3QCTH

Crystal structure of the humanized apo lt3015 anti-lysophosphatidic acid antibody fab fragment
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
223
structure length
219
Chain Sequence
EVQLVQSGAEVKKPGESLKISCQAFGYGFINYLIEWIRQMPGQGLEWIGLINPGSDYTNYNENFKGQATLSADKSSSTAYLQWSSLKASDTAMYFCARRFGYYGSGNYFDYWGQGTMVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LT3015 antibody Fab fragment, heavy chain
publication title Biochemical and structural characterization of lysophosphatidic Acid binding by a humanized monoclonal antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 219
sequence length 223
ec nomenclature
pdb deposition date 2011-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qctH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qctH01
5IB4A 5C0DA 4K23L 5CZVH 3REVA 4P3DB 3ROLB 4OQTH 4HF5H 4PJHB 2VLJB 3B9DA 3QIBC 1HILA 5ELIA 2DF3A 4PRDB 2NYYD 4Y5VC 3ZZ1A 1BBJA 1A1MB 3AXLB 4E5XB 4ODWA 5JW4N 5J1SC 4YEEA 2VN7A 5JOFA 4BFIB 1KIUA 2GSGA 3L9RA 3PQYE 5BV7C 4Y16D 3BKMH 1QO3B 4QWWC 1UKQA 3CDGA 3NZ8B 3IKCB 4R7NA 2BNQA 2B5IB 4BM7A 2CD0A 3QRFM 1KPUB 1BREA 1QOKA 2O5ZH 1U8OA 1A1NB 5L0QC 4LRNH 1JV5B 2R1YA 2ICEB 3SGJA 5I66B 4ZS6C 3D39E 3QUMA 1KYOJ 3GSVA 2KQMA 5DEFB 4OKVA 3VWKA 1D9KB 1VACB 5IW6A 4I9WD 2APWA 1NANI 1WCQA 3HLAA 5K9KB 3BX7C 2XKNB 4GRWB 3ARBD 1IQWH 3ARRA 2GFBB 3D0VA 2PYFB 1I7ZA 2IALB 2APXA 4MVBC 4M8QB 1MHEA 3MGOA 4WCYL 1K4DA 3CSGA 4QF1A 1LO4H 1IFHL 3OMZA 1EO8H 3BD5A 4C56A 1SMAA 4KRPD 3GO1L 5DA4A 4D9LL 2OK0L 1L0YA 4XXCA 3NACL 1FNHA 5EO1A 4F9LC 5ICYB 5C0AA 1MHCA 2DI8A 2V9RA 4FQHA 4YUEL 3ARZA 3DIFB 3U46A 2QQLL 4BK4A 3MBED 25C8H 3KPLA 3RI5K 3WE6A 1BLNB 4HKJA 2ZPKL 2R69H 4WU5A 3UROR 2GTZA 5DJCA 4PJ8A 1FRGL 5E8PA 3ULVL 1A4JB 1WAAE 4UTAH 5J1TC 3T65B 1OD7A 3BISA 2NY4D 1FG9C 1GAFL 3MUGA 2D9CA 1ETZB 1JWUB 3O6KL 4HH8A 4OI9A 1T6VN 1AY1H 2ERJB 3FT3B 2XACC 5C0CA 1BFTA 4E41B 4AH2B 4Y7MA 1UEMA 1I9IL 5FYLD 5J12B 2EDRA 3T08A 5KVFH 1A14L 1TITA 3TEUA 2FATH 5ALBH 5FDWA 4K7FB 4PRHA 4PV9B 3KPRE 4OZIB 3S5LA 3QUML 1FZMB 2B7DT 3OXSB 5E56A 3UTPD 3JWDL 2DQTH 4Y2DC 2CDFB 5JMOC 4ZUWA 3WLBA 4PRNB 1CIUA 4KROB 4R4FH 3T3MF 3DPBA 1ZGLA 3IDIA 3HHRB 3P0GB 3DMMA 4FABL 2IG2L 2J5LC 3REWB 5JW4M 4MZ3A 1A1OB 2ED7A 2XWTB 1LO5B 3VH8G 5D1XA 1UXSB 4FQ1L 3WUZA 3QDMB 4NIKB 2YPLE 5BZWA 4BZYA 1L9NA 5J3HD 3SDYH 4KY1H 1S5IH 5IEKB 4E0RA 5KS9E 1EMTL 5F1NB 1T03L 2P5EE 1GGYA 4DZ8B 3GSXB 3NCYP 5D2NE 3W39A 1U3HC 5E9DE 5KZCB 5DR5L 4GBXD 3RUGB 1KN4L 5EIQA 3T2PA 4WI5A 5EA0H 5B38A 2W60A 1FAKT 4X4MA 3LZFH 1ORSA 4K9EC 1G9EA 3CX5J 4F2MB 1YQ2A 5DDHB 1FHGA 2FJHB 4IRJA 5IVOA 1MF2L 1I8LC 1MVUA 3FQTB 1MAJA 1G7JA 2WLYA 2OJEA 4FXGB 4QKXB 4NKDB 1WBZA 4UOW1 2VNCA 4PGDA 2FB4H 2NY1D 3L7EB 3VXMA 3KDMA 2EZ0D 2H26A 4KK8D 2ZCHH 3MNZA 4LSRL 4LCUB 5HI4D 1QSFB 1T21A 4GAGH 4R0LB 2YPVL 1A3LH 4PV8A 4M61A 4NWUL 2YUXA 2FECI 2P8PB 4APQB 3JTTB 2W0FA 4PJBF 4QHLA 4WI3A 5M94B 4ZXBC 3AROA 1FDLL 3HZYB 2YN3A 3MCLL 4XMPL 2XV6B 2D7OA 4E42A 5F9OH 1GC1C 1XIWA 3RVTD 3RZCB 3MFFB 5D1QA 1JYWA 3MLUL 1BAFH 3QEQA 3ULUC 1MRFL 2P7TA 4I1NB 1FAIL 4PG2C 1DFBL 2C4XA 3TLRA 3FQXA 2MFNA 1KC5L 5D7LB 3HE7A 2YKLL 3IDMB 5IK3A 5CINL 3VRIB 2P24B 2FNBA 4MA8L 4M7ZC 5BS0A 5ILTL 3F7YA 1L0QA 2J6EA 2OSLA 2GJ6D 1HYRC 3THMH 2PTTA 4U6YA 3IF1A 4RCAA 1YEIL 1OF2B 1KPRA 1I9JH 4RWYH 3BZDA 4NUGL 3ZE2E 5F7EH 5L6YL 1E4XL 3DVIA 3I75A 3PWVA 4GW4A 5CILL 1KB5B 4FXKA 2O5YH 3C9NB 1DVFB 1EFXD 1L0XA 3QDJB 1QLEL 3O3AB 3EFDH 4NC2B 3KLHD 4N5EC 1DJSA 3EOTH 5IQ9B 1FL3B 1F3RB 1V7ML 3NN8A 1NFDF 1RJYA 2BY2A 3JWNC 3UDWA 2HMID 4G6JL 1ODAA 1CZ8H 2K1MA 1YMMD 5J9PA 5GJTH 2EDQA 3RVXC 4UILH 1OLLA 4MWFA 4AEIH 4LSTL 4PR5B 1INEL 2BRRH 3FFCA 2Y7QA 1A22B 4ZNCD 3VD9A 3S4SA 4PJAE 5HHNA 4K8RC 5ETUB 1AGFA 5D4QA 5F21B 5F3HA 3MXVL 4ZS7L 4O2EB 4DCQA 5HHQB 3I50H 4ZOEA 5M7QA 4L4VA 4R8WL 4X5WB 1AHWB 1E28B 4Y4KB 3RVUD 4PJDA 4AMKH 3GKWL 4PJHF 3P3YA 2OZ4H 3DECA 1NAMB 1EHAA 1D5MB 2D0FA 1KEML 4AG4L 3BWAB 3OKLA 1R5IB 2IGFH 4NJAH 2I24N 4NGHH 3R4DA 4YQXH 4OCWL 5KSBA 4PRPB 2DQIH 5DRZA 1AO7D 3PDOB 2X1XR 3LRGA 1TQCB 1RULH 4V1DA 1SEBA 1GCFA 4HPOL 3RKDC 1WT5A 4KK5C 3RY5A 3WIHL 1LO3H 5AYUL 1CFBA 5GSVB 1QR1B 1CCZA 3IYLW 5DJ6B 3U7WH 4D0CA 3E3QC 4IEFB 1ZLVK 3DYMA 4DKFH 3MV8A 4OM0H 1FV1A 5TE6L 1XCTA 3EBAA 4AY0A 5I1DB 2ITCA 3R0MA 3ULVD 3EDDA 3MJGX 4LU5L 1UM6L 1FCGA 3QAZC 3B3IB 3O45B 1KJ2B 3RGHA 2DOCA 2ADJB 4QHKJ 1IEAB 1WFOA 1CDYA 1ROWA 1XR8B 4KK6D 2OX5A 4RDQG 3TC9A 3TVMA 2BNQD 5DUBA 3CXDL 3MBEC 1JK8A 3WIFB 5TE7H 2MHAB 5F9AC 1YUHA 2NY2D 2Q86B 4P3CL 4PJ7F 5F7HA 2YBRB 1UWXK 3VWKD 1UQSA 1I7UA 3ES6A 2F5BH 4X4YA 1PKQE 3MJ8B 1NGZA 4YGVA 1DLFL 5IT2L 4XX1G 1E6OL 3GKZA 3FB7A 3S35L 3MRHA 4ELMA 1NMAL 4ZUUA 5JNYA 4XC3H 4YR6B 3PDGA 1ZHLA 1GGBH 3FT2A 3WV0A 1J0ZA 4LBEB 4MJID 5GQBA 3H0TA 1SJEA 3O4LE 4MCYB 4C56D 3MRQB 1J0KA 4X8JA 3GSWB 1XF2B 4HUKB 5KVGH 4C55A 1AC6A 1GOFA 2XZQL 2KKQA 5C0AD 3QXTA 3KYNA 4OQ1A 2Y36H 4WUKL 5JHLL 3B2UC 4U49A 4EI5A 2I9TA 1MCPL 4QHMB 4LMQE 5IHLB 5KVDL 3K80A 1J05A 2EXWD 3OXRA 4EOWL 4PGJA 4OSUL 2UZYB 3JV4A 4PJ8D 2P42B 1U93B 4OV5A 4P5TB 3FRUB 4PJ9A 3BO8B 3RTQC 1ZSDB 2FD6L 3RKPA 1F4YH 3RHWK 2NR6C 1XT5A 3IT8D 4OGZA 5FUZL 5GPRA 