3QCYA

Phosphoinositide-dependent kinase-1 (pdk1) kinase domain with 4-[2-amino-6-(3-amino-1h-indazol-6-yl)-4-pyrimidinyl]-n-phenyl-2-morpholinecarboxamide
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
286
structure length
275
Chain Sequence
QPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Structure-Based Design of Potent and Selective 3-Phosphoinositide-Dependent Kinase-1 (PDK1) Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 88
structure length 275
sequence length 286
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3qcyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3qcyA01
4O27B 3BQCA 1ZOEA 2DQ7X 1U4DA 4GV1A 5IU2A 4HVGA 4I21A 4MD9E 3W2PA 4DH5A 5AMNA 3N4UA 5CX9A 3JS2A 3VRZA 4E5AX 3NLBA 3D5XA 2XJ0A 3GC8A 5CYIA 5LWMA 1Y8YA 3DPKA 3CBLA 4LGGA 5F4NA 5H2UA 4FV6A 3AC1A 4JBVA 4QD6A 4IACA 1AQ1A 4EOLA 3MY1A 5HE0A 4DH3A 2VX3A 2YJRA 4IZ7A 3MH0A 4CKJA 3P79A 3R6XA 4FYOA 1BLXA 2RFSA 2B4SB 5CEOA 4OBQA 4YHFA 3QD0A 2VNWA 3BHTA 2X6EA 3EMGA 4QMLA 4Z7HA 2PHKA 4GT5A 2HXQA 2BAJA 2ITPA 1Q3WA 4FIFA 2BRHA 2YCSA 4B9DA 1ZMVA 2A19B 3D5VA 2B9JA 3FKOA 3R71A 3V5LA 5BX0A 4OAUC 5I4NA 3GQIA 4YHTA 5F95A 3AMYA 3QLGA 3CLYA 2NO3A 2PK9A 4PMMA 4DG0E 3LLAA 3BBWA 1YQJA 3DKGA 5K4IA 2PY3A 5B7VA 1AGWA 5HBEA 1R78A 5GJDA 4MNEA 1A9UA 3GU7A 4NKSA 5CZIA 4F65A 3ERKA 1CKPA 3LCKA 4L52A 3HMPA 4IH8A 4J1RA 3RBWA 1A06A 4FVQA 4YJUA 5EI6A 3ZH8A 5C9CA 4I5MA 3HUBA 4XS2A 3OD6X 3TJCA 3LFSA 3G5DA 1V1KA 3TTJA 1TQMA 3PG3A 3GBZA 3UQFA 3RHXA 1DS5A 4YC8A 1J7LA 4JR7A 3PP0A 2UZOA 1UU9A 2CDZA 3R83A 4JDJA 2OZOA 4PMTA 4IC7A 2J0IA 2WMUA 4BKZA 1ZZ2A 4ZZMA 5A54A 5CF8A 3JY9A 4IWPA 4MXAA 4BFMA 5M4UA 3ZFYA 4FIEA 4FV7A 3AC4A 2ITUA 2I7QA 3R9OA 4E6DA 3SOCA 4M8TA 4GKHA 3UO5A 5BVFA 2WMWA 3IECA 3IW7A 3ANRA 3PY3A 3SW4A 4RFMA 2UZVA 2GNJA 2UW5A 4C4FA 3GEQA 4NT4A 3I4BA 5JSMA 1JKTA 3FLQA 3KRXA 4I4EA 4FTRA 4FT7A 5JRQA 2NNWB 4TYGA 3DV3A 5AV2A 1NXKA 3HV5A 3PLSA 5C8MA 5EI2A 4HVDA 2EB2A 3NIZA 5HE2A 3HX4A 4MEDA 1ZOGA 4FZFB 4WUAA 2VD5A 3FSKA 1A48A 2YIXA 2F2UA 3FMDA 4AFJA 2J0JA 4D4VA 1XH7A 3BRBA 4U9AA 3WI6A 4L8MA 2XIRA 4OTFA 4FV4A 3PZHA 3VUIA 5DMZA 3CY3A 1B38A 4C4GA 3POOA 1Q97A 4UB7A 4Z7GA 4V0GB 2F4JA 4TW9A 4ALWA 2VTPA 3C4FA 3JYAA 1W0XC 3BBTB 3IQ7A 3LJ0A 4JNWA 3UODA 3V51A 1DAWA 5TO8A 1H28A 2BFYA 4QTBA 4G3DA 4ZSGA 5AUZA 3BKBA 4O7WA 3Q2MA 4C0TA 2JBPA 4YZCA 4TZRA 4H39A 4TWPA 3ENHA 3ZU7A 4ORKA 4YJNA 3OWJA 3Q4ZA 1PMNA 2VX1A 5I5ZA 3KMWA 5IISA 5KKRB 5EQPA 3OOMA 5KZIA 3VUMA 1TVOA 2ZDTA 2UZLA 4L42A 4ZTHA 2OF4A 4GMYA 3E3BX 1VYZA 4AW5A 1OBGA 2WTIA 5CSWA 3COKA 5HVJA 3BYMA 4O7SA 2W1ZA 4QQCA 4PMSA 3AGLA 3E93A 2VO3A 2EWAA 5EW3A 3DBEA 5DPVA 5FDXA 5B0XA 3QCYA 2B53A 4GVAA 3F61A 2IVUA 3E8CA 4CFUA 3I0QA 2F7ZE 3R7GA 4B0GA 3KY2A 1MUOA 5L6WL 2W99B 3RM7A 3VF8A 4D5KA 3NWWA 4EKLA 3L1SA 1PXNA 2VV9A 2C68A 3N9XA 2SRCA 3DKCA 3DT1A 3I6WA 4GUBA 3R02A 4N0SA 3M11A 2GS2A 5J87A 4EKKA 2O64A 3QD3A 3KVXA 2C3KA 4KD1A 3LMGA 5L8LA 3GQLA 3LFDA 2BZKB 1WBPA 3SW7A 4AZSA 1PXIA 3NS9A 4NTSA 4DLIA 1F3MC 3FE3A 1IG1A 1GOLA 3HDMA 4CMUA 5CY3A 4DH7A 5J7HA 4I92A 2WTKB 4EQUA 4BI0A 5A9UA 4CKRA 5LCJA 1H1SA 4IVAA 3G9LX 3KXXA 2OFVA 4QMPA 2VNYA 3COMA 3BLRA 3QGWA 5AP0A 4UMUA 5K5XA 3O23A 3CTJA 5KMJA 2B0QA 4QMUA 4O86A 5HU9A 2XB7A 3EQRA 2Y6MA 3OXIA 1YXTA 3BGPA 2J5EA 1O9UA 2IW6A 5JKGA 4FSUA 4M69A 4PDPA 2UVYA 4RA4A 2XIKA 4W8DA 5IPJA 5AA9A 5L2SA 4FUYA 3A61A 4QYGA 4FTCA 2CKEA 3UQCA 5M4FA 4LOQA 2J0LA 4IZ5A 5ETCA 4WSQA 4DT8A 3ALNA 3QCSA 3VBTA 1JPAA 5E1EA 5GZAA 4ZS4A 2BUJA 4TYHB 4YC3A 4CYJA 3ZFXA 1BX6A 2RG5A 1SNUA 3UPZA 4JDHA 5HG9A 1K9AA 5BYYA 1YXUA 2QOFA 3OWPA 5IH6A 3ZCLA 5TKDA 5L6PA 2W1FA 3L9LA 4TKSA 5E8VA 2EVAA 2ITZA 4P7EA 5J7BA 1Q8UA 4ENXA 3BGZA 3C4WA 4I6HA 3VS1A 2QG5A 3OBJA 1UKHA 3F88A 3MPTA 2PUNA 3VULA 2C3LA 4GU9A 3VS5A 3KFAA 4GFOA 5LVLA 4N70A 4BB4A 3O71A 3QTWA 3RM6A 3BYSA 5FTOA 3A4PA 3V04A 3TZ7A 2WMQA 3M1SA 4RG0A 5AM7A 4CFVA 5DRBA 4BI2A 2J51A 4IB1A 4FG9A 4BTMA 5BQ0A 1UU8A 3NGAA 1V0OA 5L2WA 3LXKA 2J5FA 1MQ4A 4R6VA 5CSXA 3FBVA 5CQWA 4C61A 5A6OA 3S00A 4XP2A 3BHVA 5EDQA 5IDNA 2YIYA 1SYKA 2ESMA 3V5JA 5BUIA 3U6IA 5CTPA 4A9SA 1PXJA 1FGIA 4CRSA 4AFEA 4ZY4A 4FZ7A 5AR8A 2C0TA 4PPCA 4ZS0A 1SZMA 2X7GA 3ZEPA 4ALVA 4BZOA 4O7YA 5C4KA 1R39A 2VWUA 2WMSA 4L45A 3BGQA 3MH3A 5CAOA 4C34A 1CKIA 4XHKB 5AUUA 5JZJA 5IH5A 3NUNA 5IEVA 2WMBA 1PKGA 2YM7A 2W5BA 2XH5A 4JT3A 2X6DA 2C5VA 4ZP5A 5E91A 4KIKB 3HP2A 5EM7A 3W32A 3BX5A 4L7SA 2FUMA 4R3CA 3ZBXA 4C58A 4C4EA 4F08A 2C6KA 3JY0A 4HZSA 2BCJA 3AMAA 4F7SA 4PX6A 4HCVA 3DDPA 3GUBA 4AWIA 5K9IA 3PRIA 2CJMA 3VF9A 4C3PA 3R8UA 2ZV7A 1H26A 2HK5A 3PA5A 3PIXA 5EHLA 1PXLA 5D41A 5EHOA 3GFWA 3C9WA 3PXKA 1STCE 3IONA 3LCSA 3UMWA 3UPXA 4AGUA 2QOHA 1JQHA 3D0EA 3WF9A 4AN3A 4QO9A 5LVOA 3F3VA 2OK1A 4U7ZA 5HIDA 4CXAA 4D2TA 5FUTA 3R0TA 2IJMA 2H8HA 4FSRA 3QTZA 2Z02A 2C5OA 4NFMA 3E8NA 5AV0A 3TZ8A 4AZWA 3PY0A 4C02A 2XCKA 4F9BA 1WVYA 2UZBA 5KX8A 3UOJA 5FRIA 1H0WA 5M56A 1G8AA 4EOPA 3C51A 3QRTA 4EH3A 3NSZA 4C4HA 4I5HA 3Q4UA 2C5YA 2GMXA 3Q9WA 4GRBA 4GT4A 4H1JA 2A1AB 2AYPA 4KSPA 4RC4A 5CWZA 3MFRA 4K0YA 3N51A 3EN6A 4RJ8A 3OW3A 4D2PA 1IRKA 4C62A 2XK4A 2XNGA 2J4ZA 3BELA 2JDOA 3EOCA 