3QD7X

Crystal structure of ydal, a stand-alone small muts-related protein from escherichia coli
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
131
structure length
131
Chain Sequence
DTLQLDNFLTTGFLDIIPLSQPLEFRREGLQHGVLDKLRSGKYPQQASLNLLRQPVEECRKMVFSFIQQALADGLRNVLIIHGKGRDDKSHANIVRSYVARWLTEFDDVQAYCTALPHHGGSGACYVALRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of YdaL, a stand-alone small MutS-related protein from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Uncharacterized protein ydaL
total genus 38
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2011-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01713 Smr Smr domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3qd7X00
3FAUA 3QD7X 4OCHA 2D9IA 2ZQEA 4OD6A 2VKCA
chains in the Genus database with same CATH superfamily
1Z2IA 1UG8A 3KDGA 2JEAI 4DR7H 1PQXA 1VBIA 1ZZIA 2ZM6H 3OTOH 4DV7H 4B3RH 4X64H 5IT9W 2HH2A 2JZXA 1X4NA 2E3UA 4JI8H 4KHPH 1F0XA 3OETA 3GKUA 2OPUA 2FMRA 2UUCH 2ZQEA 3J81W 5C0XG 3T1HH 1IBKH 2VQFH 1X4MA 4G08A 5BR8H 4JI0H 4X62H 2E5LH 4X65H 4B3TH 1NXUA 4LFCH 5JEAG 2PT7G 4JVYA 4JV5H 1WHRA 2VQEH 5LMNH 2CTFA 2LRRA 3QD7X 4OCHA 2D9IA 3T1YH 1IBLH 3V69A 2LTLA 3U1KA 3EZJA 4JI6H 1SEIA 4LF7H 1DTJA 5LMUH 4EC5A 4NXMH 1FJGH 5LL6b 1ZZKA 1I94H 4FJUA 4AIMA 1S03G 4DUYH 1VIHA 4NZRM 5FLXW 4B8CD 1J5EH 2OPVA 3I0PA 2JVZA 3SB1A 1EC6A 4DV6H 4LFAH 2PQUA 4OX9H 1XNRH 4LIJA 1HNZH 1WE8A 4B3SH 1TUAA 4LFBH 2CWHA 4B8TA 2F4VH 1WTJA 3J80W 2CTEA 4GKJH 4JI1H 2FFMA 3RF2A 4IFDG 1AN7A 1X0AA 4BA2I 1N32H 3FAUA 4NBQA 2MJHA 5K36G 2UU9H 2AXYA 4DR6H 3L7ZC 2BA0A 4DR1H 4GKKH 4LF5H 3VKEA 2JE6I 3UOEA 4DV4H 2HHHH 4DR2H 3J7AK 4BA1I 2CPMA 4DV0H 2CPQA 2X06A 5A2QW 4DUZH 2P2RA 4LF6H 2CTKA 4NZTM 4AQYH 4NXNH 4JYAH 4DV1H 4DV5H 4PDBA 1WVNA 4H8AA 2UUAH 3GR5A 3OSSD 5IWAH 4JI2H 1FKAH 1XMQH 2ANRA 4K0KH 2BL5A 1VIGA 4OD6A 2CWFA 4LF8H 4JI3H 4QMFB 1J5KA 2PY9A 2NN6G 2CTMA 4JI7H 3NCVA 2LF0A 1N34H 2YQRA 1XMOH 2A1SA 3JAMW 3GABA 1J4WA 4WANA 1HNWH 1KHMA 4DR3H 1HR0H 1X9ZA 4DR5H 1ODHA 2LTMA 2ANNA 2QNDA 2CTLA 4WALA 4AM3A 4X66H 1DT4A 4JI4H 2UXDH 2Y3MA 1HNXH 2K1HA 5DT9A 2Z0SA 2M8WA 2CTJA 4DV2H 3AEVB 1ZTGA 4OO1G 2UXCH 2JEBI 2M6QA 4B3MH 1XNQH 2JA9A 1N36H 1N33H 1MSZA 1I6UA 2UUBH 1V9NA 4YHHH 4E9JA 4YY3H 1V8CA 2DGRA 4FJSA 4DV3H 1XRHA 1IBMH 2G8YA 4JI5H 1ZZJA 2O4CA 4LF4H 4JVHA 2FPHX 1S20A 1K1GA 3KDKA 2VKCA 2UXBH 4LF9H 4DR4H 2HH3A
