3QD7X

Crystal structure of ydal, a stand-alone small muts-related protein from escherichia coli
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
131
structure length
131
Chain Sequence
b'DTLQLDNFLTTGFLDIIPLSQPLEFRREGLQHGVLDKLRSGKYPQQASLNLLRQPVEECRKMVFSFIQQALADGLRNVLIIHGKGRDDKSHANIVRSYVARWLTEFDDVQAYCTALPHHGGSGACYVALRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein ydaL
publication title Crystal structure of YdaL, a stand-alone small MutS-related protein from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 38
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2011-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01713 Smr Smr domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3qd7X00
3FAUA 2ZQEA 4OD6A 2D9IA 4OCHA 2VKCA 3QD7X
chains in the Genus database with same CATH superfamily
3SB1A 2ANRA 2UUCH 4KHPH 4AIMA 1N34H 4JI2H 2JZXA 1PQXA 4DR1H 3VKEA 1XNQH 2VKCA 1VBIA 3EZJA 4LF8H 1ZZIA 2CPMA 4X62H 1S03G 1X9ZA 1XRHA 2HH2A 1ZZJA 4DR6H 2YQRA 4JVHA 4LIJA 4LF4H 4JI6H 4LF5H 4DV5H 2G8YA 4FJUA 2D9IA 5LL6b 2ZM6H 1V8CA 4NZTM 3GABA 1DT4A 2JEBI 3V69A 4YY3H 4NXMH 2AXYA 1N33H 1X4NA 4LF6H 1IBMH 2O4CA 5IWAH 1HNXH 1I94H 2P2RA 4X65H 3GKUA 2A1SA 4DV2H 4NZRM 3FAUA 1UG8A 1XMOH 4JI8H 1HR0H 2K1HA 4OO1G 2CTKA 3OETA 3JAMW 4GKKH 1FKAH 2HH3A 1SEIA 5C0XG 2DGRA 1WVNA 4QMFB 1TUAA 1AN7A 1XMQH 2UXDH 2OPUA 2MJHA 1ODHA 1MSZA 4WANA 3OTOH 5LMUH 2CTMA 4DR3H 4LFCH 4WALA 1WHRA 2E5LH 5IT9W 4JI0H 4H8AA 1WE8A 2JE6I 1ZTGA 5K36G 2E3UA 3OSSD 2Y3MA 4LF9H 3AEVB 4DV6H 4AM3A 5FLXW 4B3MH 4LF7H 2QNDA 4FJSA 4EC5A 2HHHH 2UXBH 2FFMA 3KDKA 1F0XA 4DV7H 4DR2H 4DR7H 1HNWH 1VIHA 4DR5H 1FJGH 3I0PA 4K0KH 1S20A 3NCVA 2X06A 2NN6G 2CTJA 1I6UA 4GKJH 2JA9A 4JI3H 2OPVA 4G08A 4JI5H 2LTMA 4NXNH 2CTLA 3GR5A 1J5EH 4YHHH 5LMNH 2Z0SA 3QD7X 4JVYA 2PY9A 2VQFH 3KDGA 1IBLH 2JEAI 1EC6A 4IFDG 2LRRA 2FMRA 4B3TH 3U1KA 2UU9H 2BL5A 2PQUA 4JI4H 2F4VH 5A2QW 4B8CD 1K1GA 2UXCH 2M6QA 3J7AK 4X64H 2CTFA 3J81W 4BA1I 4JI7H 1N32H 2ANNA 2ZQEA 4OD6A 4OX9H 4JI1H 1N36H 2M8WA 4E9JA 2UUBH 1IBKH 1WTJA 2FPHX 3L7ZC 4DR4H 4LFBH 2JVZA 4DV0H 3J80W 2UUAH 4OCHA 4DV3H 3T1YH 5JEAG 4B3SH 1KHMA 4B8TA 3UOEA 5BR8H 2VQEH 4DV1H 1J4WA 1DTJA 3RF2A 4B3RH 4JYAH 2CWHA 5DT9A 2LTLA 4X66H 1X4MA 2CWFA 4AQYH 1XNRH 4NBQA 1X0AA 1ZZKA 2LF0A 4LFAH 1V9NA 2CTEA 1J5KA 1NXUA 1HNZH 1VIGA 3T1HH 1Z2IA 2PT7G 2BA0A 4DUYH 4BA2I 4DUZH 2CPQA 4DV4H 4PDBA 4JV5H