5TE0A 4AGCA 3KRRA 4FGBA 3D7TB 2C3JA 1FPUA 4AGDA 3HL7A 3HMIA 5HOAA 5HE1A 3V5PA 3KA0A 1MQBA 1XWSA 5J5TA 2X4ZA 4FUXA 4GW8A 5CT7A 4H58A 4JAIA 4AN2A 2QHNA 4QMZA 2YJSA 3E5AA 4WUNA 5CU3A 3EFJA 3G9NA 3JVRA 2GU8A 4KINA 4U41A 2BAQA 3QZGA 4BGGA 4EHZA 4FSYA 3PIZA 4GK3A 4OTHA 1H01A 4QPSA 4C8BA 5E7RA 3V5WA 2R3QA 4ZLZA 1OB3A 2VU3A 3WZKA 5FM3A 1YDRE 5DGZA 4WNMA 3ZUUA 1CMKE 1YKRA 3VS3A 4CZUA 3LCOA 3AOXA 4YZDA 2ITQA 3KRWA 4QMOA 3G90X 3LOKA 5T3QA 3ZZEA 2CNUA 2KTYA 3AD5A 3P7CA 4WD5A 4AE9A 4LYNA 2VO7A 2XK7A 2C47A 4FTQA 4IJ9A 1W83A 3K5UA 2JLDA 3LCDA 3F5PA 4LOPA 3ULZA 3UQGA 3VBVA 5AJQA 1FGKA 3W33A 3C13A 3PE2A 3W2OA 2XIZA 2FH9A 4A9TA 4MXXA 4L67A 3TNWA 2QO9A 5L6OA 1GZOA 2NRYA 3ULIA 4E93A 4EH6A 3EH9A 3QYZA 2XMYA 3F6XA 4HW7A 2B9IA 3MTFA 3BZ3A 2O65A 4CFNA 4JG7A 4W9WA 3ACJA 3G0EA 5HO6A 3TNHA 5JGDA 1VEBA 2R3IA 5IQHA 1YHVA 2OJFE 5IQAA 1FVTA 1XH8A 4BCOA 2VAGA 3ORNA 1QMZA 4I0TA 2Y0AA 4FSMA 3U54A 3VW6A 5AP4A 1YI6A 5G6VA 3Q9YA 1RDQE 2P0CA 2VWXA 1ZWSA 2WEVA 1YWVA 3LXLA 1KUTA 4JRVA 4BIEA 4C59A 5C26A 3EZVA 3QTSA 4IWDA 4F99A 1PY5A 5C1QB 4ACMA 3F5XA 3Q6UA 3ZSIA 2F57A 3FL5A 4RFYA 4QQTA 3ZZWA 4X2NA 4ANLA 5A6NA 3AGMA 3OUKA 2PPQA 4ZTMA 2CMWA 4FK6A 2ZYBA 4G16A 4PUZA 3UIUA 1UWHA 3LQ8A 4AF3A 2CNQA 4H3BA 5FEDA 5M57A 4AQCA 4GEOA 3EZRA 4Q9ZA 5IKWA 2I40A 3DNEA 5BYZA 2XKFA 4HJOA 5LQFA 4X2KA 4YJSA 3KCKA 1IA8A 4FKVA 4ACCA 3A8WA 3NCGA 5LOHA 3NNWA 4APPA 3B8QA 4FSQA 4IMYA 1J7UA 5M44A 2BMCA 3ZXTA 4WO5A 3T9IA 3MFTA 3P9JA 3LZBA 4YTIA 3DS6A 2ETRA 2QC6A 3EKKA 5ANJA 5A4EA 2F2CB 1FVVA 1U46A 3QCXA 4X7QA 4FEWA 2YABA 1PKDA 2NRUA 3KRJA 3JR1A 2DYLA 3NW5A 5HHWA 4RVMA 4FTUA 4LGHA 2ZV2A 5AP6A 3WOWA 2ZVAA 1W84A 2WQEA 3OCGA 4FL3A 4O0UA 3MVMA 4UMTA 4KS7A 4GU6A 3MIYA 5EOLA 3FMJA 4ZMFA 4RX8A 3DK7A 5ANIA 3UNJA 2YCQA 1IR3A 4GFGA 1M14A 4BI1A 1JKKA 3LFNA 4JDKA 3F9NA 4O2PA 4BICA 1LUFA 5I9YA 3DU8A 5EK7A 3TIYA 3HV7A 2NP8A 4AXAA 4C37A 2B55A 1DI9A 3OS3A 4NWMA 4UMRA 1NW1A 3A2CA 5CSHA 2GHLA 3FXWA 3I81A 2YM5A 3NW7A 4FG7A 4XG2A 3SHEA 3AQVA 3I1AA 2XK6A 3IW5A 4BIDA 1T45A 4QTDA 4FTIA 4RT7A 4D1XA 1AD5A 5LARA 2BRNA 2HXLA 4D5HA 4CT2A 5DOSA 3EB0A 1APME 3UC3A 4DEEA 3LW0A 2VTRA 3PLAE 2V7AA 4ANSA 5EYCA 4O0YA 2X2KA 2C3IB 5E8XA 2GNGA 4FIJA 4BWPA 4OAVB 2EXMA 3D4QA 4BY9E 4FNYA 3FMEA 3IDBA 1J1BA 4F1OA 1GIIA 4PQNA 4EC9A 3PPJA 3HGKA 5AUWA 5M53A 3DK6A 3KC3A 4RMZA 5HCZA 1KE5A 2UZUE 2VO6A 5ETIA 3VAPA 2H96A 4V0GA 5FD2A 3C4ZA 4AT4A 4IE9A 3TNPC 3U4WA 4AUAA 2YDIA 4ZK5A 4B4LA 2CGWA 3WYXA 2UW6A 4RVTA 3DGKA 3ROCA 3O0GA 3DB8A 4F7LA 3E62A 4XJ0A 4M12A 4A7CA 2YITA 4B6LA 4EONA 4HCTA 1M7NA 5EOBA 3QALE 2ZOQA 4CG9A 3MB7A 4I94A 3LFBA 3OUNB 2C6EA 4ASEA 3AC8A 1QCFA 1ZYJA 3KXMA 1RW8A 4ZJVA 4PL4A 4IB0A 4WG5A 5CF4A 5KZ0A 4E4LA 4UALA 3W2QA 3FZSA 4HVIA 4FICA 1HOWA 4IEBA 3NW6A 4RQVA 2OKRA 4MF1A 3DBQA 4BKJA 2VO0A 3JPVA 5I3RA 5KKRC 3GCVA 4QMVA 4RJ3A 1BYGA 2W1GA 2JBOA 2XUUA 3L8SA 4HPTE 1BL7A 3CPBA 3P5KA 2WO6A 3EN5A 4EH5A 4A4LA 1R1WA 2QR7A 2P55A 3MFUA 3RPYA 4CLIA 4DGMA 4EQCA 4EZ5A 3EHAA 3EIDA 1WBSA 4MAOA 4PL5A 4YTFA 4KIOA 3F7ZA 4D4SA 2PVHA 2PE1A 3A7FA 2QKRA 2UW3A 4YPDA 3WILA 4EYMA 5J5SA 3PA3A 3QL8A 4HYHA 5DH3A 4AT5A 4DT9A 3FLSA 4RWJA 3RZBA 4C7TA 4H05A 3MI9A 4I22A 2KULA 3VWAA 3MPMA 3C1XA 3A62A 1ZMUA 2IZUA 3MJ2A 3P7AA 5FLFA 3QKMA 3M2WA 2HZ0A 2PZYA 4F0IA 4FEQA 2OBJA 1E1XA 3S2PA 2BKZA 2Z7QA 5FXQA 2BDWA 4DFUA 4BCGA 4QPMA 1U59A 4O0XA 3SV0A 2YN8A 5CI7A 4BDEA 3KU2A 4XUFA 3TJDA 1JBPE 1GZNA 1OUKA 2WTKC 3QRJA 4FBXA 4J71A 5FEEA 3UYSA 2Q83A 4NM7A 3L8VA 3TUDA 2WTWA 1OIUA 4I3ZA 1Q5KA 3MFSA 3GC9A 1Q8ZA 2P33A 4MBJA 5I9ZA 3VJNA 4MXCA 1E1VA 4BCMA 3ORIA 2PU8A 4TYHA 3UO4A 1CDKA 5H9BA 4EK5A 3QC4A 4CV9A 5GZ9A 3HP5A 2GCDA 4FV0A 3MH2A 5HG8A 3RNYA 2XRWA 3NYNA 3FQSA 4G2FA 1MP8A 4JOAA 3TV4A 4BBFA 1H1PA 3C4EA 4ASDA 4BDHA 3IDPA 2YM4A 3AT4A 2WXVA 3LMIA 3MDYA 3RPRA 2R4BA 2RGPA 5EM6A 3PYYA 3E3PA 5C03A 4TPTA 3V5TA 1OMWA 2W96B 4EHGA 4NTTA 1NVSA 2R3PA 4XV2A 2XRUA 4AG8A 4BDJA 3H0ZA 5L2TA 4PWNA 5DT4A 5HIEA 1Y91A 2V5QA 4Y85A 5A4QA 4O81A 4F9AA 3QTIA 5JT2A 4YO6A 3ZRKA 1IAJA 5HBJA 5KMOA 3PJ8A 4H3PA 4U43A 1UNHA 4QYFA 4FX3A 2HCKA 2XIYA 3TDVA 3HEGA 4U40A 2PULA 2XF0A 2ITVA 3DA6A 4XMOA 3R7EA 4TYJA 1K3AA 1G8SA 2HIWA 4EBVA 2GFCA 4WOVA 4E4MA 4PF4A 1NVQA 1XBAA 3S0OA 1Y57A 4LV5A 4U0IA 4Z9LA 4YLJA 4UBAA 4Q2AA 1XHAA 2E9OA 2WQMA 4ZY6A 4CCUA 3CD3A 2YEXA 5EDPA 3VVHA 3LFEA 4A06A 5HQ0A 2XKEA 2QO2A 3B2WA 4EH8A 1ND4A 1X8BA 5EKOA 5CSPA 2ZDUA 2PVJA 4G5PA 4LUEA 3Q3BA 4FTLA 3FHIA 4AOIA 4NW5A 3E87A 5CU4A 2OW3A 3FLWA 4HOKA 2P4IA 2C6MA 4G6LA 2Z2WA 3EFLA 3W8LA 1BL6A 4HGLA 4LMUA 3W1FA 3GFEA 4PDYA 3TL8A 3TZ9A 2E9NA 5BVWA 4M97A 3ZC6A 3UVPA 4KIKA 3NZ0A 4FT5A 4MF0A 4QMWA 4R1YA 3FV8A 2FA2A 3F3WA 3HYHA 2C4GA 3Q32A 4J99A 1NY3A 4JJRA 4O96A 3UNZA 4AP7A 1YDSE 2XEYA 3ODZX 4BDAA 4R1VA 3NNUA 3IG7A 2R3JA 2DS1A 3VBYA 2FB8A 4I4FA 3U55A 3JVSA 4HNFA 2JIIA 3R7IA 5GJGA 3F7WA 4AA5A 3CKWA 2OJJA 2F49A 3R7OA 3A7IA 4D2VA 2WNTA 2ZMCA 1RJBA 3L9NA 4G3GA 4KABA 1F0QA 2GNLA 3I60A 3SGCA 4QYEA 2JKOA 5M07A 5HVKA 2HOGA 5HG7A 4TTHB 4GSBA 4K2RA 2B9HA 4QYYA 3VC4A 2EUFB 4XYFA 4YLKA 3FY0A 3NX8A 3D5WA 3EQGA 4QTCA 4YSMA 5D9HA 3C0HA 2JFMA 2BFXA 3U6HA 4NL0A 2BILB 5FDPA 4DF3A 3U9NA 