3BMVA 5C0CD 2Y72A 4GUPB 4YPJA 3OKMA 4J3SA 3T2NL 4FQXB 1I75A 2LU3A 5FA3B 5IOPA 1YEHL 2Z91B 1IGJA 4XP9H 1MH5A 1IAOA 4FG6C 1KIPA 1NCTA 4ERSL 4HS6B 1F13A 4PRHD 4FQCL 3N1FC 5IEHB 4QY8B 2OLDA 3X3FL 5IWLC 3FOLA 3KXFA 3DX8B 1IZJA 2R2BB 3S88H 1VERA 1X7QA 1HI6B 5DGRA 1JZ3A 2X05A 4KAQL 3WKMH 1AI1H 5F8QC 4WW2F 3DMMD 5KSVB 3RUGF 4MCZB 3C6LA 1BQHG 1FFNA 5D1XD 1JPTL 4AM0A 4P23A 3OZ9H 2Q6WA 1TJGH 2QR0B 4UINH 2OL3B 3CU1A 2R39A 1Q9KA 4JRYA 2L7JA 3QWQB 4JO2H 1FGNL 3JUZA 4YDLC 1V7NH 4KTEH 4MAYA 3IFNL 1MWAH 5H37H 3GGWA 4Z0XB 3L3GB 4CRPA 4G8GB 5CMAB 1F6LL 2VC2H 3WS6C 3NCYS 4MB3A 5IM7A 5L2JA 5HGAA 3RVTC 1N8ZA 2BVYA 4UDUB 3VFWA 1RZ7L 5EO0A 4EDWL 4H26B 2DBJA 4IRJD 1U2HA 2Z8VC 3O2DH 5FIEA 4LAJH 5EU5A 4HPYL 1M05B 3WFEH 5BMFL 4MAUH 4KHTH 4ODXA 1YZZA 4PLNC 1QQDA 1UCBH 3WS3B 4F57H 1T66D 3VXSA 3N9GL 5H2BA 4KI5F 1NFKA 4BQCA 1JF1B 3FQRB 4JM2C 3RWFB 1YECL 3U7AA 4L9DA 2IAND 3MRCA 3U7YH 4NRYA 5E5RB 4XVSL 5EZIH 3SDCB 1XGPA 2N7AA 2VYRE 3FZUC 5SX4H 5FYJL 5E00A 4F7TA 4C4KO 2VRAA 1RZ8B 2H9GB 3SE3A 2ZUQB 1M7DA 1OLZA 2D31A 3CX2A 4HK3J 5TGBB 1CS6A 1S7SA 2Y06L 1BEYH 5BW7A 1PX3A 4UT9L 1QFOA 2Z31D 2XN9E 4J1UA 1BZQK 4HCRH 5D1QD 4MX7A 5DHYA 4YFLI 3IFLH 4WUUA 5I8OH 3QEQD 5DT1H 3UMTA 3KLHC 1CLOH 1GIGH 1T1YB 4YHIB 4L8DA 1MFCL 2GIYA 4U6HA 1JUFA 5HYSB 2OXGA 2HMIC 3C2AL 1U92A 3VRJB 5D6DC 1KFAH 1T7YA 5HHPB 4NSKB 1NMCC 5ICXA 1HEZB 3CLEL 3PL6D 5MHSE 1I3UA 4MA3B 1M7IB 1BX2B 5D7SH 5HPOA 3VXQB 2AKRB 4NKOA 1JWSA 1DDHB 4PJGE 5CZXD 1N64L 3VDCA 4DGIL 4EKXA 3RPIA 5BS0D 1DL7L 3MLTA 4P9MH 3HE6B 4DJMA 3MACL 1WFTA 5EZLA 4XMKL 4LHJB 4M4PA 3RU8H 1A6VH 3HI6L 4XI5C 3MGTB 3R1GL 2MCPH 2NXZD 4LSPL 1QSEE 2Q76B 5DFVD 4FFVC 3N0PB 2I27N 2OCFD 3OKNA 4UTBH 2OR9H 2GTWB 1OT2A 1CLZL 3BXNB 1IC4H 1J8KA 4M7JH 4JFEB 5I15H 2DTMH 2ZSVA 4R4BB 4PRBB 2VLJA 2HKHL 4F15C 2YWYA 5IVZA 4ZNEE 2WINA 3IU4L 4PRDA 1D5ZB 4NKMB 3AXLA 3RWIA 1J0YA 1WICA 2VLRE 3HS0B 5DD3H 4IRSA 5SWSB 3CLFH 5B39A 2WBJC 3FB6B 3ZL4L 3AVEA 3CX5K 1YEDA 3FO9B 2C26A 3FFCD 2VXTL 4ISVA 2FX9H 3TIEB 1Q9WB 1OAUL 2Y1VA 5FECA 3DGGA 1GVIA 3C87A 3T0EE 4U0RB 4DQOL 2MQCA 3H9SB 2HG5B 5DJ2B 1HOCA 3OHXB 1MFAH 4OBSA 5ESAA 4KK6C 1I85A 1JV5A 1NDMB 2ICEA 3JWOL 4TN9A 5DHXB 2RGSA 2ICWA 2MKLC 3EFFB 3LQAC 3VGGA 5GGSB 1BQSA 5DEFA 1I4FA 3O81A 4QRTB 4S1DC 2EEBA 4C58B 1U58A 1MFEL 4JFYA 1SBSH 4Y5XB 2R15A 4V1DD 4X5LA 3QIWD 4HUVA 4ZPVB 2DLTA 4RGMB 4N8VG 3U0PB 2NY3B 4KRNA 3ZKND 3P11H 1X44A 4A6YB 2BNRE 3GIZH 3DXAB 3TNNB 4HH9B 1M1SA 3BPLB 4M8QA 4GKSB 4OLUH 1FPTL 1J8HB 4YE4H 4KV5F 1HHGA 2VSCA 2H8PA 2IPTH 3B9KA 3O6FC 1DP0A 1X6NA 4OBRA 3MV8D 5EU7C 4H5SB 2OMNA 4X83A 3AAZA 3UJTH 4NBXB 2JJWA 5ICYA 3E6FA 2R0LL 3S6CA 5EN2B 1FIEA 4BKLB 4HHAA 3TVMD 2BSSB 1DUZA 1U3YA 1BVLB 3WNMA 3C8DA 2NXYB 1A21A 4XBEH 5E2WH 5AZ2H 3GUTB 1C08B 5HD8C 1KJ3H 1TVHB 3OKEA 2EYSB 3T65A 3BH8B 3KYMB 4EN3C 1EJ6A 3BPCB 1Q0XL 3WXVL 7CGTA 3DHMA 2ADIA 4LSSH 4AH2A 2XTJB 3TZVD 3V4UL 5T3ZD 5FYKL 3SGDI 4RAUB 4LVNB 4X6CA 4OZIA 1RIVL 1VENA 4JRXE 3OXSA 1T5XB 2W07A 3W9DA 3GDBA 3NBNA 1IC1A 1C5BH 5D2LB 3ROOA 5FXCH 2RBLA 4OLXH 3SGKC 4OFYA 1DQLL 4JY4B 1N0LA 1S9WA 2HVJB 4HC1H 3REWA 4ALAL 2XWTA 3JSSA 3C8KB 4LSQL 4ORZC 1Q0YH 4NRXB 4KHXL 1UXSA 3QFJE 4RGND 4EI5D 2VDOL 4W6XB 5DS8B 3ARFC 1C8PA 1KCKA 3PIQB 2B20A 4NN7C 4P46B 4JG1H 5IHUL 5F1NA 2A2QT 1PQZA 2BRQA 4HWNA 2CQVA 3RNKB 4ZFGL 4CKVX 4Z5RB 4NO0D 4PJ9D 2WLZA 3UTTB 4XNZC 5EU4A 1YY8A 4Z8FH 2AI0H 5EO9B 1FN4A 2FIKA 1CGVA 3V0VA 1E4KA 4JM4L 4OZFA 4HQQL 2I26N 4J12A 5DDHA 5ESVB 4YXHL 3FQTA 4TQEL 2FHBA 4NKDA 1HNGA 1LEGB 1JNHA 1TLKA 1PD6A 2P43B 4PYGA 3KXFD 5HDBE 5MP6H 4M6NH 5IJVA 4XCNB 3VFRB 5DTFA 1T66C 1FVDB 3RVVD 1AQKL 3RL1B 2CR6A 4MDJB 2ZCLL 1NUDA 2FJFB 4RMWA 3LS5L 12E8H 3C6LD 2FX7H 1I3VA 2FBJL 2P8PA 4P23D 1EEZB 1YPZB 4KPHL 4MQ7B 1IKFH 3AB0B 4JRYD 5GS0H 2R1WA 1FLRL 3SCMB 5KSAC 4Y5YB 4OZ4B 1QLRB 4MAYD 3HZYA 1VFOA 2E3VA 3AREB 3D3VE 2E9JA 4NO2A 3DVFA 3BGMB 4UDTA 4G6MH 2VR9A 1T2XA 3B9EA 4MZ2A 4TRPH 3O9WC 4G3YH 4ONOA 4JAMB 4HUUA 5TDOA 3HAEG 4QCIB 4YO0A 2OR7A 1IVLA 3IDJB 3EJJX 3KPNB 1JNNH 3KLAB 1FZKB 1E4WH 3SDDA 4JG0H 3BEVB 1FORL 2MTPA 3HZKA 3TA3B 4PP2A 3VRIA 3W9EB 2HFFB 4H8WC 4LCYB 5ACLA 4Q74A 4DUWA 3PL6C 2FWOA 2BOBB 3PV6B 1P9MC 4KQ4H 1EBAA 1P1ZB 2DQCL 4X4XA 1MCNA 3G6AB 1HINH 1DSFL 2LQRA 1OF2A 3IDNB 3GMRB 3LKSB 4RRPG 5MEPB 1SJHA 1UA6L 5I30L 5HVFB 2ENSA 1H3PL 2JE8A 1OAYL 3L1OL 1CXEA 5T1LB 3TO4A 4I2XB 5TDNA 1A7OL 3O4OB 2Z35A 4P5KB 4N0YL 3VXTB 3ARGB 2RFXB 4GRLC 4YBQC 4FQ2L 3O3AA 1BQLL 1TTFA 5T5NF 1A5FL 3EO9L 4WUUD 1FL3A 3EZ8A 2A74A 3CFJA 2ID5A 3IGAB 3GHEL 2YA2A 3IETA 3NPSC 4QHKI 1PZUB 4J4PA 4HXBH 4JFDE 2P49B 2UZIL 4JY5L 5FO9A 3VWJA 2I9LB 1IAMA 4PY7A 2UZXB 5E99H 1NC2A 2WNGA 2W65B 1HWGB 4UIKL 2MOVA 4XWGL 3KPSB 1E28A 1A4KB 5CEYB 1BJMA 1ZGLP 5HHVL 3QBTB 1CD0A 4YK4C 1NAMA 5C8JB 1TFHA 1ES0A 4DW2L 2Q1EA 3PWPB 3BWAA 4OGYL 3SJVB 2Y07L 1U36A 4XP5L 2FDBP 2PN5A 3DETD 3LD8B 4JFZH 4PRPA 4JEGB 4S1SL 3O8XC 1ADQA 1TJIL 1T2JA 3GB7B 4WW1A 4X99B 4F7EB 1BECA 2IMMA 5GSVA 4Y19A 2VLJD 1X5LA 3U4BL 5I18H 4LDOB 3QR2A 4QEGA 3B43A 3H9HB 5F7FA 3DTXB 3LB6D 3RY6A 3CDFA 1EVTC 3CH8A 4QXWA 4XC1H 4JO3L 3MNVB 5FKAA 2CRYA 5MENE 1TJHL 1EVUA 2VABB 4XNUH 2EE2A 5A16B 5BV7H 4GKOA 