3QD9A

C72s/c353s mutant of trypanosoma brucei qsox containing an interdomain disulfide
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
402
structure length
388
Chain Sequence
PGLFHLDSSVVDLSGDDFSRVHRVAPLCPWIVLFYNDGCGASRRYASTFSKFAGGLKVEHGKDALQIATAAAVNCASEVDLCRKYDINFVPRLFFFYPRDSSLEHVAFENSHLEVDELESEVRRLVNKHMVVDDSLKERCIDMHFKLYTSKEELVSSTDESGRFVETTELYATDIAGAFFSAMHYDVSLVGTEPRERLTALEDFVLLVKDSLPSIGADGVVSALESITAERPFTVASWQDAVVKSGIPFDGSPRNVRWRTCRGSSPQYRGFPCGMWLLLHALTVNTPADRNVLEVIQNYIRYFFSCKESRDHFIQFNFSPNEDPVLQLWRAHNNVNARLANVKDGADPLVPKRQFPTLEACTECYDGAGNFIEAHVTGFLKQRYLWDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords QSOX from Trypanosoma brucei (TbQSOX)
publication title The dynamic disulphide relay of quiescin sulphydryl oxidase.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
total genus 108
structure length 388
sequence length 402
chains with identical sequence B, C, D
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2011-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3qd9A01
1SKRB 2VCWA 1SL1B 2HT9A 5ENUA 5ECKB 5ABRA 2TIRA 5ECQB 5F8BA 4XRDA 4N30A 4I2TA 4YAPA 1M2AA 3ZMKA 2YZHA 2BMXA 2EC4A 10GSA 2YNXA 2RUEA 3QFBC 3ZFBA 1GSUA 1X0RA 5DJLA 1HNCA 1J0FA 4IS0A 2JSYA 2C3NA 2A2RA 4F0BA 4L5OA 3GUSA 1X9WB 4PNFA 1EGRA 2JACA 1ZL9A 3M8NA 1TP9A 1SL0B 1ZGNA 4YH2A 1A23A 3QCPA 2J9HA 1OYJA 4BPYA 5ECRB 2MZCA 3FY7A 1BJXA 1ZOFA 4AJ8A 3I69A 5HR1A 4TW5A 5A5KA 3A2VA 1WMJA 4ZBAA 1GTBA 1EV9A 1AAZA 4EKZA 3ERGA 19GSA 3KMOA 2JU5A 2FA4A 2H6YA 5DQYA 4Q5RA 3UVHA 2E7PA 1RK4A 2RIIA 5E59A 2OJLA 5CYYA 3P2AA 4G19A 1K0MA 1WWJA 4TXOB 1HYUA 1EP7A 2VIMA 4TRXA 1PQNA 3BD2A 4KDXA 4WBJA 4GF0A 1ZMAA 2V41A 4XCSA 3W6GA 2GSSA 3IDVA 5GAPD 4MA9A 1THXA 5F06A 5ECLB 2VAFA 4K2DA 3ZMLA 5KN1A 3EU4A 3SBCA 1VGLA 2MBSA 5G1LA 4WEYA 2ZCTA 3HJOA 14GSA 1XOBA 5L71A 5G31A 3WT1A 1G7OA 1BQ7A 18GSA 4PX1A 3BOAA 3GL5A 3IA1A 3FK8A 4GSTA 5D9WA 1T00A 1BYEA 3QAVA 5J9CA 1Y6EA 1BEDA 2G0FA 2WJUA 2I1UA 2YWMA 4KH7A 4OMVA 1CQHA 1DE2A 4HEA2 3IAS2 3MSZA 2EIRA 1B8XA 1GUHA 4ZL9A 2B5XA 2R3XA 5IOXA 1A24A 2R4VA 2VOCA 4J56E 4WETA 2LQQA 3TRQA 2K8SA 4POLA 1GNEA 1AC1A 4ULXA 3WT2A 1E2YA 5LCZA 1XBSA 1SD8A 4TR1B 2LEGA 1FVJA 3VWVA 1F3AA 4TR1A 3KIJA 3WYWA 4FYCA 3IXRA 5IMAA 2WCIA 1MDKA 4XIHA 3DVWA 3F9UA 4YAVA 3ERFA 2CVDA 2C8UA 3P90A 3QOUA 1O73A 5IPGA 3M9KA 9GSSA 4I6XA 2IMIA 3HA9A 2V2GA 4MF6A 3HXSA 2KLXA 3KH7A 1YZXA 2P5RA 2C0EA 2PVOC 4G10A 4BL7A 3RPNA 5B8BA 3GX0A 2F9SA 2GDRA 1ERVA 2C0DA 3TDGA 3QPMA 4POMA 2P0GA 2R2JA 5G30A 1E6BA 3HKRA 2M46A 3U5RE 4IVFA 4E8HA 17GSA 1AIUA 1PGTA 2F8AA 2XPDA 5A4UA 1YEXA 1GL8A 1O6JA 4TR4A 2TRCP 4KDYA 4RI6A 4CHSA 4ECBA 2MMNA 4KAEA 2BTOT 4KNDA 4V2LA 1TTZA 3DEXA 3MNGA 2JZRA 1AXDA 2L5OA 1XW6A 1EZKA 5D9VA 2WGRA 2L57A 4EDZA 4OO4A 3RPPA 4AJ7A 1PRXA 3DXBA 1GUMA 2WFCA 4RQRA 3H1NA 1T4YA 2TRXA 2GGTA 2DIZA 3FR9A 2N5BA 4EC0A 1H4OA 1ON4A 1QXHA 2NPBA 4MZWA 4GSSA 3TJFA 2NTOA 5A4VA 2X8GA 3QDNA 1G0TA 3WD6A 1TJDA 4MDCA 1OE7A 5KN0A 3I6AA 3VFIA 4IJ3A 1F2EA 5C04A 5D73A 1ML6A 1XCCA 5DDLA 3RAZA 4LL1B 1N8JA 3ZLPA 2YCDA 5IM9A 5ECMB 3G9BA 2OBKA 3HD5A 2WDUA 2MMOA 1M0UA 4IGJA 3VI5A 3ERWA 4OCFA 3IC4A 5IOWA 5D9TA 1VF1A 2O89A 3KP8A 2CVBA 4WF5A 2ZUPA 2V1MA 4AGSA 1DBYA 1B48A 3GH6A 1OAZA 6GSUA 4ACSA 1IYIA 2H01A 1M2DA 1GTAA 4IQAA 1T7PB 1GNWA 3EE2A 2REMA 4HU9A 3OR5A 1OKDA 3G7JA 2CQ9A 2QSIA 1J08A 1XZOA 4ML6A 4MH3A 3QFAC 1XFLA 4ZIJA 4F82A 1YKAA 3C7MA 5IO0A 3TKQA 4JRRA 3ZFLA 3EINA 4K9ZA 2OE0A 3GFKA 3ED3A 3HY2A 2YOIA 2VLUA 3R2QA 1Z6NA 1PL2A 1R5PA 1GSQA 5CP1A 1OC3A 3GMFA 1X5CA 1K3OA 2HNLA 4O32A 3L9VA 3D21A 1K0CA 3EVIA 3C1RA 2HYXA 1BAYA 2DJ0A 1M99A 2DBCA 2LSTA 3TKSC 2E2GA 1TK8B 4GXZA 1R5AA 20GSA 3HVXA 4TR0A 2LS5A 3HYPA 4L5LA 3LWAA 4YQVA 4POBA 1U3AA 4HJ2A 1S3AA 2B3SA 3ZITA 1UVZA 1WOUA 3HVSA 4N11A 2BJXA 4BVXA 3GH9A 2VM1A 4DEJA 3GSTA 2C0GA 1GULA 3TKSE 2A4VA 4PQ1A 1LJRA 4IELA 3KEBA 2H0HA 12GSA 5HFGA 5GSSA 3ZL5A 4NV5A 3LFLA 3UVTA 4O92A 3RBTA 3EC3A 3FZ9A 4ILFA 2GSTA 1TW9A 4ML1A 2LQOA 3D5JA 3HCZA 2VLVA 2IPAA 5GAND 5DCGA 5IIZA 5CREA 1SK1A 5G5FA 1Q98A 3VWWA 1MDJA 1JZWA 3IV4A 2GSQA 3LSZA 4NXIA 2VL2A 3UJ1A 5J5NA 6GSTA 2IJYA 1XW5A 4EVMA 1SD9A 1C72A 1Z7RA 5IQYA 2ES7A 2HRNA 4XS6A 3FKFA 2KP2A 2WZ9A 1VF4A 3A3TA 5H5RA 4IKHA 2CV4A 4V2MA 5H5QA 1N2AA 2B1KA 3C1SA 3HJMA 2X8HA 4DSRA 2JSZA 2PERA 3TJGA 4FYUA 3ME7A 1TU8A 3TOTA 2VCTA 3KTLA 3KMNA 3LQ7A 4PXOA 1NHOA 4NAXA 3GHAA 1A8YA 3RHBA 4TKYA 1ABAA 5ECHB 1KNGA 5D93A 1TRVA 3CSIA 3QD9A 5ELGA 2M72A 2DMMA 2HRFA 1WIKA 3APOA 4ID0A 4OD7A 2ON5A 5HR0A 5ID2B 3IBHA 4BWSA 4V2NA 5ID2A 5IO2A 5FWGA 1HNBA 4F0CA 1R7HA 3H79A 1R26A 4IN0A 2P5QA 2VCZA 4Q5FA 2CA8A 1EEMA 3A2WA 3WGEA 4O7HA 3ZTLA 4G2EA 3PH9A 1QMVA 4ZXGA 1LBKA 1JZOA 1A8LA 2GQMA 3F3QA 3TB2A 5CRWA 4LMWA 4WR4A 2QKEA 4O5RA 1ERWA 5F0GA 3H93A 4IP6A 1YJ6A 3IHQA 1AQXA 2K18A 2JADA 5B7CA 3AY8A 3GV1A 6GSSA 3VWUA 2O87A 4NWYA 3W8SA 1RW1A 3HZ4A 3GKXA 4OFMA 1ZCPA 2PN8A 5DJMA 3LYPA 2O7KA 5JCUA 1I9DA 4K8MA 2H1AA 4CDOA 2H30A 3I43A 2Z9SA 2NBSA 4X1UA 5ECPB 3TRPA 2B7KA 5AGYA 2RUFA 1ST9A 1X5DA 5CRGA 2DIYA 2FGXA 3Q19A 1JZRA 1OE8A 2LJAA 5DALA 3FRCA 4F03A 2RM5A 4FO5A 5ECIB 5DVBA 1U87A 2H1DA 3ZZXA 4MPGA 1MTCA 5F07A 1PSQA 1V57A 1X9SB 5CNWA 1MD3A 1YY7A 5COHA 3HHVA 4F9ZA 2MYGA 1K0OA 3ZREA 1VRSD 13GSA 2H8LA 1S3DA 4MZCA 3QMXA 1A0RP 2AAWA 1PMTA 1SJZA 2WULA 1PN9A 2DJ2A 2CZ3A 2ON7A 3CTGA 3D22A 1KEBA 4IHUA 4RI7A 3VURA 4HZ4A 4MJBA 4WF4A 3MWHA 4MJEA 3A5WA 3FR6A 4HZ2A 3J7Yb 2YWNA 4BA7A 3UARA 3E0UA 1Y25A 2PPTA 1Z6MA 4TOPA 2NDOA 4DVCA 4ZB9A 4OWYA 3F3RA 2C3TA 1M2BA 4K7IA 5ECSA 3UBLA 1HNAA 3KXOA 2R5GA 3C8EA 3QAGA 2GQKA 1Z9HA 2HZEA 4KA0A 1THOA 2G2QA 4Z7XA 3WGDA 4PQHA 2AB6A 5F05A 1TRWA 3UEMA 3UMAA 4QL9A 4ECIA 2QGVA 5DCHA 2VO4A 3TGZA 3GA4A 4GWRA 2XHFA 4GQCA 3O6TA 1GRXA 2FD3A 6GSVA 3FZ5A 5LD0A 3F6DA 4ZL8A 1GSDA 2GT5A 1SKWB 3PINA 4XRAA 4X43A 1QUWA 4CW9A 1G6WA 2PBJA 2FCHA 5B6NA 1M9BA 1K0BA 4ISDA 3DGQA 2H70A 3F63A 3EMPA 2GS3A 1UN2A 1EGOA 1M7TA 1X5EA 1NSWA 4HJMA 4IBPA 1GTUA 1Z5YE 1DE1A 3RDWA 4YQUA 4BVYA 1A2MA 4PQIA 2IMEA 5E4WA 3FEUA 4KSOA 4MJCA 5IMZA 4GQFA 1PX6A 4DSQA 4XHMA 1FB6A 3DMLA 3CBUA 4EUYA 4KX4A 1GUKA 1GSEA 2PMTA 2CT6A 2IMDA 1NM3A 3VWXA 3FHKA 7GSSA 2XPEA 3KH9A 4TN8A 2V32A 4I8BA 2IMFA 4KB3A 3GYKA 3LJRA 2EIOA 2R6KA 1UC7A 2J23A 2LTKA 4GSNA 3Q6OA 1YDKA 5LNKe 3IE3A 3SWLA 2ZNMA 2DMLA 3EURA 3F0IA 4GTUA 4N0ZA 3N9JA 5DAKA 4JZQA 3TKPA 2PUKC 3U6VA 1F6MC 4BWQA 2HLSA 1MD4A 1GLPA 4AJ6A 1QGVA 1PX7A 4IP1A 2K6VA 3GURA 2C0FA 3WGXA 3V1WA 2H1GA 2OE3A 2XBIA 5JWOB 1B9XC 2LRTA 5IMDA 3Q74A 2KOKA 5INYA 5ELAA 5KN3A 1CQGA 2YWOA 4FH8A 1Z3EA 3IK7A 3GKMA 1Z7PA 2P31A 3GTUB 5DQSA 5J9BA 5EVOA 3GTUA 2YANA 3DKSA 3UL3A 5D8IA 2D2ZA 5ECOB 1B9YC 1X9MB 4MH2A 3GX8A 1SJIA 2VCQA 4GRFA 3NIVA 2CAIA 2QC7A 11GSA 1AW9A 2IWTA 3IOSA 1K3YA 4KCEA 2L4QA 3KTBA 4MJAA 1TU7A 1MEKA 4EXJA 5EY6A 4PNGA 3FZ4A 4MPFA 1F37A 