3QD7X

Crystal structure of ydal, a stand-alone small muts-related protein from escherichia coli
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
131
structure length
131
Chain Sequence
b'DTLQLDNFLTTGFLDIIPLSQPLEFRREGLQHGVLDKLRSGKYPQQASLNLLRQPVEECRKMVFSFIQQALADGLRNVLIIHGKGRDDKSHANIVRSYVARWLTEFDDVQAYCTALPHHGGSGACYVALRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein ydaL
molecule tags Hydrolase
source organism Escherichia coli
publication title Crystal structure of YdaL, a stand-alone small MutS-related protein from Escherichia coli.
pubmed doi rcsb
total genus 38
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2011-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01713 Smr Smr domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3qd7X00
2D9IA 3FAUA 4OD6A 2ZQEA 4OCHA 3QD7X 2VKCA
chains in the Genus database with same CATH superfamily
2UUBH 2OPUA 4NBQA 5LL6b 2UXCH 4GKKH 1NXUA 1V9NA 4LF8H 4B3RH 4K0KH 4JI7H 2NN6G 4LF4H 2PY9A 4JYAH 2BL5A 3JAMW 1Z2IA 5LMUH 1XNQH 2FPHX 3OTOH 2HHHH 2O4CA 4JI8H 3J7AK 1J5KA 1N36H 2UUCH 2UXDH 4DR4H 4WANA 2HH3A 1N32H 4B8TA 1X9ZA 2JEBI 4DV7H 2JVZA 1XMQH 5FLXW 1WTJA 3J81W 1FKAH 1S20A 3RF2A 4DR7H 3J80W 1XMOH 1IBMH 3I0PA 4FJSA 4AIMA 4X64H 4X66H 2ANNA 2PQUA 1HNWH 4DV3H 2JZXA 2CWHA 1N33H 3GABA 2F4VH 4B3MH 3NCVA 2P2RA 4YY3H 4IFDG 4LFCH 3SB1A 3QD7X 3KDGA 5BR8H 2CTFA 4LF5H 2ZM6H 3OSSD 4YHHH 2YQRA 2UU9H 1UG8A 4LF9H 2OPVA 1DT4A 1DTJA 4LIJA 4OCHA 5IWAH 2PT7G 1HNXH 2UUAH 2VQFH 4BA1I 4WALA 2JEAI 4DV0H 4JI3H 2A1SA 1HNZH 2E5LH 2M6QA 4E9JA 5JEAG 2LTLA 2ZQEA 2ANRA 4AM3A 2JE6I 3T1YH 2Z0SA 2E3UA 1IBLH 4LFBH 5C0XG 3FAUA 4DV4H 2AXYA 4LF7H 2K1HA 1ZZJA 4DR2H 1ZTGA 1ODHA 4DV2H 2G8YA 2QNDA 1S03G 4LF6H 4DR1H 4JI1H 2LF0A 1N34H 4JI6H 2BA0A 5K36G 1VIHA 4GKJH 4OO1G 5LMNH 4LFAH 1X4MA 3KDKA 1EC6A 2LRRA 4JI4H 4NXMH 4AQYH 2CTJA 1V8CA 3EZJA 2VQEH 4DV1H 1WVNA 1J4WA 4QMFB 1IBKH 3UOEA 1F0XA 4JVHA 4B8CD 2CWFA 2M8WA 4JI2H 2D9IA 4BA2I 1MSZA 4FJUA 4NZRM 5DT9A 4JVYA 2CTKA 2FMRA 4EC5A 4NZTM 4PDBA 5A2QW 2HH2A 3T1HH 4DR6H 3OETA 1I6UA 2Y3MA 1I94H 4DR5H 2CTMA 1VBIA 1TUAA 1VIGA 1X4NA 3L7ZC 4OD6A 5IT9W 1ZZKA 4KHPH 2JA9A 4DUZH 1ZZIA 2CTEA 1SEIA 1XNRH 2UXBH 4G08A 4DV6H 2LTMA 4DR3H 3VKEA 1FJGH 1XRHA 2CPMA 2CPQA 2VKCA 4B3TH 3V69A 1K1GA 4X65H 4DV5H 3GR5A 4JV5H 4NXNH 4DUYH 3AEVB 2CTLA 2X06A 1AN7A 1WE8A 4H8AA 1WHRA 4OX9H 4JI5H 3U1KA 4X62H 1HR0H 2MJHA 4JI0H 1PQXA 1KHMA 2DGRA 2FFMA 4B3SH 3GKUA 1J5EH 1X0AA