1P53A 3B3IA 43C9B 5EU6B 1UZ6E 3TN0B 3VFUB 1DQQA 3V6BR 2KQNA 3QDGB 3MJ7B 4KVNL 1G9MC 1G7LB 3T4AB 1OWRM 3RGVB 3BW9B 5TDPA 5CEZL 3V6ZA 2Q86A 1MCKA 2OI9C 3D9AH 1MREL 2FJGB 4P9HL 4LEOA 3LEYH 2Z92A 1QBLL 3MREB 3RWJA 3V6OA 4F9PA 4MLIA 2NTFA 5J1AA 4K94L 4P4KC 2ZNXA 1C5CH 4NJ9L 1DZBA 1IGCL 2AS5M 3EGSB 3F5WA 1I9RL 2EYRA 1F4WL 1F2QA 3QUZC 2HFGH 5BXFB 3VD5A 5AEAA 4BFBD 4LBEA 3B9KD 2KZ1B 3NIFF 4K7PH 5JW3H 1VFMA 3GJFB 4LAQL 1ADQL 4QXTA 1TTUA 4RQQA 5I8EB 4Q0XH 1EEYB 2WSKA 1R3HA 1A7QL 2VZVA 4NQVB 2C3GA 1WLHA 2PUQT 1AGCB 1MCDA 5LAXA 1RV6X 5IUSA 2DWDB 4QHMA 3ZKMC 4NZUL 1MJUH 4TTDD 1JHLH 4P2CG 4XBPA 3RP1A 4RGNC 4I0PC 5EIIA 2BSED 2X70B 3MROB 3MR9A 4FFZL 1CFTB 2AJVL 3GBNL 3QWOB 3MV7B 1OCWL 3QQ4B 2OJZH 3BO8A 1MRCL 2ESVB 1WZLA 5I1LB 2NPLX 1ZSDA 1JMXA 1MCWM 4NHUB 4OAWB 5JTWA 3DURB 1LMKA 1L7TH 5D2LF 5GIRA 5DEGB 3HC0B 1RVFL 3D5OF 4FQXA 2I5YL 2K3TA 4K3JH 4OB5L 5HI5C 4M5ZH 5FA3A 3MX0A 3BAEH 2NX5B 3E1F1 2R23B 2Z8WC 1RUPL 5C09B 4QGTA 2AK1L 5DWUH 1RURL 5IMOB 3INUH 4HS6A 5I1KH 5TQ0L 3IAGC 3P4NB 3Q1SL 4GKZB 4JHAH 1JHTB 5EH1A 4J7RA 1HHKB 5GJSH 5DMKB 3DX8A 3ARYA 3BP5A 4IRZH 3U2SB 4DGYH 4OZGB 4OFYD 4DZBB 4C54A 1G9NC 2DYPA 1UZ8A 2YPLA 4L4TB 3CK0L 2APBA 2LAAA 2Q8BH 4BFGA 4QRRE 5C2BL 4KUCF 1YYML 5DD0H 2OL3A 2BSRA 4KKLC 4MS8C 3QDMD 5D5MA 5JHDE 1J5OH 4AL8H 3MRPA 3TH3T 3P9MB 4OQTA 1A7NL 4NM8L 3ZDXF 3FAXA 5F89A 2CH8A 3VMPA 5JLZB 4Z0XA 4WDIB 4WNQA 5KN5A 4LPWA 1OQOA 2FL5A 4PPTA 3QFDA 3WNOA 4UDUA 2J4WH 1RUAL 5CIPH 3MRBB 1CLYH 2A0LC 2XKUA 2Q8AH 4K9EH 5EZOH 1JPFA 4NBZB 1KCUL 1FIGH 4OZHB 2HJFA 5GXBB 2P4AB 4PJEE 2NTSP 1A7RL 5D93C 1F4XL 5FV2A 1M05A 4N9OB 1MRDH 1N4XL 4YDVA 4ZTOH 4LNRA 2BSTA 2HT3C 2DM7A 1ZLVH 1I7TB 2AV1B 2AJSL 3WO3B 5I9QB 4XB7A 3GSRB 1T22B 5I17A 4RFOL 4XPGL 2X40A 4UQ2B 4ZQKA 4APQD 3SDXB 4TUJB 1WWCA 2B0SH 5EUKB 1RZ8A 2H9GA 1LILA 3WFCH 1A3RL 3BQUB 3Q6FB 4U1SA 1GC1H 1NCBH 3GZKA 5MEOB 1KLGB 4X7CC 3SO3C 4I0KA 2YMXL 3KYKH 1UWXH 1UM4H 2DS4A 3QUYB 4KKAC 4L9LA 5JDSA 4QXUH 1BD2B 2X4SA 3IJHB 4F3FA 5CZVL 5HGBA 3BUTA 4HF5L 4OQTL 4YHIA 5KVEH 3GMPB 3O3DB 4LVOC 4PJ5B 5IJKA 2HN7A 1P2CA 1FFPB 5HHPA 4NSKA 1HEZA 3QULA 4DVRL 4ZO9A 2FLRT 3GI9H 2ORBH 4MA3A 4WI4A 1BX2A 2HJLB 1FZJB 5B4MD 2EC8A 4Y1AE 5TJWK 4WEBH 3VXQA 3HFMH 5FGBA 1DDHA 1YN6B 2CIKB 5BOZG 2D7TH 1MIEL 4OD2B 5HXMA 3HE6A 1ZVHA 2OBGA 1UVQB 2Q7YB 1IC5H 4UV7H 3IRZA 5ESQA 3RVWC 3PWLA 1VFAB 3GFUA 5DVMA 3MGTA 3WHXA 5ID0A 2VERN 2WBKA 2O5ZL 3BZ4B 1J1OH 2DLFH 2JCCA 4LPUA 4LRNL 1NUNB 4G43A 2GTWA 3C2SA 1NL0H 3TO4D 2OQJA 1VESA 4IIQC 1ZT1B 3PHOB 4M93B 4HUNB 1DVFD 1AJ7H 4WFHD 3MV01 1I1RA 3PGCA 4R4BA 5I75B 4XBGB 2R9HC 5DQ9A 4NKMA 2JLLA 4AQOA 5CEZD 1NGQL 1IQWL 1HHJB 3FCTA 3HS0A 1D5BA 1FO0B 4PJAA 3FB6A 4CNIB 3HB3C 3BKJH 3OTTA 4R90H 4R9HA 4XNQA 1X5FA 5T1KA 2JIXA 1LO4L 4WWID 2JJTA 1XGQB 2HFEB 3VW3H 1EO8L 1WVZA 4K8RH 1Q9WA 1NC2D 3HMXH 2XTLA 5IHZB 1JF6A 3UAJD 3F8UB 5DJ2A 1FNSH 1RK0B 4NP4L 4FFWC 2UUDK 5IB2A 4PJXB 3LHPH 3HRZA 4NQEE 3ZYIA 2GQHA 25C8L 3EFFA 5GGSA 1I8KB 4GG6A 2R69L 4QRTA 2DQUH 1E0OB 4PRPD 3LKOB 1P84J 1MAKA 1HZHL 5CS7A 3VFVA 3P30H 3VD7A 1PEWA 4UTAL 1D9KC 4ZPVA 1A02N 2NY5C 2X4RA 1J1PH 3TNNA 3RAJH 1RZJC 1T0MA 4Y19D 1AY1L 4G9FB 4GKSA 3DJ9A 3DRQB 5I6XB 4MHHG 3G6JE 3DUUB 1ACYH 5HYIA 4HGWA 3DO7B 1ED3A 5KVFL 4LQFH 1S7VA 1DBJL 1JPGB 2FATL 5ALBL 4D9RE 4UT7H 5TQ2H 3VGDA 3EYVB 5IFAL 4WWKC 3HR5B 3LAFA 1BJ8A 2J8UB 3LEVH 3ZKXB 3VI3E 1W8OA 2VQTA 3TO2B 1J9CT 4R4FL 2YD6A 4JDZB 2BSSA 1VADB 4QLRA 2V5MA 2EDBA 5IFJB 4KK9D 3B2VL 5IVXE 3BKYL 1A6PA 4D9QD 3PABA 1C08A 4LCCB 2G9HB 3M45A 1MVFA 4KWUA 4CJ1A 4LKXB 4KY1L 1S5IL 4G7YH 4LF3A 5IMKB 4ORGA 3TWCH 3MQIA 4G8IB 3TPUA 4OGAD 2A6DB 3DARA 3S96A 5AYQA 4JZJB 4ZMAT 3SKMA 2WK2A 2BDNH 1F6AA 5I71C 2ERJC 3ZDZF 1ZVSA 3EKCA 5DK2B 3RQ3A 1MFBH 5EA0L 1XGTB 1TVBB 1Q9OA 3O4LA 2X9YA 4RAUA 4YHPB 4M1DL 3LZFL 5J12C 5FGRA 5FYLH 1X5ZA 3VXRB 5FCSH 3X13A 1T3FA 32C2B 4FTVE 4FMFA 5CSBA 5JZ7C 5LKNA 1AKJB 4MXQD 4L8SA 2HVJA 4BUGA 4LLWA 2FB4L 5FO7B 3WEXA 4KROC 4LOUC 4JFFE 4EXPX 3MV9B 4BZ2L 1SQ2N 5DS8A 4HIXH 4FP8H 3VXNB 3GSQA 5T1MB 5GISH 1LP9A 5D8JH 2W92A 5DYOA 5DZLA 4W81A 2QSTA 4DAGH 4JQVA 4WO4B 4X98A 3UTTA 1HDMA 5EO9A 2F9BT 4EIGB 2UY7A 4WW2C 5F9OL 4JE4B 1U8JA 1QFUH 4FQXD 5A40E 2RCSH 1BAFL 4XPBH 5ESVA 2E7LA 5L2KB 2B4CH 1PLGH 3LPGA 4LEXL 1I1CA 3MGAA 3ZTNH 1NCUA 3V0WH 3MPCA 3VE0B 1KUMA 3G5XA 3Q48A 3LKRA 2OZ4A 3WKNA 2PXYB 4NUJB 1JZ2A 1RJZA 2HTKC 1KBGL 3D39B 2N56A 5GZOC 1NQBA 3DX6B 1VKXB 5CP7B 1FVDA 1M6OB 2XZCH 2BNUA 2DYPD 3C5ZB 3RL1A 4D3CH 5DHVH 1IKNC 4NQUA 4R0LC 4J3UA 4MQ7A 3TBVB 1XF4A 4OZ4A 5IROC 1Q72H 3THML 5FO8B 4LP5A 4I9WE 5E8NB 4RFEB 5JORA 2VL4A 1LNUA 1OSZB 3SGDH 5LGJA 1I9JL 4M3KB 4OLWH 4RWYL 4KI5C 4HT1L 1WZMA 4MJ5B 4IOSD 2IPUG 3RZCC 4Z7QE 3MXWH 1JF5A 2AQ3A 4FQJL 5K59F 3S5LG 5BV7B 3IDJA 3EDKA 2EDWA 4P2QB 2FSEB 3X11A 3EFDL 3KLAA 4YHKL 1J12A 3GMMB 1FZKA 1OP3K 1FVCB 3MSPA 3K74B 3QG6B 1Q38A 2ZJSL 3BEVA 3C5SA 4UU9A 2QADB 3SDXF 1CZ8L 3OQ3B 5CD3A 3DX9B 3RDTA 5GJTL 1MCEA 2FX8L 1ITCA 5L0QB 5T5NG 2VXUL 2BRRL 3VFTA 3BRGC 2OP4L 4MA1C 5IBTH 1G6RH 5DI8B 2BOBA 5CBAB 3PV6A 4O5LH 4AT6B 4M43H 1P1ZA 2R2EB 3ZSTA 2PO6A 1ND0B 4WHYH 1YNLH 2BX5A 1CFSB 3B6SA 3HZMB 4KTDH 3ZHKA 2WWMC 5AZEH 1AR1D 