGKA 3L8SA 5B2LA 2F4JA 1YOLA 3I81A 4BTJA 5IMEA 3QA0A 4H39A 3ZZEA 5EI6A 2VUWA 2YFXA 3DFCB 5IU2A 2YEXA 3HNGA 4AZTA 4D2VA 3VUTA 4QTAA 3L9LA 2ZV2A 1OECA 3WZKA 3QQUA 5FM3A 4TWPA 1U5QA 4IAKA 5DFPA 5E91A 3C1XA 4XG8A 2W4OA 3ORNA 3OCSA 4TL0A 2W1EA 3G33A 2CN5A 4C38A 4QP9A 3OG7A 1WFCA 1Z57A 3CY2A 4JRNA 4NW5A 4W4WA 3VC4A 4WG3A 4G3EA 2F7XE 3OEFX 4BY9E 1UNLA 3KF7A 4FZ6A 4CKIA 3VIDA 4PP9A 4L7FA 4RA5A 5BMMA 2OIQA 5CENA 3MESA 2XK7A 4L7SA 4EH3A 1JSTA 3BCEA 4YPDA 2HZ0A 3JVSA 3DKGA 5FG8A 5L8JA 3EJ1A 4ZJVA 2ITUA 4ANOA 4ZZNA 2G2FA 4TNBA 1PF8A 1OIQA 4KNBA 4FGRA 4DITA 3LCSA 5E8TA 2Y4PA 3LFDA 4BIDA 4QT1A 5HCZA 2E9UA 3KMWA 5K0XA 3M42A 2YZAA 4FV0A 1PMUA 4KS7A 4X2FA 4NM7A 4BWPA 3NUPA 2FGIA 3E87A 3D83A 3HGKA 4GV1A 4UEUA 4YNOA 1S9JA 1NVRA 3QUPA 4H3QA 4QYEA 3WZUA 4I1ZA 4WSYA 1MRVA 4S32A 5IQGA 5CEQA 1M7NA 3FLYA 3O51A 5KMNA 1YXSA 4BN1A 3F6XA 4PMMA 3NSZA 4O2ZA 5DA3A 5BVKA 3UZRA 5IQAA 4MNEB 3UQFA 2QU5A 4B0GA 4APPA 3HZTA 4O38A 5FTOA 3U6HA 1R1WA 4GU6A 4LRJA 4S2ZA 3UYTA 3PRIA 4EYMA 3OVVA 2CSNA 5DR9A 1ND4A 2VTSA 4KIQA 4F65A 1JLUE 4CVAA 2JDTA 2R9SA 4AW5A 2UZTA 3Q6UA 5CVGA 5DGZA 3V8WA 4A9TA 4ALVA 2X9EA 5H8BA 3FXXA 2VTOA 3GU7A 3ZTXA 4RFMA 2JBPA 3K5UA 3VVHA 4BDGA 5ICPA 3TZMA 3K3IA 5JK3A 1PKGA 3DBDA 4HNIA 3CD8A 3NYXA 2G2HA 3MFSA 1JPAA 4ZXTA 1YQJA 4FTIA 1H4LA 3L8PA 3PUPA 3ZDUA 1H01A 4L52A 4AA0A 1HCKA 4BBMA 3G15A 1P5EA 2VD5A 5CF6A 3REPA 3RK7A 3UQCA 1OL6A 4II5A 4M0ZA 1ERKA 3RK9A 4L00A 4D2PA 4O22A 3CIKA 4Y83A 4O6LA 4QP4A 3NAXA 4DFNA 1UNHA 4DEAA 4N6ZA 4RJ6A 2QC6A 3BU3A 4NKAA 1Q4LA 4WRSA 3A61A 2KTYA 5BVOA 2XK4A 4P4CA 4Y95A 1PYXA 4IW0A 4I5MA 5HCYA 4KSQA 2OH4A 4NSTA 3GT8A 4NKSA 3GCSA 5EH0A 5A4TA 5IMXA 4IANA 3PG1A 5JGAA 3BV2A 4D1SA 5AUUA 5GZ9A 3RPYA 5HO7A 4JI9A 4HGEA 3K2LA 4O0VA 3A8XA 3O8UA 4Y73A 3OY3A 4CZYB 4X7QA 1ZMUA 3I1AA 2PL0A 2X7GA 4LG4A 3LM5A 4IVDA 1XH5A 4W4VA 3ZO3A 4EOQA 1PMNA 2HW6A 4R78A 1S9IA 3GC9A 4X6RA 4J97A 1XH9A 2BALA 1SYKA 1U4DA 3A62A 2RG5A 3EHAA 1PYEA 4MHAA 4ZY6A 3R7VA 4NEUA 4C3RA 4EK6A 4L43A 4PDYA 3NW6A 5CQWA 3K5VA 2F49A 3PJCA 3QX4A 4KB8A 4ZP5A 4DTBA 4O2PA 3BPRA 5HIDA 4M97A 2WTCA 2GCDA 4PL4A 2ZDTA 4WBOA 2GFSA 3QGWA 4QYYA 1R78A 4C02A 4DH5A 4C59A 5EQEA 1MRUA 3LFCA 1IEPA 4G3FA 4IE9A 3G51A 1F3MC 3WF6A 2ZV8A 2I0YA 1I09A 5TF9A 4APCA 3ZDIA 3OCTA 3HRFA 1H25A 3P5KA 3P23A 4GK3A 4XV9A 4GYGA 2RSVA 3BGPA 3H9RA 2PVYA 2V5QA 4V0GA 5HE1A 4RJ4A 3RK5A 1YI4A 4GT5A 3VS0A 4FEUA 1A06A 1ZYJA 3ZHPC 5DE2A 4B4LA 