3QD7X

Crystal structure of ydal, a stand-alone small muts-related protein from escherichia coli
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
131
structure length
131
Chain Sequence
DTLQLDNFLTTGFLDIIPLSQPLEFRREGLQHGVLDKLRSGKYPQQASLNLLRQPVEECRKMVFSFIQQALADGLRNVLIIHGKGRDDKSHANIVRSYVARWLTEFDDVQAYCTALPHHGGSGACYVALRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein ydaL
publication title Crystal structure of YdaL, a stand-alone small MutS-related protein from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 38
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2011-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01713 Smr Smr domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3qd7X00
3FAUA 4OCHA 2VKCA 4OD6A 2D9IA 3QD7X 2ZQEA
chains in the Genus database with same CATH superfamily
4JI0H 4NZTM 1IBMH 2CTFA 2LRRA 1N34H 4DV2H 2UXBH 2HHHH 2CTKA 4X62H 3T1YH 5LMUH 2ZQEA 1HNXH 3UOEA 2FFMA 4LFBH 3J7AK 1HR0H 2UUBH 4B3MH 3OTOH 3SB1A 2JA9A 4JI6H 4PDBA 1ODHA 4DR4H 2NN6G 1J5KA 5A2QW 4DUYH 2JEBI 2A1SA 1XMQH 2HH3A 2G8YA 2E5LH 2ANNA 4JVHA 2E3UA 5LMNH 2LF0A 4G08A 2Z0SA 1WHRA 3VKEA 2CPMA 4OCHA 4DV0H 3KDGA 1IBKH 2UXDH 1S20A 1KHMA 3I0PA 2JE6I 4QMFB 1N32H 4FJUA 4LF7H 3KDKA 2OPUA 3EZJA 3V69A 2VKCA 5DT9A 2PT7G 1HNWH 4IFDG 4DV5H 1HNZH 3J81W 4LF8H 3GR5A 3GKUA 1N36H 4LFCH 2OPVA 4DV1H 4OO1G 2X06A 1TUAA 5FLXW 4KHPH 4OD6A 4DR2H 4AQYH 1XNRH 2LTLA 1F0XA 2CTLA 2O4CA 5IWAH 1X0AA 4LFAH 2PQUA 1XNQH 4JYAH 1EC6A 4DV4H 4OX9H 2JVZA 2AXYA 4DR7H 4DV3H 4AIMA 1N33H 2FPHX 1ZTGA 4X64H 4GKJH 1DT4A 2BL5A 4JI7H 4LF4H 1I6UA 5LL6b 2CTEA 1WE8A 2F4VH 2HH2A 2CWHA 1IBLH 3OETA 1ZZKA 1WTJA 4NBQA 4DV6H 2UUCH 4NXMH 2UXCH 1Z2IA 4B3RH 4WANA 4H8AA 3RF2A 4YY3H 1V9NA 4JI4H 5JEAG 3T1HH 4JVYA 4DR3H 1X4NA 3FAUA 1ZZIA 4BA1I 1ZZJA 1WVNA 4DR5H 1I94H 2JZXA 2CTJA 4X66H 5BR8H 1VIGA 4X65H 5C0XG 4B3SH 2YQRA 2ANRA 1VIHA 2CWFA 1FKAH 4LF5H 1NXUA 3GABA 2DGRA 2D9IA 4WALA 4AM3A 1FJGH 1AN7A 4BA2I 3OSSD 2VQEH 2QNDA 2MJHA 4JI3H 2M6QA 3JAMW 2P2RA 1S03G 2PY9A 4LF6H 3J80W 3L7ZC 2VQFH 4NXNH 4DR6H 4EC5A 1XMOH 2LTMA 4YHHH 4JI2H 4B8TA 1J5EH 4K0KH 2Y3MA 4JI5H 4JI8H 4E9JA 2FMRA 3NCVA 2M8WA 4JI1H 4B3TH 2CPQA 1MSZA 2K1HA 3QD7X 1J4WA 3AEVB 1X9ZA 4JV5H 5IT9W 4LIJA 4DUZH 3U1KA 2JEAI 1SEIA 1DTJA 1XRHA 1X4MA 4LF9H 5K36G 2UU9H 2UUAH 1VBIA 4DV7H 4GKKH 4FJSA 1PQXA 2ZM6H 1V8CA 2CTMA 4B8CD 4DR1H 2BA0A 1UG8A 1K1GA 4NZRM