1G6YA 2OE1A 1FOVA 3LXTA 3CXGA 5J4UA 1FHEA 4ZL7A 5C00A 1FW1A 3EMXA 4JR4A 5G5EA 1ZZYA 1QK8A 3IR4A 3IK9A 2X99A 3ZIVA 4L0WA 1XVQA 4ZB6A 3HDCA 4NPBA 1T3BA 4MMMA 1W4VA 3KD0A 2VL2C 4G9HA 4WXTA 2I3YA 4JU5A 4Q5NA 3GRXA 4PUAA 3D0ZA 3CMIA 3I9V2 2DJ1A 1TRUA 4EL1A 3BCKA 1MDIA 4ECCA 1XVWA 2LKUA 2X64A 3D6IA 2C3QA 1V40A 3LEFA 3PR8A 4NHZA 5HR3A 4XS1A 4POKA 3F4SA 4YQMA 5AISA 4N10A 3L4NA 2KHPA 5A4WA 4ECJA 1A0FA 4ZILA 3BBYA 1GSSA 3P8WA 3FZAA 5J3RA 3HJPA 1U3IA 2FWEA 1BG5A 5B6MA 2FWFA 3CRUA 3ZIJA 3GKKA 2CX3A 4WBRD 4HUAA 3CTFA 1SK0A 3NOFA 1YEPA 3ZYWA 5EPFA 3VLNA 3TUEA 2JZTA 3N5OA 3UAPA 1H75A 2VM2A 3MAKA 1XOAA 1JLWA 3L9UA 1OVNA 2MMZA 1NW2A 1SU9A 5IPHA 2FNOA 2LRCA 2LJKA 2V6KA 3GKNA 3ISOA 3KJYA 5D9XA 3F8UA 4QL7A 2YP6A 1YF0A 3P7XA 2L4CA 3GN3A 1EWXA 4LLRA 2C1YA 3A2XA 1O7UA 2X8CA 2N5AA 5JCGA 2YJ7A 2HSHA 3UOMA 5ECNB 2V6OA 3LORA 1SENA 1ZYQB 4HOJA 1TI3A 2K9FA 3RHCA 3F6FA 2O85A 2VCXA 1V2AA 1JLVA 4J2FA 3DWVA 1U6TA 1K3LA 1HD2A 1A2JA 5DBQA 4KW6A 5JWRB 1V9WA 1W89A 2B5EA 1BX9A 1EV4A 2OBIA 4LMVA 2B6MA 5HFKA 2F8FA 3KP9A 4TXVA 2C4JA 5KEJA 1YF1A 2DJKA 2GTUA 4HQZA 1UA5A 2PGTA 2WS2A 1ILOA 2I81A 4LA1A 3DIEA 1WP0A 1TI1A 4I97A 1VF3A 5HFIA 1T4ZA 2YN1A 4EDYA 4WR5A 5CRDA 3LG6A 1GTIA 1JHBA 2OADA 4OFTA 4HQSA 4KDUA 4HU7A 5J41A 3VPQA 4TXOA 1HQOA 1AQWA 2H76A 2OACA 3L78A 4GLTA 3US3A 1PD21 1XWAA 2NVLA 2MMAA 8GSSA 3G7YA 4MCUA 3ZVJD 2H6XA 4RQXA 2L6CA 2H74A 4V1Ag 1DSBA 1USBA 2IMKA 1XWCA 1KTEA 3FR3A 4EE0A 2LRNA 2E0QA 2JZSA 1G7EA 3CSHA 2FUG2 1OC9B 2IL3A 2YV7A 1OC9A 2AYTA 3CSJA 3QAWA 4L8EA 1TDIA 2YZUA 3GSSA 3KCMA 5DALB 2F3MA 1WPIA 5GZZB 1TK0B 1M9AA 2FWGA 1FO5A 1O85A 3TKRA 4WKWA 1K0NA 3FYGA 2F51A 1R4WA 1VF2A 4PGTA 4MP4A 4RUVA 5JCWA 4DSSB 2R37A 3LGCA 4DSSA 1OKTA 5FHIA 3TJKA 1KBNA 1SL2B 4X0XA 2JL4A 4HI7A 3E3EA 5IMCA 3NZNA 3DYRA 2RLIA 2L6DA 1DUGA 2XC2A 3KZQA 2HFDA 3VK9A 5CAXA 3LXZA 3ZVJA 3TCOA 3D4TA 4MF7A 4TVEA 4FYBA 3G7IA 2K8VA 5HQPA 2LV3A 3DRNA 5H5SA 4KCAA 2FA8A 2LJRA 1XWBA 2CZ2A 1K0AA 2LUSA 3M3MA 3TRXA 2FWHA 5B8AA 1J9BA 2DJJA 4K7OA 2OKAA 2DC5A 2AHEA 4K1FA 1XPVA 4OCEA 2H73A 3F4TA 2I9HA 2DLXA 4EO3A 5KN2A 3TJBA 1F9MA 1XIYA 2HZEB 2CX4A 2YJHA 5G1KA 2GT6A 1EOGA 2H72A 5AN1A 1ERUA 1QFNA 2DJ3A 4QQ7A 1TRSA 2MBTA 4MK3A 2YV9A 3DD3A 5JWQB 1B4PA 1JZDA 2ALBA 3UIWA 4XS4B 4ZBBA 2E2MA 4XS4A 2PWJA 1SYXA 1SK2A 2H75A 2VL9A 3EU3A 4KSMA 2AV4A 1XXUA 1TKDB 4N0VA 3Q18A 6GSWA 2HE3A 4HDEA 5CO3A 3HVVA 1GWCA 3ZRDA 2GSRA 2L5LA 4MLYA 4NHWA 2KUCA 3K8NA 1FB0A 1YKCA 2LNSA 1LU4A 2YPMA 2DSAA 4MF5A 4OO5A 4Q5QA 1ZYEA 4ZB8A 1ACVA 3DVXA 3D4MA 3GL3A 3TOUA 4EF0A 1AQVA 4IJIA 1TK5B 2WRTA 2RM6A 2LNTA 2VLTA 4JE1A 4JEDA 2VD1A 4PURA 1EEJA 1JFUA 2H1BA 16GSA 2XBQA 6GSYA 3KM6A 1IYHA 4LL4B 3W8JA 1PKWA 2PVQA 2VD0A 3M0FA 4I5QA 1FG4A 2VL3A 2GZYA 2B7JA 3GIXA 1WJKA 1XWGA 4JBBA 5DAKB 2AUVA 4AF2A 3VPTA 2O8VB 3ME8A 2GZPA 2FHEA 3F4RA 2VUPA 4MABA 3L9SA 2CVKA 3C73A 2HSYA 4J57E 4IW9A 22GSA 3EWLA 2L59A 2PU9C 4D73B 2IFQB 3IRAA 4D73A 2GLRA 2IFQA 1FVKA 1YQ1A 2HXKA 4TR3A 3J7Yk 4E8EA 1NHYA 1URMA 4PUFC 2WB9A 2IN3A 1V98A 3LYKA 2IIYA 4K0GA 3C71A 2A2SA 2B5YA 2H0GA 5CRHA 4ZBDA 4GCIA 2GQLA 3CYNA 4IQ1A 2H66A 1GH2A 1SYRA 1XWKA 2YWIA 1SKSB 3APQA 5D96A 4I2UA 5G2ZA 5AIXA 1O8XA 1B4QA 3BJ5A 3VI7A 4K7NA 5FT3A 2AJQB 4V1Ap 2M80A 4K6XA 1U88A 1O81A 1K0DA 3H8QA 1PA3A 4JR6A 5IMFA 2HI7A 1PL1A 1TOFA 1T1VA 5GSTA 2HZFA 3QR6A 1SJ6A 1GSYA 3TJJA 2KP1A 3M1GA 3E9JB 3HZ8A 1A2LA 3M9JA 3PGTA 2H19A 1QQ2A 2FLSA 5EL8A 2N5FA 4MZBA 5AIVA 3FW2A 4KE3A 1OC8A 2C80A 4KGIA 3CRTA 2FY6A 3L0HA 1AUCA 1ERTA 2GVPA 3APSA 3S9FA 4L0UA 4HS1A 1GP1A 4FIWA 1S3CA 4OFNA 3JCML 1WE0A 1XW9A 3BCIA 4KUNA 3O76A 6GSXA 4XTSA 4F2IA 3EYTA 4P3YB 1GSFA 2VCVA 5HR2A 2H71A 3IPZA 1I5GA 2CAQA 1RQMA 1TXXA 2EIQA 3GNJA 1T8EB 3H4KA 2H6ZA 2GZZA 1O8WA 1Q4JA 4H86A 1GLQA 3MDKA 1F3BA 4NV2A 3KGKA 1EOHA 1FAAA 2I4AA 2H0IA 2OA7A 3O3TA 1PKZA 3UBKA 4K0NA 1WRYA 4NMUA 1V58A 5IMVA 1EP8A 3IAM2 3TKSA 2B1LA
chains in the Genus database with same CATH superfamily
1SKRB 2VCWA 1SL1B 2HT9A 5ENUA 5ECKB 5ABRA 2TIRA 5ECQB 5F8BA 4XRDA 4N30A 4I2TA 4YAPA 5KOXA 1M2AA 3ZMKA 2YZHA 2BMXA 2EC4A 10GSA 2YNXA 2RUEA 3QFBC 3ZFBA 1GSUA 1X0RA 5DJLA 1HNCA 1J0FA 4IS0A 2JSYA 2C3NA 2A2RA 4F0BA 4L5OA 3GUSA 1X9WB 4PNFA 1EGRA 2JACA 1ZL9A 3M8NA 1TP9A 1SL0B 1ZGNA 4YH2A 1A23A 3QCPA 2J9HA 1OYJA 4BPYA 5ECRB 2MZCA 3FY7A 1BJXA 2X4AA 1ZOFA 4AJ8A 3I69A 5HR1A 4TW5A 2R0PA 5A5KA 3A2VA 1WMJA 4ZBAA 1GTBA 1EV9A 1AAZA 4EKZA 3ERGA 19GSA 3KMOA 2JU5A 2HRAA 2FA4A 2H6YA 5DQYA 4Q5RA 3UVHA 2E7PA 1RK4A 2RIIA 5E59A 2OJLA 5CYYA 3P2AA 4G19A 1K0MA 1WWJA 4TXOB 1HYUA 1EP7A 2VIMA 4TRXA 1PQNA 3BD2A 4KDXA 4WBJA 4GF0A 1ZMAA 2V41A 4XCSA 3W6GA 2GSSA 3IDVA 5GAPD 4MA9A 1THXA 5F06A 5ECLB 2VAFA 4K2DA 3ZMLA 5KN1A 3EU4A 3SBCA 1VGLA 2MBSA 5G1LA 4WEYA 2ZCTA 3HJOA 14GSA 1XOBA 5L71A 5G31A 3WT1A 1G7OA 1BQ7A 18GSA 4PX1A 3BOAA 3GL5A 3IA1A 3FK8A 4GSTA 5D9WA 1T00A 1BYEA 3QAVA 5J9CA 1Y6EA 1BEDA 2G0FA 2WJUA 2I1UA 2YWMA 4KH7A 4OMVA 1CQHA 1DE2A 4HEA2 3IAS2 3MSZA 2EIRA 1B8XA 1GUHA 4ZL9A 2B5XA 2R3XA 5IOXA 1A24A 2R4VA 2VOCA 4J56E 4HSCX 4WETA 2LQQA 3TRQA 2K8SA 3HVNA 4POLA 4KF9A 1GNEA 1AC1A 4ULXA 3WT2A 1E2YA 5LCZA 1XBSA 4O5UA 1SD8A 4TR1B 2LEGA 1FVJA 3VWVA 1F3AA 4TR1A 3KIJA 3WYWA 4FYCA 3IXRA 5IMAA 2WCIA 1MDKA 4XIHA 3DVWA 3F9UA 4YAVA 3ERFA 2CVDA 2C8UA 3P90A 3QOUA 1O73A 5IPGA 3M9KA 9GSSA 4I6XA 2IMIA 3HA9A 2V2GA 4MF6A 3HXSA 2KLXA 3KH7A 1YZXA 2P5RA 2C0EA 4BL7B 2PVOC 4G10A 4BL7A 3RPNA 5B8BA 3GX0A 2F9SA 2GDRA 1ERVA 2C0DA 3TDGA 3QPMA 4POMA 2P0GA 2R2JA 5G30A 1E6BA 1M3JA 3HKRA 2M46A 3U5RE 4IVFA 4E8HA 4YKGA 17GSA 1AIUA 1PGTA 2F8AA 2XPDA 5A4UA 1YEXA 1GL8A 1O6JA 1PN0A 4TR4A 2TRCP 4KDYA 4RI6A 4CHSA 4ECBA 2MMNA 4KAEA 2BTOT 4KNDA 4V2LA 1TTZA 3DEXA 3MNGA 2JZRA 1AXDA 2L5OA 1XW6A 1EZKA 5D9VA 2WGRA 2L57A 4EDZA 1PFOA 4OO4A 3RPPA 4AJ7A 1PRXA 3DXBA 1GUMA 2WFCA 4RQRA 3H1NA 1T4YA 2TRXA 2GGTA 2DIZA 3FR9A 2N5BA 4EC0A 1H4OA 1ON4A 1QXHA 2NPBA 4MZWA 4GSSA 3TJFA 2NTOA 5A4VA 2X8GA 3QDNA 1G0TA 3WD6A 1TJDA 4MDCA 1OE7A 5KN0A 3I6AA 3VFIA 4A5PA 5KOWA 4IJ3A 1F2EA 5C04A 2UZ8A 5D73A 1ML6A 1XCCA 5DDLA 3RAZA 4LL1B 1N8JA 3ZLPA 2YCDA 5IM9A 5ECMB 3G9BA 2OBKA 3HD5A 2WDUA 2MMOA 1M0UA 4IGJA 3VI5A 3ERWA 4OCFA 3IC4A 5IOWA 5D9TA 1VF1A 2O89A 3KP8A 2CVBA 4WF5A 2ZUPA 2V1MA 4AGSA 1DBYA 1B48A 3GH6A 1OAZA 6GSUA 3FMWA 4ACSA 1IYIA 2H01A 1M2DA 1GTAA 4IQAA 1T7PB 1GNWA 3EE2A 2REMA 4HU9A 3OR5A 1OKDA 3G7JA 2CQ9A 2QSIA 1J08A 1XZOA 4ML6A 4MH3A 3QFAC 1XFLA 4ZIJA 4F82A 1YKAA 3C7MA 5IO0A 3TKQA 4JRRA 3ZFLA 3EINA 4K9ZA 2OE0A 3GFKA 2DKIA 3ED3A 3HY2A 2YOIA 2VLUA 3R2QA 1Z6NA 1PL2A 1R5PA 1GSQA 5CP1A 1OC3A 3GMFA 1X5CA 1K3OA 2HNLA 4O32A 3L9VA 3D21A 1K0CA 3EVIA 3C1RA 2HYXA 1BAYA 2DJ0A 1M99A 2DBCA 2LSTA 3TKSC 2E2GA 1TK8B 4GXZA 1R5AA 20GSA 3HVXA 4TR0A 2LS5A 3HYPA 4L5LA 3LWAA 3PPUA 4POBA 4YQVA 1U3AA 4HJ2A 2QA1A 1S3AA 2B3SA 3ZITA 1UVZA 4BVXB 1WOUA 3HVSA 4N11A 2BJXA 4BVXA 3GH9A 2VM1A 4DEJA 