2FVDA 5HG5A 4MBIA 5L6PA 2QQ7A 3EQGA 4EZ3A 3GFWA 3UNZA 2OIDA 1OL5A 2C6IA 3C13A 5AA8A 4PTCA 3HUBA 2GHGA 3TNHA 3D2KA 3WF7A 3B8RA 3PXZA 3S1HA 2R3KA 4H1JA 3ZFMA 3DKOA 4FZFB 3M11A 3EFKA 3BHVA 4FTRA 5K0KA 3CQWA 1FPUA 4DAWA 3D5VA 3E5AA 4BCQA 4EOIA 2FSMX 3ET7A 4IVAA 3LQ8A 4FKQA 2P2IA 4I3ZA 4EQMA 2WELA 4JX7A 3JR1A 4IQ6A 5AP1A 2NO3A 2EU9A 4IWQA 3BKBA 5AR8A 4RWJA 5FP5A 2C6LA 3NYNA 4XLVA 2UVXA 2JGZA 1SM2A 3CTJA 5G1XA 3MIYA 2B55A 2WTVA 3G0EA 4RJ8A 4K18A 3ZO4A 4EOMA 2W1DA 3RWQA 4DYMA 4FSTA 4I5CA 4FIEA 2VWIA 1FVVA 4J96A 3TXOA 5KMKA 1DAWA 1LUFA 2W05A 2XM9A 3GQLA 4RVMA 4TPTA 4TYHB 3FLZA 5L6OA 3KK9A 4DEEA 2X7OA 4UV0A 5DYJA 5DRBA 4NIFB 4GYIA 5TT7A 3Q32A 2C6MA 4FTAA 3GBZA 3TTJA 4AGCA 2VGPA 3RJCA 2R4BA 3GB2A 5FQDC 1QPDA 3PY3A 3KXXA 4OGRA 3R21A 3BI6A 4QRCA 4UALA 5EOBA 4ENXA 2ZAZA 4BHNA 4FSWA 4BCPA 4FV2A 1YI6A 3HMMA 3S00A 2GPHA 4XV1A 1F5QA 3C4WA 4EWQA 5BVDA 3I0OA 4U8ZA 3AMAA 4J7BA 4EKKA 1UKIA 5F94A 2PK9A 2XMYA 4FKOA 3BE2A 5KBQA 4C36A 1FVRA 3LJ2A 3DBEA 4QTEA 3OF0A 3QQHA 3FMJA 5DH3A 3PLAE 4TTHB 2JKQA 5HVYA 3FDNA 3CC6A 3F5GA 4A9SA 4PP7A 2WIPA 2ZV7A 1WAKA 3PDTA 4FG9A 3F5XA 3LJ0A 4GJ2A 3PSBA 3EN4A 1QMZA 2VO6A 3Q96A 4W9XA 3DCVA 2P33A 4ZJJA 3NDMA 3NNUA 1NW1A 2PUUA 3R73A 2FO0A 3EFWA 4KS8A 2OO8X 3WOWA 4EONA 5AP6A 3DXPA 2QOKA 4Z16A 4C3PA 3C4XA 3GC7A 2OG8A 4RGJA 3HP5A 5GJFA 1R39A 3OMVA 2PYWA 3V04A 1YOJA 3GCPA 2XBAA 2WO6A 4JOAA 5E1SA 3FKOA 3RI1A 4WO5A 4XS2A 4HJOA 4RIYA 5FLFA 3NPCA 4JDJA 4FR4A 5ETAA 4EWHA 2HYYA 3SOAA 1ZOGA 4ZTLA 1MP8A 3CSVA 3MWUA 2B9HA 4U0IA 4FTCA 3U87A 3E7OA 2GS7A 3IDBA 3IGGA 4FNWA 4IVCA 1KV1A 2XCHA 4KKHA 5K5NA 5CAVA 3UNKA 3EQBA 4YZNA 1OKVA 1KSWA 2QODA 3DOGA 2YITA 4JLCA 4FSNA 5KZ0A 1OIRA 3TM0A 5TOZA 3TNIA 2VTAA 5LVNA 5JZJA 4FL1A 3TJDA 4C0TA 3BZ3A 1U59A 2GNIA 5HTBA 3ZC5A 3QTXA 5EDRA 3SXFA 4QOXA 4A07A 1UA2A 4FTUA 5AUXA 2EWAA 5CSVA 1YOMA 4NK9A 3VF9A 5HG7A 3R8UA 3QRIA 3LXKA 4BCJA 2QOBA 3NUNA 3PWYA 4FX3A 3WILA 4EH9A 3KRXA 3LXLA 3MB6A 4X2KA 4YGAA 3DV3A 3TACA 4AGUA 4ONAA 4B9DA 4IFGA 2X8IA 4FNYA 3RAWA 4I6HA 4M66A 2P0CA 3OUNB 3B2TA 3EYGA 3F5UA 4ALUA 3CPCA 5JFWA 1XQZA 2W1GA 3MFRA 5I9XA 3IOPA 2WAJA 3R6XA 3FMHA 3BGQA 3K3JA 4G6OA 3BGZA 2HZIA 2JITA 5AUZA 4Y5HA 4I0TA 3FJQE 5I9UA 4PX6A 3LVPA 3DS6A 2Q83A 3SD0A 4C4IA 1Q8TA 5AR2A 4ZEGA 3C4FA 2WMAA 4FTMA 2NRUA 2JIUA 4GIHA 4IAFA 4M69A 4QP2A 5HICA 4EUUA 3FUPA 4HYUA 2WMTA 2WMRA 1WBSA 2HXLA 3LMIA 5EG3A 4DGOA 2C5XA 4AE6A 4AE9A 3I7CA 3SKCA 3BV3A 