3VFPB 3OGCB 2D9QB 4PS4H 1AQDB 1K4CB 4U1LB 1FSKB 2OZ4L 4I2XA 4ZUVB 5B38G 2NW3B 3KPRB 3S3PA 2IGFL 5FM5M 3LEXA 4YQXL 5F6HJ 2DQIL 2EKSA 4HZAA 3QPQC 1F97A 5FYLE 1DVFC 1K3IA 1U95B 5EZJA 3BFOA 3UO1H 1LO3L 5I1GL 5IGXH 3UTPE 3BH9B 3H7BB 1A9EA 2PR4L 1C5DA 1RFDH 2WBWB 4O9HH 4OLYH 4HAFA 3PXHA 1KV3A 1J0HA 4PJGA 4Z7WE 2BVEA 2WMPA 2ZUSA 3RA7H 5KS9B 5C9JB 1DEDA 5DUPH 4DKFL 2X41A 4YHOL 3DV4B 3FB5A 4KRMB 3KS0J 4MSWA 5D2NB 5E9DB 4XCFH 4QRQA 5IESH 4MNQA 3OX8B 1L6XA 2DB8A 1EXUB 5HHMD 3HE6D 2B2XH 5CEYA 5KAQG 3T2QA 2CLZA 1BZ9A 4XZUA 3SOBH 1AHWC 4LRIA 2H3NB 1R6VA 4Y4KC 4YHLH 2XT1B 1HIMH 4JLRA 2W0KA 4ONFH 1CFNB 3F7VB 4X6FA 3NFPB 4KJQD 4Q6IB 5TE7L 5TPWL 2D7MA 3H2WA 2HT2C 4W4NA 2X6MA 2L4OA 3CXHJ 4CMMB 5C0BB 3GB7A 1KPVB 1ZANH 2HJKB 5CSZA 1A6UH 4RA0C 3BP4B 2F5BL 3NZHL 4XH2B 4I3SH 1MHPL 3QEHA 2VN4A 3H9HA 5SWSD 1AFVH 4XC3L 3LQMA 1C1EL 5GGRB 3MNVA 1GGBL 5FHAH 4PRAA 5F3BA 5CBEB 1MY5A 1HCFX 1H15A 2VABA 5T1KD 3T0EA 2JIXD 1XGYL 1CL7I 2YRPA 1LHZA 1Z3GH 43C9A 3TN0A 5MI0B 3VFUA 5SWZB 1MWAA 2W0LA 4IMKA 4YHNA 1QBAA 1U3HB 3T4AA 5J6GB 2UWEE 2R0KH 3Q5YA 2CLVA 3AU1B 5KVGL 2VB5A 3W11C 5L8LB 2Y36L 5IBLD 2VKXA 4I8DA 1OD9A 1M71A 5EWIH 2WAHA 4X8XA 1JBJA 4U6XB 5T33H 1I3RA 4GFTB 3TESA 3O3EA 1G7HA 1IM9B 3N1GC 5FB8B 3LQAH 1CFVL 2EE6A 3CAFA 2DJ4A 3K8MA 4JR9H 4GAYB 4TYUA 2ZG1A 3MRJB 4YNYB 5BVJA 1LVEA 1NH6A 3O2DA 4GSDL 4Q9QH 5B8CC 4OUUA 4XHJC 1W8NA 1YQVH 2FIRT 1RQ5A 4OGAC 2NY3D 1DLHA 1NEZB 1XGUB 2CDGA 1SHMA 2J8UF 3S34H 3DXAD 1CGSH 1IGIL 3U30B 5ENWA 3WL9B 1FJ1B 5BXFA 1CT8A 3QNZB 3P77A 3C8HA 5L88H 2CUMA 4U1JA 4XP9L 2E6JA 3GBLA 3OJ2C 4PJIB 2ZUWA 1XGRA 1OGAB 3B83A 4TPRL 5IB5A 2FHFA 3GSOB 5AWNH 3CVIH 3HUJB 1EEYA 3X14B 4NQVA 1U8MB 2V7HB 4EDXB 5JXED 1WUNT 2H2PD 3S88L 2DWDA 4X9HA 5F6IB 4OUOA 3WKML 2GJ6E 4IHOB 1AI1L 4PUBH 2A6IB 2ZOKB 3OJDA 1INQA 3ARSA 4HCRA 2Q3AA 3EYFB 3GMLB 2YK1L 2NXYD 1DBMH 4UINL 3RJDA 3L5WB 3QWOA 5E4EB 1NBZB 5GGVY 3DRTB 5DJXB 4U1NB 1U6AH 5I1LA 5ERWA 4P5TC 2IC2A 1MWAL 4J3VA 4XCCH 4RISH 4ONHA 4HG4J 3CSYA 4EQ2A 2VC2L 5DEZA 1P7HL 2X9WA 3QO0B 2X4QB 1M7XA 1Q8MA 2DQHH 1RUMH 1YMME 3HPLB 3TJHC 4M7ZB 1FC2D 1T2QH 3FN0H 3P4NA 2WW8A 4EUPH 4O00A 1HHKA 1YMHA 3SE4A 1XF3B 4PLKD 2YXFA 4RFNB 4IOFD 4OCXH 4JFXB 3CDCA 3QFJA 1LO0H 3NFSH 4U7SA 3CFBB 3WFEL 5I2IA 5HHOB 1UCBL 4F57L 1NC4B 3L95A 3SY0B 3WCYA 4AIXA 1R0AH 3AGVA 1ZS8B 4GRMB 3O41B 2Q87A 2F5AH 2WQRA 4LLMA 4YHZH 5FAAA 3U7YL 4MB5A 3LDBB 3OKKB 3WDIA 3CNKA 1AO7E 3EYSH 2G60H 3WIIH 5ID1A 4YHMH 5HYJB 4KJPD 1XR9B 4LHUB 3UTTD 3OAUH 1ZAGA 1BEYL 2IAMC 3G5ZB 5DZOA 3QRGH 1GOHA 4U1GC 3U0WL 1JJUA 1QBBA 2CUHA 2PW2B 4ZAKB 3IFLL 1VB9A 4OM1H 4OZHA 3STLB 5DT1L 4ZOCA 1CLOL 1GIGL 2W9EH 3ULVE 4G6AC 3FO1B 5F1IA 4L3EB 2RHEA 4L4JA 1KFAL 3GHBH 1NGXB 4HUMB 1JCKA 1T1XA 4H1LH 5L7XH 1JZ7A 4HIJB 2VLKA 5IG7B 3EOYG 3NTCH 4YXLH 5D7SL 3FMGH 3GSRA 5FFLA 2YPKB 1NLBL 1TCRA 1T22A 1U8HB 5J89A 1X5YA 5GZND 2V2XA 1ZHNB 5FF6B 3D3VA 2ZUUA 1AE6H 4U3XA 1RIHH 1FNGA 5EUKA 3SDCC 5BVPL 1A6VL 5JA8B 1GZQB 3BQUA 1NKOA 4PG9A 2MCPL 2ZUQC 1CICA 3BD4A 4UTBL 2OR9L 4FXLA 4PGZA 1RUKL 1ZA6B 3NAAH 1W0WA 2ICES 4LLQB 4BH7B 3I85A 3IU3B 1WAAF 1X5HA 2DTML 2MCG1 4XP1H 3O3DA 4MJIE 1HYSC 5TF1H 5C0IB 1AGBA 2XOTA 5DK3A 3NVQA 4MGXA 1U8KB 4ZFZB 4C56E 2G5BA 4NCC2 1A7PL 4Z7VA 2H1PH 1V3LA 3CLFL 3W0WB 3RDTD 2DQJH 4H8WH 5C0AE 4JPWL 1P7KB 2HT4D 3L3HA 2FX9L 5I0DA 2X4PA 1CQYA 1OM3H 2VLLB 1UVQA 2PO6D 1IAKA 1KGCD 1VFAA 3L3IB 4EVNA 1MFAL 3DUSB 4QNPE 3ZT7A 5T1LD 2NZ9D 2DM4A 3GMQB 4YBLC 1EDQA 1GHFL 1V5JA 2ATPB 3FN3A 1KN2H 3PHQB 4AEFA 5KS9F 1SBSL 2GAZB 3JV6A 4Z0BH 4MXVE 1U8PB 4XBGA 3MRNB 4JFDA 1HSBB 1QEWA 2EDEA 4HC1A 1NGPL 5BJTA 1HHJA 3P11L 4PRHE 3MMEA 5EOQH 4B7IA 3UJIL 3GIZL 4BSWA 2EKJA 3FB8A 1BM3H 1XZ0B 5MHSD 3CPLA 2V2TB 4LASH 4OLUL 2A73A 3IS0X 4YE4L 2R2HB 4JFQA 4D8PB 2IPTL 3T0WA 5ADPH 5LXGH 1CWVA 1CXFA 4ZTPH 4CMHC 4JDVB 3C08H 1I1AA 3MODL 2O5XH 4J3WA 4N0CC 3UJTL 5TFSH 4M9PA 4MNQD 1RAMA 3WDHA 4MHHI 3NIDE 2HWZH 5EC2B 2WZPD 3DO3A 1A6TB 2XXMB 1W72H 4PJXA 4QHUB 4U0RC 2CKBL 4PTUB 1VGEH 3BPOB 1A9BB 2AXHA 3B5TA 4HKZA 5J0BA 1I8KA 3ARDB 2ARWA 1GJIA 4HUWB 5E2WL 5AZ2L 3A6BL 4XPHH 4EBQL 2XRAH 2Q7NA 5TE4H 1UJ3B 2G2RB 2VXVH 4J8RB 1R5WB 1SY6L 4M62L 4X80L 5ANME 1NGYB 4X4ME 3M07A 4Y5XC 4RGMC 5EUOB 3QHFH 4G6FD 3MRMA 4G9FA 4JHBA 4K3GA 3TYGH 3DUUA 3OV6A 5MEQA 1YN7B 5E6IA 4TVSa 1BBDL 4HZLA 1JPGA 4EJ1C 4D0BB 4HIIB 3FQUB 3VH8B 4AENB 3TBYA 1H3WM 3HR5A 3WJJC 1G0DA 1ZT7A 2IFFH 4K3EH 1C5BL 2B1HL 4YDKH 3TN0D 4OLXL 5K9JH 2Q20A 3QDGD 2IANE 4U3CA 5JXEC 1G9MH 2H2PC 1VADA 4HC1L 5F9JA 3K0WA 1Q0YL 5IFJA 4G42A 5JQ6H 3BGFB 4Y4FA 2G9HA 3U9PL 4MD5A 2D4DA 4GO6B 4XAWH 2FO4B 4X7EC 4JG1L 3SDAA 3LV3A 5ICZA 3PJSB 5IB3B 2IPUK 2A6DA 3AS3A 1S78D 3OPZH 4HBCH 4DOHE 4JZJA 4OFVA 3OSKA 3QEQE 4HK0A 4PJCA 3PHSA 5DK2A 4JJ5A 1X5AA 3ZE2F 2OXHA 3EDFA 2XTJC 1UG9A 4PBVC 1FG2A 1UGNA 5CHNA 3VXRA 3OR6A 2C1PA 2YD8A 1RZFH 4HLZG 2AJ3A 3LKNB 5I76B 4LVNC 3QXAA 3FAWA 3NCJH 4NO5B 2A6JA 5GHWL 3MOQA 3LH2L 4HGKC 1CGWA 3TGXA 2BY0A 5FO7A 1QSEB 5BS0E 4RGOL 1K6QH 5MP6L 3ESUF 1ZWIA 3QIUA 4M6NL 4WTZG 2P47B 1QFWH 5JR1L 3KHOA 1S7TA 1V05A 3VXNA 5SX5K 2DM2A 4PREB 3HCVB 2FX7L 4YPGB 4P46C 5JPMA 4S1RH 1IKFL 4QRPB 2W9LA 1DBKH 3U4EB 4M1CC 