3GSTA 2C0GA 1GULA 3TKSE 2A4VA 4PQ1A 1LJRA 4IELA 3KEBA 2H0HA 12GSA 5HFGA 2HSMA 5GSSA 3ZL5A 4NV5A 3LFLA 3UVTA 4O92A 3RBTA 3EC3A 3CQFA 3FZ9A 4ILFA 2GSTA 1TW9A 4ML1A 2LQOA 3D5JA 3HCZA 2VLVA 2IPAA 3IC8A 5GAND 5DCGA 5IIZA 5CREA 1SK1A 5G5FA 1Q98A 3VWWA 1MDJA 1JZWA 3IV4A 2GSQA 3LSZA 4NXIA 2VL2A 3UJ1A 5J5NA 6GSTA 2IJYA 1XW5A 4EVMA 1SD9A 1C72A 1Z7RA 5IQYA 2ES7A 2HRNA 4XS6A 3FKFA 2KP2A 2WZ9A 1VF4A 3A3TA 5H5RA 4IKHA 2CV4A 4V2MA 5H5QA 1N2AA 2B1KA 3C1SA 3HJMA 2X8HA 4DSRA 2JSZA 2PERA 3TJGA 4FYUA 3ME7A 1TU8A 3TOTA 2VCTA 3KTLA 3KMNA 3LQ7A 4PXOA 1NHOA 4Z2UA 4NAXA 3GHAA 1A8YA 3RHBA 4TKYA 1ABAA 5ECHB 1KNGA 5D93A 1TRVA 3CSIA 3QD9A 5ELGA 2M72A 2DMMA 2HRFA 1WIKA 3APOA 4ID0A 4OD7A 2ON5A 5HR0A 5ID2B 3IBHA 4BWSA 4V2NA 5ID2A 5IO2A 5FWGA 1HNBA 4F0CA 1R7HA 3H79A 1R26A 4IN0A 2P5QA 2VCZA 4Q5FA 2CA8A 1EEMA 3A2WA 3WGEA 4O7HA 3ZTLA 4G2EA 3PH9A 1QMVA 4ZXGA 1LBKA 1JZOA 1A8LA 2GQMA 3F3QA 3TB2A 5CRWA 4LMWA 4WR4A 2QKEA 4O5RA 1ERWA 5F0GA 3H93A 4IP6A 1YJ6A 3IHQA 1AQXA 2K18A 2JADA 5B7CA 3AY8A 3GV1A 6GSSA 3VWUA 2O87A 4NWYA 3W8SA 1RW1A 3HZ4A 3GKXA 4OFMA 1ZCPA 2PN8A 5DJMA 3LYPA 2O7KA 5JCUA 1I9DA 4K8MA 2H1AA 4CDOA 2H30A 3I43A 2Z9SA 2NBSA 4X1UA 5ECPB 3TRPA 5AGYA 2B7KA 2RUFA 1ST9A 5BRTA 1X5DA 5CRGA 2DIYA 2FGXA 3Q19A 4CY8A 1JZRA 1OE8A 2LJAA 5DALA 3FRCA 4F03A 2RM5A 4FO5A 5ECIB 5DVBA 1U87A 2H1DA 3ZZXA 4MPGA 1MTCA 5F07A 1PSQA 1V57A 3A5IA 1X9SB 5CNWA 1MD3A 1YY7A 5COHA 3HHVA 4F9ZA 2MYGA 1K0OA 3ZREA 1VRSD 13GSA 2H8LA 1S3DA 1M3IA 4MZCA 3QMXA 1A0RP 2AAWA 1PMTA 1SJZA 2WULA 1PN9A 2DJ2A 2CZ3A 2ON7A 3CTGA 3D22A 1KEBA 4IHUA 4RI7A 3VURA 4HZ4A 4MJBA 4WF4A 3MWHA 4MJEA 3A5WA 3FR6A 4HZ2A 3J7Yb 2A4HA 2DKHA 2YWNA 4BA7A 3UARA 3E0UA 1Y25A 2PPTA 1Z6MA 4TOPA 2NDOA 2R0GA 4DVCA 4ZB9A 4OWYA 3F3RA 2C3TA 1M2BA 4K7IA 5ECSA 3UBLA 1HNAA 3KXOA 2R5GA 3C8EA 3QAGA 2GQKA 1Z9HA 2HZEA 4KA0A 1THOA 2G2QA 4Z7XA 3WGDA 4PQHA 2AB6A 5F05A 1TRWA 3UEMA 3UMAA 4QL9A 4ECIA 2QGVA 5DCHA 2VO4A 3TGZA 3GA4A 4GWRA 2XHFA 4GQCA 3O6TA 1GRXA 2FD3A 6GSVA 3FZ5A 5LD0A 3F6DA 4ZL8A 1GSDA 2GT5A 1SKWB 3PINA 4XRAA 4X43A 1QUWA 4CW9A 1G6WA 2PBJA 2FCHA 5B6NA 1M9BA 1K0BA 4ISDA 3IHGA 3DGQA 2H70A 3F63A 3EMPA 2GS3A 1UN2A 1EGOA 1M7TA 1X5EA 1NSWA 4HJMA 4IBPA 1GTUA 1Z5YE 4BVYB 1DE1A 3RDWA 4YQUA 4BVYA 1A2MA 4PQIA 2IMEA 5E4WA 3FEUA 4KSOA 4MJCA 5IMZA 4GQFA 1PX6A 4DSQA 4XHMA 1FB6A 3DMLA 3CBUA 4EUYA 4KX4A 1GUKA 1GSEA 2PMTA 2CT6A 2IMDA 1NM3A 3VWXA 3FHKA 7GSSA 4Z2RA 2XPEA 3KH9A 4TN8A 2V32A 4I8BA 2IMFA 4KB3A 3GYKA 3LJRA 2EIOA 2R6KA 1UC7A 2J23A 2LTKA 4GSNA 3Q6OA 1YDKA 5LNKe 3IE3A 3SWLA 2ZNMA 2DMLA 3EURA 3F0IA 4GTUA 4N0ZA 3N9JA 5DAKA 4JZQA 3TKPA 2PUKC 3U6VA 1F6MC 4BWQA 2HLSA 1MD4A 1GLPA 4AJ6A 1QGVA 1PX7A 4IP1A 2K6VA 3GURA 2C0FA 3WGXA 3V1WA 2H1GA 2OE3A 2XBIA 5JWOB 1B9XC 2LRTA 5IMDA 3Q74A 2KOKA 5INYA 5ELAA 5KN3A 1CQGA 2YWOA 4FH8A 1Z3EA 3IK7A 3GKMA 1Z7PA 2P31A 3GTUB 5DQSA 5J9BA 5EVOA 3GTUA 2YANA 3DKSA 3UL3A 5D8IA 2D2ZA 5ECOB 4EIPA 1B9YC 1X9MB 4MH2A 3GX8A 1SJIA 2VCQA 4GRFA 3NIVA 2CAIA 2QC7A 11GSA 1AW9A 2IWTA 3IOSA 1K3YA 4KCEA 2L4QA 3KTBA 4MJAA 1TU7A 1MEKA 4EXJA 5EY6A 4PNGA 3FZ4A 4MPFA 1F37A 1G6YA 2OE1A 1FOVA 3LXTA 3CXGA 5J4UA 1FHEA 4ZL7A 5C00A 1FW1A 3EMXA 4JR4A 5G5EA 1ZZYA 1QK8A 3IR4A 3IK9A 2X99A 3ZIVA 4L0WA 1XVQA 4ZB6A 3HDCA 4NPBA 1T3BA 4MMMA 1W4VA 3KD0A 2VL2C 4G9HA 4WXTA 2I3YA 4JU5A 4Q5NA 3EPTA 3GRXA 4PUAA 3D0ZA 3CMIA 3I9V2 2DJ1A 1TRUA 4EL1A 3BCKA 1MDIA 4ECCA 1XVWA 2LKUA 2X64A 3D6IA 2C3QA 1V40A 3LEFA 3PR8A 4NHZA 5HR3A 4XS1A 4POKA 3F4SA 4YQMA 5AISA 4N10A 3L4NA 2KHPA 5A4WA 4ECJA 1A0FA 4ZILA 3BBYA 1GSSA 3P8WA 3FZAA 5J3RA 3HJPA 1U3IA 2FWEA 1BG5A 5B6MA 2FWFA 3CRUA 3ZIJA 3GKKA 2CX3A 4WBRD 4HUAA 3CTFA 4X4JA 1SK0A 3NOFA 4EIQA 1YEPA 3ZYWA 5EPFA 3VLNA 3TUEA 2JZTA 3N5OA 3UAPA 1H75A 2VM2A 3MAKA 1XOAA 1JLWA 3L9UA 1OVNA 2MMZA 1NW2A 1SU9A 5IPHA 2FNOA 2LRCA 2LJKA 2V6KA 3GKNA 3ISOA 3KJYA 5D9XA 3F8UA 4QL7A 2YP6A 1YF0A 3P7XA 2L4CA 3GN3A 1EWXA 4LLRA 2C1YA 3A2XA 1O7UA 2X8CA 2N5AA 5JCGA 2YJ7A 2HSHA 2QA2A 5ECNB 3UOMA 2V6OA 3LORA 1SENA 1ZYQB 4HOJA 1TI3A 2K9FA 3RHCA 3F6FA 2O85A 2VCXA 1V2AA 1JLVA 4J2FA 3DWVA 1U6TA 1K3LA 4FQUA 1HD2A 1A2JA 5DBQA 2A2PA 4KW6A 5JWRB 1V9WA 1W89A 4CY6A 2B5EA 1BX9A 1EV4A 2OBIA 4LMVA 2B6MA 5HFKA 2F8FA 3R3EA 3KP9A 4TXVA 2C4JA 5KEJA 1YF1A 2DJKA 2GTUA 4HQZA 1UA5A 2PGTA 2WS2A 1ILOA 2I81A 4LA1A 3DIEA 1WP0A 1TI1A 4I97A 1VF3A 5HFIA 1T4ZA 2YN1A 4EDYA 4WR5A 5CRDA 2HRKA 3LG6A 1GTIA 1JHBA 2OADA 4OFTA 4HQSA 4KDUA 4HU7A 5J41A 3VPQA 4TXOA 1HQOA 1AQWA 2H76A 2OACA 3L78A 4GLTA 3US3A 1PD21 1XWAA 2NVLA 2MMAA 8GSSA 3G7YA 4MCUA 3ZVJD 2H6XA 4RQXA 2L6CA 2H74A 4V1Ag 1DSBA 1USBA 2IMKA 1XWCA 1KTEA 3FR3A 4EE0A 2LRNA 2E0QA 2JZSA 1G7EA 3CSHA 2FUG2 1OC9B 2IL3A 2YV7A 1OC9A 2AYTA 3CSJA 3QAWA 4L8EA 1TDIA 2YZUA 3GSSA 3KCMA 5DALB 2F3MA 1WPIA 5GZZB 1TK0B 1M9AA 2FWGA 1FO5A 1O85A 3TKRA 4WKWA 1K0NA 3FYGA 2F51A 1R4WA 1VF2A 4PGTA 1XG8A 4MP4A 4RUVA 5JCWA 4DSSB 2R37A 3LGCA 4DSSA 1OKTA 4G0LA 5FHIA 3TJKA 1KBNA 1SL2B 4X0XA 2JL4A 4HI7A 3E3EA 5IMCA 3NZNA 3DYRA 2RLIA 2L6DA 1DUGA 2XC2A 3KZQA 2HFDA 3VK9A 5CAXA 3LXZA 3ZVJA 3TCOA 3D4TA 4MF7A 4TVEA 4FYBA 3G7IA 2K8VA 5HQPA 2LV3A 3DRNA 5H5SA 4KCAA 2FA8A 2LJRA 1XWBA 2CZ2A 1K0AA 2LUSA 4BIKA 3M3MA 3TRXA 2FWHA 5B8AA 1J9BA 3MYDA 2DJJA 5BMUA 4Z2TA 4K7OA 4YKFA 2OKAA 2DC5A 2AHEA 4K1FA 1XPVA 4OCEA 2H73A 3F4TA 2I9HA 2DLXA 4EO3A 4K2XA 5KN2A 3TJBA 1F9MA 1XIYA 2HZEB 2CX4A 2YJHA 5G1KA 2GT6A 1EOGA 2H72A 5AN1A 1ERUA 1QFNA 2DJ3A 4QQ7A 1TRSA 2MBTA 4MK3A 2YV9A 3DD3A 5JWQB 1B4PA 1JZDA 2ALBA 3UIWA 4XS4B 4K5SA 4ZBBA 2E2MA 4XS4A 2PWJA 1SYXA 1SK2A 2H75A 2VL9A 3EU3A 4KSMA 2AV4A 1ZYNA 1XXUA 1TKDB 4N0VA 3Q18A 6GSWA 4G0IA 4ICYA 2HE3A 4HDEA 5CO3A 3HVVA 1GWCA 3ZRDA 2GSRA 2L5LA 1ZYPA 4MLYA 4NHWA 2KUCA 3K8NA 1FB0A 1YKCA 2LNSA 3LW9A 1LU4A 2YPMA 2DSAA 4O5QA 4MF5A 4OO5A 4Q5QA 1ZYEA 4ZB8A 1ACVA 3DVXA 3D4MA 3GL3A 3TOUA 4EF0A 1AQVA 4IJIA 1TK5B 2WRTA 2RM6A 2LNTA 2VLTA 4JE1A 4JEDA 2VD1A 4PURA 1EEJA 1JFUA 2H1BA 2R0CA 16GSA 2XBQA 6GSYA 3KM6A 1IYHA 4LL4B 3W8JA 1PKWA 2PVQA 2VD0A 3M0FA 4I5QA 1FG4A 2VL3A 2GZYA 2B7JA 3GIXA 1WJKA 1XWGA 4JBBA 5DAKB 2AUVA 4AF2A 3VPTA 2O8VB 3ME8A 2GZPA 2FHEA 3F4RA 2VUPA 4MABA 3L9SA 2CVKA 3C73A 2HSYA 4J57E 4IW9A 22GSA 3EWLA 2L59A 2PU9C 4D73B 2IFQB 3IRAA 4D73A 2GLRA 2IFQA 1FVKA 1YQ1A 2HXKA 4TR3A 3J7Yk 4E8EA 1NHYA 1URMA 4PUFC 2WB9A 2IN3A 1V98A 3LYKA 2IIYA 4K0GA 3C71A 2A2SA 2B5YA 2H0GA 5CRHA 4ZBDA 4GCIA 2GQLA 3CYNA 4IQ1A 2H66A 1GH2A 1SYRA 1XWKA 2YWIA 1SKSB 3APQA 5D96A 4I2UA 5G2ZA 5AIXA 1O8XA 1B4QA 3BJ5A 3VI7A 4K7NA 5FT3A 2AJQB 4V1Ap 2M80A 4K6XA 1U88A 1O81A 1K0DA 3H8QA 1PA3A 1S3RA 4JR6A 5IMFA 2HI7A 1PL1A 1TOFA 1T1VA 5GSTA 2HZFA 3QR6A 1SJ6A 4MNNA 1GSYA 3TJJA 2KP1A 3M1GA 3E9JB 3HZ8A 1A2LA 3M9JA 3PGTA 2H19A 1QQ2A 2FLSA 2N5FA 5EL8A 4MZBA 5AIVA 3FW2A 4G0KA 1FOHA 4KE3A 1OC8A 2C80A 4KGIA 3CRTA 2FY6A 4PTSA 3L0HA 1AUCA 1ERTA 2GVPA 3APSA 3S9FA 4L0UA 4HS1A 1GP1A 4FIWA 1S3CA 4OFNA 3JCML 1WE0A 1XW9A 3BCIA 4KUNA 3O76A 6GSXA 4XTSA 4F2IA 3EYTA 4USSA 4P3YB 1GSFA 4K5RA 2VCVA 5HR2A 2H71A 3IPZA 1I5GA 2CAQA 1RQMA 1TXXA 2EIQA 3GNJA 1T8EB 3H4KA 2H6ZA 3MIXA 2GZZA 2X49A 1O8WA 1Q4JA 4H86A 1GLQA 3MDKA 1F3BA 4NV2A 3KGKA 1EOHA 1FAAA 2I4AA 2H0IA 2OA7A 3O3TA 1PKZA 3UBKA 4K0NA 1WRYA 4NMUA 1V58A 5IMVA 1EP8A 3IAM2 3TKSA 2B1LA