3TUDA 3NUUA 1K2PA 4FSYA 3RAKA 3U51A 1M52A 4A9UA 4F9BA 4CNHA 4B8MA 2YIXA 1GJOA 3FKNA 2R64A 4J8MA 3FPQA 2RL5A 2UUEA 3R9DA 2WD1A 1Q8YA 2YM5A 3AQVA 3ORTA 5KX8A 4EQCA 4CMOA 3OT8A 4FNXA 4XH6A 2FA2A 1GY3A 5HESA 1UNGA 5AP5A 4WSQA 2OSCA 3VS5A 1CM8A 5M09A 2CHLA 4D9TA 4ZTMA 3OW3A 3TKHA 2Y9QA 3Q5IA 4NFNA 3CY3A 3R9RA 2YAKA 5EW8A 4IM3A 2OIBA 1OKYA 2E9PA 3EQCA 4O7ZA 2VTJA 4QYHA 5DT0A 1PXIA 4OTIA 1K3AA 3EZVA 5E7RA 4M14A 4R7IA 4RMZA 2PSQA 5FEEA 3V8TA 5IUGA 5LMKC 2JEDA 3DQXA 4OBOA 3K54A 5A6OA 2VTNA 5GIPE 1KV2A 4WNKA 1O6KA 3BLQA 1XH6A 2O8YA 5IQBA 1P4OA 4HGSA 5CXHA 4BL1A 2AC3A 4FTJA 4GH2A 2BKKA 3UIXA 5A3XA 5HLNA 2O3PA 3Q5ZA 4OR5A 4OBQA 5F9EA 2BHEA 2BIKB 3LLTA 3UVPA 3VW8A 5ETCA 3MYGA 5ETIA 2ZB0A 4FIHA 5HKMA 3ZRMA 4KUJA 4XJ0A 3LCTA 5HORA 3LFNA
chains in the Genus database with same CATH superfamily
1BL6A 1H0VA 3QCQA 2HENA 3KRJA 3FI2A 5CU2A 3R04A 2Q0NA 3TZ7A 4F09A 1BYGA 5EI2A 5DWRA 2LAVA 4R5SA 4BZOA 1QPJA 2CLXA 2IZSA 2BAQA 3UMXA 4C62A 5AM6A 4E4NA 1J91A 4O7YA 5G6VA 4BZDA 1OKWA 2YCSA 4JR7A 4PDPA 1NXKA 5DOSA 5CNOA 3C51A 2XP2A 4DT9A 3GCQA 2BZJA 3QRUA 4R3CA 3CE3A 5K9IA 2UW5A 2EXMA 3Q9WA 3ZO2A 2UZOA 4I21A 2GNGA 4IVBA 5J1WA 3DZQA 4M15A 4LOOA 2F57A 5FRIA 5FWKK 3COMA 4FIGA 4HYHA 5C27A 4WNMA 4F6UA 3E8NA 5CU0A 3ULZA 2A98A 4I6QA 5IQIA 5EK7A 2QVSE 2YIYA 5AIRA 1UU9A 1YHWA 5HE2A 3RHXA 1UU7A 4MEDA 3PVBA 1W2FA 5FDXA 5L6WL 3W55A 4MD7E 3H9FA 2C30A 4M7IA 3OP5A 2X7FA 1JQHA 3RPOA 4CV9A 4FJVA 3D94A 3Q4UA 2GTNA 4HOKA 2CKPA 4O7SA 3DZOA 4RSSA 2XK8A 1ZYLA 4ZTNA 4H3PA 4FBXA 3IPHA 2QU6A 1DM2A 4KIKA 3E62A 5M51A 3N4VA 3O2MA 3QTZA 4MBJA 3V6SA 5AP3A 4D4RA 2J51A 5BUIA 3AD4A 3FXZA 4M67A 1OZ1A 4FE2A 2J4ZA 3MV5A 5DG5A 1WBNA 4MD9E 4C2WA 3FC1X 4YSJA 3F3VA 4K8AA 4ZTRA 4QPAA 3QCXA 2X0GA 3EKNA 4YTHA 5DEYA 5M08A 3DY7A 2QCSA 2WU6A 3LE6A 3QQGA 2C69A 4FL2A 4L3JA 4MQ2A 1M2PA 1Z9XA 4RT7A 4XRLA 4AFJA 5JRQA 1O6LA 2GDOA 3D7TB 4GUEA 4H05A 3HA8A 3ZEPA 3CTQA 2JAVA 3LXPA 2BCJA 4I6FA 4BGQA 5CSWA 2BDFA 3CXWA 4OW8A 2UZNA 3ZBFA 1H07A 3Q3BA 3WF8A 2XYUA 4FT0A 4KKGA 2B52A 3EKKA 4ZOGA 3WIGA 4U81A 5J79A 4FV1A 4AZWA 4DGNA 4XOZA 3BHHA 3FMLA 3S4QA 1H27A 3R02A 2WNTA 3MGYA 2XK3A 4MF0A 3SXRA 4XG3A 4AN9A 1O9UA 1QPCA 3FSKA 2C6OA 3W0PA 5E1EA 4QYGA 4Z3VA 5IH6A 3D5WA 2ZFYA 5FBOA 1ZZ2A 4AS0A 5LVMA 3R7YA 5EYKA 3DK3A 4O86A 5IA1A 4TYGA 5I3OA 3F82A 3I0QA 2OJGA 3G2FA 3UVRA 2BFYA 2DYLA 2J90A 3FZSA 4U5JA 4N70A 3OC1A 3MPAA 2ONLA 2J50A 3OOMA 4OTPA 2X0OA 