chains in the Genus database with same CATH topology
3KDGA 4DR7H 2ZM6H 3OTOH 4DV7H 4B3RH 4X64H 5IT9W 4JI8H 4KHPH 1F0XA 3OETA 2UUCH 2ZQEA 3J81W 3T1HH 1IBKH 2VQFH 5BR8H 4G08A 4JI0H 4X62H 2E5LH 4X65H 4B3TH 4LFCH 2PT7G 4JV5H 2VQEH 5LMNH 3QD7X 4OCHA 2D9IA 3T1YH 1IBLH 3EZJA 4JI6H 1SEIA 4LF7H 5LMUH 4EC5A 4NXMH 1FJGH 5LL6b 1I94H 1S03G 4DUYH 4NZRM 5FLXW 4B8CD 1J5EH 3SB1A 4DV6H 4LFAH 4OX9H 1XNRH 1HNZH 4B3SH 4LFBH 2F4VH 3J80W 4GKJH 4JI1H 3RF2A 1AN7A 1N32H 3FAUA 2UU9H 4DR6H 4DR1H 4GKKH 4LF5H 4DV4H 3J7AK 2HHHH 4DR2H 4DV0H 5A2QW 4DUZH 4LF6H 4NZTM 4AQYH 4NXNH 4JYAH 4DV1H 4DV5H 4PDBA 2UUAH 3GR5A 3OSSD 5IWAH 4JI2H 1FKAH 1XMQH 4K0KH 4OD6A 4LF8H 4JI3H 4JI7H 3NCVA 2LF0A 1N34H 1XMOH 3JAMW 3GABA 1HNWH 4DR3H 1HR0H 1X9ZA 4DR5H 1ODHA 4X66H 2UXDH 4JI4H 2Y3MA 1HNXH 5DT9A 4DV2H 2UXCH 4B3MH 1XNQH 1N36H 1N33H 1I6UA 2UUBH 4YHHH 4E9JA 4YY3H 4DV3H 1IBMH 4JI5H 2O4CA 4LF4H 2FPHX 2UXBH 3KDKA 2VKCA 4LF9H 4DR4H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAU A;  3QD7 X;  4OCH A;  2D9I A;  2ZQE A;  4OD6 A;  2VKC A; 
#chains in the Genus database with same CATH topology
 1Z2I A;  1UG8 A;  3KDG A;  2JEA I;  4DR7 H;  1PQX A;  1VBI A;  1ZZI A;  2ZM6 H;  3OTO H;  4DV7 H;  4B3R H;  4X64 H;  5IT9 W;  2HH2 A;  2JZX A;  1X4N A;  2E3U A;  4JI8 H;  4KHP H;  1F0X A;  3OET A;  3GKU A;  2OPU A;  2FMR A;  2UUC H;  2ZQE A;  3J81 W;  5C0X G;  3T1H H;  1IBK H;  2VQF H;  1X4M A;  4G08 A;  5BR8 H;  4JI0 H;  4X62 H;  2E5L H;  4X65 H;  4B3T H;  1NXU A;  4LFC H;  5JEA G;  2PT7 G;  4JVY A;  4JV5 H;  1WHR A;  2VQE H;  5LMN H;  2CTF A;  2LRR A;  3QD7 X;  4OCH A;  2D9I A;  3T1Y H;  1IBL H;  3V69 A;  2LTL A;  3U1K A;  3EZJ A;  4JI6 H;  1SEI A;  4LF7 H;  1DTJ A;  5LMU H;  4EC5 A;  4NXM H;  1FJG H;  5LL6 b;  1ZZK A;  1I94 H;  4FJU A;  4AIM A;  1S03 G;  4DUY H;  1VIH A;  4NZR M;  5FLX W;  4B8C D;  1J5E H;  2OPV A;  3I0P A;  2JVZ A;  3SB1 A;  1EC6 A;  4DV6 H;  4LFA H;  2PQU A;  4OX9 H;  1XNR H;  4LIJ A;  1HNZ H;  1WE8 A;  4B3S H;  1TUA A;  4LFB H;  2CWH A;  4B8T A;  2F4V H;  1WTJ A;  3J80 W;  2CTE A;  4GKJ H;  4JI1 H;  2FFM A;  3RF2 A;  4IFD G;  1AN7 A;  1X0A A;  4BA2 I;  1N32 H;  3FAU A;  4NBQ A;  2MJH A;  5K36 G;  2UU9 H;  2AXY A;  4DR6 H;  3L7Z C;  2BA0 A;  4DR1 H;  4GKK H;  4LF5 H;  3VKE A;  2JE6 I;  3UOE A;  4DV4 H;  2HHH H;  4DR2 H;  3J7A K;  4BA1 I;  2CPM A;  4DV0 H;  2CPQ A;  2X06 A;  5A2Q W;  4DUZ H;  2P2R A;  4LF6 H;  2CTK A;  