chains in the Genus database with same CATH topology
1SKRB 2VCWA 1SL1B 2HT9A 5ENUA 5ECKB 5ABRA 2TIRA 5ECQB 5F8BA 4XRDA 4N30A 4I2TA 4YAPA 5KOXA 1M2AA 3ZMKA 2YZHA 2BMXA 2EC4A 10GSA 2YNXA 2RUEA 3QFBC 3ZFBA 1GSUA 1X0RA 5DJLA 1HNCA 1J0FA 4IS0A 2JSYA 2C3NA 2A2RA 4F0BA 4L5OA 3GUSA 1X9WB 4PNFA 1EGRA 2JACA 1ZL9A 3M8NA 1TP9A 1SL0B 1ZGNA 4YH2A 1A23A 3QCPA 2J9HA 1OYJA 4BPYA 5ECRB 2MZCA 3FY7A 1BJXA 2X4AA 1ZOFA 4AJ8A 3I69A 5HR1A 4TW5A 2R0PA 5A5KA 3A2VA 1WMJA 4ZBAA 1GTBA 1EV9A 1AAZA 4EKZA 3ERGA 19GSA 3KMOA 2JU5A 2HRAA 2FA4A 2H6YA 5DQYA 4Q5RA 3UVHA 2E7PA 1RK4A 2RIIA 5E59A 2OJLA 5CYYA 3P2AA 4G19A 1K0MA 1WWJA 4TXOB 1HYUA 1EP7A 2VIMA 4TRXA 1PQNA 3BD2A 4KDXA 4WBJA 4GF0A 1ZMAA 2V41A 4XCSA 3W6GA 2GSSA 3IDVA 5GAPD 4MA9A 1THXA 5F06A 5ECLB 2VAFA 4K2DA 3ZMLA 5KN1A 3EU4A 3SBCA 1VGLA 2MBSA 5G1LA 4WEYA 2ZCTA 3HJOA 14GSA 1XOBA 5L71A 5G31A 3WT1A 1G7OA 1BQ7A 18GSA 4PX1A 3BOAA 3GL5A 3IA1A 3FK8A 4GSTA 5D9WA 1T00A 1BYEA 3QAVA 5J9CA 1Y6EA 1BEDA 2G0FA 2WJUA 2I1UA 2YWMA 4KH7A 4OMVA 1CQHA 1DE2A 4HEA2 3IAS2 3MSZA 2EIRA 1B8XA 1GUHA 4ZL9A 2B5XA 2R3XA 5IOXA 1A24A 2R4VA 2VOCA 4J56E 4WETA 2LQQA 3TRQA 2K8SA 4POLA 4KF9A 1GNEA 1AC1A 4ULXA 3WT2A 1E2YA 5LCZA 1XBSA 4O5UA 1SD8A 4TR1B 2LEGA 1FVJA 3VWVA 1F3AA 4TR1A 3KIJA 3WYWA 4FYCA 3IXRA 5IMAA 2WCIA 1MDKA 4XIHA 3DVWA 3F9UA 4YAVA 3ERFA 2CVDA 2C8UA 3P90A 3QOUA 1O73A 5IPGA 3M9KA 9GSSA 4I6XA 2IMIA 3HA9A 2V2GA 4MF6A 3HXSA 2KLXA 3KH7A 1YZXA 2P5RA 2C0EA 4BL7B 2PVOC 4G10A 4BL7A 3RPNA 5B8BA 3GX0A 2F9SA 2GDRA 1ERVA 2C0DA 3TDGA 3QPMA 4POMA 2P0GA 2R2JA 5G30A 1E6BA 3HKRA 2M46A 3U5RE 4IVFA 4E8HA 4YKGA 17GSA 1AIUA 1PGTA 2F8AA 2XPDA 5A4UA 1YEXA 1GL8A 1O6JA 1PN0A 4TR4A 2TRCP 4KDYA 4RI6A 4CHSA 4ECBA 2MMNA 4KAEA 2BTOT 4KNDA 4V2LA 1TTZA 3DEXA 3MNGA 2JZRA 1AXDA 2L5OA 1XW6A 1EZKA 5D9VA 2WGRA 2L57A 4EDZA 4OO4A 3RPPA 4AJ7A 1PRXA 3DXBA 1GUMA 2WFCA 4RQRA 3H1NA 1T4YA 2TRXA 2GGTA 2DIZA 3FR9A 2N5BA 4EC0A 1H4OA 1ON4A 1QXHA 2NPBA 4MZWA 4GSSA 3TJFA 2NTOA 5A4VA 2X8GA 3QDNA 1G0TA 3WD6A 1TJDA 4MDCA 1OE7A 5KN0A 3I6AA 3VFIA 4A5PA 5KOWA 4IJ3A 1F2EA 5C04A 2UZ8A 5D73A 1ML6A 1XCCA 5DDLA 3RAZA 4LL1B 1N8JA 3ZLPA 2YCDA 5IM9A 5ECMB 3G9BA 2OBKA 3HD5A 2WDUA 2MMOA 1M0UA 4IGJA 3VI5A 3ERWA 4OCFA 3IC4A 5IOWA 5D9TA 1VF1A 2O89A 3KP8A 2CVBA 4WF5A 2ZUPA 2V1MA 4AGSA 1DBYA 1B48A 3GH6A 1OAZA 6GSUA 3FMWA 4ACSA 1IYIA 2H01A 1M2DA 1GTAA 4IQAA 1T7PB 1GNWA 3EE2A 2REMA 4HU9A 3OR5A 1OKDA 3G7JA 2CQ9A 2QSIA 1J08A 1XZOA 4ML6A 4MH3A 3QFAC 1XFLA 4ZIJA 4F82A 1YKAA 3C7MA 5IO0A 3TKQA 4JRRA 3ZFLA 3EINA 4K9ZA 2OE0A 3GFKA 2DKIA 3ED3A 3HY2A 2YOIA 2VLUA 3R2QA 1Z6NA 1PL2A 1R5PA 1GSQA 5CP1A 1OC3A 3GMFA 1X5CA 1K3OA 2HNLA 4O32A 3L9VA 3D21A 1K0CA 3EVIA 3C1RA 2HYXA 1BAYA 2DJ0A 1M99A 2DBCA 2LSTA 3TKSC 2E2GA 1TK8B 4GXZA 1R5AA 20GSA 3HVXA 4TR0A 2LS5A 3HYPA 4L5LA 3LWAA 3PPUA 4POBA 4YQVA 1U3AA 4HJ2A 2QA1A 1S3AA 2B3SA 3ZITA 1UVZA 4BVXB 1WOUA 3HVSA 4N11A 2BJXA 4BVXA 3GH9A 2VM1A 4DEJA 3GSTA 2C0GA 1GULA 3TKSE 2A4VA 4PQ1A 1LJRA 4IELA 3KEBA 2H0HA 12GSA 5HFGA 2HSMA 5GSSA 3ZL5A 4NV5A 3LFLA 3UVTA 4O92A 3RBTA 3EC3A 3FZ9A 4ILFA 2GSTA 1TW9A 4ML1A 2LQOA 3D5JA 3HCZA 2VLVA 2IPAA 3IC8A 5GAND 5DCGA 5IIZA 5CREA 1SK1A 5G5FA 1Q98A 3VWWA 1MDJA 1JZWA 3IV4A 2GSQA 3LSZA 4NXIA 2VL2A 3UJ1A 5J5NA 6GSTA 2IJYA 1XW5A 4EVMA 1SD9A 1C72A 1Z7RA 5IQYA 2ES7A 2HRNA 4XS6A 3FKFA 2KP2A 2WZ9A 1VF4A 3A3TA 5H5RA 4IKHA 2CV4A 4V2MA 5H5QA 1N2AA 2B1KA 3C1SA 3HJMA 2X8HA 4DSRA 2JSZA 2PERA 3TJGA 4FYUA 3ME7A 1TU8A 3TOTA 2VCTA 3KTLA 3KMNA 3LQ7A 4PXOA 1NHOA 4Z2UA 4NAXA 3GHAA 1A8YA 3RHBA 4TKYA 1ABAA 5ECHB 1KNGA 5D93A 1TRVA 3CSIA 3QD9A 5ELGA 2M72A 2DMMA 2HRFA 1WIKA 3APOA 4ID0A 4OD7A 2ON5A 5HR0A 5ID2B 3IBHA 4BWSA 4V2NA 5ID2A 5IO2A 5FWGA 1HNBA 4F0CA 1R7HA 3H79A 1R26A 4IN0A 2P5QA 2VCZA 4Q5FA 2CA8A 1EEMA 3A2WA 3WGEA 4O7HA 3ZTLA 4G2EA 3PH9A 1QMVA 4ZXGA 1LBKA 1JZOA 1A8LA 2GQMA 3F3QA 3TB2A 5CRWA 4LMWA 4WR4A 2QKEA 4O5RA 1ERWA 5F0GA 3H93A 4IP6A 1YJ6A 3IHQA 1AQXA 2K18A 2JADA 5B7CA 3AY8A 3GV1A 6GSSA 3VWUA 2O87A 4NWYA 3W8SA 1RW1A 3HZ4A 3GKXA 4OFMA 1ZCPA 2PN8A 5DJMA 3LYPA 2O7KA 5JCUA 1I9DA 4K8MA 2H1AA 4CDOA 2H30A 3I43A 2Z9SA 2NBSA 4X1UA 5ECPB 3TRPA 5AGYA 2B7KA 2RUFA 1ST9A 5BRTA 1X5DA 5CRGA 2DIYA 2FGXA 3Q19A 4CY8A 1JZRA 1OE8A 2LJAA 5DALA 3FRCA 4F03A 2RM5A 4FO5A 5ECIB 5DVBA 1U87A 2H1DA 3ZZXA 4MPGA 1MTCA 5F07A 1PSQA 1V57A 3A5IA 1X9SB 5CNWA 1MD3A 1YY7A 5COHA 3HHVA 4F9ZA 2MYGA 1K0OA 3ZREA 1VRSD 13GSA 2H8LA 1S3DA 4MZCA 3QMXA 1A0RP 2AAWA 1PMTA 1SJZA 2WULA 1PN9A 2DJ2A 2CZ3A 2ON7A 3CTGA 3D22A 1KEBA 4IHUA 4RI7A 3VURA 4HZ4A 4MJBA 4WF4A 3MWHA 4MJEA 3A5WA 3FR6A 4HZ2A 3J7Yb 2A4HA 2DKHA 2YWNA 4BA7A 3UARA 3E0UA 1Y25A 2PPTA 1Z6MA 4TOPA 2NDOA 2R0GA 4DVCA 4ZB9A 4OWYA 3F3RA 2C3TA 1M2BA 4K7IA 5ECSA 3UBLA 1HNAA 3KXOA 2R5GA 3C8EA 3QAGA 2GQKA 1Z9HA 2HZEA 4KA0A 1THOA 2G2QA 4Z7XA 3WGDA 4PQHA 2AB6A 5F05A 1TRWA 3UEMA 3UMAA 4QL9A 4ECIA 2QGVA 5DCHA 2VO4A 3TGZA 3GA4A 4GWRA 2XHFA 4GQCA 3O6TA 1GRXA 2FD3A 6GSVA 3FZ5A 5LD0A 3F6DA 4ZL8A 1GSDA 2GT5A 1SKWB 3PINA 4XRAA 4X43A 1QUWA 4CW9A 1G6WA 2PBJA 2FCHA 5B6NA 1M9BA 1K0BA 4ISDA 3IHGA 3DGQA 2H70A 3F63A 3EMPA 2GS3A 1UN2A 1EGOA 1M7TA 1X5EA 1NSWA 4HJMA 4IBPA 1GTUA 1Z5YE 4BVYB 1DE1A 3RDWA 4YQUA 4BVYA 1A2MA 4PQIA 2IMEA 5E4WA 3FEUA 4KSOA 4MJCA 5IMZA 4GQFA 1PX6A 4DSQA 4XHMA 1FB6A 3DMLA 3CBUA 4EUYA 4KX4A 1GUKA 1GSEA 2PMTA 2CT6A 2IMDA 1NM3A 3VWXA 3FHKA 7GSSA 4Z2RA 2XPEA 3KH9A 4TN8A 2V32A 4I8BA 2IMFA 4KB3A 3GYKA 3LJRA 2EIOA 2R6KA 1UC7A 2J23A 2LTKA 4GSNA 3Q6OA 1YDKA 5LNKe 3IE3A 3SWLA 2ZNMA 2DMLA 3EURA 3F0IA 4GTUA 4N0ZA 3N9JA 5DAKA 4JZQA 3TKPA 2PUKC 3U6VA 1F6MC 4BWQA 2HLSA 1MD4A 1GLPA 4AJ6A 1QGVA 1PX7A 4IP1A 2K6VA 3GURA 2C0FA 3WGXA 3V1WA 2H1GA 2OE3A 2XBIA 5JWOB 1B9XC 2LRTA 5IMDA 3Q74A 2KOKA 5INYA 5ELAA 5KN3A 1CQGA 2YWOA 4FH8A 1Z3EA 3IK7A 3GKMA 1Z7PA 2P31A 3GTUB 5DQSA 5J9BA 5EVOA 3GTUA 2YANA 3DKSA 3UL3A 5D8IA 2D2ZA 5ECOB 4EIPA 1B9YC 1X9MB 4MH2A 3GX8A 1SJIA 2VCQA 4GRFA 3NIVA 2CAIA 2QC7A 11GSA 1AW9A 2IWTA 3IOSA 1K3YA 4KCEA 2L4QA 3KTBA 4MJAA 1TU7A 1MEKA 4EXJA 5EY6A 4PNGA 3FZ4A 4MPFA 1F37A 1G6YA 2OE1A 1FOVA 3LXTA 3CXGA 5J4UA 1FHEA 4ZL7A 5C00A 1FW1A 3EMXA 4JR4A 5G5EA 1ZZYA 1QK8A 3IR4A 3IK9A 2X99A 3ZIVA 4L0WA 1XVQA 4ZB6A 3HDCA 4NPBA 1T3BA 4MMMA 1W4VA 3KD0A 2VL2C 4G9HA 4WXTA 2I3YA 4JU5A 4Q5NA 3EPTA 3GRXA 4PUAA 3D0ZA 3CMIA 3I9V2 2DJ1A 1TRUA 4EL1A 3BCKA 1MDIA 4ECCA 1XVWA 2LKUA 2X64A 3D6IA 2C3QA 1V40A 3LEFA 3PR8A 4NHZA 5HR3A 4XS1A 4POKA 3F4SA 4YQMA 5AISA 4N10A 3L4NA 2KHPA 5A4WA 4ECJA 1A0FA 4ZILA 3BBYA 1GSSA 3P8WA 3FZAA 5J3RA 