4HPTE 2XA4A 5ITAA 4BRXA 2I0HA 1WVXA 4IJ9A 3D14A 1GZ8A 3QCSA 1YKRA 2W4JA 3IW7A 3IDPA 1SNUA 2E2BA 4L6QA 5ANOA 5IUIA 4NM5A 5HG8A 2CNUA 3A4OX 2FYSA 5HE0A 3PJ8A 4FYOA 1OM1A 3KU2A 1M17A 2NRYA 4MKCA 5TR6A 2A4LA 5JGDA 5CY3A 3SVVA 4C7TA 2C6KA 3E93A 5EHYA 4QMSA 3QD2B 2ZOQA 1TQMA 1JBPE 4Y72A 4RC2A 3QD0A 3OT3A 1R3CA 4I6BA 4F6WA 5J5TA 1GIJA 5J1VA 2XF0A 1NY3A 4JR3A 4FRFA 5FEDA 4KINA 5JKGA 1M7QA 1OKZA 1TQPA 1WBPA 5EDQA 3EN9A 3KL8A 1RW8A 3KFAA 5LWNA 4AZFA 3IQ7A 2PZIA 4ANBA 3NZ0A 3F3TA 4J52A 3HV4A 4UB7A 5HQ0A 3A99A 2VTIA 4FT5A 2V0DA 3FZOA 4I4FA 4YSMA 4UMTA 3DDQA 3FQSA 3PXRA 3VWAA 4EHGA 3OWKA 2NPQA 3FXWA 2FSTX 4YPSA 3H3CA 1FMOE 1FMKA 5KE0A 3TG1A 4GK2A 4F0IA 1W84A 2ZMCA 2V62A 4GRBA 4N4SA 4YTFA 2BDWA 2OZOA 3DAKA 1V1KA 3PVUA 4IDTA 4QNYA 3KXMA 4UBAA 5CI6A 4EKLA 3ZRKA 1G8JA 2OK1A 2Z8CA 3CP9A 3O96A 4IWDA 3MY5A 3E8CA 4OTFA 4YJRA 4JS8A 3TKUA 2PE1A 2PMLX 4XMOA 3TEIA 1A9UA 3CKXA 3VBTA 4BHZA 3HDNA 1H1RA 2HZ4A 1CSNA 4YZMA 2R3IA 5LCJA 1IR3A 3QXPA 4IC7A 4X6QC 5L2IA 3OBGA 4I24A 2Y6MA 4G6NA 4P90A 3ZLXA 4ZSGA 1GZKA 1XBCA 2YERA 3AG9A 3R1QA 3ZUTA 5CXZA 2AYPA 4GFGA 5E9EA 4F7NA 1KE8A 1YVJA 4OAVB 2HCKA 2J5FA 2R3GA 4R3RA 3AC4A 3RWPA 4LUEA 2RGPA 4ZLZA 2WQBA 3G9LX 4G5JA 1P2AA 2UVYA 4ITIA 4NM3A 3VN9A 2CPKE 3JUHA 5CF4A 2W1ZA 5ANJA 2C5OA 2AUHA 4DTKA 3AT4A 4EH5A 5BNJA 3QTWA 4F0FA 3GU6A 2UZWE 1OL1A 3FC2A 3FLSA 3GU4A 4AA4A 3HV7A 4HW7A 2O63A 4D28A 5JFVA 4EK4A 4X2NA 5AP0A 2HOGA 1XH7A 4IX6A 3DBCA 2WQEA 4L8MA 4G1WA 4KKEA 2C5YA 4BC6A 4YHFA 4O7NA 2PPQA 1BI8A 2IWIA 4GCJA 1JSVA 5AJQA 2Z02A 3AGLA 3C4CA 1FINA 4RIXA 3C4EA 4M84A 3MY1A 3AC5A 4D4SA 4N6YA 5JN2A 4MX9A 3ZLSA 4M3QA 4BCMA 3MA6A 3VAPA 4CCBA 4AW2A 4YC6A 3VJOA 5L4QA 3GEQA 2W99B 4FV8A 4X3FA 1VJYA 4ASXA 3D4QA 5IA0A 4I6LA 4HPUE 5J9LA 5CF8A 3ZRLA 4CKRA 3TIYA 5C26A 3AKKA 5LMAA 2VTPA 2ITVA 1PJKA 2JAMA 4C61A 1Q8ZA 2C5NA 3ALNA 3BL7A 2H9VA 4HGTA 5HGIA 2BROA 3H4JA 3L9NA 3F61A 3T3UA 4EOLA 5KMOA 3BEGA 4V01A 3T8OA 4IM2A 2YABA 4F9AA 3V5JA 1H24A 5DI1A 4CLIA 5KNJA 3E92A 1VEBA 3EZRA 5JEBA 4FKGA 3NWWA 2QHNA 1OMWA 2R0UA 2XK6A 3EQRA 2FUMA 4IAZA 4RX7A 5AWMA 1EH4A 3DKCA 3E88A 4X0MA 3T9TA 1OPLA 2H34A 3IKAA 2KULA 4MBLA 4ANSA 4MQ1A 4BCOA 3RPRA 2W1HA 4EOKA 4DFUA 1Q8WA 3CQEA 3AT2A 1HOWA 2R2PA 4UMQA 3D7ZA 2WHBA 5D10A 3R7GA 2WQNA 4QP7A 3MY0A 3NUYA 3GOKA 5HEZA 3ZS5A 2CKOA 1DAYA 1IASA 5JZNA 2PVNA 4C35A 4PL3A 1IAJA 2ERZE 3MB7A 2Z2WA 3QA8A 2OXXA 3UE4A 3H30A 5F20A 1JSUA 1WBVA 1BMKA 2QLUA 