4M0ZA 4ZJJA 1OIQA 3QQGA 5EQYA 2B9FA 3PUPA 3IS5A 1BMKA 1MRUA 3W2SA 5C01A 2PVMA 4UZDA 1JKSA 4DC2A 2GS6A 1YXSA 3ETAA 3QTUA 4FODA 4OTWA 5JK3A 4WBBB 4YUQA 3QHWA 4FF8A 3FUPA 1H1WA 3MVLA 4Q5EA 3T9TA 2R3FA 2O3PA 2PTKA 4FMQA 3MSSA 3QA0A 4FV3A 4FSTA 4O1PA 5CVGA 5D7VA 2X8EA 2R3RA 4OTQA 4PTGA 3K2LA 5FBNC 4F1MA 2BTRA 2JIUA 3QF9A 4KWPA 3VHKA 3PSDA 5AR7A 2XK8A 4IQ6A 2I0VA 4G6NA 3P1AA 1KV2A 4D4RA 5L2IA 2W1DA 4FOCA 4D28A 5DFPA 4FV5A 3ZC5A 3QXPA 5JQ8A 4OT6A 4BCIA 2ERKA 4DBNA 4Z3VA 3WF7A 4S31A 3ZUVA 4AW1A 3P0MA 4ZTRA 4MYGA 4B8LA 4E5WA 2QODA 4YR8A 3O7LD 1H27A 1ZZLA 3OTVA 5H3QA 4BCNA 2CKOA 3LM5A 1L8TA 3FPMA 4J8NA 3WBLA 3CGOA 2CGXA 3HLLA 3VJOA 2C1BA 2EXEA 5GZ8A 3MYGA 3EFKA 3MY5A 4GG7A 5F1ZA 4FE2A 3DQWA 4F7JA 3DQXA 4K33A 2CLXA 4IB5A 2W4OA 2CHLA 4ANMA 3GCPA 1SVHA 3ELJA 2GSFA 2O5KA 2W1HA 3KQ7A 4MVFA 3SXSA 1JKLA 4UV0A 1YOLA 2BVAA 2UW4A 3PPZA 4IDVA 4MK0A 5AUXA 4AT3A 4ZTLA 3LMHA 4II5A 4R3PA 4F9WA 4YBKA 5KMIA 5IEYA 3ENMA 4I41A 2PVRA 5JH6A 3PXZA 3GU6A 1U54B 2QONA 2BRBA 3COIA 3Q4CA 2CCIA 3Q2JA 2BRGA 3TDWA 5AIRA 2ERZE 2X9EA 4FV2A 4XX9A 5EH0A 3LJ2A 5IDPA 2Y9QA 5J9ZA 3S95A 4M3QA 4O7LA 5T68A 3ZFMA 4IM3A 4BWKA 4ANBA 2QOKA 4O7RA 1REKA 5DT0A 4EHEA 4R7BA 3Q04A 1NVRA 1S9JA 4AGWA 4DEBA 2BAKA 1W8CA 4JX7A 5HVYA 4G9CA 1PW2A 3VO3A 4RX5A 4QYHA 4GKIA 3FEGA 3NPCA 3IPHA 3ZLSA 4RJ5A 2UVZA 2QVSE 2XBAA 1G3NA 2RSVA 5L8KA 2RIOA 2WOUA 4KKEA 1ZYCA 2P2HA 3PG1A 3COHA 5AP7A 4OUCA 4E26A 5TR6A 3OY1A 2ITXA 4CQGA 4LG4A 4DTKA 2NPQA 2WIPA 5ANGA 4CEGA 4DEIA 3DFCB 1ZRZA 2VTOA 3M42A 1GZKA 3GC7A 3CS9A 3IDCA 3UZTA 2C30A 2W06A 4RIWB 2X81A 2JC6A 3LFQA 2ITYA 4OTPA 5CF6A 4HCUA 2ZM4A 5I9WA 4PNIA 2W4JA 3CR0A 4RBLA 3D2IA 4K6ZA 3KN6A 3PIYA 4I20A 1WVWA 5JRSA 4O22A 4BTKA 4DEHA 3DXQA 5I9UA 4CFWA 4RQKA 4CZTA 2IZTA 3ZYAA 4PDOA 4EOKA 4F4PA 5CANA 3QAME 4EI4A 3BI6A 4XNEA 5EYDA 1Z57A 2OZAB 3DLZA 5ITAA 3BLQA 4DFZE 1ZYSA 2CLQA 3PA4A 4I93A 5IMXA 3A99A 2YZLA 3UOHA 3FMKA 2C1AA 3I0OA 4IXPA 1Y6AA 2BROA 5F94A 4IANA 4DA5A 1OIRA 4YJRA 5IA5A 5TT7A 3RCDA 4XOZA 4XG7A 4O21A 4RJ6A 5AUTA 3OFMA 4A9UA 4WNPA 2QNJA 5B2LA 2OWBA 1YXXA 4NFNA 3PVGA 5C4LA 4FKWA 4TT7A 3HAVA 1UWJA 2HY81 3FY2A 2RL5A 2OXXA 4ERKA 5BUEA 5K4JA 3C0GA 3QA8A 3LE6A 1F5QA 2WQBA 2OXYA 3SG8A 1KE8A 3FJQE 3AD6A 4N6YA 2V7OA 3R28A 3AMBA 4N6ZA 4OW8A 3L8XA 3HDNA 4XCUA 2PWLA 5DLSA 3ORLA 2OG8A 2OFUA 3R30A 5DE2A 2PZIA 3RINA 3VIDA 4YTCA 2W0JA 4IWOA 5EQEA 1SVGA 4IAIA 3PXFA 4J98A 3N4TA 5EYKA 3W8QA 2J6MA 3S1HA 1JOWB 4IJPA 5E8SA 5ICPA 4FTKA 4WG4A 5JN2A 5A46A 5KMNA 2ZV8A 3E8EA 3PXRA 4DITA 1GAGA 3ORTA 2GTMA 4S30A 3KXNA 4L9IA 4NUSA 1PMVA 5IUGA 4V05A 2OJ9A 1JLUE 2R3MA 2VTIA 4XG6A 5IUHA 2XK3A 3SXRA 3RWQA 1FMKA 4EH2A 3VUGA 1OPKA 4JQ7A 4DGLC 4U8ZA 4EK6A 2C5NA 3RK7A 2HY0A 4G17A 4BKYA 4KRCA 1YWNA 3V3VA 3ZSGA 4E4NA 3G15A 4FKTA 4GIIA 3FXZA 3TNQB 4WRSA 3QUPA 5EW9A 3VS0A 1UNLA 2JDVA 2XNBA 2X0GA 3R01A 4FKUA 4FSZA 3FQHA 2QLUA 3ZXZA 4D9UA 4LFIA 3TUCA 3KL8A 5HTBA 3MV5A 2Y8OA 4FKQA 3PY1A 2YHVA 1W7HA 4JDIA 4DFLA 4D55A 2JKKA 3RALA 3NUAA 3OWKA 3TEIA 1YXVA 4LL5A 4GYIA 4EK3A 4IC8A 4OTRA 5DA3A 1WBTA 2R3GA 4RC2A 2E9PA 5KMKA 1ATPE 3QFVA 4O6EA 2W7XA 4QMSA 4O84A 3EN7A 3HZTA 3PWDA 4BDDA 5E4HA 3VHEA 3IOKA 3R8MA 3D9VA 3O8TA 1OVEA 3PFQA 3FI4A 1BI7A 3IW4A 2Y6OA 3OMVA 3PXQA 4YU2A 4U44A 5B2MA 2WIHA 2QOCA 4DFXE 2QG7A 3CXWA 4JG6A 2VZ6A 2PVLA 2R3HA 4I6QA 2DWBA 5JFSA 4M14A 4PRJA 3CY2A 4QP2A 4HYIA 4BBMA 3O8PA 2ZM3A 4LRJA 5LVMA 4ACDA 3K3JA 1CSNA 1KE6A 2I0EA 3V8WA 3DOGA 1ZMWA 3WYYA 1PHKA 3KKVA 2WELA 3ET7A 4YPSA 1Q61A 3UZPA 5L4QA 2GTNA 4O82A 5EG3A 1JSTA 4CMOA 5M08A 5AM6A 5KMLA 2B1PA 2QD9A 5BUJA 4J8MA 4DH8A 5IQFA 2W1CA 5D7AA 4QQ5A 4A4XA 3PPKA 3QWKA 2PVFA 4UXLA 5CVFA 1OKWA 4MXZA 4PTCA 2QOIA 1UU3A 4WIHA 2QURA 2WHBA 4J96A 2OU7A 3G33A 2ITWA 1Q8TA 3HV3A 4FNXA 4GK4A 4NIFA 3QCQA 3ZS5A 5K0XA 3RGFA 4I5CA 3TIZA 3DZOA 2G2HA 4A4OA 3FL4A 3MA6A 5AV1A 4CV8A 4PMPA 5FP6A 2WTJA 3V8SA 5ETAA 4HVHA 3RTPA 4IIRA 5LMBA 1XQZA 2RG6A 4KB8A 3V6SA 3Q53A 3R04A 4L3PA 5JMSA 4YZNA 3ZO2A 3Q96A 4H36A 4KUJA 4EEVA 1I44A 3E92A 3UIBA 2QOBA 2C69A 2IN6A 4L46A 4O0RA 4XG9A 2ONLC 4XRLA 4YJTA 5IQDA 2XZSA 5AAGA 3BWFA 4QMYA 4JBQA 2JEDA 1ZYLA 4ZXTA 4P5ZA 3R9NA 1VYWA 2VWYA 4RFZA 5TF9A 4BGHA 1OPLA 4HYUA 3R2BA 3MBLA 2YCFA 3CQWA 3L9PA 3KXHA 5CZHA 1U5QA 4J7BA 3ZBFA 2GFSA 3FHRA 4XV1A 5JFWA 3RAHA 1ERKA 5C27A 3RKBA 4JLCA 3GVUA 3OZ6A 2YLFA 5J1VA 3LQ3A 1ZY4A 4ANQA 4L7FA 4OTGA 4DCEA 3BU6A 1MRYA 1O6LA 2ZV9A 3MVHA 5AP2A 4BHZA 3QGYA 4F6WA 5FEQA 4D0XA 2W1EA 1PXMA 4NJ3A 4YHJA 4BCHA 4EL9A 4K8AA 1PMEA 5ACKA 4UEUA 2XKCA 3UG2A 3GGFA 5GINE 2B7AA 4NCTA 1Z9XA 2VTSA 3P78A 4L44A 4P2KA 4WG3A 1QPJA 4D9TA 2XNPA 4ZTNA 4YO4A 4G3EA 2VGPA 3DDQA 1GIJA 3REPA 5DT3A 4NCTC 4FA2A 4IVDA 4FEUA 4IX5A 3OCBA 1SMHA 5A4TA 1P5EA 2JIVA 3H0YA 4PP7A 3E7OA 2X7FA 3GCUA 4K18A 4JBOA 4TN6A 4PV0A 3LFFA 4QNAA 2WGJA 3P7BA 5AUYA 2G1TA 2Y4PA 4HPUE 4LL0A 2XM8A 2RF9A 5I9XA 4RLKA 4EOJA 5KNJA 4E73A 2WQNA 2XKDA 2CGVA 1OL1A 4V01A 1Q62A 2UW8A 4J53A 2BIYA 3Q6WA 1I09A 3VS4A 4C38A 4KKGA 1ZARA 3QXOA 2G01A 4M13A 4NU1A 5H8BA 4F9CA 4YMJA 1OL6A 4YLLA 1ZYDA 1HCKA 1ZY5A 3QQUA 4RWLA 2J0MB 2UV2A 3II5A 3MESA 5EYMA 3CJGA 3KXGA 5AUVA 3QZIA 4RIOA 4I1ZA 3GB2A 