3HJPA 1U3IA 2FWEA 1BG5A 5B6MA 2FWFA 3CRUA 3ZIJA 3GKKA 2CX3A 4WBRD 4HUAA 3CTFA 4X4JA 1SK0A 3NOFA 4EIQA 1YEPA 3ZYWA 5EPFA 3VLNA 3TUEA 2JZTA 3N5OA 3UAPA 1H75A 2VM2A 3MAKA 1XOAA 1JLWA 3L9UA 1OVNA 2MMZA 1NW2A 1SU9A 5IPHA 2FNOA 2LRCA 2LJKA 2V6KA 3GKNA 3ISOA 3KJYA 5D9XA 3F8UA 4QL7A 2YP6A 1YF0A 3P7XA 2L4CA 3GN3A 1EWXA 4LLRA 2C1YA 3A2XA 1O7UA 2X8CA 2N5AA 5JCGA 2YJ7A 2HSHA 2QA2A 5ECNB 3UOMA 2V6OA 3LORA 1SENA 1ZYQB 4HOJA 1TI3A 2K9FA 3RHCA 3F6FA 2O85A 2VCXA 1V2AA 1JLVA 4J2FA 3DWVA 1U6TA 1K3LA 4FQUA 1HD2A 1A2JA 5DBQA 2A2PA 4KW6A 5JWRB 1V9WA 1W89A 4CY6A 2B5EA 1BX9A 1EV4A 2OBIA 4LMVA 2B6MA 5HFKA 2F8FA 3R3EA 3KP9A 4TXVA 2C4JA 5KEJA 1YF1A 2DJKA 2GTUA 4HQZA 1UA5A 2PGTA 2WS2A 1ILOA 2I81A 4LA1A 3DIEA 1WP0A 1TI1A 4I97A 1VF3A 5HFIA 1T4ZA 2YN1A 4EDYA 4WR5A 5CRDA 2HRKA 3LG6A 1GTIA 1JHBA 2OADA 4OFTA 4HQSA 4KDUA 4HU7A 5J41A 3VPQA 4TXOA 1HQOA 1AQWA 2H76A 2OACA 3L78A 4GLTA 3US3A 1PD21 1XWAA 2NVLA 2MMAA 8GSSA 3G7YA 4MCUA 3ZVJD 2H6XA 4RQXA 2L6CA 2H74A 4V1Ag 1DSBA 1USBA 2IMKA 1XWCA 1KTEA 3FR3A 4EE0A 2LRNA 2E0QA 2JZSA 1G7EA 3CSHA 2FUG2 1OC9B 2IL3A 2YV7A 1OC9A 2AYTA 3CSJA 3QAWA 4L8EA 1TDIA 2YZUA 3GSSA 3KCMA 5DALB 2F3MA 1WPIA 5GZZB 1TK0B 1M9AA 2FWGA 1FO5A 1O85A 3TKRA 4WKWA 1K0NA 3FYGA 2F51A 1R4WA 1VF2A 4PGTA 4MP4A 4RUVA 5JCWA 4DSSB 2R37A 3LGCA 4DSSA 1OKTA 4G0LA 5FHIA 3TJKA 1KBNA 1SL2B 4X0XA 2JL4A 4HI7A 3E3EA 5IMCA 3NZNA 3DYRA 2RLIA 2L6DA 1DUGA 2XC2A 3KZQA 2HFDA 3VK9A 5CAXA 3LXZA 3ZVJA 3TCOA 3D4TA 4MF7A 4TVEA 4FYBA 3G7IA 2K8VA 5HQPA 2LV3A 3DRNA 5H5SA 4KCAA 2FA8A 2LJRA 1XWBA 2CZ2A 1K0AA 2LUSA 3M3MA 3TRXA 2FWHA 5B8AA 1J9BA 3MYDA 2DJJA 5BMUA 4Z2TA 4K7OA 4YKFA 2OKAA 2DC5A 2AHEA 4K1FA 1XPVA 4OCEA 2H73A 3F4TA 2I9HA 2DLXA 4EO3A 4K2XA 5KN2A 3TJBA 1F9MA 1XIYA 2HZEB 2CX4A 2YJHA 5G1KA 2GT6A 1EOGA 2H72A 5AN1A 1ERUA 1QFNA 2DJ3A 4QQ7A 1TRSA 2MBTA 4MK3A 2YV9A 3DD3A 5JWQB 1B4PA 1JZDA 2ALBA 3UIWA 4XS4B 4K5SA 4ZBBA 2E2MA 4XS4A 2PWJA 1SYXA 1SK2A 2H75A 2VL9A 3EU3A 4KSMA 2AV4A 1ZYNA 1XXUA 1TKDB 4N0VA 3Q18A 6GSWA 4G0IA 4ICYA 2HE3A 4HDEA 5CO3A 3HVVA 1GWCA 3ZRDA 2GSRA 2L5LA 1ZYPA 4MLYA 4NHWA 2KUCA 3K8NA 1FB0A 1YKCA 2LNSA 3LW9A 1LU4A 2YPMA 2DSAA 4O5QA 4MF5A 4OO5A 4Q5QA 1ZYEA 4ZB8A 1ACVA 3DVXA 3D4MA 3GL3A 3TOUA 4EF0A 1AQVA 4IJIA 1TK5B 2WRTA 2RM6A 2LNTA 2VLTA 4JE1A 4JEDA 2VD1A 4PURA 1EEJA 1JFUA 2H1BA 2R0CA 16GSA 2XBQA 6GSYA 3KM6A 1IYHA 4LL4B 3W8JA 1PKWA 2PVQA 2VD0A 3M0FA 4I5QA 1FG4A 2VL3A 2GZYA 2B7JA 3GIXA 1WJKA 1XWGA 4JBBA 5DAKB 2AUVA 4AF2A 3VPTA 2O8VB 3ME8A 2GZPA 2FHEA 3F4RA 2VUPA 4MABA 3L9SA 2CVKA 3C73A 2HSYA 4J57E 4IW9A 22GSA 3EWLA 2L59A 2PU9C 4D73B 2IFQB 3IRAA 4D73A 2GLRA 2IFQA 1FVKA 1YQ1A 2HXKA 4TR3A 3J7Yk 4E8EA 1NHYA 1URMA 4PUFC 2WB9A 2IN3A 1V98A 3LYKA 2IIYA 4K0GA 3C71A 2A2SA 2B5YA 2H0GA 5CRHA 4ZBDA 4GCIA 2GQLA 3CYNA 4IQ1A 2H66A 1GH2A 1SYRA 1XWKA 2YWIA 1SKSB 3APQA 5D96A 4I2UA 5G2ZA 5AIXA 1O8XA 1B4QA 3BJ5A 3VI7A 4K7NA 5FT3A 2AJQB 4V1Ap 2M80A 4K6XA 1U88A 1O81A 1K0DA 3H8QA 1PA3A 4JR6A 5IMFA 2HI7A 1PL1A 1TOFA 1T1VA 5GSTA 2HZFA 3QR6A 1SJ6A 4MNNA 1GSYA 3TJJA 2KP1A 3M1GA 3E9JB 3HZ8A 1A2LA 3M9JA 3PGTA 2H19A 1QQ2A 2FLSA 2N5FA 5EL8A 4MZBA 5AIVA 3FW2A 4G0KA 1FOHA 4KE3A 1OC8A 2C80A 4KGIA 3CRTA 2FY6A 4PTSA 3L0HA 1AUCA 1ERTA 2GVPA 3APSA 3S9FA 4L0UA 4HS1A 1GP1A 4FIWA 1S3CA 4OFNA 3JCML 1WE0A 1XW9A 3BCIA 4KUNA 3O76A 6GSXA 4XTSA 4F2IA 3EYTA 4USSA 4P3YB 1GSFA 4K5RA 2VCVA 5HR2A 2H71A 3IPZA 1I5GA 2CAQA 1RQMA 1TXXA 2EIQA 3GNJA 1T8EB 3H4KA 2H6ZA 3MIXA 2GZZA 2X49A 1O8WA 1Q4JA 4H86A 1GLQA 3MDKA 1F3BA 4NV2A 3KGKA 1EOHA 1FAAA 2I4AA 2H0IA 2OA7A 3O3TA 1PKZA 3UBKA 4K0NA 1WRYA 4NMUA 1V58A 5IMVA 1EP8A 3IAM2 3TKSA 2B1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SKR B;  2VCW A;  1SL1 B;  2HT9 A;  5ENU A;  5ECK B;  5ABR A;  2TIR A;  5ECQ B;  5F8B A;  4XRD A;  4N30 A;  4I2T A;  4YAP A;  1M2A A;  3ZMK A;  2YZH A;  2BMX A;  2EC4 A;  10GS A;  2YNX A;  2RUE A;  3QFB C;  3ZFB A;  1GSU A;  1X0R A;  5DJL A;  1HNC A;  1J0F A;  4IS0 A;  2JSY A;  2C3N A;  2A2R A;  4F0B A;  4L5O A;  3GUS A;  1X9W B;  4PNF A;  1EGR A;  2JAC A;  1ZL9 A;  3M8N A;  1TP9 A;  1SL0 B;  1ZGN A;  4YH2 A;  1A23 A;  3QCP A;  2J9H A;  1OYJ A;  4BPY A;  5ECR B;  2MZC A;  3FY7 A;  1BJX A;  1ZOF A;  4AJ8 A;  3I69 A;  5HR1 A;  4TW5 A;  5A5K A;  3A2V A;  1WMJ A;  4ZBA A;  1GTB A;  1EV9 A;  1AAZ A;  4EKZ A;  3ERG A;  19GS A;  3KMO A;  2JU5 A;  2FA4 A;  2H6Y A;  5DQY A;  4Q5R A;  3UVH A;  2E7P A;  1RK4 A;  2RII A;  5E59 A;  2OJL A;  5CYY A;  3P2A A;  4G19 A;  1K0M A;  1WWJ A;  4TXO B;  1HYU A;  1EP7 A;  2VIM A;  4TRX A;  1PQN A;  3BD2 A;  4KDX A;  4WBJ A;  4GF0 A;  1ZMA A;  2V41 A;  4XCS A;  3W6G A;  2GSS A;  3IDV A;  5GAP D;  4MA9 A;  1THX A;  5F06 A;  5ECL B;  2VAF A;  4K2D A;  3ZML A;  5KN1 A;  3EU4 A;  3SBC A;  1VGL A;  2MBS A;  5G1L A;  4WEY A;  2ZCT A;  3HJO A;  14GS A;  1XOB A;  5L71 A;  5G31 A;  3WT1 A;  1G7O A;  1BQ7 A;  18GS A;  4PX1 A;  3BOA A;  3GL5 A;  3IA1 A;  3FK8 A;  4GST A;  5D9W A;  1T00 A;  1BYE A;  3QAV A;  5J9C A;  1Y6E A;  1BED A;  2G0F A;  2WJU A;  2I1U A;  2YWM A;  4KH7 A;  4OMV A;  1CQH A;  1DE2 A;  4HEA 2;  3IAS 2;  3MSZ A;  2EIR A;  1B8X A;  1GUH A;  4ZL9 A;  2B5X A;  2R3X A;  5IOX A;  1A24 A;  2R4V A;  2VOC A;  4J56 E;  4WET A;  2LQQ A;  3TRQ A;  2K8S A;  4POL A;  1GNE A;  1AC1 A;  4ULX A;  3WT2 A;  1E2Y A;  5LCZ A;  1XBS A;  1SD8 A;  4TR1 B;  2LEG A;  1FVJ A;  3VWV A;  1F3A A;  4TR1 A;  3KIJ A;  3WYW A;  4FYC A;  3IXR A;  5IMA A;  2WCI A;  1MDK A;  4XIH A;  3DVW A;  3F9U A;  4YAV A;  3ERF A;  2CVD A;  2C8U A;  3P90 A;  3QOU A;  1O73 A;  5IPG A;  3M9K A;  9GSS A;  4I6X A;  2IMI A;  3HA9 A;  2V2G A;  4MF6 A;  3HXS A;  2KLX A;  3KH7 A;  1YZX A;  2P5R A;  2C0E A;  2PVO C;  4G10 A;  4BL7 A;  3RPN A;  5B8B A;  3GX0 A;  2F9S A;  2GDR A;  1ERV A;  2C0D A;  3TDG A;  3QPM A;  4POM A;  2P0G A;  2R2J A;  5G30 A;  1E6B A;  3HKR A;  2M46 A;  3U5R E;  4IVF A;  4E8H A;  17GS A;  1AIU A;  1PGT A;  2F8A A;  2XPD A;  5A4U A;  1YEX A;  1GL8 A;  1O6J A;  4TR4 A;  2TRC P;  4KDY A;  4RI6 A;  4CHS A;  4ECB A;  2MMN A;  4KAE A;  2BTO T;  4KND A;  4V2L A;  1TTZ A;  3DEX A;  3MNG A;  2JZR A;  1AXD A;  2L5O A;  1XW6 A;  1EZK A;  5D9V A;  2WGR A;  2L57 A;  4EDZ A;  4OO4 A;  3RPP A;  4AJ7 A;  1PRX A;  3DXB A;  1GUM A;  2WFC A;  4RQR A;  3H1N A;  1T4Y A;  2TRX A;  2GGT A;  2DIZ A;  3FR9 A;  2N5B A;  4EC0 A;  1H4O A;  1ON4 A;  1QXH A;  2NPB A;  4MZW A;  4GSS A;  3TJF A;  2NTO A;  5A4V A;  2X8G A;  3QDN A;  1G0T A;  3WD6 A;  1TJD A;  4MDC A;  1OE7 A;  5KN0 A;  3I6A A;  3VFI A;  4IJ3 A;  1F2E A;  5C04 A;  5D73 A;  1ML6 A;  1XCC A;  5DDL A;  3RAZ A;  4LL1 B;  1N8J A;  3ZLP A;  2YCD A;  5IM9 A;  5ECM B;  3G9B A;  2OBK A;  3HD5 A;  2WDU A;  2MMO A;  1M0U A;  4IGJ A;  3VI5 A;  3ERW A;  4OCF A;  3IC4 A;  5IOW A;  5D9T A;  1VF1 A;  