3HV3A 5DIAA 4RZVA 5E8XA 5H2UA 5AUTA 4CD0A 3LOKA 2XKDA 4LFIA 1YDSE 2QNJA 4KRDA 1P14A 4OT5A 4MNEA 4G34A 3FE3A 3F7ZA 4FKIA 5LVPA 5BPYA 3WF5A 3VBQA 3P7CA 3WZDA 4HVDA 3ZCLA 4DLJA 5HU9A 3DXQA 3O8TA 3UG2A 3KK8A 3CR0A 3UP2A 4YURA 5I9YA 3P4KA 2AEGA 4CMTA 5EM7A 5CSPA 1M2QA 3TTIA 4DGGA 4U3YA 4O81A 3SV0A 4FI1A 5EHOA 1OUYA 4GMYA 2VNWA 3MJ1A 4Y5QA 3UPZA 2ITTA 3N9XA 5M06A 2J6MA 4LMNA 3DA6A 1GOLA 4EK8A 1B38A 2BHHA 5CU4A 4E4LA 2XALA 2GNJA 3SG9A 5KZIA 3IDCA 4ASDA 4CFNA 5FM2A 3F2NA 2CKEA 4ACDA 4WUAA 2P55A 4PNIA 4K2RA 4G3GA 5CTPA 1WBTA 4G3CA 4MXYA 3U54A 5C01A 1ZMWA 4KBAA 5C8NA 3THBA 5AV1A 5BVFA 4IAYA 4YJVA 2WMSA 2XNMA 3FLQA 5M55A 3V5QA 2CNVA 3W8QA 4ZY4A 2YM7A 4D0WA 5L2WA 3VRYA 1U54A 1G8SA 4DA5A 4O7RA 3DAEA 3F3WA 3OUKA 1UV5A 5DMZA 2XNBA 4H36A 4U79A 5GZ8A 4HYSA 3MFTA 3GCUA 4L46A 4WNPA 3NUAA 3KMMA 4J53A 4W9WA 1J7LA 4E26A 4QQTA 3A7JA 2VV9A 2OWBA 4MNFA 3AD5A 3E63A 5F95A 4B6LA 2ITNA 4EH4A 3DQWA 4QP6A 2R7IA 4TNDA 2HXQA 4P5ZA 1RDQE 3R8MA 4BIBA 5JQ5A 2QKRA 5BUEA 1KUTA 4PTGA 3R8ZA 2OZAA 4QDVA 2WMWA 4IIRA 1Q41A 3FZTA 4EH8A 4QMNA 3HMOA 4CGAA 2IPXA 3IOKA 3ZUUA 4E4XA 4BGHA 5HLPA 4BCKA 1PRYA 1G3NA 5A14A 2C68A 4S31A 2I40A 2B1PA 1XMLA 3R28A 4NT4A 3Q9YA 4DH7A 3TUBA 3IW8A 4RQKA 4R7BA 2GS6A 1ZRZA 5BUJA 5HNGA 3C7QA 2A19B 4J8NA 4ZTHA 4ZK5A 5EQPA 1Q97A 5GNKA 3BBWA 2O0UA 2Z7RA 3EL8A 3FLWA 4O0UA 2ZV9A 1T45A 5DVRA 4RVTA 3EL7A 4X21A 4ZTQA 4ANNA 3P79A 3HDMA 3U6JA 2XB7A 3MVLA 4JNWA 3O0GA 3FAAA 3FLNC 2B53A 4FIFA 1BKXA 1JKLA 4PPCA 4U97A 5CSHA 4BCHA 4KBCA 1KE9A 4E93A 4F7LA 5D7AA 3BQCA 1AQ1A 4FTLA 5CAOA 2BAJA 4FTTA 2PMIA 2YWVA 4MWIA 2VWBA 1FBNA 2VWYA 3RKBA 4D4VA 3FI8A 2XNOA 4O0RA 4GJ3A 3P9JA 3G5DA 4CRSA 3ODYX 5L8KA 4ZSEA 2EXCX 2J0LA 4FMQA 4EOPA 3PYYA 1YHVA 3GC0A 3MJ2A 4IZYA 4V0GB 4I22A 5A9UA 1H0WA 4JQ8A 2ITPA 5CNNA 1XHAA 4KIPA 2NP8A 4UMRA 3W0SA 5AP7A 1IRKA 3BL9A 4PMSA 4J71A 4XNEA 3MIAA 3G90X 1CKIA 5CT0A 4AXFA 2XM8A 4D4YA 5IEVA 1DI8A 2BTRA 1UU8A 3UO4A 4IX4A 3BYVA 3OBJA 4QD6A 5D12A 4RC4A 4OAUC 3V3VA 4AW0A 3F3ZA 4GK4A 1WBOA 3R7UA 5BVEA 5KMLA 3V5TA 3MTLA 5LVOA 5KKRB 3LXNA 4LL5A 4YC3A 2QI8A 2OFUA 3AMBA 4U40A 4LUDA 3N4TA 5JSMA 2VRXA 3DNDA 3ZEWA 3LZBA 3DFAA 2G9XA 3OXZA 4GEOA 3VULA 4F9YA 1JWHA 3LLAA 3RM7A 3EOCA 4B7TA 5CVHA 3QGYA 3HA6A 1RE8A 2WOTA 4AGWA 5CWZA 5GINE 5EW3A 1FVTA 4JX3A 4PMTA 3IO7A 3UVQA 4TYHA 4CTCA 2CCIA 2X9FA 3BELA 2GHMA 3R1SA 3W0OA 1REKA 4GT3A 2JDOA 5HOAA 2QOCA 4W4YA 4AF3A 3NMUF 1IG1A 2XNNA 1BUHA 