1WIPA 2C7UA 3IFPB 5A2JH 3EYOB 3UBXG 1N59B 4X7TB 1BVKA 5HGDA 1EGJH 4WEMB 3BDXA 4G6ML 5K9OB 3V5DA 4G3YL 1W0VB 1HQ4B 3O2WH 1WQVT 4L29B 5L8JB 5BQ7A 3FFCE 3EO1A 1MNUH 4LFHD 1OTTD 5C0ND 4MQTB 1Y6KR 4JPIA 3S7GA 4F7PB 2ICWJ 2YEZB 4NM4H 1HXYB 1T0NB 4FQIH 4LQ1A 1E4WL 2X4TB 3U9UB 1CGTA 2F58H 2A9NH 5KSUA 2C3WA 3DX6A 5CP7A 1M6OA 2L0DA 1G9NH 4L5FH 5EBLB 1AD9A 2A77H 5D7IB 1CXKA 4O02H 4QTHA 5F7LB 4GKNA 4PJDE 1EK3A 1T20A 5F6HI 4KQ4L 4MD0A 4OJFH 5E8DL 2Z4QB 3V4VH 3NABH 3V7MA 4NQCA 4B5EA 1HINL 3MV11 3QIBA 1DBAL 3HNSH 5E8NA 4TUKH 5KSBE 5CJQH 3SCMC 4Y5YC 4Y5VA 2GKIA 5CJBA 4V1DE 1GPOH 3U36B 3ARWA 3AREC 2DQDH 3CFEA 4MJ5A 4YAQA 1GZPB 1OVZA 3QI9C 2AQ1A 3QO1B 4ODSL 3WFZA 1NLDH 1UACH 1UB6A 2VDKL 4H0HB 4FFYH 1XAUA 2BFVH 3S98A 2FSEA 1SYSA 4G8FA 1EBPA 3CZFB 5A43C 3L3KB 1B3JA 1FVCA 3BKCL 5T3XH 4R2GD 4MDIA 5CSGA 1BJ1J 4M48L 3MV8E 4QTIL 1ONQB 2DIAA 1VA9A 3OKDB 2MWCA 3IVKB 1MI5A 4ZFFB 3TH2T 3TA3C 1S8DA 4FS0A 5CBAA 3SQOL 4DWHA 2VLKD 5E99L 2H32H 5KJRH 3T4YB 3KHQA 3HZMA 1NMBH 1KG0A 3LMJH 1CXLA 1E4XI 4JN2B 1FYTB 3RWCB 3D3VD 2GSIA 3FJTA 3FFDB 2PF6A 2P1YA 3NCBB 2BHYA 4DUXA 4K2UH 1A2YA 1V3JA 4BQ8A 1JGVH 3BQUD 5IW1A 5CD5D 5EOCH 1ORQB 2NZ9C 3PNWA 5KW9H 4OZFG 1CICD 4JFZL 4A2LA 5C9KA 4R3SB 1BFOA 3O4OC 5T3ZE 3QUYD 4ELME 2WM0A 5C0FA 3ARGC 3VFNA 3KPQB 1BD2D 5EC1B 3NOIA 4G9DA 4F9LA 4RMTA 3BH9A 4NNYB 3EOAA 3HAEH 3E6HB 4X0KA 3BT2H 5JO5A 4OF6A 2CIIA 5HYEA 3MLRH 2W1NA 1FNAA 1JRHI 4RZCA 5J57B 1RHHB 1IBGH 5C9JA 2QHRH 3FT4A 3P2TA 5H35A 4O2FB 4U4BA 1CG9A 4XNUL 4RGNE 5DVLA 3FQWB 4W68A 3QG7L 1NJ9A 4UT6L 1T5WB 1AGDA 2ZOLB 4GMSL 1K8DB 1MLBA 2F53E 1FFOB 2YD9A 2J2ZA 5FYJU 1CFNA 3NFPA 1VEMA 2FGWH 4HKBB 3B9AA 5CUSH 1UYWH 5H94A 3R06A 2IBZX 3B8YA 3QZWG 3BVNA 3LD8C 5C0BA 1JNLH 3D9AL 4YIQA 3LEYL 3OKOA 3PGDA 4Y2DA 5FOBB 5J4MA 2XZAH 2QV2A 1KTLA 4XRCB 1C5CL 1FL6A 4CADA 1K5NB 3T09A 3V7AG 1IGYB 1JGUH 3P0YL 1J1XL 5B3NA 1T7WA 4NRZB 4BQBA 3U82B 2HFGL 3KXFE 4Q9RL 1OWWA 1MEXH 1FZOA 1A6WH 2NW2B 2H45A 1TZHB 4HIEA 4K7PL 5E6ZA 4X6DA 3TH4T 1I1AD 1U3HA 4NQEA 5J6GA 4Q0XL 4N1EA 4GW1B 3UJJH 1K85A 4LGPB 1JGDA 4ODVH 4JRYE 4XNZB 3RGVC 1J86A 1UXWB 4NQSB 3EW3B 5CIPA 1MJUL 3SE3C 4N0UE 1JHLL 1P4LB 4CN1A 4GAYA 4XPFH 4CW1A 3DGCR 1WCBA 3QH3A 5D1ZB 1D6VH 1I8LA 1BFVH 3ZDYE 2OJZL 2KDGA 4U3HA 3IXTB 2YR3A 2VUYA 3ZHLA 3G6JA 1RZJH 4HFWB 1A6ZA 4ZPTB 5CP3H 3TBTA 4G9FD 4GRWH 3WL9A 1PZ5B 4K3JL 1KT2B 3AUVA 4I18B 4QRUB 3BAEL 4HS3B 4NNPH 2V2WB 5E6ID 3WHE0 2HKFH 1VFBA 5DWUL 3INUL 1OGAA 5D72L 5I1KL 5E03A 3FO0H 3HUJA 5IF0B 2EXYD 3HNVL 4WU7A 4JHAL 5DJ8B 5CJOH 1OP3H 3UYRH 3LPFA 3QXDA 2N4IA 5IR1A 5GJSL 5KSAB 5F93C 1ERNA 4IRZL 4ZXBA 2YD4A 5DMGD 2VITB 4YFEA 1OB1A 4DGYL 2XWBA 1S7QB 2A6IA 2QSCL 2ZOKA 4RAVB 4NCC1 3V5HA 2CK2A 1GGUA 3MJ6A 2IFGA 3I2CL 1D3CA 2Q8BL 5HI3D 2R1XA 1RU9H 4X6BA 4NQDA 5DD0L 3SGEH 4Y4FD 5HYQB 3L5WA 1FYHB 3IJYA 4X6EA 3KJ6H 4X9GA 1J5OL 3GIVA 4PJGF 1P7QA 3STBA 5IKCA 1T04B 3IDUA 4Q9BA 1R24B 4PG2A 3CFDA 5E1AB 3OF6A 4P5MB 3U79A 4WUUE 4JVWA 5DJDB 3QO0A 2X4QA 4NQXB 1CL7H 2Y25A 4FTVA 2J4WL 2IQAB 3HPLA 2XYCA 1CLYL 2E27L 3MCG1 5EFIB 2VDRH 2VXQH 4DTGH 4K9EL 4NN5B 5EZOL 3VXRD 2GT9B 1R3KB 3X12B 4F7CB 1FIGL 3P73B 3DVGB 4TVPH 3CFBA 1MRDL 4KKBC 4ZTOL 5I1IH 4KJWD 5FK9A 1NC4A 1CK0H 3MRLB 2AEWA 1I7RB 3L7FB 1S7XB 3LN4A 4GRMA 2CRZA 3GM0A 1U8QB 3O6ML 4GRLB 4NC1E 3OKKA 4MNHB 3BWUC 2P44B 3DNKA 3G5VB 5CCKH 4KQ3H 1TENA 5ACZB 1C12A 1Q9LB 3NPSB 2B0SL 4XWOD 3WFCL 4NCDA 2WUCH 4F80A 2VLJE 2HRLA 5MENB 3MA7B 2VTFA 4OF5A 4Z78A 3TJEH 1OTSD 3BEWB 3A6CH 4Y16A 4U33A 1UM4L 1OTUD 3HMXA 5DFWH 3JV5A 4QXUL 3QWRD 3UCRA 5HGHB 5L2KD 2DBLH 3FO2A 2GY5A 2WQ8A 2VH5L 5KVEL 3EOBB 2IH3A 5C0GA 5D70L 3PWNB 3BDYH 1A6AA 2OR8A 2NY6C 2CMRH 5JQHC 1IGML 4DN4H 2JELL 4X9BA 3TP4A 5IG7A 3GI9L 5BRZA 2ORBL 3C5ZD 3X14A 1RZIA 2DIJA 3O0RH 1PW3A 3I3DA 4WEBL 3HFML 3MUY1 4LSUH 5I9QC 1PG7W 4IOIB 1ZHNA 3CCHB 2D7TL 5FF6A 5T1DH 1S7RB 4OCSH 2MMXA 5IBUG 4NQCD 2XFXA 4UV7L 1QG3A 1NCDL 4KZEH 3HZVA 4DGVH 3V5KB 2K7QA 3QPXH 1J1OL 5I1JH 2DLFL 2EIEA 3T8XB 1NBYA 1EAPA 4GRWE 1NL0L 3J7HA 1X5XA 2DQFA 1AJ7L 3HC4L 4QOKB 2BY3A 5DRWB 3MLXH 3QUYC 4MLSA 5EOTB 1H5BA 3ORJA 4QWWD 3LVEA 4M00A 5C0IA 5JA9A 4ZFOL 1KLUA 3K2MC 2YSSB 3GJFK 1DN0A 4XNMB 3DV6B 3MRFA 4WEUD 2V17H 4NZRH 2QADD 4GMTH 3MBEA 2ATKB 4Y89A 4OGXH 1M4KA 1INDL 5B21A 4HV8B 3BKJL 5DJAB 4R90L 3FONA 1MI5D 2OI9B 4ZS6D 3IAQA 1QRNB 1H8SA 1C7SA 1GOGA 3T0DA 2JB5H 3HN3A 3G9VA 2VLLA 2BC4A 5AD0A 3HMXL 3ECBB 4Z95H 2VDPH 4P4KB 3ZE0E 4HKXB 2YC1B 5J56B 2XQYG 3O3BB 1UT9A 3MFGB 2VR4A 3CMOL 4N8VB 3QUXC 5AUMB 5D6CA 3WFDL 3GMQA 4P2OB 2VISA 4MVBD 3QUZB 1MHHA 2DQUL 4E41E 2KBGA 4GQPH 1KB5H 3P30L 4G80B 4CVUA 2AXGB 1QVOB 1S9XA 3LSOB 4NPYA 4WHDA 5I75C 4CL7A 4X6CE 3VFOA 4OZIE 1L9MA 4RMSA 2H2SC 5LVEA 2V2TA 7FABH 4LLYA 5JHDB 2R2HA 1DEEB 3VA6A 3CZJA 2V9TA 1J11A 4NN6B 4I0PB 4JKKA 2JJSC 1S5HB 3IDYC 5TQ2L 1KULA 3FL7A 1E6JH 1N3NB 2O93L 3QDME 1MCRA 1N6QH 3LEVL 3RTQA 4D94A 5F7DA 3WFHB 3F12B 4OT1H 4X5XB 2X4OA 1A9BA 5HDBF 5D7JC 3M17B 1JZ8A 1Y0LA 5FUOL 3RUGE 3D69B 4UAOC 4PFEA 2ITDB 5F1KC 5C0BD 2AJUL 4G7YL 4J8RA 5JPNA 4TUOB 4Y2DD 1MIMH 5IWLA 2R4RH 1NEZG 3MYJA 5EUOA 4PP1C 2EO1A 5JW4R 5I1EH 5HDQH 4F37F 2A9MH 2PYEB 1YNTA 5DHVA 3GI8H 