2O89 A;  3KP8 A;  2CVB A;  4WF5 A;  2ZUP A;  2V1M A;  4AGS A;  1DBY A;  1B48 A;  3GH6 A;  1OAZ A;  6GSU A;  4ACS A;  1IYI A;  2H01 A;  1M2D A;  1GTA A;  4IQA A;  1T7P B;  1GNW A;  3EE2 A;  2REM A;  4HU9 A;  3OR5 A;  1OKD A;  3G7J A;  2CQ9 A;  2QSI A;  1J08 A;  1XZO A;  4ML6 A;  4MH3 A;  3QFA C;  1XFL A;  4ZIJ A;  4F82 A;  1YKA A;  3C7M A;  5IO0 A;  3TKQ A;  4JRR A;  3ZFL A;  3EIN A;  4K9Z A;  2OE0 A;  3GFK A;  3ED3 A;  3HY2 A;  2YOI A;  2VLU A;  3R2Q A;  1Z6N A;  1PL2 A;  1R5P A;  1GSQ A;  5CP1 A;  1OC3 A;  3GMF A;  1X5C A;  1K3O A;  2HNL A;  4O32 A;  3L9V A;  3D21 A;  1K0C A;  3EVI A;  3C1R A;  2HYX A;  1BAY A;  2DJ0 A;  1M99 A;  2DBC A;  2LST A;  3TKS C;  2E2G A;  1TK8 B;  4GXZ A;  1R5A A;  20GS A;  3HVX A;  4TR0 A;  2LS5 A;  3HYP A;  4L5L A;  3LWA A;  4YQV A;  4POB A;  1U3A A;  4HJ2 A;  1S3A A;  2B3S A;  3ZIT A;  1UVZ A;  1WOU A;  3HVS A;  4N11 A;  2BJX A;  4BVX A;  3GH9 A;  2VM1 A;  4DEJ A;  3GST A;  2C0G A;  1GUL A;  3TKS E;  2A4V A;  4PQ1 A;  1LJR A;  4IEL A;  3KEB A;  2H0H A;  12GS A;  5HFG A;  5GSS A;  3ZL5 A;  4NV5 A;  3LFL A;  3UVT A;  4O92 A;  3RBT A;  3EC3 A;  3FZ9 A;  4ILF A;  2GST A;  1TW9 A;  4ML1 A;  2LQO A;  3D5J A;  3HCZ A;  2VLV A;  2IPA A;  5GAN D;  5DCG A;  5IIZ A;  5CRE A;  1SK1 A;  5G5F A;  1Q98 A;  3VWW A;  1MDJ A;  1JZW A;  3IV4 A;  2GSQ A;  3LSZ A;  4NXI A;  2VL2 A;  3UJ1 A;  5J5N A;  6GST A;  2IJY A;  1XW5 A;  4EVM A;  1SD9 A;  1C72 A;  1Z7R A;  5IQY A;  2ES7 A;  2HRN A;  4XS6 A;  3FKF A;  2KP2 A;  2WZ9 A;  1VF4 A;  3A3T A;  5H5R A;  4IKH A;  2CV4 A;  4V2M A;  5H5Q A;  1N2A A;  2B1K A;  3C1S A;  3HJM A;  2X8H A;  4DSR A;  2JSZ A;  2PER A;  3TJG A;  4FYU A;  3ME7 A;  1TU8 A;  3TOT A;  2VCT A;  3KTL A;  3KMN A;  3LQ7 A;  4PXO A;  1NHO A;  4NAX A;  3GHA A;  1A8Y A;  3RHB A;  4TKY A;  1ABA A;  5ECH B;  1KNG A;  5D93 A;  1TRV A;  3CSI A;  3QD9 A;  5ELG A;  2M72 A;  2DMM A;  2HRF A;  1WIK A;  3APO A;  4ID0 A;  4OD7 A;  2ON5 A;  5HR0 A;  5ID2 B;  3IBH A;  4BWS A;  4V2N A;  5ID2 A;  5IO2 A;  5FWG A;  1HNB A;  4F0C A;  1R7H A;  3H79 A;  1R26 A;  4IN0 A;  2P5Q A;  2VCZ A;  4Q5F A;  2CA8 A;  1EEM A;  3A2W A;  3WGE A;  4O7H A;  3ZTL A;  4G2E A;  3PH9 A;  1QMV A;  4ZXG A;  1LBK A;  1JZO A;  1A8L A;  2GQM A;  3F3Q A;  3TB2 A;  5CRW A;  4LMW A;  4WR4 A;  2QKE A;  4O5R A;  1ERW A;  5F0G A;  3H93 A;  4IP6 A;  1YJ6 A;  3IHQ A;  1AQX A;  2K18 A;  2JAD A;  5B7C A;  3AY8 A;  3GV1 A;  6GSS A;  3VWU A;  2O87 A;  4NWY A;  3W8S A;  1RW1 A;  3HZ4 A;  3GKX A;  4OFM A;  1ZCP A;  2PN8 A;  5DJM A;  3LYP A;  2O7K A;  5JCU A;  1I9D A;  4K8M A;  2H1A A;  4CDO A;  2H30 A;  3I43 A;  2Z9S A;  2NBS A;  4X1U A;  5ECP B;  3TRP A;  2B7K A;  5AGY A;  2RUF A;  1ST9 A;  1X5D A;  5CRG A;  2DIY A;  2FGX A;  3Q19 A;  1JZR A;  1OE8 A;  2LJA A;  5DAL A;  3FRC A;  4F03 A;  2RM5 A;  4FO5 A;  5ECI B;  5DVB A;  1U87 A;  2H1D A;  3ZZX A;  4MPG A;  1MTC A;  5F07 A;  1PSQ A;  1V57 A;  1X9S B;  5CNW A;  1MD3 A;  1YY7 A;  5COH A;  3HHV A;  4F9Z A;  2MYG A;  1K0O A;  3ZRE A;  1VRS D;  13GS A;  2H8L A;  1S3D A;  4MZC A;  3QMX A;  1A0R P;  2AAW A;  1PMT A;  1SJZ A;  2WUL A;  1PN9 A;  2DJ2 A;  2CZ3 A;  2ON7 A;  3CTG A;  3D22 A;  1KEB A;  4IHU A;  4RI7 A;  3VUR A;  4HZ4 A;  4MJB A;  4WF4 A;  3MWH A;  4MJE A;  3A5W A;  3FR6 A;  4HZ2 A;  3J7Y b;  2YWN A;  4BA7 A;  3UAR A;  3E0U A;  1Y25 A;  2PPT A;  1Z6M A;  4TOP A;  2NDO A;  4DVC A;  4ZB9 A;  4OWY A;  3F3R A;  2C3T A;  1M2B A;  4K7I A;  5ECS A;  3UBL A;  1HNA A;  3KXO A;  2R5G A;  3C8E A;  3QAG A;  2GQK A;  1Z9H A;  2HZE A;  4KA0 A;  1THO A;  2G2Q A;  4Z7X A;  3WGD A;  4PQH A;  2AB6 A;  5F05 A;  1TRW A;  3UEM A;  3UMA A;  4QL9 A;  4ECI A;  2QGV A;  5DCH A;  2VO4 A;  3TGZ A;  3GA4 A;  4GWR A;  2XHF A;  4GQC A;  3O6T A;  1GRX A;  2FD3 A;  6GSV A;  3FZ5 A;  5LD0 A;  3F6D A;  4ZL8 A;  1GSD A;  2GT5 A;  1SKW B;  3PIN A;  4XRA A;  4X43 A;  1QUW A;  4CW9 A;  1G6W A;  2PBJ A;  2FCH A;  5B6N A;  1M9B A;  1K0B A;  4ISD A;  3DGQ A;  2H70 A;  3F63 A;  3EMP A;  2GS3 A;  1UN2 A;  1EGO A;  1M7T A;  1X5E A;  1NSW A;  4HJM A;  4IBP A;  1GTU A;  1Z5Y E;  1DE1 A;  3RDW A;  4YQU A;  4BVY A;  1A2M A;  4PQI A;  2IME A;  5E4W A;  3FEU A;  4KSO A;  4MJC A;  5IMZ A;  4GQF A;  1PX6 A;  4DSQ A;  4XHM A;  1FB6 A;  3DML A;  3CBU A;  4EUY A;  4KX4 A;  1GUK A;  1GSE A;  2PMT A;  2CT6 A;  2IMD A;  1NM3 A;  3VWX A;  3FHK A;  7GSS A;  2XPE A;  3KH9 A;  4TN8 A;  2V32 A;  4I8B A;  2IMF A;  4KB3 A;  3GYK A;  3LJR A;  2EIO A;  2R6K A;  1UC7 A;  2J23 A;  2LTK A;  4GSN A;  3Q6O A;  1YDK A;  5LNK e;  3IE3 A;  3SWL A;  2ZNM A;  2DML A;  3EUR A;  3F0I A;  4GTU A;  4N0Z A;  3N9J A;  5DAK A;  4JZQ A;  3TKP A;  2PUK C;  3U6V A;  1F6M C;  4BWQ A;  2HLS A;  1MD4 A;  1GLP A;  4AJ6 A;  1QGV A;  1PX7 A;  4IP1 A;  2K6V A;  3GUR A;  2C0F A;  3WGX A;  3V1W A;  2H1G A;  2OE3 A;  2XBI A;  5JWO B;  1B9X C;  2LRT A;  5IMD A;  3Q74 A;  2KOK A;  5INY A;  5ELA A;  5KN3 A;  1CQG A;  2YWO A;  4FH8 A;  1Z3E A;  3IK7 A;  3GKM A;  1Z7P A;  2P31 A;  3GTU B;  5DQS A;  5J9B A;  5EVO A;  3GTU A;  2YAN A;  3DKS A;  3UL3 A;  5D8I A;  2D2Z A;  5ECO B;  1B9Y C;  1X9M B;  4MH2 A;  3GX8 A;  1SJI A;  2VCQ A;  4GRF A;  3NIV A;  2CAI A;  2QC7 A;  11GS A;  1AW9 A;  2IWT A;  3IOS A;  1K3Y A;  4KCE A;  2L4Q A;  3KTB A;  4MJA A;  1TU7 A;  1MEK A;  4EXJ A;  5EY6 A;  4PNG A;  3FZ4 A;  4MPF A;  1F37 A;  1G6Y A;  2OE1 A;  1FOV A;  3LXT A;  3CXG A;  5J4U A;  1FHE A;  4ZL7 A;  5C00 A;  1FW1 A;  3EMX A;  4JR4 A;  5G5E A;  1ZZY A;  1QK8 A;  3IR4 A;  3IK9 A;  2X99 A;  3ZIV A;  4L0W A;  1XVQ A;  4ZB6 A;  3HDC A;  4NPB A;  1T3B A;  4MMM A;  1W4V A;  3KD0 A;  2VL2 C;  4G9H A;  4WXT A;  2I3Y A;  4JU5 A;  4Q5N A;  3GRX A;  4PUA A;  3D0Z A;  3CMI A;  3I9V 2;  2DJ1 A;  1TRU A;  4EL1 A;  3BCK A;  1MDI A;  4ECC A;  1XVW A;  2LKU A;  2X64 A;  3D6I A;  2C3Q A;  1V40 A;  3LEF A;  3PR8 A;  4NHZ A;  5HR3 A;  4XS1 A;  4POK A;  3F4S A;  4YQM A;  5AIS A;  4N10 A;  3L4N A;  2KHP A;  5A4W A;  4ECJ A;  1A0F A;  4ZIL A;  3BBY A;  1GSS A;  3P8W A;  3FZA A;  5J3R A;  3HJP A;  1U3I A;  2FWE A;  1BG5 A;  5B6M A;  2FWF A;  3CRU A;  3ZIJ A;  3GKK A;  2CX3 A;  4WBR D;  4HUA A;  3CTF A;  1SK0 A;  3NOF A;  1YEP A;  3ZYW A;  5EPF A;  3VLN A;  3TUE A;  2JZT A;  3N5O A;  3UAP A;  1H75 A;  2VM2 A;  3MAK A;  1XOA A;  1JLW A;  3L9U A;  1OVN A;  2MMZ A;  1NW2 A;  1SU9 A;  5IPH A;  2FNO A;  2LRC A;  2LJK A;  2V6K A;  3GKN A;  3ISO A;  3KJY A;  5D9X A;  3F8U A;  4QL7 A;  2YP6 A;  1YF0 A;  3P7X A;  2L4C A;  3GN3 A;  1EWX A;  4LLR A;  2C1Y A;  3A2X A;  1O7U A;  2X8C A;  2N5A A;  5JCG A;  2YJ7 A;  2HSH A;  3UOM A;  5ECN B;  2V6O A;  3LOR A;  1SEN A;  1ZYQ B;  4HOJ A;  1TI3 A;  2K9F A;  3RHC A;  3F6F A;  2O85 