4XG4A 5J9YA 4UN0C 2PYWA 4JI9A 4RGJA 2I6LA 4BDBA 4GJ3A 2PMIA 4UZHA 5HTIA 4F9YA 2UVXA 1URWA 2REIA 4OT5A 5A14A 4IDTA 2C0OA 4LRKA 3AD4A 4W9XA 4E5BA 5BVNA 5E1SA 2IW8A 1H25A 3WZUA 4IVCA 5DRDA 4O0SA 4UMQA 4PTEA 5GNKA 3WF6A 4FT3A 2WAJA 5AV3A 3WIGA 5CEPA 1YOMA 1SNXA 4TWOA 4HYSA 4BIBA 3W10A 3UBDA 2VTJA 4F64A 2FGIA 3LIJA 5EI8A 5A3XA 2Y4IB 2ETKA 3R22A 4UYNA 5BVEA 3UIXA 1YHSA 2JDSA 4WSYA 1P4FA 3GU4A 3SDJA 4FIIA 2O8YA 4U42A 3PJCA 1BI8A 3OP5A 2XVDA 3CE3A 3EFWA 2JDTA 3WE4A 2H6DA 3EQHA 5F9EA 3PVUA 5JFVA 4C3RA 4CQEA 3OY3A 5IH4A 4N57A 5HESA 2YLEA 3H3CA 4MH7A 2XNOA 2UZTA 5DIAA 3IKAA 3RZFA 4BYIA 1IA9A 2UW9A 3SD0A 2RFDA 1NA7A 1SVEA 3FQEA 4O83A 3E64A 3FI2A 4M69B 5K3YA 3FZOA 4X6QC 4U97A 3PSBA 3NAXA 4H3QA 3A7HA 3F5UA 3AG9A 2X7OA 3Q9XA 2BHEA 3DXPA 2ITNA 3TKUA 4USEA 5FXRA 2OH4A 5AX3A 4GT3A 3P86A 4EHVA 3A7GA 4GL9A 4AN9A 3SA0A 1B39A 3NIEA 1CTPE 3SRVB 5M4CA 5IQGA 4UMPA 1QPEA 4A9RA 4C2VA 3KF7A 4WKQA 1U54A 5AAEA 3HKOA 2P3GX 3TWJA 5LWNA 2CCHA 3CC6A 1OPJA 5BVOA 4QTAA 3WARA 1R0PA 5IA0A 3P23A 4L3LA 1B6CB 5E90A 3R9RA 2XP2A 2VWBA 3FDNA 4GYGA 3V01A 4X21A 4BTFA 4WRGA 4FIHA 5M09A 5CU6A 2CGUA 3QX4A 1URCA 5GIOE 1Q3DA 3R1NA 2BTSA 1H1RA 1LEZA 4O6LA 4LOOA 3C0IA 4S2ZA 4FSWA 2WEIA 3ZONA 1S9IA 3OT8A 2XIXA 2XA4A 4NW6A 2X8IA 5IQCA 1TQIA 4MWIA 3BYOA 4DEGA 4CTCA 4CLJA 4X3JA 3HMOA 1REJA 3E8DA 4W4XA 4AZFA 2XK9A 2WU7A 3OCTA 3Q60A 4XLIA 4D58A 3ZO4A 5HO7A 3NNVA 4S34A 2V22A 2OIBA 1SM2A 1ZOHA 4O0TA 4QQJA 2GHMA 2QOQA 3FAAA 1P14A 3G2FA 3MIAA 2GNHA 4HGTA 4HZRA 4RIWA 4YJOA 3TT0A 3TCPA 4FTJA 3VUHA 5CEMA 5J9LA 2YDJA 4BF2A 5M55A 2O0UA 2PMNX 3EQIA 4FZDB 3D2KA 4BBEA 2OJGA 3ORXA 1WCCA 4ID7A 4UWCA 5B2KA 3G6GA 4BDCA 5C8NA 4ZZOA 3LLTA 3LJ1A 3UP7A 4AA4A 4FGRA 3I79A 3FWQA 3NCZA 2XS0A 4IB3A 4FKIA 4WA9A 4X6RA 3GT8A 4I0SA 3U51A 4D2RA 5A4LA 1H0VA 1O6KA 1OUYA 5CSVA 4P5QA 3ZDIA 2WKMA 1GZ8A 1XO2B 5HIBA 4OGRA 1UKIA 3GOPA 4XG3A 3QWJA 3TM0A 2FSMX 3QZFA 2JITA 3QTRA 4FTNA 4M15A 4WNOA 4EK4A 3ZM9A 3RK5A 4M0YA 3KB7A 3QQFA 3GC0A 3OHTA 3EN9A 3VUTA 3WIKA 5CAQA 5K5NA 5KCVA 5LMKC 3CSVA 2CN5A 4Z16A 3F2NA 3W18A 3DXNA 4EOQA 5HI2A 3KREA 4NH1A 3ACKA 5DEWA 5CAVA 3BHUA 2BZJA 2JAVA 4F7NA 2PUUA 4TY1A 4RX7A 4YURA 1YI3A 2RFEA 2R9SA 5D10A 2ZB1A 4HGSA 3F3TA 3V8TA 3R63A 3FMHA 4FKJA 4RPVA 4L01A 3GNIB 5HLNA 5ANKA 3HAMA 2EB3A 1P4OA 4YP8A 4U45A 4AW0A 4EOSA 5FTGA 4RIYB 4MHAA 1OBDA 4O91A 3PJ3A 2PZRA 3U9CA 3D7ZA 4P90A 3TV7A 5KBRA 3BLHA 4OR5A 4DLJA 5EKNA 1XR1A 2IO6A 4RVLA 4MQ2A 3C4CA 4ZTSA 2UW7A 4D2WA 1GJOA 2YCRA 2W4KA 3F2AA 3BE2A 3DCVA 3VS7A 2R7BA 3KVWA 3LXPA 3VN9A 4EUUA 3O51A 4BDGA 4G1WA 3CIKA 3DAKA 3SAYA 2O63A 3GU8A 2WB8A 4C36A 1OL7A 4R5YA 3WZDA 4DN5A 4TNBA 4C3FA 4KRDA 4RRVA 1Q4LA 5JZNA 1PMUA 2Z7SA 4LGDA 2VWIA 4ZEGA 5CAUA 2YIQA 3JUHA 4F0FA 4Z55A 4UXQA 5FP5A 4BWXA 4FKPA 3BHYA 3A8XA 3FPQA 4YZMA 4CKIA 3EL8A 3LAUA 1KWPA 2G15A 2YAAA 5HE3A 4F70A 2HW6A 2DUVA 4M84A 5KE0A 2QKWB 3NYOA 5T6KA 3EQFA 2C6LA 2PL0A 5FBOA 5LXMA 4AZTA 2WZJA 3DTWA 2VUWA 4I5PA 4PPBA 5E8UA 4NJDA 1FVRA 2G2IA 3HV6A 2J0KA 4I23A 3RAIA 2G2FA 3FC1X 3RHKA 3FI8A 4IX3A 3EYHA 2R5TA 4GK2A 4ZLYA 3R7VA 5J1WA 4E3CA 4AZVA 4UWYA 3OG7A 3UOLA 5D1JA 2A4LA 2BR1A 2IWIA 4E6CA 2CKQA 4BCPA 1TQPA 2WMAA 2YIRA 4YBJA 2VWVA 5E8TA 4KBCA 2YAKA 5CEIA 4MXOA 4PP9A 3ATSA 3F2RA 4Y5QA 4QMTA 4EH4A 1OKVA 4EZ7A 1WBOA 3F66A 2PSQA 3EN4A 3LFCA 4ALUA 3TNIA 2Z8CA 5CXZA 3K5VA 4ERWA 4CFMA 4CD0A 4MWHA 4QMMA 3OEZA 4FSNA 3GXLA 3ZLXA 4NM3A 5HCXA 4WT6A 3EYGA 4OTIA 4D4YA 3ZM4A 4AE6A 2OICA 1XH6A 5G1XA 1FQ1B 3ORZA 4KSQA 4PDSA 2YA9A 4ZTQA 3FI3A 1RQQA 2BPMA 3F3ZA 3PWYA 4O7TA 4TNDA 3SKCA 4KBKA 4X3FB 2O2UA 4BDIA 2X2LA 3VUKA 4A07A 4BGQA 3U6JA 4GFMA 2XJ1A 2V0DA 3RK9A 5DYJA 3GP0A 4G6OA 1XJDA 4OTDA 5FG8A 4NM0A 3HA6A 1H08A 3BYUA 3D83A 4DEDA 4FTTA 3D7TA 3IO7A 2RFNA 5H8EA 5IEXA 1HCLA 2A27A 5DHJA 2HZIA 3QZHA 3CTHA 5M4IA 4KAOA 4MBIA 4S32A 3ZRMA 2PZPA 3PVWA 3BIZA 4L00A 4IX6A 3ANQA 5AX9A 4BVUA 4ANOA 3HRBA 5IA1A 4ACHA 1PRYA 3UMXA 4L68A 5ACBC 2YM8A 4DAWA 2UZWE 5HNIX 3O8UA 2OF2A 2YISA 2FSTX 4MX9A 4F09A 2H34A 1OECA 4IHPA 2QOOA 5EHYA 3H30A 3UOKA 4J52A 4ZAUA 4IFGA 3MVJA 4NSTA 5AR4A 3ITZA 4FKGA 2ITTA 2X4FA 2CN8A 4FT0A 4Y72A 4QTEA 5HU3A 3RJCA 1WFCA 4E1ZA 3DNDA 3P08A 3IOPA 3OROA 1YDTE 2WQOA 3A60A 4LMNA 4IW0A 1YI4A 4DE4A 3SLSA 2YERA 3TUBA 3QUDA 3MB6A 3VS6A 4RJ7A 1VZOA 3CTQA 5BPYA 5FXSA 4FEXA 5HO8A 4FKRA 4JRNA 4WNKA 1H4LA 5FWKK 4D1ZA 4ITIA 4TL0A 4L43A 4XLVA 4EORA 2VTNA 1QPDA 5ANDA 4JXFA 1G5SA 3RAKA 4KKHA 4EC8A 4APCA 2X8DA 3NMUF 4O1OA 4BCJA 4WHZA 4ASZA 2VGOA 3F82A 3ZSHA 3AXWA 4CG8A 4FR4A 4NM5A 1YHWA 2J50A 1YRPA 2R2PA 4BZDA 4EOOA 4TWNA 1W98A 3FLNC 4RX9A 2BZIB 3RMFA 5AP5A 4FTMA 4B7TA 1H1QA 1BKXA 2ZM1A 2B52A 2ZAZA 1OKZA 1WZYA 2VTAA 2ZB0A 3DB6A 2VTHA 4O7VA 5E92A 4G31A 5FGKA 1PYEA 2PUPA 4C33A 2WMTA 3BV3A 3NNXA 3Q4TA 3R21A 5HCYA 5HBHA 2UW0A 5DR2A 2GNFA 4FV1A 3UZRA 4FG8A 2HWOA 2ZJWA 3GENA 3KULB 2HZ4A 4GCJA 4NKAA 3DJ7A 2A2AA 4QP7A 3UC4A 2FSLX 3R8LA 1J91A 2FSOX 4IVBA 4LI5A 5CAPA 2HYYA 2C6IA 4QMXA 3DBDA 2GHGA 5L8JA 4BRXA 5AADA 5CALA 4BR3A 2WD1A 1QL6A 2IVTA 5CS6A 3TACA 3MPAA 1ZXEA 4IAKA 3EQDA 3MH1A 3DKOA 4Q9SA 3R00A 3DJ5A 4DG3E 4XG8A 4PNKA 1OKYA 4DGGA 5DR6A 5HLWA 1WBVA 3FZRA 