chains in the Genus database with same CATH topology
4JI0H 4NZTM 1IBMH 1N34H 4DV2H 2UXBH 2HHHH 4X62H 3T1YH 5LMUH 2ZQEA 1HNXH 4LFBH 3J7AK 1HR0H 2UUBH 4B3MH 3OTOH 3SB1A 4JI6H 4PDBA 1ODHA 4DR4H 5A2QW 4DUYH 1XMQH 2E5LH 5LMNH 2LF0A 4G08A 4OCHA 4DV0H 3KDGA 1IBKH 2UXDH 1N32H 4LF7H 3KDKA 1HNWH 3EZJA 2VKCA 5DT9A 2PT7G 4DV5H 1HNZH 3J81W 4LF8H 3GR5A 1N36H 4LFCH 4DV1H 5FLXW 4KHPH 4OD6A 4DR2H 4AQYH 1XNRH 1F0XA 5IWAH 2O4CA 4LFAH 1XNQH 4JYAH 4DV4H 4OX9H 4DR7H 4DV3H 1N33H 2FPHX 4X64H 4GKJH 4JI7H 4LF4H 1I6UA 5LL6b 2F4VH 2UUCH 1IBLH 3OETA 2UXCH 4DV6H 4NXMH 4B3RH 3RF2A 4YY3H 4JI4H 3T1HH 4DR3H 3FAUA 4DR5H 1I94H 4X66H 5BR8H 4X65H 4B3SH 1FKAH 4LF5H 3GABA 2D9IA 1FJGH 1AN7A 3OSSD 2VQEH 4JI3H 3JAMW 1S03G 4LF6H 3J80W 2VQFH 4NXNH 4DR6H 4EC5A 1XMOH 4YHHH 4JI2H 4K0KH 1J5EH 2Y3MA 4JI5H 4JI8H 4E9JA 3NCVA 4JI1H 4B3TH 5IT9W 3QD7X 4JV5H 1X9ZA 4DUZH 1SEIA 4LF9H 2UU9H 2UUAH 4DV7H 4GKKH 2ZM6H 4B8CD 4DR1H 4NZRM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAU A;  4OCH A;  2VKC A;  4OD6 A;  2D9I A;  3QD7 X;  2ZQE A; 
#chains in the Genus database with same CATH topology
 4JI0 H;  4NZT M;  1IBM H;  2CTF A;  2LRR A;  1N34 H;  4DV2 H;  2UXB H;  2HHH H;  2CTK A;  4X62 H;  3T1Y H;  5LMU H;  2ZQE A;  1HNX H;  3UOE A;  2FFM A;  4LFB H;  3J7A K;  1HR0 H;  2UUB H;  4B3M H;  3OTO H;  3SB1 A;  2JA9 A;  4JI6 H;  4PDB A;  1ODH A;  4DR4 H;  2NN6 G;  1J5K A;  5A2Q W;  4DUY H;  2JEB I;  2A1S A;  1XMQ H;  2HH3 A;  2G8Y A;  2E5L H;  2ANN A;  4JVH A;  2E3U A;  5LMN H;  2LF0 A;  4G08 A;  2Z0S A;  1WHR A;  3VKE A;  2CPM A;  4OCH A;  4DV0 H;  3KDG A;  1IBK H;  2UXD H;  1S20 A;  1KHM A;  3I0P A;  2JE6 I;  4QMF B;  1N32 H;  4FJU A;  4LF7 H;  3KDK A;  2OPU A;  3EZJ A;  3V69 A;  2VKC A;  5DT9 A;  2PT7 G;  1HNW H;  4IFD G;  4DV5 H;  1HNZ H;  3J81 W;  4LF8 H;  3GR5 A;  3GKU A;  1N36 H;  4LFC H;  2OPV A;  4DV1 H;  4OO1 G;  2X06 A;  1TUA A;  5FLX W;  4KHP H;  4OD6 A;  4DR2 H;  4AQY H;  1XNR H;  2LTL A;  1F0X A;  2CTL A;  2O4C A;  5IWA H;  1X0A A;  4LFA H;  2PQU A;  1XNQ H;  4JYA H;  1EC6 A;  4DV4 H;  4OX9 H;  2JVZ A;  2AXY A;  4DR7 H;  4DV3 H;  4AIM A;  1N33 H;  2FPH X;  1ZTG A;  4X64 H;  4GKJ H;  1DT4 A;  2BL5 A;  4JI7 H;  4LF4 H;  1I6U A;  5LL6 b;  2CTE A;  1WE8 A;  2F4V H;  2HH2 A;  2CWH A;  1IBL H;  3OET A;  1ZZK A;  1WTJ A;  4NBQ A;  4DV6 H;  2UUC H;  4NXM H;  2UXC H;  1Z2I A;  4B3R H;  4WAN A;  4H8A A;  3RF2 A;  4YY3 H;  1V9N