3PVGA 3COKA 2ETMA 3EYHA 3GC8A 3UZTA 4JBOA 4YJQA 2GQSA 2W0JA 4JG8A 4L3LA 3AD6A 3ZYAA 1XWSA 4RG0A 2IW8A 4L3PA 1NVQA 2YWPA 4EHZA 2IW6A 4RJ7A 4YR8A 4DF3A 2CGWA 2BPMA 2QO7A 4YLKA 4K11A 3UBDA 4TN6A 2W96B 1YXUA 3KEXA 4YJPA 3VBXA 5DT4A 2Z60A 2VTHA 2PZRA 3F9NA 3QU0A 5EI8A 5K5XA 5EYDA 1ST4A 2B4SB 5IQCA 4L01A 3A7HA 5HO6A 4GKHA 5HVJA 3UIMA 5JQ8A 3D2IA 4C3FA 4UXQA 4UZHA 4XUFA 2C1BA 2VTMA 2GMXA 3F3UA 4D9UA 3LPBA 2OICA 4E7WA 3DNEA 3DT1A 5LWMA 2QOFA 2YIWA 3BYOA 3NGAA 3NLBA 4DH3A 5E8YA 5DRDA 5EM8A 5LMBA 2UZEA 3ZXTA 4O96A 3RMFA 4IB0A 3NAYA 3BE9A 4JL9A 5AR4A 4CFMA 2I7QA 4IXPA 4EL9A 4FKTA 3QALE 4O21A 2YN8A 3I5ZA 3OY1A 5ETFA 5HBHA 3ORMA 4RPVA 2OF2A 3LFFA 1GZOA 2GQGA 3HYHA 5E8VA 1T46A 4MXCA 3IW6A 4CYIA 4RIYB 2BVAA 2GNHA 1LPUA 5E92A 4GUBA 2ZDUA 4BR3A 3R7EA 4NJDA 4DG0E 5AR5A 4YP8A 1YWNA 2P4IA 2RFSA 2QONA 4JJRA 3RTPA 4BWKA 2W5HA 3ULIA 5IISA 3QQJA 3ACKA 3ENMA 4XHKB 1H1WA 1YW2A 3SXSA 3QYWA 3UC3A 2EUFB 3P7AA 5I3RA 3V5WA 1B6CB 2PZ5A 3UDTA 3ZONA 5KMMA 1H1SA 4XBRA 3Q04A 4Z55A 2XJ0A 3ZOSA 1U5RA 2RFNA 3ANQA 3TCPA 2Y4IB 4ZS4A 3EQDA 2W06A 3MPMA 2YA9A 5E90A 5I4NA 2OJIA 4QMUA 3GGFA 4I41A 2YCFA 2C3LA 3AXWA 5HU3A 3TZ9A 3U4UA 4LRKA 4UWYA 3IG7A 4FG7A 4D2WA 2VWWA 3FL5A 3PE1A 3DB8A 1FQ1B 1F0QA 2EB3A 3JY9A 4PDSA 2WTWA 2GU8A 1L3RE 4RFZA 3AC1A 4ARKA 4DDGA 2J0KA 2V7OA 3I60A 1CMKE 3AMYA 2OU7A 4QMVA 3WYYA 4CV8A 3QRJA 1R0EA 4GU9A 4M0YA 2I1MA 4RVKA 4K6ZA 3PSDA 2F2UA 4MXOA 4FF8A 1AD5A 4UYAA 4D2RA 1G8AA 2QOIA 2A1AB 4G2FA 2ITOA 4IZAA 3KXNA 4HVHA 3L9MA 2CN8A 1JKKA 3OTUA 3ORKA 4YJNA 3W2PA 3F2AA 5AP4A 3OS3A 2GNLA 3BWJA 2C47A 4FT7A 2XIZA 1XKKA 2Z7LA 4M69B 3ACJA 3TV7A 3SDJA 4EH6A 3OWPA 2UZDA 3QRKA 4CFXA 3PP0A 5J9ZA 3HL7A 1WZYA 4O4BB 1A48A 3IGOA 2BRHA 2IG7A 3MVMA 4PF4A 4JBVA 2DUVA 2UVZA 2C3KA 2XUUA 2HIWA 4BTFA 3PA3A 1VR2A 2J9MA 2UW7A 3EFJA 4C34A 3EIDA 5IEXA 5BYZA 3KULA 4W4XA 2Z7QA 4F99A 2F7ZE 2CGXA 1H00A 4AZSA 4U43A 3QX2A 4HCVA 2EVAA 2ITZA 4GKIA 1DS5A 2R3OA 1H26A 4R6VA 5CEIA 5CVFA 2BZHB 4QP3A 3PUFC 4JIKA 1H08A 4F9WA 5A6NA 3FYKX 1URWA 1SMHA 4DCEA 4ASZA 5EOLA 4IDVA 1MRYA 4FEXA 1YWRA 3Q4TA 4G6LA 2WQOA 4IB1A 4DFXE 4KWPA 3L9PA 1ZWSA 2QG5A 5L2TA 3UIUA 4ZSLA 5HIBA 3PFYA 2WXVA 2XIKA 4I4EA 1PXOA 2WMVA 2R3HA 3FWQA 4D55A 2HY81 4DH1A 4FSUA 4HYIA 4JRVA 2PVKA 4LMUA 5CX9A 1J1BA 3KVWA 1XH4A 1Y57A 5FD2A 4D1ZA 4EOJA 1H1QA 3HEGA 3Q4CA 3ZLYA 4K77A 4MYGA 3U9CA 4AZVA 3R71A 4U45A 3QHRA 1Q61A 3PSCA 4OT6A 4TWCA 5HI2A 3TNQB 4YUQA 