3QKLA 1V0PA 2Q0NA 2YDKA 3OTUA 3PTGA 1M52A 4OBPA 3R9DA 2BHHA 5LCKA 4DGNA 4M7IA 4XP0A 2EXCX 4UY9A 3V6RA 1JSUA 1UV5A 3E63A 4ZSJA 3U4UA 4R8QA 4BCKA 2JKQA 5KHXA 2HW7A 3RNIA 5DEYA 3UVRA 5BNJA 2VN9A 2VTQA 2ZMDA 2XBJA 3C7QA 2WOTA 3POZA 4FTOA 5AV4A 4IAYA 5AR5A 2X1NA 3BU5A 4CSVA 4FYNA 3LKMA 4W4WA 3ROYA 2CKPA 3Q5IA 4C4JA 4FI1A 1Q8YA 5DBXA 2CNVA 4F6UA 5HEZA 4JIAA 2Y4IC 3TZMA 3EQPA 1IAHA 3BHHA 2WMVA 1RE8A 3NUUA 3IGGA 4FTAA 2OI4X 5HORA 4FNZA 4AW2A 1IEPA 3R1YA 4W8EA 4BYJA 2WMXA 3NR9A 4RWIA 3ZTXA 2JGZA 4FV8A 2W1IA 3UJGA 1JAMA 3DBCA 4XP3A 3CQUA 5DI1A 5AR2A 3UGCA 5E8WA 4EWHA 2PMLX 5IA2A 3QQLA 2EU9A 1PXKA 4OLIA 1W82A 4YTHA 5FQDC 5JGAA 5CT0A 2BDFA 3TV6A 2VWWA 4QT1A 3RCJA 4ZY5A 3ID6C 3QTQA 2QQ7A 4ITJA 4C57A 3DLSA 3UE4A 4RIXB 5AR3A 3R8PA 2VTMA 3LVPA 4X2JA 3SRVA 5KMMA 3QKKA 1YW2A 3FKLA 3ZLYA 3CJFA 4FKSA 4HNIA 4S33A 1XKKA 5CEQA 2IW9A 4F0GA 4JL9A 4DHFA 3GCQA 4P4CA 3D94A 4RZWA 4DTBA 3OEFX 3W2RA 4R77A 4RC3A 3FMLA 5DR9A 4E6QA 5AEPA 4USFA 2R7IA 4EWQA 3DAJA 1Q99A 2W9ZB 3D14A 3HNGA 5HX6A 1XBBA 2XYUA 4O0VA 4ZSLA 3GI3A 3NUSA 1Q24A 3VQUA 5CNNA 5IMEA 3MTLA 1M7QA 4GH2A 1LR4A 4GIHA 4EH9A 4PY1A 1KSWA 1FINA 2WMRA 3AC5A 3UNKA 3BE9A 4JG8A 4MBLA 4B99A 3OC1A 5A4CA 2OXDA 3EQBA 4KNBA 4QRCA 3T8OA 4CMTA 5HX8A 5CNOA 1FMOE 2OLCA 3RPOA 2R3OA 3HRCA 4FT9A 4I24A 5I3OA 3AT3A 3CGFA 3HMNA 3QC9A 5H8GA 2GQSA 2R64A 3W16A 2HELA 2PE0A 3FKNA 3TG1A 4ENYA 4UX9A 4EOIA 2BALA 3MJ1A 3R1SA 2R0IA 2Q0BA 4IAAA 3OT3A 5CVHA 2JDRA 1R0EA 2F7XE 3I7CA 5AWMA 5M06A 3E7VA 1JWHA 3IW8A 5EM5A 3KK8A 3HUCA 4R3RA 4XOYA 1NT2A 4MXYA 3QYWA 4XH6A 4XBRA 1WAKA 4MQ1A 4AA0A 4QMQA 5L2QA 4J97A 3TKIA 2BRMA 2WPAA 3C4XA 4ARKA 5CEKA 3RI1A 2VTLA 5IF1A 2ITOA 5KUPA 3R1QA 4LUDA 1MRVA 1GY3A 3C50A 2IZRA 2GQRA 2AC3A 1GIHA 4JS8A 4RSSA 5BMSA 4Y95A 5CASA 2JKMA 5E9EA 5CI6A 5DVRA 2B54A 4FV9A 4IM2A 3DAEA 3Q9ZA 3QX2A 5L3AA 1WBNA 4YNOA 2I0HA 3Q52A 1H8FA 2J90A 2WFYA 4U5JA 4C4IA 4CT1A 4JR3A 3KN5A 1UU7A 5FTQA 3H9FA 4DFYA 4E4XA 2CSNA 4BDKA 4IADA 4PPAA 3CPCA 3I6UA 5HD7A 4E6AA 1LP4A 5BYLA 3Q5ZA 2JFLA 4Y83A 2OIDA 4MNEB 3HVCA 1OL2A 4G9RA 1J1CA 2IVSA 4B8MA 4K9YA 4TWCA 1FBNA 4ASXA 4ZLOA 3RP9A 2X2MA 1OM1A 2QCSA 3BPRA 3JXWA 3ZEWA 4DGOA 4I6BA 3ORPA 1UVRA 3BQRA 3PRFA 1XBCA 1LPUA 3PDTA 3SG9A 4EUTA 5EW8A 2WTDA 4WBOA 3ZHPC 3ORMA 4RIYA 4NYEA 1GNGA 4ZOGA 2ONLA 2OH0E 2YFXA 4X0MA 4QP4A 3OBGA 4ACGA 4GS6A 2IPXA 3PSCA 5HICA 5KHWA 3BYVA 2YIWA 4R7HA 4BDFA 3WZJA 5F20A 4AU8A 4KBAA 2VRXA 3L8PA 4A9YA 4K1BA 3VRYA 4CNHA 5EM8A 3EKNA 1P2AA 3SOAA 3VQHA 3CKXA 2HZNA 3ZO1A 3QLFA 3HV4A 1DI8A 4W4VA 1XH9A 2PVKA 4FK3A 1QPCA 3QHRA 2V62A 4IM0A 4ONAA 3KCFA 4UYAA 2IVVA 4LQMA 3RVGA 5HG5A 3FXXA 3CP9A 2C6TA 3OWLA 4QP6A 3EL7A 4G5JA 3VS2A 4NK9A 4CVAA 1O6YA 1ZLTA 5ANOA 2BZHB 1JSVA 3FMNA 2QLQA 4BN1A 4FVRA 4DFBA 2BKKA 2XJ2A 3CD8A 3F69A 1JNKA 3TI1A 5HD4A 3G6HA 2GDOA 3AC3A 4FIGA 2YWVA 5ETFA 5J79A 3PJ2A 4FKLA 4FVPA 4G34A 3KRLA 5CQUA 5JGBA 3GOKA 1WMKA 2C5XA 4DH1A 2F9GA 4FZAB 3VNTA 3O50A 3UIMA 5JFXA 3QQHA 3QD4A 4G3FA 3BCEA 4J95A 2ACXA 1EH4A 1JVPP 3RPSA 2Y7JA 2V55A 1H00A 3QUEA 3CQEA 2FVDA 4ITHA 4MNFA 3WZEA 5HTCA 2X39A 3CEKA 3NAYA 5DN3A 1V0BA 4RVKA 2C6DA 4E20A 3UG1A 4O7NA 4FC0A 4IZAA 4YJPA 4IFCA 4AOJA 4F63A 3EWHA 3FZPA 3OXTA 4U3ZA 4MTAA 2QU6A 5D12A 1CKJA 2XYNA 2QHMA 3NRMA 3N4VA 3R7UA 2P2IA 3KF4A 5E8ZA 3OVVA 4IAZA 4QMNA 3PVBA 3W2CA 2XEZA 2YM6A 2YZAA 3MA3A 4K11A 3UDBA 5IA4A 3HA8A 4FL2A 3IK3A 3RAWA 1IASA 3H9OA 3ZDUA 4YNEA 3FSFA 4YZBA 4EJNA 3FMMA 4MD7E 2W5HA 3ATTA 2E9VA 2F7EE 4AX8A 5LVNA 4G3CA 3DJ6A 3U8WA 4FKOA 4NZWB 3GCSA 3RWPA 3I7BA 3R73A 5DWRA 3DZQA 3PE1A 2J9MA 4X3FA 3VW8A 1DM2A 2W17A 4DG2E 1M17A 1U5RA 3G51A 4JQ8A 5BMMA 2LAVA 3O2MA 4ZMEA 5BVKA 3SX9A 3ZRLA 1OIYA 3QQKA 3GU5A 4X3FC 3SVVA 5AAFA 2XNNA 3T3UA 1YWRA 3R2YA 4GUEA 3KMUA 5LMAA 3ALOA 3DTCA 4U81A 3OCSA 3MY0A 4D0WA 4AZEA 4NEUA 2OIQA 4MCVA 3LM0A 5I9VA 3MN3A 3QRIA 4D2SA 3O7LB 3OOGA 5LJJA 4CGAA 3NUXA 1J3HA 4GVJA 2UUEA 4JBPA 4QNYA 4DBXA 3BU3A 4EYJA 4BHNA 1R3CA 2UZDA 4L53A 5CU2A 1L3RE 1PJKA 2QOLA 4ZIMA 1T46A 2XCHA 3THBA 1FOTA 2JD5A 3TN8A 4Y8DA 1VJYA 3NUPA 5ANEA 4C35A 4BC6A 4AAAA 4R7IA 4XRJA 2HENA 4RA5A 4CTBA 3PJ1A 2I1MA 2Z7RA 4IWQA 3SC1A 4XV9A 3W55A 3NEWA 4IX4A 3R9HA 2R3KA 2C0IA 3ZO3A 4EZ3A 4JIKA 3FZTA 4FNWA 4BCQA 3WF8A 4K77A 5CU0A 2R0UA 4HGEA 5AFVA 3BWJA 5GIPE 1PF8A 3K3IA 4TXCA 5HLPA 3WE8A 5BVDA 3S4QA 3NUYA 4L6QA 5HZNA 4TYIA 1BUHA 4QPAA 5CF5A 2WTVA 4OBOA 1KE7A 4Y46A 4YJQA 2AUHA 4YC6A 3SQQA 5EFQA 5GJFA 3UP2A 4FL1A 4IBMA 3QU0A 2WTCA 3VBQA 4L3JA 3DY7A 3FYJX 1ZAOA 3FLYA 3UO6A 2PVNA 1KOAA 2QU5A 2R3NA 4FZ6A 4I6FA 2PVYA 3A4OX 3G0FA 3NYVA 3H10A 3PZEA 2IZSA 4E7WA 4JVGA 4RJ4A 3NVKI 3P4KA 1KOBA 1Q41A 2GPHA 1YVJA 2J2IB 4EH7A 3DKFA 4ZSEA 3K54A 1OL5A 3BV2A 5IUIA 3KEXA 1Y6BA 2VX0A 1PXOA 2YWPA 3HECA 1H24A 3TXOA 4E8AA 4YZ9A 1Y8GA 3QD2B 2J7TA 1PXPA 2RKUA 3T3VA 3QTXA 2JAMA 3EQCA 3EJ1A 5IG1A 2BIKB 3FC2A 4W4YA 4X2FA 2IG7A 3TKHA 4QP8A 3RPVA 5KO1A 3H4JA 3I5ZA 4JX3A 1CM8A 3LXNA 3OXZA 5J95A 2UZEA 1VR2A 4ZZNA 3TTIA 2QI8A 4M68A 2YACA 3O17A 2OGVA 1PYXA 4YJVA 1M2QA 4TYEA 3OF0A 2Z7LA 3C5UA 5HGIA 4KIQA 3KULA 2X9FA 2YM3A 4U6RA 5M51A 2XNEA 3U87A 4XV3A 5K0KA 3L9MA 1E9HA 4Y73A 4JAJA 4QP9A 