chains in the Genus database with same CATH topology
2UUBH 5LL6b 2UXCH 4GKKH 4LF8H 4K0KH 4B3RH 4JI7H 4LF4H 4JYAH 3JAMW 5LMUH 1XNQH 2FPHX 3OTOH 2HHHH 2O4CA 4JI8H 3J7AK 1N36H 2UUCH 2UXDH 4DR4H 1N32H 1X9ZA 4DV7H 1XMQH 5FLXW 3J81W 1FKAH 3RF2A 4DR7H 3J80W 1XMOH 1IBMH 4X64H 4X66H 1HNWH 4DV3H 1N33H 3GABA 2F4VH 4B3MH 3NCVA 4YY3H 4LFCH 3SB1A 3QD7X 3KDGA 5BR8H 4LF5H 2ZM6H 3OSSD 4YHHH 2UU9H 4LF9H 5IWAH 4OCHA 2PT7G 1HNXH 2UUAH 2VQFH 4DV0H 4JI3H 1HNZH 2E5LH 4E9JA 2ZQEA 3T1YH 1IBLH 4LFBH 3FAUA 4DV4H 4LF7H 4DR2H 1ODHA 4DV2H 1S03G 4LF6H 4DR1H 2LF0A 1N34H 4JI6H 4GKJH 5LMNH 4LFAH 3KDKA 4JI4H 4NXMH 4AQYH 4DV1H 3EZJA 2VQEH 1IBKH 1F0XA 4B8CD 4JI2H 2D9IA 5DT9A 4NZRM 4EC5A 4NZTM 4PDBA 5A2QW 3T1HH 4DR6H 1I6UA 3OETA 2Y3MA 1I94H 4DR5H 4OD6A 5IT9W 4KHPH 4DUZH 1SEIA 1XNRH 2UXBH 4G08A 4DV6H 4DR3H 1FJGH 2VKCA 4X65H 4DV5H 3GR5A 4JV5H 4NXNH 4DUYH 1AN7A 4OX9H 4JI5H 4X62H 1HR0H 4JI0H 4B3SH 4JI1H 1J5EH 4B3TH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9I A;  3FAU A;  4OD6 A;  2ZQE A;  4OCH A;  3QD7 X;  2VKC A; 
#chains in the Genus database with same CATH topology
 2UUB H;  2OPU A;  4NBQ A;  5LL6 b;  2UXC H;  4GKK H;  1NXU A;  1V9N A;  4LF8 H;  4B3R H;  4K0K H;  4JI7 H;  2NN6 G;  4LF4 H;  2PY9 A;  4JYA H;  2BL5 A;  3JAM W;  1Z2I A;  5LMU H;  1XNQ H;  2FPH X;  3OTO H;  2HHH H;  2O4C A;  4JI8 H;  3J7A K;  1J5K A;  1N36 H;  2UUC H;  2UXD H;  4DR4 H;  4WAN A;  2HH3 A;  1N32 H;  4B8T A;  1X9Z A;  2JEB I;  4DV7 H;  2JVZ A;  1XMQ H;  5FLX W;  1WTJ A;  3J81 W;  1FKA H;  1S20 A;  3RF2 A;  4DR7 H;  3J80 W;  1XMO H;  1IBM H;  3I0P A;  4FJS A;  4AIM A;  4X64 H;  4X66 H;  2ANN A;  2PQU A;  1HNW H;  4DV3 H;  2JZX A;  2CWH A;  1N33 H;  3GAB A;  2F4V H;  4B3M H;  3NCV A;  2P2R A;  4YY3 H;  4IFD G;  4LFC H;  3SB1 A;  3QD7 X;  3KDG A;  5BR8 H;  2CTF A;  4LF5 H;  2ZM6 H;  3OSS D;  4YHH H;  2YQR A;  2UU9 H;  1UG8 A;  4LF9 H;  2OPV A;  1DT4 A;  1DTJ A;  4LIJ A;  4OCH A;  5IWA H;  2PT7 G;  1HNX H;  2UUA H;  2VQF H;  4BA1 I;  4WAL A;  2JEA I;  4DV0 H;  4JI3 H;  2A1S A;  1HNZ H;  2E5L H;  2M6Q A;  4E9J A;  5JEA G;  2LTL A;  2ZQE A;  2ANR A;  4AM3 A;  2JE6 I;  3T1Y H;  2Z0S A;  2E3U A;  1IBL H;  4LFB H;  5C0X G;  3FAU A;  4DV4 H;  2AXY A;  4LF7 H;  2K1H A;  1ZZJ A;  4DR2 H;  1ZTG A;  1ODH A;  4DV2 H;  2G8Y A;  2QND A;  1S03 G;  4LF6 H;  4DR1 H;  4JI1 H;  2LF0 A;  1N34 H;  4JI6 H;  2BA0 A;  5K36 G;  1VIH A;  