A;  2VCX A;  1V2A A;  1JLV A;  4J2F A;  3DWV A;  1U6T A;  1K3L A;  1HD2 A;  1A2J A;  5DBQ A;  4KW6 A;  5JWR B;  1V9W A;  1W89 A;  2B5E A;  1BX9 A;  1EV4 A;  2OBI A;  4LMV A;  2B6M A;  5HFK A;  2F8F A;  3KP9 A;  4TXV A;  2C4J A;  5KEJ A;  1YF1 A;  2DJK A;  2GTU A;  4HQZ A;  1UA5 A;  2PGT A;  2WS2 A;  1ILO A;  2I81 A;  4LA1 A;  3DIE A;  1WP0 A;  1TI1 A;  4I97 A;  1VF3 A;  5HFI A;  1T4Z A;  2YN1 A;  4EDY A;  4WR5 A;  5CRD A;  3LG6 A;  1GTI A;  1JHB A;  2OAD A;  4OFT A;  4HQS A;  4KDU A;  4HU7 A;  5J41 A;  3VPQ A;  4TXO A;  1HQO A;  1AQW A;  2H76 A;  2OAC A;  3L78 A;  4GLT A;  3US3 A;  1PD2 1;  1XWA A;  2NVL A;  2MMA A;  8GSS A;  3G7Y A;  4MCU A;  3ZVJ D;  2H6X A;  4RQX A;  2L6C A;  2H74 A;  4V1A g;  1DSB A;  1USB A;  2IMK A;  1XWC A;  1KTE A;  3FR3 A;  4EE0 A;  2LRN A;  2E0Q A;  2JZS A;  1G7E A;  3CSH A;  2FUG 2;  1OC9 B;  2IL3 A;  2YV7 A;  1OC9 A;  2AYT A;  3CSJ A;  3QAW A;  4L8E A;  1TDI A;  2YZU A;  3GSS A;  3KCM A;  5DAL B;  2F3M A;  1WPI A;  5GZZ B;  1TK0 B;  1M9A A;  2FWG A;  1FO5 A;  1O85 A;  3TKR A;  4WKW A;  1K0N A;  3FYG A;  2F51 A;  1R4W A;  1VF2 A;  4PGT A;  4MP4 A;  4RUV A;  5JCW A;  4DSS B;  2R37 A;  3LGC A;  4DSS A;  1OKT A;  5FHI A;  3TJK A;  1KBN A;  1SL2 B;  4X0X A;  2JL4 A;  4HI7 A;  3E3E A;  5IMC A;  3NZN A;  3DYR A;  2RLI A;  2L6D A;  1DUG A;  2XC2 A;  3KZQ A;  2HFD A;  3VK9 A;  5CAX A;  3LXZ A;  3ZVJ A;  3TCO A;  3D4T A;  4MF7 A;  4TVE A;  4FYB A;  3G7I A;  2K8V A;  5HQP A;  2LV3 A;  3DRN A;  5H5S A;  4KCA A;  2FA8 A;  2LJR A;  1XWB A;  2CZ2 A;  1K0A A;  2LUS A;  3M3M A;  3TRX A;  2FWH A;  5B8A A;  1J9B A;  2DJJ A;  4K7O A;  2OKA A;  2DC5 A;  2AHE A;  4K1F A;  1XPV A;  4OCE A;  2H73 A;  3F4T A;  2I9H A;  2DLX A;  4EO3 A;  5KN2 A;  3TJB A;  1F9M A;  1XIY A;  2HZE B;  2CX4 A;  2YJH A;  5G1K A;  2GT6 A;  1EOG A;  2H72 A;  5AN1 A;  1ERU A;  1QFN A;  2DJ3 A;  4QQ7 A;  1TRS A;  2MBT A;  4MK3 A;  2YV9 A;  3DD3 A;  5JWQ B;  1B4P A;  1JZD A;  2ALB A;  3UIW A;  4XS4 B;  4ZBB A;  2E2M A;  4XS4 A;  2PWJ A;  1SYX A;  1SK2 A;  2H75 A;  2VL9 A;  3EU3 A;  4KSM A;  2AV4 A;  1XXU A;  1TKD B;  4N0V A;  3Q18 A;  6GSW A;  2HE3 A;  4HDE A;  5CO3 A;  3HVV A;  1GWC A;  3ZRD A;  2GSR A;  2L5L A;  4MLY A;  4NHW A;  2KUC A;  3K8N A;  1FB0 A;  1YKC A;  2LNS A;  1LU4 A;  2YPM A;  2DSA A;  4MF5 A;  4OO5 A;  4Q5Q A;  1ZYE A;  4ZB8 A;  1ACV A;  3DVX A;  3D4M A;  3GL3 A;  3TOU A;  4EF0 A;  1AQV A;  4IJI A;  1TK5 B;  2WRT A;  2RM6 A;  2LNT A;  2VLT A;  4JE1 A;  4JED A;  2VD1 A;  4PUR A;  1EEJ A;  1JFU A;  2H1B A;  16GS A;  2XBQ A;  6GSY A;  3KM6 A;  1IYH A;  4LL4 B;  3W8J A;  1PKW A;  2PVQ A;  2VD0 A;  3M0F A;  4I5Q A;  1FG4 A;  2VL3 A;  2GZY A;  2B7J A;  3GIX A;  1WJK A;  1XWG A;  4JBB A;  5DAK B;  2AUV A;  4AF2 A;  3VPT A;  2O8V B;  3ME8 A;  2GZP A;  2FHE A;  3F4R A;  2VUP A;  4MAB A;  3L9S A;  2CVK A;  3C73 A;  2HSY A;  4J57 E;  4IW9 A;  22GS A;  3EWL A;  2L59 A;  2PU9 C;  4D73 B;  2IFQ B;  3IRA A;  4D73 A;  2GLR A;  2IFQ A;  1FVK A;  1YQ1 A;  2HXK A;  4TR3 A;  3J7Y k;  4E8E A;  1NHY A;  1URM A;  4PUF C;  2WB9 A;  2IN3 A;  1V98 A;  3LYK A;  2IIY A;  4K0G A;  3C71 A;  2A2S A;  2B5Y A;  2H0G A;  5CRH A;  4ZBD A;  4GCI A;  2GQL A;  3CYN A;  4IQ1 A;  2H66 A;  1GH2 A;  1SYR A;  1XWK A;  2YWI A;  1SKS B;  3APQ A;  5D96 A;  4I2U A;  5G2Z A;  5AIX A;  1O8X A;  1B4Q A;  3BJ5 A;  3VI7 A;  4K7N A;  5FT3 A;  2AJQ B;  4V1A p;  2M80 A;  4K6X A;  1U88 A;  1O81 A;  1K0D A;  3H8Q A;  1PA3 A;  4JR6 A;  5IMF A;  2HI7 A;  1PL1 A;  1TOF A;  1T1V A;  5GST A;  2HZF A;  3QR6 A;  1SJ6 A;  1GSY A;  3TJJ A;  2KP1 A;  3M1G A;  3E9J B;  3HZ8 A;  1A2L A;  3M9J A;  3PGT A;  2H19 A;  1QQ2 A;  2FLS A;  5EL8 A;  2N5F A;  4MZB A;  5AIV A;  3FW2 A;  4KE3 A;  1OC8 A;  2C80 A;  4KGI A;  3CRT A;  2FY6 A;  3L0H A;  1AUC A;  1ERT A;  2GVP A;  3APS A;  3S9F A;  4L0U A;  4HS1 A;  1GP1 A;  4FIW A;  1S3C A;  4OFN A;  3JCM L;  1WE0 A;  1XW9 A;  3BCI A;  4KUN A;  3O76 A;  6GSX A;  4XTS A;  4F2I A;  3EYT A;  4P3Y B;  1GSF A;  2VCV A;  5HR2 A;  2H71 A;  3IPZ A;  1I5G A;  2CAQ A;  1RQM A;  1TXX A;  2EIQ A;  3GNJ A;  1T8E B;  3H4K A;  2H6Z A;  2GZZ A;  1O8W A;  1Q4J A;  4H86 A;  1GLQ A;  3MDK A;  1F3B A;  4NV2 A;  3KGK A;  1EOH A;  1FAA A;  2I4A A;  2H0I A;  2OA7 A;  3O3T A;  1PKZ A;  3UBK A;  4K0N A;  1WRY A;  4NMU A;  1V58 A;  5IMV A;  1EP8 A;  3IAM 2;  3TKS A;  2B1L A; 
#chains in the Genus database with same CATH topology
 1SKR B;  2VCW A;  1SL1 B;  2HT9 A;  5ENU A;  5ECK B;  5ABR A;  2TIR A;  5ECQ B;  5F8B A;  4XRD A;  4N30 A;  4I2T A;  4YAP A;  5KOX A;  1M2A A;  3ZMK A;  2YZH A;  2BMX A;  2EC4 A;  10GS A;  2YNX A;  2RUE A;  3QFB C;  3ZFB A;  1GSU A;  1X0R A;  5DJL A;  1HNC A;  1J0F A;  4IS0 A;  2JSY A;  2C3N A;  2A2R A;  4F0B A;  4L5O A;  3GUS A;  1X9W B;  4PNF A;  1EGR A;  2JAC A;  1ZL9 A;  3M8N A;  1TP9 A;  1SL0 B;  1ZGN A;  4YH2 A;  1A23 A;  3QCP A;  2J9H A;  1OYJ A;  4BPY A;  5ECR B;  2MZC A;  3FY7 A;  1BJX A;  2X4A A;  1ZOF A;  4AJ8 A;  3I69 A;  5HR1 A;  4TW5 A;  2R0P A;  5A5K A;  3A2V A;  1WMJ A;  4ZBA A;  1GTB A;  1EV9 A;  1AAZ A;  4EKZ A;  3ERG A;  19GS A;  3KMO A;  2JU5 A;  2HRA A;  2FA4 A;  2H6Y A;  5DQY A;  4Q5R A;  3UVH A;  2E7P A;  1RK4 A;  2RII A;  5E59 A;  2OJL A;  5CYY A;  3P2A A;  4G19 A;  1K0M A;  1WWJ A;  4TXO B;  1HYU A;  1EP7 A;  2VIM A;  4TRX A;  1PQN A;  3BD2 A;  4KDX A;  4WBJ A;  4GF0 A;  1ZMA A;  2V41 A;  4XCS A;  3W6G A;  2GSS A;  3IDV A;  5GAP D;  4MA9 A;  1THX A;  5F06 A;  5ECL B;  2VAF A;  4K2D A;  3ZML A;  5KN1 A;  3EU4 A;  3SBC A;  1VGL A;  2MBS A;  5G1L A;  4WEY A;  2ZCT A;  3HJO A;  14GS A;  1XOB A;  5L71 A;  5G31 A;  3WT1 A;  1G7O A;  1BQ7 A;  18GS A;  4PX1 A;  3BOA A;  3GL5 A;  3IA1 A;  3FK8 A;  4GST A;  5D9W A;  1T00 A;  1BYE A;  3QAV A;  5J9C A;  1Y6E A;  1BED A;  2G0F A;  2WJU A;  2I1U A;  2YWM A;  4KH7 A;  4OMV A;  1CQH A;  1DE2 A;  4HEA 2;  3IAS 2;  3MSZ A;  2EIR A;  1B8X A;  1GUH A;  4ZL9 A;  2B5X A;  2R3X A;  5IOX A;  1A24 A;  2R4V A;  2VOC A;  4J56 E;  4HSC X;  4WET A;  2LQQ A;  3TRQ A;  2K8S A;  3HVN A;  4POL A;  4KF9 A;  1GNE A;  1AC1 A;  4ULX A;  3WT2 A;  1E2Y A;  5LCZ A;  1XBS A;  4O5U A;  1SD8 A;  4TR1 B;  2LEG A;  1FVJ A;  3VWV A;  1F3A A;  4TR1 A;  3KIJ A;  3WYW A;  4FYC A;  3IXR A;  5IMA A;  2WCI A;  1MDK A;  4XIH A;  3DVW A;  3F9U A;  4YAV A;  3ERF A;  2CVD A;  2C8U A;  3P90 A;  3QOU A;  1O73 A;  5IPG A;  3M9K A;  9GSS A;  4I6X A;  2IMI A;  3HA9 A;  2V2G A;  4MF6 A;  3HXS A;  2KLX A;  3KH7 A;  1YZX A;  2P5R A;  2C0E A;  4BL7 B;  2PVO C;  4G10 A;  4BL7 A;  3RPN A;  5B8B A;  3GX0 A;  2F9S A;  2GDR A;  1ERV A;  2C0D A;  3TDG A;  3QPM A;  4POM A;  2P0G A;  2R2J A;  5G30 A;  1E6B A;  1M3J A;  3HKR A;  2M46 