chains in the Genus database with same CATH topology
3SB1A 2UUCH 4KHPH 1N34H 4JI2H 4DR1H 1XNQH 2VKCA 4LF8H 3EZJA 1S03G 4X62H 1X9ZA 4DR6H 4LF4H 4JI6H 4LF5H 4DV5H 2D9IA 5LL6b 2ZM6H 4NZTM 3GABA 4YY3H 4NXMH 1N33H 4LF6H 1IBMH 2O4CA 5IWAH 1HNXH 1I94H 4X65H 4DV2H 4NZRM 3FAUA 1XMOH 4JI8H 1HR0H 3OETA 3JAMW 4GKKH 1FKAH 1SEIA 1AN7A 1XMQH 2UXDH 1ODHA 3OTOH 5LMUH 4DR3H 4LFCH 2E5LH 5IT9W 4JI0H 3OSSD 2Y3MA 4LF9H 4DV6H 5FLXW 4B3MH 4LF7H 4EC5A 2UXBH 2HHHH 3KDKA 1F0XA 4DV7H 4DR2H 4DR7H 1HNWH 4DR5H 1FJGH 4K0KH 3NCVA 1I6UA 4GKJH 4JI3H 4G08A 4JI5H 4NXNH 3GR5A 1J5EH 4YHHH 5LMNH 3QD7X 2VQFH 3KDGA 1IBLH 4B3TH 2UU9H 4JI4H 2F4VH 5A2QW 4B8CD 2UXCH 3J7AK 4X64H 3J81W 4JI7H 1N32H 2ZQEA 4OD6A 4OX9H 4JI1H 1N36H 4E9JA 2UUBH 4DR4H 1IBKH 2FPHX 4LFBH 4DV0H 3J80W 2UUAH 4OCHA 4DV3H 3T1YH 4B3SH 5BR8H 2VQEH 4DV1H 3RF2A 4B3RH 4JYAH 5DT9A 4X66H 4AQYH 1XNRH 4LFAH 2LF0A 1HNZH 3T1HH 2PT7G 4DUYH 4DUZH 4DV4H 4PDBA 4JV5H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAU A;  2ZQE A;  4OD6 A;  2D9I A;  4OCH A;  2VKC A;  3QD7 X; 
#chains in the Genus database with same CATH topology
 3SB1 A;  2ANR A;  2UUC H;  4KHP H;  4AIM A;  1N34 H;  4JI2 H;  2JZX A;  1PQX A;  4DR1 H;  3VKE A;  1XNQ H;  2VKC A;  1VBI A;  3EZJ A;  4LF8 H;  1ZZI A;  2CPM A;  4X62 H;  1S03 G;  1X9Z A;  1XRH A;  2HH2 A;  1ZZJ A;  4DR6 H;  2YQR A;  4JVH A;  4LIJ A;  4LF4 H;  4JI6 H;  4LF5 H;  4DV5 H;  2G8Y A;  4FJU A;  2D9I A;  5LL6 b;  2ZM6 H;  1V8C A;  4NZT M;  3GAB A;  1DT4 A;  2JEB I;  3V69 A;  4YY3 H;  4NXM H;  2AXY A;  1N33 H;  1X4N A;  4LF6 H;  1IBM H;  2O4C A;  5IWA H;  1HNX H;  1I94 H;  2P2R A;  4X65 H;  3GKU A;  2A1S A;  4DV2 H;  4NZR M;  3FAU A;  1UG8 A;  1XMO H;  4JI8 H;  1HR0 H;  2K1H A;  4OO1 G;  2CTK A;  3OET A;  3JAM W;  4GKK H;  1FKA H;  2HH3 A;  1SEI A;  5C0X G;  2DGR A;  1WVN A;  4QMF B;  1TUA A;  1AN7 A;  1XMQ H;  2UXD H;  2OPU A;  2MJH A;  1ODH A;  1MSZ A;  4WAN A;  3OTO H;  5LMU H;  2CTM A;  4DR3 H;  4LFC H;  4WAL A;  1WHR A;  2E5L H;  5IT9 W;  4JI0 H;  4H8A A;  1WE8 A;  2JE6 I;  1ZTG A;  5K36 G;  2E3U A;  3OSS D;  2Y3M A;  4LF9 H;  3AEV B;  4DV6 H;  4AM3 A;  5FLX W;  4B3M H;  4LF7 H;  2QND A;  4FJS A;  4EC5 A;  2HHH H;  2UXB H;  2FFM A;  3KDK A;  1F0X A;  4DV7 H;  4DR2 H;  4DR7 H;  1HNW H;  1VIH A;  4DR5 H;  1FJG H;  3I0P A;  4K0K H;  1S20 A;  3NCV A;  2X06 A;  2NN6 G;  2CTJ A;  1I6U A;  4GKJ H;  2JA9 A;  4JI3 H;  2OPV A;  4G08 