3HV5A 4ZLOA 4I5PA 5IEYA 3N4UA 2PWLA 4M13A 3UP7A 4QMLA 2ITWA 4QMZA 3LAUA 5J8IA 2UZBA 5AV0A 3LJ1A 5BQ0A 3WARA 4JDIA 3AOXA 3ZO1A 3EFLA 2OBJA 3UNJA 3NW5A 4NCTC 5J7BA 3QBNA 3JY0A 4RIWA 2PVMA 3C5IA 3HRBA 2B9IA 4N0SA 5H8EA 3ZSIA 4PMPA 3FBVA 1PXJA 5AIKA 3R30A 2X6EA 3S2PA 1SNXA 4ACCA 1Y91A 4YO4A 2F2CB 3ZM9A 3PTGA 5HX6A 3FKLA 3KRRA 2O2UA 4L9IA 4Q5EA 1Q5KA 1Q99A 3UJGA 4FZAB 2R5TA 2AC5A 3R63A 1Z5MA 1W2DA 4FV6A 3F5PA 4NW6A 3COIA 5FXQA 4CXAA 5L8LA 2IJMA 1ZOEA 3EQPA 3KQ7A 5CT7A 3TL8A 3W2QA 3W16A 3ZZWA 4F1MA 5DBXA 3COHA 2W17A 3RINA 4YU2A 1REJA 3IONA 5BMSA 2PVHA 4D1XA 2QKWB 2OFVA 3F88A 2PMOX 4FODA 3U6IA 4DN5A 4RWKA 4ZZOA 2XYNA 4D2SA 4BB4A 1YXXA 2J0JA 4U3ZA 3PY1A 1W8CA 4FZDB 3NS9A 4GFMA 3FEGA 3NCGA 1RJBA 4G31A 2X2KA 1WVYA 2UZUE 3R9OA 4BDDA 5LXMA 3DTCA 3ZC6A 2IVUA 1L8TA 3QQFA 5BYLA 5ANKA 1JOWB 1KE5A 2OH0E 3F7WA 4DFYA 4Z7GA 2IO6A 2QOHA 3ROYA 3PRFA 1QCFA 5C1QB 4UN0C 4FV4A 4WD5A 2O65A 3IK3A 4O7TA 4OTDA 3R01A 3R1YA 3GCVA 4TY1A 5I9VA 4XCUA 3L8VA 1H1PA 5FEQA 4WBBB 2BKZA 2SRCA 4BICA 2RFDA 2V7AA 4LL0A 4KIKB 5KMJA 2IW9A 1I44A 2IZUA 3SAYA 4FEVA 1V0PA 2XJ2A 1M14A 2VU3A 4QNAA 4GT4A 4RRVA 5H3QA 4BCFA 5AM7A 5AEPA 4LV7A 5AAFA 3FZRA 3NUSA 4KBKA 5IKWA 3R9HA 2FB8A 4TRLA 4OBPA 3UZPA 3FMDA 4QMPA 4FTNA 3SX9A 3VUHA 1GAGA 5C4LA 4D5HA 3QAME 2YM4A 1GIIA 2WTJA 3D7TA 4FVPA 4RLLA 3W2OA 4PRJA 1ZYCA 4EH7A 2J0IA 4YTIA 4U9AA 4K9YA 4YJSA 4IACA 3R22A 5AX3A 3R8LA 2GTMA 3TKIA 3UOKA 4EK3A 3IW4A 4CCUA 2J5EA 4ZTSA 3C50A 3KB7A 3TNPC 1YHSA 4U80A 5HVKA 2YIRA 5AR7A 2PVLA 2R3MA 4B8LA 2UW9A 2A0CX 4ZZMA 2X6DA 4BGGA 3MH0A 4G16A 4Y8DA 4ZMEA 2VN9A 2PMNX 3GU8A 4DGMA 3RNIA 4F08A 4LDTA 3PXFA 4RX8A 3A2CA 4D5KA 2JDVA 2PUPA 5IZFA 1XO2B 2DWBA 3PVWA 5AUYA 2C0IA 2I6LA 4UMUA 1LEZA 2FH9A 3GENA 5HNBA 3CJGA 4I0RA 4IB5A 5TO8A 5LCKA 3BQRA 4O7LA 3HLLA 2ZM1A 3LFSA 4TYEA 3RPVA 1Q8UA 4O91A 4AOJA 4L42A 5H9BA 2YLFA 3NW7A 5JT2A 3FI3A 1W83A 3HAVA 5I5ZA 5KUPA 3QTIA 4AG8A 3FMEA 4EK5A 3C5UA 3D0EA 4FIJA 3O17A 5H8GA 5CF5A 2BIYA 3CS9A 5HCXA 4EQUA 4F1TA 4FIIA 2XIYA 4EOOA 4Y46A 3B8QA 3VS6A 2ZM3A 3G6GA 3D9VA 3NIZA 3OXTA 3UPXA 4XYFA 3BRBA 3PA5A 4JG6A 2VTQA 4CFWA 3JYAA 4CQGA 5CEMA 1GIHA 2ETRA 4TT7A 4ACMA 4BVUA 2XNGA 3RVGA 3MDYA 5KCVA 3UDSA 3R7IA 4XP0A 4BCNA 2WPAA 3CCNA 1E9HA 1SZMA 2HWOA 3KREA 1MQ4A 3QZIA 5AV3A 4BCGA 2O5KA 4DGLC 4DG3E 5IA2A 3G0FA 3C4ZA 4TZRA 5EW9A 5T6KA 1ZXEA 2VO7A 3VS3A 1ST0A 3C0GA 4MH7A 4WUNA 4YZ9A 5CYIA 5GJDA 3VRZA 3BU6A 3MBLA 4F1OA 