5I6XC 3CC5B 1KOAA 4D0BA 4H20H 1RJLA 4HIIA 4GLRI 4PGBB 5FYLL 5AAMA 5IIEA 4XCYA 3VGBA 1TMCB 4BQ9A 1NBVH 2UWEA 4JY6B 1U8NB 4UIMB 1RD6A 5SWZD 3U48A 4FMKA 1U3HD 2VQ1B 2QHLA 1KJ2H 2AK4B 3ZKXC 5ISZB 3WS6A 4HUXA 1LK2B 3RX7A 5ITFA 3AM8C 5DGQA 4BZ1H 2FO4A 1CD8A 1GSMA 2AVGA 5HI3C 1JI2A 4FP8L 5GISL 4LCCC 3PJSA 2GJJA 3SKNA 1ZEAH 3DX7B 1OAKH 4KXZI 3QCTH 4YZFE 4DAGL 2ICWI 1PGRB 1WBYB 1XH3B 3H9YA 3P9WB 3MZTA 3BYTA 3I6GB 2ZSWB 4PB0L 4WTWA 2VLMD 1G6RA 1K8IA 3KPMB 3LN5B 2E9BA 2JB6B 4M8VA 5TH2B 5ITBH 3D2UB 4JM2A 3VWJC 4P9HC 4XPBL 3T0AA 4R96B 2BOCA 2B4CL 1KIRA 1JPST 1OGAD 1IL1B 2E9IA 3U6RA 1DCLA 3UBXI 3ZTNL 4TTGA 8FABA 3NFNB 3V0WL 3GSNB 4J3TA 1IGTA 1NEUA 4UV4L 4ZXBD 3ULSA 1H0DB 43CAA 1B0RA 3ESVF 1JGLH 3D0LA 4QRSA 4D3CL 1BZ7A 4WCYH 3WUWA 3SO3B 2V5YA 3WXWL 2X44D 4MJ4A 4N9GB 1HCVA 1FBIH 1IEBA 4YPGA 3PP4H 4NQDD 2R2CA 1F02I 2DQEH 3ULUD 1ZHBA 4FNLL 1P7QD 2Z93B 3U4EA 4UUJB 3HAEB 3GO1H 4D9LH 4WFHE 1Q72L 1RPQA 3IFPA 3JBG7 3ALXA 4X7TA 4WO4C 2F74B 5D6DA 5D9SA 5IFHH 3OF6D 5EBMB 1X9QA 1B4RA 1F4HA 3BIBX 5DQJB 5CEZE 1OT1A 2F19H 1FE8H 3MXWL 4FTVD 1FC1A 1HQ4A 3VA2C 1FRGH 4JCLA 3EJZC 3BIAX 2M2DA 1NFDB 2OTUB 2YEZA 2X4TA 1GAFH 3ARQA 3U4AA 3O6KH 2NQCA 2PXYC 4GXVL 4XPTH 5D7IA 2V9QA 2BVPA 1K2DB 1NC4D 2CDEA 4XT1C 1I9IH 5IBTL 1G6RL 3C5ZC 3DBXA 3QEUB 4IIQB 4HK3N 4M43L 1U8LB 4OIIH 2Z4QA 1JZ6A 2EDHA 3Q5OA 5EU3B 2NLJA 1YNLL 1UZ6F 1QA9A 4N5ED 4KTDL 4PRPE 3RIFF 4PRIB 5HYJD 2BCKB 4PS4L 5ECJE 4UI2A 3U36A 4YWGH 2WBJA 1I1YA 1FP5A 4B41A 4Z7UA 3RVXD 4FABH 4Y19E 1G7IB 4YJZL 3IJSB 2VXSH 4V2CB 4ZAKD 4FQ1H 3CZFA 4K8RD 3UZEA 3RZWA 1ONQA 3UO1L 5CEXB 3QNXA 1ZMYA 5IGXL 1ZGLM 3N50A 3L3JA 1RFDL 5IVXB 1G7PB 2QADC 4O9HL 5EG6C 2FYYA 1I1FA 4OLYL 1JWMB 3RA7L 3JUYA 5CKGA 4QYOA 5BRZD 5ADOH 5A2LH 4PBWD 4ZSOB 5IESL 5DD6B 3RKDD 2V5TA 4HIHB 4GOSA 4JN2A 4D9QE 4KK5D 1MF2H 3MNWA 2BP3A 1KTDB 3FFDA 5DQDL 3V8CA 1HH6A 2A83B 3D85B 4LCWA 5J7CC 1MJJA 3SOBL 5E1HB 3V6OE 3VXUB 4JPKH 5A2FA 1FSKC 4ONFL 3TF7C 3O6FA 2EYTB 2H6PA 1UWGL 4R3SA 4PJ7B 4BSVB 3DSFL 4LSRH 2CK0H 2NZIA 3JVGC 4PLJC 3PGFH 4CUCA 2Y9RT 3FTGA 4MJIA 4O51B 4PGCB 1ZANL 4NDMB 2F54B 4NBYB 3T04D 4NWUH 4WWKB 2QKIA 3PWJB 4U1IB 3OAZK 2VDNL 4I3SL 1AP2B 1T1ZA 4XMPH 4LLVB 5F71A 3W0WD 3C60B 2FLBT 5FHAL 2FEEL 4OCRH 2JK5A 3S37L 4QXGH 3MLUH 1Z3GL 5FOJA 4EN3A 1RIUH 3P4MB 5D2NC 2DKUA 1T5WA 4HDIB 1FAIH 2ZOLA 4LKCB 4NYLA 3I02A 1AXSB 1P4BH 1EUTA 4MQXD 2R0KL 3CVHB 5I71B 5EWIL 3KS0H 5T33L 2BZDA 4NT6A 2OM5A 1X3DA 2EIBA 5CINH 5SX5H 4YFDB 1CDHA 2IADA 3LQAL 4Q6IC 4EUPA 4MA8H 3OBAA 4JR9L 5CGYC 1P4IL 5ILTH 4AQ1B 1VEPA 4Q9QL 5HJ3A 4RMQA 3SGKA 4MNGB 3BPNB 1AC0A 2XIDA 1MUJB 2YOCA 3IXAB 1UC6A 1OP5K 1IGYA 1X4ZA 3LQZB 3MYZA 3S34L 4CVZA 3JTSA 1CGSL 4QHNB 5DO2D 1H8NA 4U1HA 4Z6AT 1LEKB 3B2UD 4W6YB 3KPOB 1RI8A 1OARL 4NUGH 1CDJA 2B39A 4PD4K 3ARFA 1EEUA 4H25B 5FUCE 4L8BA 1E4XH 1N26A 1CFQA 5L88L 1G7MB 2QQKH 4JFHD 4P2RA 5AWNL 5LGHH 4GW1A 5I8KL 4P4RB 5MI0C 3W5MA 1H3VA 1U8IB 4PJEF 2ADGB 5D5ME 4Q6YA 3RTQD 1JGEB 5DK0B 3VG9C 3UPRB 3ARBB 2PCPB 4CDHA 4WW2B 4PUBL 3HI5L 2NR6D 1KJMB 2F8XC 5C0EA 4DVBA 5EBWB 1INEH 3V79C 1VPOH 5ANMA 4WV1B 1DBML 2EIDA 3L5JA 2AXFB 3FQNA 4FG6D 5HPMB 3E2HB 3Q3GA 1RZGA 3G08B 1U6AL 3EUUA 5SWQB 1JRHH 4XCCL 4RISL 4HFWA 4AIZB 3RIAF 5MERB 4ZPTA 5KG9B 5FCUH 4MJ2A 1O7VA 4BJLA 4H1LA 4A6YH 1PZ5A 3BYYA 5E5UB 3U30C 1KT2A 4NZTH 4HS3A 1X5IA 3VJ6A 2V2WA 1RUML 2XZZA 4ODUB 3BHBA 1T2QL 3FN0L 1PYWA 1BQHA 2AAVA 1KB9J 1Z5LB 5IMMB 1ITBB 4LPTA 2IANA 2F8VA 5DJ8A 3ZHDA 4PJFA 5FGBC 4S11A 4HPOH 5KSAA 1UB5B 3WHE1 2NY4B 4OCXL 3WIHH 2CO7B 1LO0L 5GGUB 4NNXA 2VE6A 4GG8A 5E2UH 4N0FB 5F6IC 1T89C 3O9WA 1QPXA 3RWDA 2Z31A 1TZIB 5ACMA 1R0AL 2EDXA 3G5YB 2F5AL 1O5DT 5DRNA 4JGJA 2W9DH 2XPGB 5TE6H 4YHZL 2EO9A 1R5VB 5C08B 5E4EC 4LU5H 4ZUTB 1UM6H 3WIIL 3ZT5A 2G60L 4YHML 2BVOB 5DUMH 4R4ND 1EX0A 3OAUL 4NQXA 1RUQL 4I48A 2C5DC 3CUPA 3CXDH 3ILPA 3QRGL 2QTEA 3P9LB 3PL6A 4MA1B 4WTXA 5EFIA 3NA9L 1NGWB 4JM2D 1R3KA 4GS7C 4F7CA 4OM1L 4M5YH 5F7NC 5H37G 3ZKQD 4Y2OA 3U0TA 3DVGA 3FZUD 4RFNC 2VAAA 5HHME 4GBXB 1AIFB 3MRLA 1OW0C 1E6OH 2XWJB 4K71C 1UENA 3GHBL 1S7XA 3S35H 1YEJL 2GCYB 5L7XL 4JKWA 5B3JF 3KPPA 3NTCL 4YXLL 4GRLA 4Z77B 4LARL 3V6FA 2BVQA 2AEPL 4L8CB 2D03L 2SEBB 2HRPL 1BIHA 2JCCE 1BOGB 3H3PL 4XVJH 1AE6L 2E8ZA 3D18B 5LJYH 4QRPD 5D71H 3LDBC 4HJ0C 2GJZB 3RWHB 1RIHL 5F1OB 1SVCP 4ENED 4JFEE 2XY2A 4C83B 1KNOB 2NY1B 4FOMA 3MLWL 3MA7A 1FL5A 4EI6B 3BEWA 5A2IH 3I6KB 5C6TH 5SWSE 5KVDH 1N5AB 4ZAKC 3SBWC 5GS0D 5I19H 1KIQB 2QBWA 4XP1L 4MA7L 3RL2B 1SYVB 3STZA 1W72A 1F42A 1T7ZA 4N5UA 3PWNA 1QFWM 3EZJB 1ZHKA 4XI5D 4IMLB 2AV7B 3EHBC 4WJ5A 5EORL 4YLQT 3ARUA 1A8JH 1B0GB 3G6JF 3L3DA 4FFVD 3MLVH 2DQJL 4H8WL 1IARB 1V3KA 2XICA 3O8XA 4LDLB 4HWZB 2A1WH 4WVRA 3F7QA 5GSRB 2EEDA 4X7SL 5DSCB 4RNRB 1YEHH 4Q58C 3M1BB 1OM3L 3WNPA 3DVNB 2R0WH 3G9AB 3QIWA 4WFED 4GG6E 4FQCH 3VI3F 1DQJA 3V5KA 3VG0H 1MCQA 2J6EL 4LLDA 3TCLB 1A7BA 4S2SB 2WBJD 2LU7A 5IVXF 3DXAE 2HP4A 1NSNH 3D25B 5IMLA 4XVTL 1JPTH 5DRWA 4LPCA 5EOTA 4ZYKB 2DRUA 3HNTL 4Z0BL 1D6EA 2FZ3B 2GJ6B 1N2RA 1PAMA 2J3SA 4LNVA 4B53A 5DD5H 1ZT4A 3EO0A 4HV8A 3VFMA 4LASL 2HYMA 1QRNA 2CO6B 2VZ1A 2HLFC 1RZ7H 5ADPL 4IS6A 5LXGL 4PGEB 4S1DD 2O5XL 1MELA 