4GKJ H;  4OO1 G;  5LMN H;  4LFA H;  1X4M A;  3KDK A;  1EC6 A;  2LRR A;  4JI4 H;  4NXM H;  4AQY H;  2CTJ A;  1V8C A;  3EZJ A;  2VQE H;  4DV1 H;  1WVN A;  1J4W A;  4QMF B;  1IBK H;  3UOE A;  1F0X A;  4JVH A;  4B8C D;  2CWF A;  2M8W A;  4JI2 H;  2D9I A;  4BA2 I;  1MSZ A;  4FJU A;  4NZR M;  5DT9 A;  4JVY A;  2CTK A;  2FMR A;  4EC5 A;  4NZT M;  4PDB A;  5A2Q W;  2HH2 A;  3T1H H;  4DR6 H;  3OET A;  1I6U A;  2Y3M A;  1I94 H;  4DR5 H;  2CTM A;  1VBI A;  1TUA A;  1VIG A;  1X4N A;  3L7Z C;  4OD6 A;  5IT9 W;  1ZZK A;  4KHP H;  2JA9 A;  4DUZ H;  1ZZI A;  2CTE A;  1SEI A;  1XNR H;  2UXB H;  4G08 A;  4DV6 H;  2LTM A;  4DR3 H;  3VKE A;  1FJG H;  1XRH A;  2CPM A;  2CPQ A;  2VKC A;  4B3T H;  3V69 A;  1K1G A;  4X65 H;  4DV5 H;  3GR5 A;  4JV5 H;  4NXN H;  4DUY H;  3AEV B;  2CTL A;  2X06 A;  1AN7 A;  1WE8 A;  4H8A A;  1WHR A;  4OX9 H;  4JI5 H;  3U1K A;  4X62 H;  1HR0 H;  2MJH A;  4JI0 H;  1PQX A;  1KHM A;  2DGR A;  2FFM A;  4B3S H;  3GKU A;  1J5E H;  1X0A A; 
#chains in the Genus database with same CATH homology
 2UUB H;  5LL6 b;  2UXC H;  4GKK H;  4LF8 H;  4K0K H;  4B3R H;  4JI7 H;  4LF4 H;  4JYA H;  3JAM W;  5LMU H;  1XNQ H;  2FPH X;  3OTO H;  2HHH H;  2O4C A;  4JI8 H;  3J7A K;  1N36 H;  2UUC H;  2UXD H;  4DR4 H;  1N32 H;  1X9Z A;  4DV7 H;  1XMQ H;  5FLX W;  3J81 W;  1FKA H;  3RF2 A;  4DR7 H;  3J80 W;  1XMO H;  1IBM H;  4X64 H;  4X66 H;  1HNW H;  4DV3 H;  1N33 H;  3GAB A;  2F4V H;  4B3M H;  3NCV A;  4YY3 H;  4LFC H;  3SB1 A;  3QD7 X;  3KDG A;  5BR8 H;  4LF5 H;  2ZM6 H;  3OSS D;  4YHH H;  2UU9 H;  4LF9 H;  5IWA H;  4OCH A;  2PT7 G;  1HNX H;  2UUA H;  2VQF H;  4DV0 H;  4JI3 H;  1HNZ H;  2E5L H;  4E9J A;  2ZQE A;  3T1Y H;  1IBL H;  4LFB H;  3FAU A;  4DV4 H;  4LF7 H;  4DR2 H;  1ODH A;  4DV2 H;  1S03 G;  4LF6 H;  4DR1 H;  2LF0 A;  1N34 H;  4JI6 H;  4GKJ H;  5LMN H;  4LFA H;  3KDK A;  4JI4 H;  4NXM H;  4AQY H;  4DV1 H;  3EZJ A;  2VQE H;  1IBK H;  1F0X A;  4B8C D;  4JI2 H;  2D9I A;  5DT9 A;  4NZR M;  4EC5 A;  4NZT M;  4PDB A;  5A2Q W;  3T1H H;  4DR6 H;  1I6U A;  3OET A;  2Y3M A;  1I94 H;  4DR5 H;  4OD6 A;  5IT9 W;  4KHP H;  4DUZ H;  1SEI A;  1XNR H;  2UXB H;  4G08 A;  4DV6 H;  4DR3 H;  1FJG H;  2VKC A;  4X65 H;  4DV5 H;  3GR5 A;  4JV5 H;  4NXN H;  4DUY H;  1AN7 A;  4OX9 H;  4JI5 H;  4X62 H;  1HR0 H;  4JI0 H;  4B3S H;  4JI1 H;  1J5E H;  4B3T H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...