3I6WA 4PDOA 4FC0A 2QHMA 4LQMA 1YXVA 1YDRE 4LV5A 3NNWA 4QO9A 4EOSA 5IPJA 3PIZA 3QUDA 3U4WA 2WZJA 5B2KA 2W5BA 3UTOA 3VS7A 4EUTA 2X2LA 3EMGA 3QWKA 4O4FA 4FK3A 3DK7A 4O1PA 3OEZA 3UGCA 4AQCA 3ORIA 2JKMA 4MF1A 5I9ZA 4P7EA 4PV0A 2IZTA 2WMUA 2ONLC 2YDIA 3BYMA 4YJUA 5AR3A 4R1VA 5ACBC 3ATTA 3OOGA 3PG3A 3P1AA 1R0PA 1Y8GA 5CS6A 5LJJA 2I0EA 3FV8A 3VUDA 5J7HA 5IQEA 3ZFXA 2WEVA 1XMMA 2BR1A 2X0PA 3A60A 1P4FA 3LIJA 4FEQA 4TW9A 4M12A 4USEA 3KKVA 3NNVA 5FGKA 2VNYA 3MTFA 2PTKA 4E6CA 5DT3A 4X2JA 4MD8E 4B99A 5EDPA 5KO1A 3LMGA 1DI9A 3CEKA 1KE7A 4I92A 4F4PA 4DBXA 2YISA 4O0TA 2R3NA 4EBWA 5HNIX 1J7IA 3POOA 2UW0A 4CFVA 5DR2A 3LQ3A 3I7BA 5BV3A 4QPSA 3ORLA 4R77A 3BLRA 3DK6A 2JKKA 4O0XA 4U44A 3QZFA 2OJFE 3D5UA 4U7ZA 4AGDA 3FQHA 4ITJA 3JVRA 4BF2A 1OPKA 4O4CA 3DB6A 3QWJA 4IH8A 4BDKA 4E8AA 3BHYA 3BX5A 4CSVA 5IG1A 3SRVB 5EQYA 3OXIA 3QD4A 4K0YA 4MTAA 4R1YA 4XV3A 1TFFA 2QG7A 4IEBA 4WRGA 1BX6A 5J95A 4H58A 4OTQA 2X39A 3KGAA 3PFQA 3BYUA 4G9RA 4RA4A 3V51A 3W33A 4AXAA 3CGOA 4FK6A 4OTRA 4PTEA 3E7VA 4BTMA 2V55A 4HVGA 3O8PA 4MAOA 2JFMA 3ZFYA 1PMEA 3CLYA 3KN5A 3B2WA 1OI9A 4GSBA 3FMMA 5HTCA 3MN3A 5IQDA 1YRPA 5CAQA 4U6RA 4CZUA 4JVGA 1XBBA 4IJPA 2QOOA 1W98A 3HX4A 2RF9A 4U41A 3UIBA 4BFMA 2ERKA 5C03A 3EH9A 4UYNA 5T68A 3V01A 4JAIA 1CKJA 4RIXB 4E6DA 4GG5A 1UWHA 3ITZA 3A8WA 3IS5A 4RJ3A 1E1VA 3SOCA 4AU8A 2CLQA 3QHWA 2B54A 3VUIA 4LGHA 4WG4A 4C33A 3NVMB 2PHKA 3W0NA 3NIEA 4X3FB 4ANMA 4BBEA 4R3PA 4S33A 3FQEA 5IA3A 1OL7A 2C3JA 3KXZA 4TYIA 5AA9A 3SW7A 4H3BA 2CNQA 3DDPA 2PZYA 3LHJA 3OCBA 3QTSA 3P08A 3AC3A 2YLEA 1TKIA 1JKTA 3MH1A 3POZA 3FPMA 4RIOA 4A06A 4HCUA 2ACXA 3ZBXA 4BZNA 1G5SA 1VYZA 5M56A 1XH8A 3BWFA 4AFEA 1ZY5A 2R0IA 4NM0A 1PKDA 4EI4A 3L8XA 3QYZA 4LOPA 3OWLA 4ZY5A 1JKSA 5KBRA 4ANQA 4RC3A 3ZSGA 5A46A 4AOIA 3NVKI 1YXTA 2UV2A 3Q2JA 1U46A 4FKSA 5KHXA 4XG2A 3PP1A 5C8KA 2HK5A 3JXWA 2CDZA 3RM6A 3ORXA 3R83A 4WA9A 1PHKA 2YJSA 3C0IA 4QMWA 3ALOA 5M4FA 4HVSA 3PJ1A 1UWJA 5K4JA 4LOQA 3H9OA 4PWNA 1OIYA 2UW3A 4RJ5A 1KWPA 4FVRA 2E9NA 1W7HA 3VS4A 3C9WA 4DEHA 2XBJA 4KSPA 4BTKA 3O5AA 4QPMA 4BI1A 3PIXA 3UYSA 3PXKA 5D11A 4X3FC 4E20A 3ZM4A 2BZKB 3V5LA 3DJ6A 3MSSA 4QP1A 4CEGA 5AUWA 4DLIA 5AAEA 2E9OA 5M53A 2BMCA 3FMNA 5F1ZA 5FXRA 2WMQA 4Q5HA 2UW4A 4IADA 1B39A 4EHVA 4TKSA 4ZMFA 3AT3A 4PQNA 4E73A 1UKHA 2OGVA 4EC9A 4FVQA 4EZ7A 2G15A 2YM3A 3HP2A 3PJ3A 4AACA 4I5HA 4F0GA 3KRWA 5IDPA 1PY5A 4WG5A 3WZJA 5HBJA 2X1NA 3TN8A 4O0YA 5JFSA 3HMIA