4HJGA 3LRSA 1OAQL 5B8CB 4NO3A 5TFSL 4KRLB 1FYTD 2QQQA 1F2XK 2HWZL 2VR5A 3GMOA 1J87A 1EA9C 1W72L 4MQXC 5E8OB 1VGEL 5GGVH 3KAAA 1LE5B 4HPYH 3DROA 3F58H 1YMMB 4LCWD 3G04B 1QKZH 2Z8RA 3L3OB 3TZVA 3QUZA 4EZMA 5FM8A 3O6FD 1JMZA 4XPHL 1YECH 2XRAL 3SQBA 2AXGA 5TE4L 1CBVH 2VXVL 3LSOA 3TIDB 1VGKA 2Y6SC 3SPVA 2P8MA 3QHFL 3TBWB 1YEFL 3TYGL 4ZUSB 1DEEA 5DO2C 3MLSH 2NY0B 5FGSA 4I0PA 4UT9H 3UTOA 1Z0NA 2NNAA 5FA4B 5I1AA 4HX1A 1F11A 5HD8D 3MTRA 1N3NA 4OD3L 5GRYA 1OSPL 1RK1A 2IFFL 4K3EL 2F53A 4GXUN 4EN3D 4YDKL 3F12A 1BFSA 5C0DB 4WENB 1O7SA 3N85H 5K9JL 4NO0A 1LP9E 1EGJA 2EC9U 2ENYA 1HILB 3BPOC 5E2TH 3GNML 5JQ6L 1BBJB 4XCEA 4PTTA 2YD7A 3D69A 1IM3A 3NH7H 4ODWB 3ARDC 3UTTE 1PY4A 4XAWL 1G7QA 4LIQH 1JPSL 1WZKA 5JOFB 5HSFA 2G5RA 2GSGB 3L9RB 4P57A 3SKOA 1UJ3C 1QR4A 4WHCA 3OPZL 1DL7H 4HBCL 3CDGB 4JVPA 4F33A 2PYEA 2X9XA 4U6TA 1MCLA 3HI6H 4X7FC 4R7NB 4FZ8H 2BNQB 4QT5B 2XG4A 3R1GH 1KCRH 2I25N 4LSPH 4PGBA 4Z7QF 3GBMH 1UH4A 3OR7A 4XTRC 1U8OB 5T3ZL 1HQRA 2NY2B 2ZUYA 1LEIB 3ARFD 1UFUA 1CD1B 5C1MB 3GRWH 1O0VA 3QUMB 3GSVB 4UIMA 1SJXA 4P2RD 3VWKB 5IW6B 4HLJA 4YDJA 1XCQA 2HKHH 2YN5A 2VDMH 3ALPA 4N0UA 5ISZA 1YPZE 3HLAB 3TNMB 4Y0GA 1K6QL 1JYVA 2IAMB 3WFBL 2CSPA 4U1GB 1QFWL 4JFOA 1KYOK 1I7ZB 4FQLH 3BGFC 3MRDA 1MHEB 1OPGH 3MGOB 1I8MB 3W2DH 1K4DB 4PJBA 4QF1B 4S1RL 4LVEA 1WBYA 2BY1A 2J7LA 5EO1B 5H8DA 3QUKA 4R4NC 1MHCB 4FQHB 3KPMA 1QSZA 3FRPG 3U46B 2YD1A 1CXIA 2H32A 4HKJB 4OCYH 4XGZA 4WU5B 2CRMA 3O2WL 2GTZB 5DJCB 1YY9C 4PJ8B 3NGBC 2K9UA 5C2UB 5E8PB 3GJFH 4NM4L 5KSAD 3TBSA 5DRXA 4XMLL 1S9YA 3MUGB 3V9FA 2F58L 2PW1A 4DFIA 2BXYA 1KGCE 1G9NL 2DLIA 3OAYK 1C16A 1RZKH 4L5FL 2A77L 4U05A 2W38A 2X4UA 4RIRA 5C0CB 2FHCA 4Z7WF 5GRZA 1FPTH 3O9WD 2BVTA 4KI1A 1CVSC 4N9GA 3TFKC 5A1AA 3MRRA 4OJFL 4I2XE 4GXUM 5GS3A 3NABL 5FDWB 1Z9LA 4PRHB 3QQ9C 2HLAA 3HAEA 3S5LB 1CDBA 3HNSL 4OFDA 4TUKL 3HC3H 5CJQL 1NCWH 2R0LH 3UPAA 4XXDA 5EBMA 4ZUWB 1L7IH 3WLBB 4ENEC 1U2CA 2DQDL 2GITA 1Y6MR 1KCVH 3IDIB 3UXFA 3DMMB 1NLDL 1UACL 4HMEA 5GRVK 4FFYL 2A6KA 3WN5A 1PEZA 5CLWA 3LOWA 1T4KB 3BZEB 2DIBA 2IH1A 4XNYH 1B6UA 3VFSA 3V95A 2X1WL 3VXOA 1I8IB 3VD4A 4AEHH 1DANT 4MNQE 3T3PE 4N8CH 1S7UB 3KPSE 2COQA 4MJ6B 3BJ91 1OGTA 4YBLB 2RAMA 1DE4A 4IIQA 5FYKH 1U8LA 5B38B 2W60B 4NFDA 4LLUB 5EU3A 4GRLD 1RIVH 4LMQI 1ORSB 4UOW0 4WY7H 4YBQD 1NMBL 4P3DA 4PRIA 3ROLA 4IRJB 4U6VH 4PJHA 1A3QA 1MVUB 2WV3A 2UWEF 1G7JB 2OJEB 1XFPA 4K2UL 1TVDA 1A1MA 5EOCL 4E5XA 3E8UL 4RBPK 5IQ7H 4LSQH 3VXMB 3IJSA 3CH1B 3KDMB 4BFIA 2VDOH 4CMHB 1T21B 1MCBA 1TPXB 5IHUH 1QO3A 4C59B 5GRWA 4PV8B 4M61B 4WGWB 4OKDA 3CFCL 5CEXA 3NZ8A 3IKCA 3MRIB 4CVXB 1JNJA 2W0FB 4I77L 1KPUA 1BF8A 2E6QA 1A1NA 3QDGE 3BE1H 1IBGL 5I66A 4E42B 1KB9K 1XIWB 2QHRL 3O8XD 4UB0H 1RJCA 1D9KA 1VACA 4HIHA 5HVHB 1LD9B 2GW5A 4M03A 2P7TB 5K9KA 5CP3A 2XKNA 1F3DH 3VXUA 2I07B 2BERA 1Z9SA 2GFBA 2NY7L 1X4XA 2PYFA 4PYHA 2AEQH 2EYTA 2IALA 2FGWL 1NCCH 1UM5H 3HE7B 5CUSL 4PJ7A 5IK3B 4NFBA 3GSUB 1JNLL 2ZCLH 1GXEA 4W6WB 15C8H 4WWKA 2FBJH 3PWJA 3VGHA 4U1IA 3JXAA 2R8SH 1TIUA 1VHPA 3IFOB 4KPHH 4YHYB 4UNUA 3EYQC 1EIBA 4KVCH 2OSLB 4M7KH 5DXWA 3DIFA 2PTTB 4U6YB 3IF1B 3J8F7 2M26A 2V7NB 3CMGA 4XNXH 1XF1A 1BLNA 1MEXL 5IB1B 1QRND 3PWVB 4OF8A 4GW4B 1WITA 3ARVA 4FXKB 4POZC 5CGTA 1A4JA 2J88H 4P4KD 4S10A 1YEGH 3UJJL 3PDDA 1ETZA 1JWUA 1WBXB 1CU4L 4ODVL 3FT3A 3NN8B 1RJYB 4E41A 1FORH 4OLEA 5J9PB 4P2OD 3QUZD 4MWFB 4WI6A 4JKPH 3FFCB 4XPFL 2QEJA 4K7FA 4PV9A 2KUTA 3S4SB 1FZMA 5HHNB 3RFZC 1BFVL 5GRXG 1AGFB 4Y4HC 5F3HB 5CJXC 2CDFA 1T83C 3QCVH 4TNWF 3FKUS 4DCQB 4KKCC 4PRNA 3LQZA 2HTLD 4QHNA 1RZJL 5I30H 3ZTJH 4F58H 3RX5A 4L4VB 3SE8H 2D0GA 1A1OA 3ZKMD 2G75B 1LO5A 1FO0H 1NAKH 4OZGE 1G7MA 1H9VA 1ZLSL 1NANH 4I0PD 3QDMA 2HKFL 4L4TE 2VSDA 5IEKA 4HMDA 4OD1H 5DRZB 4Z7OE 1BQLH 4P4RA 5CJOL 3UYRL 4V1DB 3EO9H 1SEBB 4DZ8A 3GSXA 1HWHB 2F53D 3ULVF 1JGEA 3GHEH 5DK0A 3UPRA 4A2MA 2P45B 4YDIL 2BXZA 4WW2A 2YD3A 3RUGA 3AMLA 1IAIM 3WJLC 1UCTA 4BH8B 5JUEH 3QJHB 2IF7A 4D0CB 5HI5D 1RU9L 5DLML 3KJ6L 4F2MA 5HPMA 4TOYL 3G08A 4XP6L 3T1FB 2FJHA 1FV1B 5D1ZC 1XCTB 4Q2ZB 3VRLE 1N7MH 1J0JA 3WLWC 3CSPA 4FXGA 5FV1L 4XWGH 3WO4B 5JW5B 3VMNA 3L7EA 2W59A 2PYED 4JPVL 4OZHE 1LGVA 1IKNA 2ED9A 4LCUA 4I18C 1QSFA 4R0LA 2VDRL 4KKLD 4MS8D 4S1SH 3F65A 1YUHB 1TJIH 4APQA 1UB5A 5FDYA 1MCIA 1UWEH 2VLKE 1JFQL 3JTTA 5IROA 1EUUA 1I7UB 4X4YB 5IVNA 4N0FA 2AK4D 4U31A 5ISZD 1NGZB 4YGVB 1WK0A 5I1CH 3QI9B 3FB7B 3RZCA 3MFFA 1EFQA 5JNYB 4WFFD 5M95B 3EYUH 1EO5A 2A0LD 1ZHLB 1U41A 3FT2B 5C08A 4CVWA 4ZUTA 3S9DB 5T3XD 2X7LB 3H0TB 5CCKL 4KQ3L 2VZTA 1FGVL 5HHXL 4JFPB 2ZZUT 2DDQH 4KVNH 1BD2E 3AFLA 4X8JB 1YC7A 5D7LA 5KVMC 3IDMA 2HT3D 4QNPF 3BMWA 3KYNB 1MFDL 2ARJB 1NGWA 2P24A 3UYPA 4EI5B 2I9TB 3TJEL 4X7DC 3A6CL 3S36L 4Z7VE 4P9HH 1J05B 1I9EA 4JCMA 4NN5C 1QBLH 3OXRB 2DBLL 2IWGA 4MXVF 3OAZH 3JV4B 3LS4H 4OV5B 4PJ9B 4NJ9H 1IGCH 3BDYL 2CMRL 1AD0B 3WNKA 5SX4I 2XI9A 1KB5A 3OKMB 3C9NA 4L8CA 1PFCA 1DVFA 4KKAD 4LSUL 1CD9B 1BOGA 3I3EA 3QDJA 5T1DL 4W4OC 1KIPB 3OGOE 5IQ9A 3NIDF 1BHGA 1OAZH 4QO1A 4KZEL 4DGVL 3B9VA 3ME0A 1A7QH 3FOLB 3QPXL 5E08H 1X7QB 5GS2H 4PR5A 1N5AA 4M9OA 5ETUA 1FFNB 4FFZH 1QPPA 4AM0B 1KIQA 2Q6WB 1IC7H 1SYVA 1SEQH 4O2EA 1OCWH 1Q9KB 4JRYB 