A;  4JI5 H;  2LTM A;  4NXN H;  2CTL A;  3GR5 A;  1J5E H;  4YHH H;  5LMN H;  2Z0S A;  3QD7 X;  4JVY A;  2PY9 A;  2VQF H;  3KDG A;  1IBL H;  2JEA I;  1EC6 A;  4IFD G;  2LRR A;  2FMR A;  4B3T H;  3U1K A;  2UU9 H;  2BL5 A;  2PQU A;  4JI4 H;  2F4V H;  5A2Q W;  4B8C D;  1K1G A;  2UXC H;  2M6Q A;  3J7A K;  4X64 H;  2CTF A;  3J81 W;  4BA1 I;  4JI7 H;  1N32 H;  2ANN A;  2ZQE A;  4OD6 A;  4OX9 H;  4JI1 H;  1N36 H;  2M8W A;  4E9J A;  2UUB H;  1IBK H;  1WTJ A;  2FPH X;  3L7Z C;  4DR4 H;  4LFB H;  2JVZ A;  4DV0 H;  3J80 W;  2UUA H;  4OCH A;  4DV3 H;  3T1Y H;  5JEA G;  4B3S H;  1KHM A;  4B8T A;  3UOE A;  5BR8 H;  2VQE H;  4DV1 H;  1J4W A;  1DTJ A;  3RF2 A;  4B3R H;  4JYA H;  2CWH A;  5DT9 A;  2LTL A;  4X66 H;  1X4M A;  2CWF A;  4AQY H;  1XNR H;  4NBQ A;  1X0A A;  1ZZK A;  2LF0 A;  4LFA H;  1V9N A;  2CTE A;  1J5K A;  1NXU A;  1HNZ H;  1VIG A;  3T1H H;  1Z2I A;  2PT7 G;  2BA0 A;  4DUY H;  4BA2 I;  4DUZ H;  2CPQ A;  4DV4 H;  4PDB A;  4JV5 H; 
#chains in the Genus database with same CATH homology
 3SB1 A;  2UUC H;  4KHP H;  1N34 H;  4JI2 H;  4DR1 H;  1XNQ H;  2VKC A;  4LF8 H;  3EZJ A;  1S03 G;  4X62 H;  1X9Z A;  4DR6 H;  4LF4 H;  4JI6 H;  4LF5 H;  4DV5 H;  2D9I A;  5LL6 b;  2ZM6 H;  4NZT M;  3GAB A;  4YY3 H;  4NXM H;  1N33 H;  4LF6 H;  1IBM H;  2O4C A;  5IWA H;  1HNX H;  1I94 H;  4X65 H;  4DV2 H;  4NZR M;  3FAU A;  1XMO H;  4JI8 H;  1HR0 H;  3OET A;  3JAM W;  4GKK H;  1FKA H;  1SEI A;  1AN7 A;  1XMQ H;  2UXD H;  1ODH A;  3OTO H;  5LMU H;  4DR3 H;  4LFC H;  2E5L H;  5IT9 W;  4JI0 H;  3OSS D;  2Y3M A;  4LF9 H;  4DV6 H;  5FLX W;  4B3M H;  4LF7 H;  4EC5 A;  2UXB H;  2HHH H;  3KDK A;  1F0X A;  4DV7 H;  4DR2 H;  4DR7 H;  1HNW H;  4DR5 H;  1FJG H;  4K0K H;  3NCV A;  1I6U A;  4GKJ H;  4JI3 H;  4G08 A;  4JI5 H;  4NXN H;  3GR5 A;  1J5E H;  4YHH H;  5LMN H;  3QD7 X;  2VQF H;  3KDG A;  1IBL H;  4B3T H;  2UU9 H;  4JI4 H;  2F4V H;  5A2Q W;  4B8C D;  2UXC H;  3J7A K;  4X64 H;  3J81 W;  4JI7 H;  1N32 H;  2ZQE A;  4OD6 A;  4OX9 H;  4JI1 H;  1N36 H;  4E9J A;  2UUB H;  4DR4 H;  1IBK H;  2FPH X;  4LFB H;  4DV0 H;  3J80 W;  2UUA H;  4OCH A;  4DV3 H;  3T1Y H;  4B3S H;  5BR8 H;  2VQE H;  4DV1 H;  3RF2 A;  4B3R H;  4JYA H;  5DT9 A;  4X66 H;  4AQY H;  1XNR H;  4LFA H;  2LF0 A;  1HNZ H;  3T1H H;  2PT7 G;  4DUY H;  4DUZ H;  4DV4 H;  4PDB A;  4JV5 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...