4EBWA 4Q5HA 2PE2A 4LRMA 4H1MA 2W5AA 3MWUA 3D5UA 3LPBA 3IW6A 4U3YA 3NDMA 3UYTA 4QP1A 2W05A 2LGCA 2OJIA 3VBXA 2XNMA 2PZ5A 3ZLWA 4I0RA 3SXFA 5JQ5A 5TOZA 4ANNA 1Q8WA 3B8RA 5E8YA 3UVQA 4BL1A 4FOBA 3PP1A 4DINA 5JEBA 3R8VA 5KBQA 3FLZA 4M67A 4KS8A 3ORKA 4XBUA 2OO8X 2UZNA 1TKIA 2C6OA 3R7YA 5HNBA 2AC5A 3CCNA 4CRLA 1XH4A 4JQEA 2WU6A 3AT2A 2HWPA 5CLPA 3HRFA 4U80A 3I5NA 4DYMA 3BEAA 3QRKA 4KA3A 4D1SA 4HVSA 5IQBA 4CZYB 3S3IA 2OZAA 2QO7A 1K2PA 2FYSA 2H9VA 1Z5MA 3KK9A 3F3UA 4PL3A 3C5IA 5DNRA 2OSCA 2R3LA 2E2BA 4CYIA 4R78A 5LMKA 1OI9A 1UNGA 4IZYA 4GJ2A 4F6SA 2GS7A 1XH5A 4DFNA 1KV1A 2FO0A 3UTOA 5AP3A 3DK3A 3MW1A 3H9RA 2G9XA 4EOMA 3LFAA 3IGOA 1UA2A 3MGYA 4RZVA 4V04A 3KXZA 2Z60A 1DAYA 4F1TA 4TRLA 4GG5A 3DBFA 3WF5A 1YOJA 4QP3A 5HKMA 5I0BA 1M2PA 3LCTA 1OGUA 4MKCA 4AS0A 4ZSAA 4M66A 4O7ZA 3E88A 4MD8E 2VTTA 4BCFA 4EQMA 2A0CX 2HAKA 5EDRA 3ODYX 3V5QA 4CCBA 1OITA 4FEVA 4XEYA 3AC2A 4UWBA 4KIPA 4BZNA 3LQ5A 1WBWA 3VUDA 3OW4A 5CXHA 4ZJIA 3KMMA 4DEAA 4EJ7A 4AOTA 2ETMA 1M2RA 2W9FB 4DCAA 4QOXA 5AP1A 4RIXA 5AA8A 2GNIA 4DTAA 3QQJA 2GQGA 3QBNA 4U79A 4YSJA 5LVPA 1H07A 2QR8A 4N4SA 4X2GA 4NIFB 1J7IA 5IZFA 4R5SA 5IQEA 3ZOSA 4Y5HA 3NVMB 4O38A 4O2ZA 4RLLA 5FM2A 5HNGA 5J8IA 3BEGA 3KGAA 3R8ZA 2VWZA 3FZ1A 3QRUA 4O0WA 3MS9A 5CENA 2XM9A 5IA3A 2PUIA 5C8KA 4CFXA 2CPKE 3ZMMA 3LHJA 5AIKA 3ZUTA 3F5GA 3NYXA 3O96A 3A7JA 2PMOX 3B2TA 3PXYA 4YGAA 4LV8A 4AACA 4BTJA 4RWKA 4USDA 5IQIA 3D15A 2I0YA 5D11A 2E9UA 1KE9A 3HMMA 5GHVA 4LM5A 1WVXA 5DG5A 1OZ1A 3VBWA 2BDJA 1LEWA 3FYKX 4CFFA 4IAFA 4EK8A 4C2WA 3DFAA
chains in the Genus database with same CATH superfamily
4O27B 3BQCA 1ZOEA 2DQ7X 1U4DA 4GV1A 5IU2A 4HVGA 4I21A 4MD9E 3W2PA 4DH5A 5AMNA 3N4UA 5CX9A 3JS2A 3VRZA 4E5AX 3NLBA 3D5XA 2XJ0A 3GC8A 5CYIA 5LWMA 1Y8YA 3DPKA 3CBLA 4LGGA 5F4NA 5H2UA 4FV6A 3AC1A 4JBVA 4QD6A 4IACA 1AQ1A 4EOLA 3KIOC 3MY1A 5HE0A 4DH3A 2VX3A 2YJRA 4IZ7A 3MH0A 4CKJA 3P79A 3R6XA 3UDZA 4FYOA 1BLXA 2RFSA 2B4SB 5CEOA 4OBQA 4YHFA 3QD0A 2VNWA 3BHTA 2X6EA 3EMGA 4QMLA 4Z7HA 2PHKA 4GT5A 2HXQA 2BAJA 2ITPA 1Q3WA 4FIFA 2BRHA 2YCSA 4B9DA 1ZMVA 2A19B 3D5VA 2B9JA 3FKOA 3R71A 3V5LA 5BX0A 4OAUC 5I4NA 3GQIA 4YHTA 5F95A 3AMYA 3QLGA 3CLYA 2NO3A 2PK9A 4PMMA 4DG0E 3LLAA 3BBWA 1YQJA 3DKGA 5K4IA 2PY3A 5B7VA 1AGWA 5HBEA 1R78A 5GJDA 4MNEA 1A9UA 3GU7A 4NKSA 5CZIA 4F65A 3ERKA 1CKPA 3LCKA 4L52A 3HMPA 4IH8A 4J1RA 3RBWA 1A06A 4FVQA 4YJUA 5EI6A 3ZH8A 5C9CA 4I5MA 3HUBA 4XS2A 3OD6X 3TJCA 3LFSA 3G5DA 1V1KA 3TTJA 1TQMA 3PG3A 3GBZA 3UQFA 3RHXA 1DS5A 4YC8A 1J7LA 4JR7A 3PP0A 2UZOA 1UU9A 2CDZA 3R83A 4JDJA 2OZOA 4PMTA 4IC7A 2J0IA 2WMUA 4BKZA 1ND4A 1ZZ2A 4ZZMA 5A54A 5CF8A 3JY9A 4IWPA 4MXAA 4BFMA 5M4UA 3ZFYA 4FIEA 4FV7A 3AC4A 2ITUA 2I7QA 3R9OA 4E6DA 3SOCA 4M8TA 4GKHA 3UO5A 5BVFA 2WMWA 3IECA 3IW7A 3ANRA 3PY3A 3SW4A 4RFMA 2UZVA 2GNJA 2UW5A 4LV7A 4C4FA 3GEQA 4NT4A 3I4BA 5JSMA 1JKTA 3FLQA 3KRXA 4I4EA 4FTRA 4FT7A 5JRQA 2NNWB 4TYGA 3DV3A 5AV2A 1NXKA 3HV5A 3PLSA 5C8MA 5EI2A 4HVDA 2EB2A 3NIZA 5HE2A 3HX4A 4MEDA 1ZOGA 4FZFB 4WUAA 2VD5A 3FSKA 1A48A 2YIXA 2F2UA 3FMDA 4AFJA 2J0JA 4D4VA 1XH7A 3VONA 3BRBA 4U9AA 3WI6A 4L8MA 2XIRA 4OTFA 4FV4A 3PZHA 3VUIA 5DMZA 3CY3A 1B38A 4C4GA 3POOA 1Q97A 4UB7A 4Z7GA 4V0GB 2F4JA 4TW9A 4ALWA 2VTPA 3C4FA 3JYAA 1W0XC 3BBTB 3IQ7A 3LJ0A 4JNWA 3UODA 3V51A 1DAWA 5TO8A 1H28A 2BFYA 4QTBA 4G3DA 4ZSGA 5AUZA 3BKBA 4O7WA 3Q2MA 4C0TA 2JBPA 4YZCA 4TZRA 4H39A 4TWPA 3ENHA 3ZU7A 4ORKA 4YJNA 3OWJA 3Q4ZA 1PMNA 2VX1A 5I5ZA 3KMWA 5IISA 5KKRB 5EQPA 3OOMA 5KZIA 3VUMA 1TVOA 2ZDTA 2UZLA 4L42A 4ZTHA 2OF4A 4GMYA 3E3BX 1VYZA 4AW5A 1OBGA 2WTIA 5CSWA 3COKA 5HVJA 3BYMA 4O7SA 2W1ZA 4QQCA 4PMSA 3AGLA 3E93A 2VO3A 2EWAA 5EW3A 3DBEA 5DPVA 5FDXA 5B0XA 3QCYA 2B53A 4GVAA 3F61A 2IVUA 3E8CA 4CFUA 3I0QA 2F7ZE 3R7GA 4B0GA 3KY2A 1MUOA 5L6WL 2W99B 3RM7A 3VF8A 4D5KA 3NWWA 4EKLA 3L1SA 1PXNA 2VV9A 2C68A 3N9XA 2SRCA 3DKCA 3DT1A 3I6WA 4GUBA 3R02A 4N0SA 3M11A 2GS2A 5J87A 4EKKA 3BL9A 2O64A 3QD3A 3KVXA 2C3KA 4KD1A 3LMGA 5L8LA 3GQLA 3LFDA 2BZKB 1WBPA 3SW7A 4AZSA 1PXIA 3NS9A 4NTSA 4DLIA 1F3MC 3FE3A 1IG1A 1GOLA 3HDMA 4CMUA 5CY3A 4DH7A 5J7HA 4I92A 2WTKB 4EQUA 4BI0A 5A9UA 4CKRA 5LCJA 1H1SA 4IVAA 3G9LX 3KXXA 2OFVA 4QMPA 2VNYA 3COMA 3BLRA 3QGWA 5AP0A 4UMUA 5K5XA 3O23A 3CTJA 5KMJA 2B0QA 4QMUA 4O86A 5HU9A 2XB7A 3EQRA 2Y6MA 3OXIA 1YXTA 3BGPA 2J5EA 1O9UA 2IW6A 5JKGA 4FSUA 4M69A 4PDPA 2UVYA 4RA4A 2XIKA 4W8DA 5IPJA 5AA9A 5L2SA 4FUYA 3A61A 4QYGA 4FTCA 2CKEA 3UQCA 5M4FA 4LOQA 2J0LA 4IZ5A 5ETCA 4WSQA 4DT8A 3ALNA 3QCSA 3VBTA 1JPAA 5E1EA 5GZAA 4ZS4A 4QDVA 2BUJA 4TYHB 4YC3A 4CYJA 3ZFXA 1BX6A 2RG5A 1SNUA 3UPZA 4JDHA 5HG9A 1K9AA 5BYYA 1YXUA 2QOFA 3OWPA 5IH6A 3ZCLA 5TKDA 5L6PA 2W1FA 3L9LA 4TKSA 5E8VA 2EVAA 2ITZA 4P7EA 5J7BA 4JMQA 1Q8UA 4ENXA 3BGZA 3C4WA 4I6HA 3VS1A 2QG5A 3OBJA 1UKHA 3F88A 3MPTA 2PUNA 3VULA 2C3LA 4GU9A 3VS5A 3KFAA 4GFOA 5LVLA 4N70A 4BB4A 3O71A 3QTWA 3RM6A 3BYSA 5FTOA 3A4PA 3V04A 3TZ7A 2XALA 2WMQA 3M1SA 4RG0A 5AM7A 4CFVA 5DRBA 4BI2A 2J51A 4IB1A 4FG9A 4BTMA 5BQ0A 1UU8A 3NGAA 1V0OA 5L2WA 3LXKA 2J5FA 1MQ4A 4R6VA 5CSXA 3FBVA 5CQWA 4C61A 5A6OA 3S00A 4XP2A 3BHVA 5EDQA 5IDNA 2YIYA 1SYKA 2ESMA 3V5JA 5BUIA 3U6IA 5CTPA 4A9SA 1PXJA 