5HHQA 1OP5H 2VAJA 5DJ0B 3RVWD 4X5WA 4YH6A 1AHWA 4UQ3B 4Y4KA 4GMTL 1JHKH 1MLCB 1S3KH 4MMZC 4OGXL 4WHTB 4F37K 3GGWB 1D5MA 1R5IA 1X5KA 2I5YH 5IM7B 4HWZA 4L1DA 4PJXE 4JN1H 3VI4E 5HGAB 1N8ZB 2HVKB 3VFWB 2MPAH 3M1BA 3PDOA 1YEKL 2JB5L 2P5WB 3DVNA 3MLYH 3HA0A 4Z95L 3SDAC 5I73C 5EO0B 3BP7B 1AXTH 2R9HD 4PRID 1F90H 1QR1A 3F7RA 2F8OA 3KGRA 3VGAB 4OCNC 2EC9T 5DJ6A 3LKPB 3TCLA 4J3OC 3LKQB 1E4JA 4S2SA 2VWEC 2AJYH 3HB3D 4ODXB 5KAQF 1QQDB 3LCYA 3VXSB 4G9FE 5H2BB 1IAIL 2Y5TB 3MOBH 3HG1B 5I1DA 4K7PX 1KB5L 3NCCB 1D7FA 3O45A 1KJ2A 3B4NA 3MRCB 2R56H 4NRYB 2ADJA 3TT3H 1QHOA 4FFWD 1IEAA 5E00B 1XR8A 4F7TB 3V2AR 3P0VL 2J8UE 7FABL 1M7DB 2D31B 5FKPB 3WIFA 1S7SB 3N1MC 2MHAA 1PKOA 3SE9L 4RX4A 2YBRA 4MX7B 5B8CA 1E6JL 1KCUH 1D9KD 1N6QL 2PETA 3MJ8A 4OT1L 4L8DB 4U6HB 1JUFB 3QXVA 3VXUD 1HXMB 5F8RC 1U92B 4YR6A 1F8TH 1S7WB 3T0VA 1NAML 4P2OC 5ICXB 2AJSH 1KSRA 4PJCE 1TNNA 4G6KL 4EXKA 2F54D 1JVKA 4MCYA 3UTSB 4NKOB 4RFOH 4WWKD 4LPVA 3K4DA 2R4RL 3MRQA 1E27B 3RPIB 3VXRE 3GSWA 1XF2A 3MLTB 1PDKA 1PVHA 2HTLC 4ZUSA 5EZLB 5HDQL 2A9ML 1NPUA 4EQ3A 5L9DH 3HR6A 1PSKL 4H20L 4NN6C 4XB8A 3OKNB 3N1PC 4HWUA 1NBVL 1HK6A 5IP4A 2EDOA 1U93A 1RHFA 4P5TA 1F4AA 3KNBB 3FRUA 4KDTC 4ONGH 4J6RH 1ZXQA 4WGVB 2ZSVB 1KJ2L 4MQSB 3DLQR 5IVZB 2O26U 1HH9B 2WINB 3T1WA 1B4JL 3RWIB 4BZ1L 4GUPA 4E41D 2EH8H 4IRSB 4DVRH 5B39B 3MUHL 4Z18A 1Z0MA 4PJDF 1N0XH 1YEDB 2Z91A 1OP9A 4QGYA 4ISVB 1ZEAL 1OAKL 1MIEH 2ZUTA 5IEHA 4QY8A 3QCTL 5JZ7D 5KSBF 5FECB 4JQXC 4TVPD 3DGGB 1Z2KA 3RIFK 5L2KE 3C6SB 1R3LB 3MJ9H 2R2BA 1ZTXH 1PG7H 5I8CB 4QT5A 1B2WH 1HI6A 4KROD 4LOUD 1HOCB 2R0ZH 5ESAB 5KSVA 4MCZA 4O58H 5ITBL 1IT9H 1LEIA 1CD1A 4KJYB 2ICWB 3OB0K 5F96L 2DMBA 2QR0A 1I4FB 5HBBA 1U58B 5DF0A 4PB9L 4JFYB 5FM4A 3TNMA 3A67H 4HUVB 5HDLA 5LQBL 5KZCD 3L3GA 1EJOL 1NGQH 2IAMA 3D6GA 4G8GA 5CMAA 4NQCE 2D3VA 1JGLL 1H3GA 3UBXB 1MCOL 3R8QA 1I8MA 1HHGB 2YZ8A 2H8PB 1FBIL 3B9KB 4KMTH 3PP4L 3O2VL 4MXWL 2DQEL 1SVZA 5GRUH 1CE1H 4H26A 4Z9KB 2APTA 4YGAB 3X3GL 3AAZB 4P2QE 1EHXA 4CAGA 4NP4H 4TSAL 3E6FB 2YA1A 5IFHL 2NY6B 3QT2A 2HTKD 2CKNA 3WS3A 5GZOD 4FHBD 2F19L 1WGOA 5A3IC 4HHAB 1FE8L 1JF1A 5BCAA 1DUZB 3FQRA 3RWFA 3SHSA 3FOMB 1QSFD 4ELMF 4JQIH 3QNYB 1MI5E 1HZHH 2IBBA 3OKEB 3SDCA 4YBHA 5C92A 2XQBH 1WWWX 5SV4A 5TGBA 2ADIB 5LCVH 4XPTL 4KI5D 1WISA 1F58L 3RZCD 5F70A 1DBJH 1KJVB 4OIIL 4X6CB 2CR3A 5E70A 3V4PH 2GK2A 2OL3L 5C08D 3ULUH 5IFAH 1BWWA 1TTGA 3W9DB 3KR3H 1T1YA 5DC0A 3U83A 5HYSA 3ROOB 3VRJA 3WSQH 4YWGL 4ETQB 5D7LD 1S9WB 2VXSL 3B2VH 1EHLH 3BKYH 1M7IA 4WRLA 2AKRA 1T4KA 3BZEA 3M8OH 3BKML 3ARPA 2D4FA 4LVHB 6CGTA 1PQZB 2WWMD 1I8IA 3DUHA 3CIQA 4RMRA 1OAXH 1MFNA 3QUXB 1S7UA 4MJ6A 1BGXH 4M3JA 5EU4B 2Q76A 1YY8B 4B50A 1FN4B 2VJXA 5JXAH 3BXNA 2FIKB 5ADOL 4M1DH 4LLUA 3V0VB 4V2BA 5F9DC 2X1QA 4OZFB 3QPQD 4JFEA 3ILQC 3QDJD 4S0TD 4PRBA 1P5UA 4L1HA 5C0BE 3T77B 1QNZH 1VEOA 1D5ZA 1G1YA 3AS2A 1JNHB 1QBMH 2J8HA 5SWSA 4JPKL 3CH1A 3S3SA 4BZ2H 5FM5O 5IJVB 3FO9A 4LGSB 5DTFB 1BMGA 2CK0L 4WHYG 4LGRB 3PGFL 1P6AB 1LE9B 3IDYB 3TIEA 3ZDYF 5EB9A 3MRIA 4CVXA 3VXPB 6FABH 3H9SA 2DL9A 2HG5A 2R1WB 1GH7A 4X6DE 3OHXA 5D7JB 5SWZE 3RIAK 4Y4KD 4YX2H 5C70A 5INCB 1NDMA 4NO2B 3WUWG 4UDTB 2HT2D 4OCRL 1MJ7H 4UAOB 2RQ8A 4RSVA 5INDB 1NFIB 4HUUB 4QXGL 1LD9A 3QZWB 4N68A 1RIUL 4TSBH 5TDOB 4LEXH 4Y5XA 4YO0B 5JDJA 1F6FB 3U0PA 1P4BL 4A6YA 2I07A 4WFGE 3DXAA 2EE3A 4HH9A 3SDDB 4DEPB 2WP3O 1U9KA 1KBGH 3HZKB 1J8HA 4KGJA 4HWEH 3GSUA 2VLME 4PP2B 4ZO6A 3ZO0A 1PJ9A 3WJJA 3P40A 2FWOB 5C7XH 1ZV5A 4H5SA 4G8EB 1X6LA 3IFOA 3WIHA 3MBXH 2DQTL 4X4XB 5BZDB 3LPWA 5JXEA 4PJIE 1OGAE 3K46A 5EN2A 1J0IA 3HUJE 3W11D 2V7NA 4BKLA 1SJHB 1QYGH 1WF5A 2VDQH 5IB1A 1BVLA 1GGIH 4HT1H 3C60C 3TO4B 5C07B 5C0RH 5J6HB 5TDNB 4FQJH 3GUTA 2QQKL 1TVHA 4O2CB 2Z35B 4RX4D 5EPMB 2EYSA 3SDYL 3BH8A 2BJMH 5LGHL 3KYMA 1ULVA 3BPCA 4NQDE 4XHJD 4YHKH 1WBXA 5DD1H 3W82A 3ULUE 2A74B 3CFJB 2ZJSH 2EDYA 2JJVA 3IETB 3OAYH 5FGCB 2NYYC 4BQ6A 2GY7B 2PTVA 2FX8H 1CR9H 2VXUH 3TCXA 3RRQA 2OP4H 3VWJB 1Q94B 5FO9B 1VPOL 4KUZH 5K33A 4PY7B 4HWBH 5BO1H 1T5XA 5F9WC 1MOEA 1LK3H 3IDXH 4Y16C 1NC2B 5D2LA 2VZOA 3BIKB 1JRHL 2UY6A 3BPNC 3DI3B 4OCMC 3TV3H 4JY4A 5FCUL 4HS8H 2V5RA 4A6YL 2G75A 3C8KA 3VU2A 4NZTL 4NRXA 4TNVF 1CVRA 2NY0D 2MSPA 3K8LA 1ES0B 4OLZH 2ZCHL 2CXGA 3PIQA 5HHOE 4GAGL 4P46A 3V8OA 3VFGH 1II4E 1A3LL 1UH2A 3RNKA 4F7MB 4PLOB 4JO1H 4WW1B 4Z5RA 4OFKA 4P5TD 1HE7A 5I1GH 3DSNA 3ZKSD 4Y19B 5E2UL 1ACZA 4BH8A 2PR4H 3ARBC 3QJHA 5HYJE 4N0RA 3PQYB 4G5ZH 3TJHD 2W9DL 3T1FA 2EDJA 4YHOH 4WV1C 4Q2ZA 5FKAB 1RY7B 3VGEA 3E2HC 4KRPC 5JW5A 1LEGA 1EEQA 1H5BC 1G84A 5DUML 1DQQB 5JOEA 3BN9D 4RBPH 5TDPB 1T0PB 4XCNA 3V6ZB 3VFRA 2R4SH 4GRWF 1JZ5A 4L3EE 4MDJA 5TPWH 2FJFA 3FHAA 1EEZA 1YPZA 1KCLA 3V52H 4M5YL 4LEOB 1JTPA 5BRZE 2Z92B 4FRWA 3H7LA 2YUVA 2VZUA 3H6JA 3BP6B 5ABDE 3RWJB 3SCMA 4Y5YA 5J1AB 2NTFB 4XAKD 2NY4C 3NZHH 1QLRA 1MHPH 3AREA 3QI9A 3BGMA 1D5IH 2IAMD 4G8GD 5CLTA 2D7QA 3F5WB 2EYRB 1C1EH 4JAMA 5F7EL 4EUPG 2OMBA 2GHWB 1BPVA 1B88A 3E3QE 2O5YL 4QCIA 1XGYH 2X7LA 4XVJL 3KPNA 2MNUA 5D71L 3I6LD 3ZE0F 4QXTB 4JFPA 3EOTL 4RQQB 4NC0B 4G6AD 4U2YA 4B7LA 1R3HB 3QA3B 2ARJA 4X9IA 3TA3A 5LAXB 3W9EA 2HFFA 4P49A 4LCYA 4UILL 4AEIL 4Z7NE 4XBPB