A;  4JI4 H;  5JEA G;  3T1H H;  4JVY A;  4DR3 H;  1X4N A;  3FAU A;  1ZZI A;  4BA1 I;  1ZZJ A;  1WVN A;  4DR5 H;  1I94 H;  2JZX A;  2CTJ A;  4X66 H;  5BR8 H;  1VIG A;  4X65 H;  5C0X G;  4B3S H;  2YQR A;  2ANR A;  1VIH A;  2CWF A;  1FKA H;  4LF5 H;  1NXU A;  3GAB A;  2DGR A;  2D9I A;  4WAL A;  4AM3 A;  1FJG H;  1AN7 A;  4BA2 I;  3OSS D;  2VQE H;  2QND A;  2MJH A;  4JI3 H;  2M6Q A;  3JAM W;  2P2R A;  1S03 G;  2PY9 A;  4LF6 H;  3J80 W;  3L7Z C;  2VQF H;  4NXN H;  4DR6 H;  4EC5 A;  1XMO H;  2LTM A;  4YHH H;  4JI2 H;  4B8T A;  1J5E H;  4K0K H;  2Y3M A;  4JI5 H;  4JI8 H;  4E9J A;  2FMR A;  3NCV A;  2M8W A;  4JI1 H;  4B3T H;  2CPQ A;  1MSZ A;  2K1H A;  3QD7 X;  1J4W A;  3AEV B;  1X9Z A;  4JV5 H;  5IT9 W;  4LIJ A;  4DUZ H;  3U1K A;  2JEA I;  1SEI A;  1DTJ A;  1XRH A;  1X4M A;  4LF9 H;  5K36 G;  2UU9 H;  2UUA H;  1VBI A;  4DV7 H;  4GKK H;  4FJS A;  1PQX A;  2ZM6 H;  1V8C A;  2CTM A;  4B8C D;  4DR1 H;  2BA0 A;  1UG8 A;  1K1G A;  4NZR M; 
#chains in the Genus database with same CATH homology
 4JI0 H;  4NZT M;  1IBM H;  1N34 H;  4DV2 H;  2UXB H;  2HHH H;  4X62 H;  3T1Y H;  5LMU H;  2ZQE A;  1HNX H;  4LFB H;  3J7A K;  1HR0 H;  2UUB H;  4B3M H;  3OTO H;  3SB1 A;  4JI6 H;  4PDB A;  1ODH A;  4DR4 H;  5A2Q W;  4DUY H;  1XMQ H;  2E5L H;  5LMN H;  2LF0 A;  4G08 A;  4OCH A;  4DV0 H;  3KDG A;  1IBK H;  2UXD H;  1N32 H;  4LF7 H;  3KDK A;  1HNW H;  3EZJ A;  2VKC A;  5DT9 A;  2PT7 G;  4DV5 H;  1HNZ H;  3J81 W;  4LF8 H;  3GR5 A;  1N36 H;  4LFC H;  4DV1 H;  5FLX W;  4KHP H;  4OD6 A;  4DR2 H;  4AQY H;  1XNR H;  1F0X A;  5IWA H;  2O4C A;  4LFA H;  1XNQ H;  4JYA H;  4DV4 H;  4OX9 H;  4DR7 H;  4DV3 H;  1N33 H;  2FPH X;  4X64 H;  4GKJ H;  4JI7 H;  4LF4 H;  1I6U A;  5LL6 b;  2F4V H;  2UUC H;  1IBL H;  3OET A;  2UXC H;  4DV6 H;  4NXM H;  4B3R H;  3RF2 A;  4YY3 H;  4JI4 H;  3T1H H;  4DR3 H;  3FAU A;  4DR5 H;  1I94 H;  4X66 H;  5BR8 H;  4X65 H;  4B3S H;  1FKA H;  4LF5 H;  3GAB A;  2D9I A;  1FJG H;  1AN7 A;  3OSS D;  2VQE H;  4JI3 H;  3JAM W;  1S03 G;  4LF6 H;  3J80 W;  2VQF H;  4NXN H;  4DR6 H;  4EC5 A;  1XMO H;  4YHH H;  4JI2 H;  4K0K H;  1J5E H;  2Y3M A;  4JI5 H;  4JI8 H;  4E9J A;  3NCV A;  4JI1 H;  4B3T H;  5IT9 W;  3QD7 X;  4JV5 H;  1X9Z A;  4DUZ H;  1SEI A;  4LF9 H;  2UU9 H;  2UUA H;  4DV7 H;  4GKK H;  2ZM6 H;  4B8C D;  4DR1 H;  4NZR M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...