1FGIA 4CRSA 4AFEA 4ZY4A 4FZ7A 5AR8A 2C0TA 4PPCA 4ZS0A 1SZMA 2X7GA 3ZEPA 4ALVA 4BZOA 4O7YA 5C4KA 1R39A 2VWUA 2WMSA 4L45A 3BGQA 3MH3A 5CAOA 4C34A 1CKIA 4XHKB 5AUUA 5JZJA 5IH5A 3NUNA 5IEVA 2WMBA 1PKGA 2YM7A 2W5BA 2XH5A 4JT3A 2X6DA 2C5VA 4ZP5A 5E91A 4KIKB 1ST0A 3HP2A 5EM7A 3W32A 3BX5A 4L7SA 2FUMA 4R3CA 3ZBXA 4C58A 4C4EA 4F08A 2C6KA 3JY0A 4HZSA 2BCJA 3AMAA 4F7SA 4PX6A 4FJVA 4HCVA 3DDPA 3GUBA 4AWIA 5K9IA 3PRIA 2CJMA 3VF9A 4C3PA 3R8UA 2ZV7A 1H26A 2HK5A 3PA5A 3PIXA 5EHLA 1PXLA 5D41A 5EHOA 3GFWA 3C9WA 3PXKA 1STCE 3IONA 3LCSA 3UMWA 3UPXA 4AGUA 2QOHA 1JQHA 3D0EA 3WF9A 4AN3A 4QO9A 5LVOA 3F3VA 2OK1A 4U7ZA 5HIDA 4CXAA 4D2TA 5FUTA 3R0TA 2IJMA 2H8HA 4FSRA 3TMOA 3QTZA 2Z02A 2C5OA 4NFMA 3E8NA 5AV0A 3TZ8A 4AZWA 3PY0A 4C02A 2XCKA 4F9BA 1WVYA 2UZBA 5KX8A 3UOJA 5FRIA 1H0WA 5M56A 1G8AA 4EOPA 3C51A 3QRTA 4EH3A 3NSZA 4C4HA 4I5HA 3Q4UA 2C5YA 2GMXA 3Q9WA 4GRBA 4GT4A 4H1JA 2A1AB 2AYPA 4KSPA 4RC4A 5CWZA 3MFRA 4K0YA 3N51A 3EN6A 4RJ8A 3OW3A 4D2PA 1IRKA 4C62A 2XK4A 2XNGA 2J4ZA 3BELA 2JDOA 3EOCA 5TE0A 4AGCA 3KRRA 4FGBA 3D7TB 2C3JA 1FPUA 4AGDA 3HL7A 3HMIA 5HOAA 5HE1A 3V5PA 3KA0A 1MQBA 1XWSA 5J5TA 2X4ZA 4FUXA 4GW8A 5CT7A 4H58A 4JAIA 4AN2A 2QHNA 2XAOA 4QMZA 2YJSA 3E5AA 4WUNA 5CU3A 3EFJA 3G9NA 3JVRA 2GU8A 4KINA 4U41A 2BAQA 3QZGA 4BGGA 4EHZA 4FSYA 3PIZA 4GK3A 4OTHA 1H01A 4QPSA 4C8BA 5E7RA 3V5WA 2R3QA 4ZLZA 1OB3A 2VU3A 3WZKA 5FM3A 1YDRE 5DGZA 4WNMA 3ZUUA 1CMKE 1YKRA 3VS3A 4CZUA 3LCOA 3AOXA 4YZDA 2ITQA 3KRWA 4QMOA 3G90X 3LOKA 5T3QA 3ZZEA 2CNUA 2KTYA 3AD5A 3P7CA 4WD5A 4AE9A 4LYNA 2VO7A 2XK7A 2C47A 4FTQA 4IJ9A 1W83A 3K5UA 2JLDA 3LCDA 3F5PA 4LOPA 3ULZA 3UQGA 3VBVA 5AJQA 1FGKA 2A98A 3W33A 3C13A 3PE2A 3W2OA 2XIZA 2FH9A 4A9TA 4MXXA 4L67A 3TNWA 2QO9A 5L6OA 1GZOA 2NRYA 3ULIA 4E93A 4EH6A 3EH9A 3QYZA 2XMYA 3F6XA 4HW7A 2B9IA 3MTFA 3BZ3A 2O65A 4CFNA 4JG7A 4W9WA 3ACJA 3G0EA 5HO6A 3TNHA 5JGDA 1VEBA 2R3IA 5IQHA 1YHVA 2OJFE 5IQAA 1FVTA 1XH8A 4BCOA 2VAGA 3ORNA 1QMZA 4I0TA 2Y0AA 4FSMA 3U54A 3VW6A 5AP4A 1YI6A 5G6VA 3Q9YA 1RDQE 2P0CA 2VWXA 1ZWSA 2WEVA 1YWVA 3LXLA 1KUTA 4JRVA 4BIEA 4C59A 5C26A 3EZVA 3QTSA 4IWDA 4F99A 1PY5A 5C1QB 4ACMA 3F5XA 3Q6UA 3ZSIA 2F57A 3FL5A 4RFYA 4QQTA 3ZZWA 4X2NA 4ANLA 5A6NA 3AGMA 3OUKA 2PPQA 4ZTMA 2CMWA 4FK6A 2ZYBA 4G16A 4PUZA 3UIUA 1UWHA 3LQ8A 4AF3A 2CNQA 4H3BA 5FEDA 5M57A 4AQCA 4GEOA 3EZRA 4Q9ZA 5IKWA 2I40A 3DNEA 5BYZA 2XKFA 4HJOA 5LQFA 4X2KA 4YJSA 3KCKA 1IA8A 4FKVA 4ACCA 3A8WA 3NCGA 5LOHA 3NNWA 3W0MA 4APPA 3B8QA 4FSQA 4IMYA 1J7UA 5M44A 2BMCA 3ZXTA 4WO5A 3T9IA 3MFTA 3P9JA 4AAYA 3LZBA 4YTIA 3DS6A 2ETRA 2QC6A 3EKKA 5ANJA 5A4EA 2F2CB 1FVVA 1U46A 3QCXA 4X7QA 4FEWA 2YABA 1PKDA 2NRUA 3KRJA 3JR1A 2DYLA 3NW5A 5HHWA 4RVMA 1XMLA 4FTUA 4LGHA 2ZV2A 5AP6A 3WOWA 2ZVAA 1W84A 2WQEA 3OCGA 4FL3A 4O0UA 3MVMA 4UMTA 4KS7A 4GU6A 3MIYA 5EOLA 3FMJA 4ZMFA 4RX8A 3DK7A 5ANIA 3UNJA 2YCQA 1IR3A 4GFGA 1M14A 4BI1A 1JKKA 3LFNA 4JDKA 3F9NA 4O2PA 4BICA 1LUFA 5I9YA 3DU8A 5EK7A 3TIYA 3HV7A 2NP8A 4AXAA 4C37A 2B55A 1DI9A 3OS3A 4NWMA 4UMRA 1NW1A 3A2CA 5CSHA 2GHLA 3FXWA 3I81A 2YM5A 3NW7A 4FG7A 4XG2A 3SHEA 3AQVA 3I1AA 2XK6A 3IW5A 4BIDA 1T45A 4QTDA 4FTIA 4RT7A 4D1XA 1AD5A 5LARA 2BRNA 2HXLA 4D5HA 4CT2A 5DOSA 3EB0A 1APME 3UC3A 4DEEA 3LW0A 2VTRA 3PLAE 2V7AA 4ANSA 5EYCA 4O0YA 2X2KA 2IF8A 2C3IB 5E8XA 2GNGA 4FIJA 4BWPA 4OAVB 2EXMA 3D4QA 4BY9E 4FNYA 3FMEA 3IDBA 1J1BA 4F1OA 1GIIA 4PQNA 4EC9A 3PPJA 3HGKA 5AUWA 5M53A 3DK6A 3KC3A 4RMZA 5HCZA 1KE5A 2UZUE 2VO6A 5ETIA 3VAPA 2H96A 4V0GA 5FD2A 3C4ZA 4AT4A 4IE9A 3TNPC 3U4WA 4AUAA 2YDIA 4ZK5A 4B4LA 2CGWA 3WYXA 2UW6A 4RVTA 3DGKA 3ROCA 3O0GA 3DB8A 4F7LA 3E62A 4XJ0A 4M12A 4A7CA 2YITA 4B6LA 4EONA 4HCTA 1M7NA 5EOBA 3QALE 2ZOQA 4CG9A 3MB7A 4I94A 3LFBA 3OUNB 2C6EA 4ASEA 3AC8A 1QCFA 1ZYJA 3KXMA 1RW8A 4ZJVA 4PL4A 4IB0A 4WG5A 5CF4A 5KZ0A 4E4LA 4UALA 3W2QA 3FZSA 4HVIA 4FICA 1HOWA 4IEBA 3NW6A 4RQVA 2OKRA 4MF1A 3DBQA 4BKJA 2VO0A 3JPVA 5I3RA 5KKRC 3GCVA 4QMVA 4RJ3A 1BYGA 2W1GA 2JBOA 2XUUA 3L8SA 4HPTE 1BL7A 3CPBA 3P5KA 2WO6A 3EN5A 4EH5A 4A4LA 1R1WA 2QR7A 3W0PA 2P55A 3MFUA 3RPYA 4CLIA 4DGMA 4EQCA 4EZ5A 3EHAA 3EIDA 1WBSA 4MAOA 4PL5A 4YTFA 4KIOA 3W0RA 3F7ZA 4D4SA 2PVHA 2PE1A 3A7FA 2QKRA 2UW3A 4YPDA 3WILA 4EYMA 5J5SA 3PA3A 3QL8A 4HYHA 5DH3A 4AT5A 4DT9A 3FLSA 4RWJA 3RZBA 2AQXA 4C7TA 4H05A 3MI9A 4I22A 3AKLA 2KULA 3VWAA 3MPMA 3C1XA 3A62A 1ZMUA 2IZUA 3MJ2A 3P7AA 5FLFA 3QKMA 3M2WA 2HZ0A 2PZYA 4DHZA 3UDTA 4F0IA 4FEQA 2OBJA 1E1XA 3S2PA 2BKZA 2Z7QA 5FXQA 2BDWA 4DFUA 4BCGA 4QPMA 1U59A 4O0XA 3SV0A 2YN8A 5CI7A 1XMMA 4BDEA 3KU2A 4XUFA 3TJDA 1JBPE 1GZNA 1OUKA 2WTKC 3QRJA 4FBXA 4J71A 5FEEA 3UYSA 2Q83A 4NM7A 3L8VA 3TUDA 2WTWA 1OIUA 4I3ZA 1Q5KA 3MFSA 3GC9A 1Q8ZA 2P33A 4MBJA 5I9ZA 3VJNA 4MXCA 1E1VA 4BCMA 3ORIA 2PU8A 4TYHA 3UO4A 1CDKA 5H9BA 4EK5A 3QC4A 4CV9A 5GZ9A 3HP5A 2GCDA 4FV0A 3MH2A 5HG8A 3RNYA 2XRWA 3NYNA 3FQSA 4G2FA 1MP8A 4JOAA 3TV4A 4BBFA 1H1PA 3C4EA 4ASDA 4BDHA 3IDPA 2YM4A 3AT4A 2WXVA 3LMIA 3MDYA 3RPRA 2R4BA 2RGPA 5EM6A 3PYYA 3E3PA 5C03A 4TPTA 3V5TA 1OMWA 2W96B 4EHGA 4NTTA 1NVSA 2R3PA 4XV2A 2XRUA 4AG8A 4BDJA 3H0ZA 5L2TA 4PWNA 5DT4A 5HIEA 1Y91A 2V5QA 4Y85A 5A4QA 4O81A 4F9AA 3QTIA 5JT2A 4YO6A 3ZRKA 1IAJA 