4NZT M;  4AQY H;  4NXN H;  4JYA H;  4DV1 H;  4DV5 H;  4PDB A;  1WVN A;  4H8A A;  2UUA H;  3GR5 A;  3OSS D;  5IWA H;  4JI2 H;  1FKA H;  1XMQ H;  2ANR A;  4K0K H;  2BL5 A;  1VIG A;  4OD6 A;  2CWF A;  4LF8 H;  4JI3 H;  4QMF B;  1J5K A;  2PY9 A;  2NN6 G;  2CTM A;  4JI7 H;  3NCV A;  2LF0 A;  1N34 H;  2YQR A;  1XMO H;  2A1S A;  3JAM W;  3GAB A;  1J4W A;  4WAN A;  1HNW H;  1KHM A;  4DR3 H;  1HR0 H;  1X9Z A;  4DR5 H;  1ODH A;  2LTM A;  2ANN A;  2QND A;  2CTL A;  4WAL A;  4AM3 A;  4X66 H;  1DT4 A;  4JI4 H;  2UXD H;  2Y3M A;  1HNX H;  2K1H A;  5DT9 A;  2Z0S A;  2M8W A;  2CTJ A;  4DV2 H;  3AEV B;  1ZTG A;  4OO1 G;  2UXC H;  2JEB I;  2M6Q A;  4B3M H;  1XNQ H;  2JA9 A;  1N36 H;  1N33 H;  1MSZ A;  1I6U A;  2UUB H;  1V9N A;  4YHH H;  4E9J A;  4YY3 H;  1V8C A;  2DGR A;  4FJS A;  4DV3 H;  1XRH A;  1IBM H;  2G8Y A;  4JI5 H;  1ZZJ A;  2O4C A;  4LF4 H;  4JVH A;  2FPH X;  1S20 A;  1K1G A;  3KDK A;  2VKC A;  2UXB H;  4LF9 H;  4DR4 H;  2HH3 A; 
#chains in the Genus database with same CATH homology
 3KDG A;  4DR7 H;  2ZM6 H;  3OTO H;  4DV7 H;  4B3R H;  4X64 H;  5IT9 W;  4JI8 H;  4KHP H;  1F0X A;  3OET A;  2UUC H;  2ZQE A;  3J81 W;  3T1H H;  1IBK H;  2VQF H;  5BR8 H;  4G08 A;  4JI0 H;  4X62 H;  2E5L H;  4X65 H;  4B3T H;  4LFC H;  2PT7 G;  4JV5 H;  2VQE H;  5LMN H;  3QD7 X;  4OCH A;  2D9I A;  3T1Y H;  1IBL H;  3EZJ A;  4JI6 H;  1SEI A;  4LF7 H;  5LMU H;  4EC5 A;  4NXM H;  1FJG H;  5LL6 b;  1I94 H;  1S03 G;  4DUY H;  4NZR M;  5FLX W;  4B8C D;  1J5E H;  3SB1 A;  4DV6 H;  4LFA H;  4OX9 H;  1XNR H;  1HNZ H;  4B3S H;  4LFB H;  2F4V H;  3J80 W;  4GKJ H;  4JI1 H;  3RF2 A;  1AN7 A;  1N32 H;  3FAU A;  2UU9 H;  4DR6 H;  4DR1 H;  4GKK H;  4LF5 H;  4DV4 H;  3J7A K;  2HHH H;  4DR2 H;  4DV0 H;  5A2Q W;  4DUZ H;  4LF6 H;  4NZT M;  4AQY H;  4NXN H;  4JYA H;  4DV1 H;  4DV5 H;  4PDB A;  2UUA H;  3GR5 A;  3OSS D;  5IWA H;  4JI2 H;  1FKA H;  1XMQ H;  4K0K H;  4OD6 A;  4LF8 H;  4JI3 H;  4JI7 H;  3NCV A;  2LF0 A;  1N34 H;  1XMO H;  3JAM W;  3GAB A;  1HNW H;  4DR3 H;  1HR0 H;  1X9Z A;  4DR5 H;  1ODH A;  4X66 H;  2UXD H;  4JI4 H;  2Y3M A;  1HNX H;  5DT9 A;  4DV2 H;  2UXC H;  4B3M H;  1XNQ H;  1N36 H;  1N33 H;  1I6U A;  2UUB H;  4YHH H;  4E9J A;  4YY3 H;  4DV3 H;  1IBM H;  4JI5 H;  2O4C A;  4LF4 H;  2FPH X;  2UXB H;  3KDK A;  2VKC A;  4LF9 H;  4DR4 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...