5HBJA 5KMOA 3PJ8A 4H3PA 4U43A 1UNHA 4QYFA 4FX3A 2HCKA 2XIYA 3TDVA 3HEGA 4U40A 2PULA 2XF0A 2ITVA 3DA6A 4XMOA 3R7EA 4TYJA 1K3AA 1G8SA 2HIWA 4EBVA 2GFCA 4WOVA 4E4MA 4PF4A 1NVQA 1XBAA 3S0OA 1Y57A 4LV5A 4U0IA 4Z9LA 4YLJA 4UBAA 4Q2AA 1XHAA 2E9OA 2WQMA 4ZY6A 4CCUA 3CD3A 2YEXA 5EDPA 3VVHA 3LFEA 4O4FA 4A06A 1W2FA 2QO2A 3B2WA 2XKEA 4EH8A 1X8BA 5HQ0A 5EKOA 5CSPA 2ZDUA 2PVJA 4G5PA 4LUEA 3Q3BA 4FTLA 3FHIA 4AOIA 4NW5A 3E87A 5CU4A 2OW3A 3FLWA 4HOKA 2P4IA 2C6MA 4G6LA 2Z2WA 3EFLA 3W8LA 1BL6A 4HGLA 4LMUA 2AEGA 3W1FA 3GFEA 4PDYA 3TL8A 3TZ9A 2E9NA 4DDIA 5BVWA 4M97A 3ZC6A 3UVPA 4KIKA 3NZ0A 4FT5A 4MF0A 4QMWA 4R1YA 3FV8A 2FA2A 3F3WA 3HYHA 2C4GA 3Q32A 4J99A 1NY3A 4JJRA 4O96A 3UNZA 4AP7A 1YDSE 2XEYA 3ODZX 3BL7A 4BDAA 4R1VA 3NNUA 3IG7A 2R3JA 2DS1A 3VBYA 2FB8A 4I4FA 3U55A 3JVSA 4HNFA 2JIIA 3R7IA 5GJGA 3F7WA 4AA5A 3CKWA 2OJJA 2F49A 3R7OA 1OGYA 3A7IA 4D2VA 2WNTA 2ZMCA 1RJBA 3L9NA 4G3GA 4KABA 1F0QA 2GNLA 3I60A 3SGCA 4QYEA 2JKOA 5M07A 5HVKA 2HOGA 5HG7A 4TTHB 4GSBA 4K2RA 3PUFC 2B9HA 4QYYA 3VC4A 2EUFB 4XYFA 4YLKA 3FY0A 3NX8A 3D5WA 3EQGA 4QTCA 4YSMA 5D9HA 3C0HA 2JFMA 2BFXA 3U6HA 4NL0A 2BILB 5FDPA 4DF3A 3U9NA 4M0ZA 4ZJJA 1OIQA 3QQGA 5EQYA 2B9FA 3PUPA 3IS5A 1BMKA 1MRUA 3W2SA 5C01A 2PVMA 4UZDA 1JKSA 4DC2A 2GS6A 1YXSA 3ETAA 3QTUA 4FODA 4OTWA 2XANA 5JK3A 4WBBB 4YUQA 3QHWA 4FF8A 3FUPA 1H1WA 3MVLA 4Q5EA 3T9TA 2R3FA 2O3PA 2PTKA 4FMQA 3MSSA 3QA0A 4FV3A 4FSTA 4O1PA 5CVGA 5D7VA 2X8EA 2R3RA 4OTQA 4PTGA 3K2LA 4DDGA 5FBNC 4F1MA 2BTRA 2JIUA 3QF9A 4KWPA 3VHKA 3PSDA 5AR7A 2XK8A 4IQ6A 1W2CA 2I0VA 4G6NA 3P1AA 1KV2A 4D4RA 5L2IA 2W1DA 4FOCA 4D28A 5DFPA 4FV5A 3ZC5A 3QXPA 5JQ8A 4OT6A 4BCIA 2ERKA 4DBNA 4Z3VA 3WF7A 4S31A 3ZUVA 4AW1A 3P0MA 4ZTRA 4MYGA 4B8LA 4E5WA 2QODA 4YR8A 3O7LD 1H27A 1ZZLA 3OTVA 5H3QA 4BCNA 2CKOA 4AQKA 3LM5A 1L8TA 3FPMA 4J8NA 3WBLA 3CGOA 2CGXA 3HLLA 3VJOA 2C1BA 2EXEA 5GZ8A 3MYGA 3EFKA 3MY5A 4GG7A 5F1ZA 4FE2A 3DQWA 4F7JA 3DQXA 4K33A 2CLXA 4IB5A 2W4OA 2CHLA 4ANMA 3GCPA 1SVHA 3ELJA 2GSFA 2O5KA 2W1HA 3KQ7A 4MVFA 3SXSA 1JKLA 4UV0A 1YOLA 2BVAA 2UW4A 3PPZA 4IDVA 4MK0A 5AUXA 4AT3A 4ZTLA 3LMHA 4II5A 4R3PA 4F9WA 4YBKA 5KMIA 5IEYA 3ENMA 4I41A 2PVRA 5JH6A 3PXZA 3GU6A 1U54B 2QONA 2BRBA 3COIA 3Q4CA 2CCIA 3Q2JA 2BRGA 3TDWA 5AIRA 2ERZE 2X9EA 4FV2A 4XX9A 5EH0A 3LJ2A 5IDPA 2Y9QA 5J9ZA 3S95A 4M3QA 4O7LA 5T68A 3ZFMA 4IM3A 4BWKA 4ANBA 2QOKA 4O7RA 1REKA 5DT0A 4EHEA 4R7BA 3Q04A 1NVRA 1S9JA 4AGWA 4DEBA 2BAKA 1W8CA 4JX7A 5HVYA 4G9CA 1PW2A 3VO3A 4RX5A 4QYHA 4GKIA 3FEGA 2ZFYA 3NPCA 3IPHA 3ZLSA 4RJ5A 2UVZA 2QVSE 2XBAA 1G3NA 2RSVA 5L8KA 2RIOA 2WOUA 4KKEA 1ZYCA 2P2HA 3PG1A 3COHA 5AP7A 4OUCA 4E26A 5TR6A 3OY1A 2ITXA 4CQGA 4LG4A 4DTKA 2NPQA 2WIPA 5ANGA 4CEGA 4DEIA 3DFCB 1ZRZA 2VTOA 3M42A 1GZKA 3GC7A 3CS9A 3IDCA 3UZTA 2C30A 2W06A 4RIWB 2X81A 2JC6A 3LFQA 2ITYA 4OTPA 5CF6A 4HCUA 2ZM4A 5I9WA 5BV3A 4PNIA 2W4JA 3CR0A 4RBLA 3D2IA 4K6ZA 3KN6A 3PIYA 4I20A 1WVWA 5JRSA 4O22A 4BTKA 4DEHA 3DXQA 5I9UA 4CFWA 4RQKA 4CZTA 2IZTA 3ZYAA 4PDOA 4EOKA 4F4PA 5CANA 3QAME 4EI4A 3BI6A 4XNEA 5EYDA 1Z57A 2OZAB 3DLZA 5ITAA 3BLQA 4DFZE 1ZYSA 2CLQA 3PA4A 4I93A 5IMXA 3A99A 4O4DA 2YZLA 3UOHA 3FMKA 2C1AA 3I0OA 4IXPA 1Y6AA 2BROA 5F94A 4IANA 4DA5A 1OIRA 4YJRA 5IA5A 5TT7A 3RCDA 4XOZA 4XG7A 4O21A 4RJ6A 5AUTA 3OFMA 4A9UA 4WNPA 2QNJA 5B2LA 2OWBA 1YXXA 4NFNA 3PVGA 5C4LA 4FKWA 4TT7A 3HAVA 1UWJA 2HY81 3FY2A 2RL5A 2OXXA 4ERKA 5BUEA 5K4JA 3C0GA 3QA8A 3LE6A 1F5QA 2WQBA 2OXYA 3SG8A 1KE8A 3FJQE 3AD6A 4N6YA 2V7OA 3R28A 3AMBA 4N6ZA 4OW8A 3L8XA 3HDNA 4XCUA 2PWLA 5DLSA 3ORLA 2OG8A 2OFUA 3R30A 5DE2A 2PZIA 3RINA 3VIDA 4YTCA 2W0JA 4IWOA 5EQEA 1SVGA 4IAIA 3PXFA 4J98A 3N4TA 5EYKA 3W8QA 2J6MA 3S1HA 1JOWB 4IJPA 5E8SA 5ICPA 4FTKA 4WG4A 5JN2A 5A46A 5KMNA 2ZV8A 3E8EA 3PXRA 4DITA 1GAGA 3ORTA 2GTMA 4S30A 3KXNA 4L9IA 4NUSA 1PMVA 5IUGA 4V05A 2OJ9A 1JLUE 2R3MA 2VTIA 4XG6A 5IUHA 2XK3A 3SXRA 3RWQA 1FMKA 4EH2A 3VUGA 1OPKA 4JQ7A 4DGLC 4FRFA 4U8ZA 4EK6A 2C5NA 3RK7A 4BJJB 2HY0A 4G17A 4BKYA 4KRCA 1YWNA 3V3VA 3ZSGA 4E4NA 3G15A 4FKTA 4GIIA 3FXZA 3TNQB 4WRSA 3QUPA 5EW9A 3VS0A 1UNLA 2JDVA 2XNBA 2X0GA 3R01A 4FKUA 4FSZA 3FQHA 2QLUA 3ZXZA 4D9UA 4LFIA 3TUCA 3KL8A 5HTBA 3MV5A 2Y8OA 4FKQA 3PY1A 2YHVA 1W7HA 4JDIA 4DFLA 4D55A 2JKKA 3RALA 3NUAA 3OWKA 3TEIA 1YXVA 4LL5A 4GYIA 4EK3A 4IC8A 4OTRA 5DA3A 1WBTA 2R3GA 4RC2A 2E9PA 5KMKA 1ATPE 3QFVA 4O6EA 2W7XA 4QMSA 4O84A 3EN7A 3HZTA 3PWDA 4BDDA 5E4HA 3VHEA 3IOKA 3R8MA 3D9VA 3O8TA 1OVEA 3PFQA 3FI4A 1BI7A 3IW4A 2Y6OA 3OMVA 3PXQA 4YU2A 4U44A 5B2MA 2WIHA 2QOCA 4DFXE 2QG7A 3CXWA 4JG6A 2VZ6A 2PVLA 2R3HA 4I6QA 2DWBA 5JFSA 4M14A 4PRJA 3CY2A 4QP2A 4HYIA 4BBMA 3O8PA 2ZM3A 4LRJA 5LVMA 4ACDA 3K3JA 1CSNA 1KE6A 2I0EA 3V8WA 3DOGA 1ZMWA 3WYYA 1PHKA 3KKVA 2WELA 3ET7A 4YPSA 1Q61A 3UZPA 5L4QA 2GTNA 4O82A 5EG3A 1JSTA 4CMOA 5M08A 5AM6A 5KMLA 4QEBA 2B1PA 2QD9A 5BUJA 4J8MA 4DH8A 5IQFA 2W1CA 5D7AA 4QQ5A 4A4XA 3PPKA 3QWKA 3PFYA 2PVFA 4UXLA 5CVFA 1OKWA 4MXZA 4PTCA 2QOIA 1UU3A 4WIHA 2QURA 2WHBA 4J96A 2OU7A 3G33A 2ITWA 1Q8TA 3HV3A 4FNXA 4GK4A 4NIFA 3QCQA 3ZS5A 5K0XA 3RGFA 4I5CA 3TIZA 3DZOA 2G2HA 4A4OA 3FL4A 3MA6A 5AV1A 4CV8A 4PMPA 5FP6A 2WTJA 3V8SA 5ETAA 4HVHA 3RTPA 4IIRA 5LMBA