A;  3U5R E;  4IVF A;  4E8H A;  4YKG A;  17GS A;  1AIU A;  1PGT A;  2F8A A;  2XPD A;  5A4U A;  1YEX A;  1GL8 A;  1O6J A;  1PN0 A;  4TR4 A;  2TRC P;  4KDY A;  4RI6 A;  4CHS A;  4ECB A;  2MMN A;  4KAE A;  2BTO T;  4KND A;  4V2L A;  1TTZ A;  3DEX A;  3MNG A;  2JZR A;  1AXD A;  2L5O A;  1XW6 A;  1EZK A;  5D9V A;  2WGR A;  2L57 A;  4EDZ A;  1PFO A;  4OO4 A;  3RPP A;  4AJ7 A;  1PRX A;  3DXB A;  1GUM A;  2WFC A;  4RQR A;  3H1N A;  1T4Y A;  2TRX A;  2GGT A;  2DIZ A;  3FR9 A;  2N5B A;  4EC0 A;  1H4O A;  1ON4 A;  1QXH A;  2NPB A;  4MZW A;  4GSS A;  3TJF A;  2NTO A;  5A4V A;  2X8G A;  3QDN A;  1G0T A;  3WD6 A;  1TJD A;  4MDC A;  1OE7 A;  5KN0 A;  3I6A A;  3VFI A;  4A5P A;  5KOW A;  4IJ3 A;  1F2E A;  5C04 A;  2UZ8 A;  5D73 A;  1ML6 A;  1XCC A;  5DDL A;  3RAZ A;  4LL1 B;  1N8J A;  3ZLP A;  2YCD A;  5IM9 A;  5ECM B;  3G9B A;  2OBK A;  3HD5 A;  2WDU A;  2MMO A;  1M0U A;  4IGJ A;  3VI5 A;  3ERW A;  4OCF A;  3IC4 A;  5IOW A;  5D9T A;  1VF1 A;  2O89 A;  3KP8 A;  2CVB A;  4WF5 A;  2ZUP A;  2V1M A;  4AGS A;  1DBY A;  1B48 A;  3GH6 A;  1OAZ A;  6GSU A;  3FMW A;  4ACS A;  1IYI A;  2H01 A;  1M2D A;  1GTA A;  4IQA A;  1T7P B;  1GNW A;  3EE2 A;  2REM A;  4HU9 A;  3OR5 A;  1OKD A;  3G7J A;  2CQ9 A;  2QSI A;  1J08 A;  1XZO A;  4ML6 A;  4MH3 A;  3QFA C;  1XFL A;  4ZIJ A;  4F82 A;  1YKA A;  3C7M A;  5IO0 A;  3TKQ A;  4JRR A;  3ZFL A;  3EIN A;  4K9Z A;  2OE0 A;  3GFK A;  2DKI A;  3ED3 A;  3HY2 A;  2YOI A;  2VLU A;  3R2Q A;  1Z6N A;  1PL2 A;  1R5P A;  1GSQ A;  5CP1 A;  1OC3 A;  3GMF A;  1X5C A;  1K3O A;  2HNL A;  4O32 A;  3L9V A;  3D21 A;  1K0C A;  3EVI A;  3C1R A;  2HYX A;  1BAY A;  2DJ0 A;  1M99 A;  2DBC A;  2LST A;  3TKS C;  2E2G A;  1TK8 B;  4GXZ A;  1R5A A;  20GS A;  3HVX A;  4TR0 A;  2LS5 A;  3HYP A;  4L5L A;  3LWA A;  3PPU A;  4POB A;  4YQV A;  1U3A A;  4HJ2 A;  2QA1 A;  1S3A A;  2B3S A;  3ZIT A;  1UVZ A;  4BVX B;  1WOU A;  3HVS A;  4N11 A;  2BJX A;  4BVX A;  3GH9 A;  2VM1 A;  4DEJ A;  3GST A;  2C0G A;  1GUL A;  3TKS E;  2A4V A;  4PQ1 A;  1LJR A;  4IEL A;  3KEB A;  2H0H A;  12GS A;  5HFG A;  2HSM A;  5GSS A;  3ZL5 A;  4NV5 A;  3LFL A;  3UVT A;  4O92 A;  3RBT A;  3EC3 A;  3CQF A;  3FZ9 A;  4ILF A;  2GST A;  1TW9 A;  4ML1 A;  2LQO A;  3D5J A;  3HCZ A;  2VLV A;  2IPA A;  3IC8 A;  5GAN D;  5DCG A;  5IIZ A;  5CRE A;  1SK1 A;  5G5F A;  1Q98 A;  3VWW A;  1MDJ A;  1JZW A;  3IV4 A;  2GSQ A;  3LSZ A;  4NXI A;  2VL2 A;  3UJ1 A;  5J5N A;  6GST A;  2IJY A;  1XW5 A;  4EVM A;  1SD9 A;  1C72 A;  1Z7R A;  5IQY A;  2ES7 A;  2HRN A;  4XS6 A;  3FKF A;  2KP2 A;  2WZ9 A;  1VF4 A;  3A3T A;  5H5R A;  4IKH A;  2CV4 A;  4V2M A;  5H5Q A;  1N2A A;  2B1K A;  3C1S A;  3HJM A;  2X8H A;  4DSR A;  2JSZ A;  2PER A;  3TJG A;  4FYU A;  3ME7 A;  1TU8 A;  3TOT A;  2VCT A;  3KTL A;  3KMN A;  3LQ7 A;  4PXO A;  1NHO A;  4Z2U A;  4NAX A;  3GHA A;  1A8Y A;  3RHB A;  4TKY A;  1ABA A;  5ECH B;  1KNG A;  5D93 A;  1TRV A;  3CSI A;  3QD9 A;  5ELG A;  2M72 A;  2DMM A;  2HRF A;  1WIK A;  3APO A;  4ID0 A;  4OD7 A;  2ON5 A;  5HR0 A;  5ID2 B;  3IBH A;  4BWS A;  4V2N A;  5ID2 A;  5IO2 A;  5FWG A;  1HNB A;  4F0C A;  1R7H A;  3H79 A;  1R26 A;  4IN0 A;  2P5Q A;  2VCZ A;  4Q5F A;  2CA8 A;  1EEM A;  3A2W A;  3WGE A;  4O7H A;  3ZTL A;  4G2E A;  3PH9 A;  1QMV A;  4ZXG A;  1LBK A;  1JZO A;  1A8L A;  2GQM A;  3F3Q A;  3TB2 A;  5CRW A;  4LMW A;  4WR4 A;  2QKE A;  4O5R A;  1ERW A;  5F0G A;  3H93 A;  4IP6 A;  1YJ6 A;  3IHQ A;  1AQX A;  2K18 A;  2JAD A;  5B7C A;  3AY8 A;  3GV1 A;  6GSS A;  3VWU A;  2O87 A;  4NWY A;  3W8S A;  1RW1 A;  3HZ4 A;  3GKX A;  4OFM A;  1ZCP A;  2PN8 A;  5DJM A;  3LYP A;  2O7K A;  5JCU A;  1I9D A;  4K8M A;  2H1A A;  4CDO A;  2H30 A;  3I43 A;  2Z9S A;  2NBS A;  4X1U A;  5ECP B;  3TRP A;  5AGY A;  2B7K A;  2RUF A;  1ST9 A;  5BRT A;  1X5D A;  5CRG A;  2DIY A;  2FGX A;  3Q19 A;  4CY8 A;  1JZR A;  1OE8 A;  2LJA A;  5DAL A;  3FRC A;  4F03 A;  2RM5 A;  4FO5 A;  5ECI B;  5DVB A;  1U87 A;  2H1D A;  3ZZX A;  4MPG A;  1MTC A;  5F07 A;  1PSQ A;  1V57 A;  3A5I A;  1X9S B;  5CNW A;  1MD3 A;  1YY7 A;  5COH A;  3HHV A;  4F9Z A;  2MYG A;  1K0O A;  3ZRE A;  1VRS D;  13GS A;  2H8L A;  1S3D A;  1M3I A;  4MZC A;  3QMX A;  1A0R P;  2AAW A;  1PMT A;  1SJZ A;  2WUL A;  1PN9 A;  2DJ2 A;  2CZ3 A;  2ON7 A;  3CTG A;  3D22 A;  1KEB A;  4IHU A;  4RI7 A;  3VUR A;  4HZ4 A;  4MJB A;  4WF4 A;  3MWH A;  4MJE A;  3A5W A;  3FR6 A;  4HZ2 A;  3J7Y b;  2A4H A;  2DKH A;  2YWN A;  4BA7 A;  3UAR A;  3E0U A;  1Y25 A;  2PPT A;  1Z6M A;  4TOP A;  2NDO A;  2R0G A;  4DVC A;  4ZB9 A;  4OWY A;  3F3R A;  2C3T A;  1M2B A;  4K7I A;  5ECS A;  3UBL A;  1HNA A;  3KXO A;  2R5G A;  3C8E A;  3QAG A;  2GQK A;  1Z9H A;  2HZE A;  4KA0 A;  1THO A;  2G2Q A;  4Z7X A;  3WGD A;  4PQH A;  2AB6 A;  5F05 A;  1TRW A;  3UEM A;  3UMA A;  4QL9 A;  4ECI A;  2QGV A;  5DCH A;  2VO4 A;  3TGZ A;  3GA4 A;  4GWR A;  2XHF A;  4GQC A;  3O6T A;  1GRX A;  2FD3 A;  6GSV A;  3FZ5 A;  5LD0 A;  3F6D A;  4ZL8 A;  1GSD A;  2GT5 A;  1SKW B;  3PIN A;  4XRA A;  4X43 A;  1QUW A;  4CW9 A;  1G6W A;  2PBJ A;  2FCH A;  5B6N A;  1M9B A;  1K0B A;  4ISD A;  3IHG A;  3DGQ A;  2H70 A;  3F63 A;  3EMP A;  2GS3 A;  1UN2 A;  1EGO A;  1M7T A;  1X5E A;  1NSW A;  4HJM A;  4IBP A;  1GTU A;  1Z5Y E;  4BVY B;  1DE1 A;  3RDW A;  4YQU A;  4BVY A;  1A2M A;  4PQI A;  2IME A;  5E4W A;  3FEU A;  4KSO A;  4MJC A;  5IMZ A;  4GQF A;  1PX6 A;  4DSQ A;  4XHM A;  1FB6 A;  3DML A;  3CBU A;  4EUY A;  4KX4 A;  1GUK A;  1GSE A;  2PMT A;  2CT6 A;  2IMD A;  1NM3 A;  3VWX A;  3FHK A;  7GSS A;  4Z2R A;  2XPE A;  3KH9 A;  4TN8 A;  2V32 A;  4I8B A;  2IMF A;  4KB3 A;  3GYK A;  3LJR A;  2EIO A;  2R6K A;  1UC7 A;  2J23 A;  2LTK A;  4GSN A;  3Q6O A;  1YDK A;  5LNK e;  3IE3 A;  3SWL A;  2ZNM A;  2DML A;  3EUR A;  3F0I A;  4GTU A;  4N0Z A;  3N9J A;  5DAK A;  4JZQ A;  3TKP A;  2PUK C;  3U6V A;  1F6M C;  4BWQ A;  2HLS A;  1MD4 A;  1GLP A;  4AJ6 A;  1QGV A;  1PX7 A;  4IP1 A;  2K6V A;  3GUR A;  2C0F A;  3WGX A;  3V1W A;  2H1G A;  2OE3 A;  2XBI A;  5JWO B;  1B9X C;  2LRT A;  5IMD A;  3Q74 A;  2KOK A;  5INY A;  5ELA A;  5KN3 A;  1CQG A;  2YWO A;  4FH8 A;  1Z3E A;  3IK7 A;  3GKM A;  1Z7P A;  2P31 A;  3GTU B;  5DQS A;  5J9B A;  5EVO A;  3GTU A;  2YAN A;  3DKS A;  3UL3 A;  5D8I A;  2D2Z A;  5ECO B;  4EIP A;  1B9Y C;  1X9M B;  4MH2 A;  3GX8 A;  1SJI A;  2VCQ A;  4GRF A;  3NIV A;  2CAI A;  2QC7 A;  11GS A;  1AW9 A;  2IWT A;  3IOS A;  1K3Y A;  4KCE A;  2L4Q A;  3KTB A;  4MJA A;  1TU7 A;  1MEK A;  4EXJ A;  5EY6 A;  4PNG A;  3FZ4 A;  4MPF A;  1F37 A;  1G6Y A;  2OE1 A;  1FOV A;  3LXT A;  3CXG A;  5J4U A;  1FHE A;  4ZL7 A;  5C00 A;  1FW1 A;  3EMX A;  4JR4 A;  5G5E A;  1ZZY A;  1QK8 A;  3IR4 A;  3IK9 A;  2X99 A;  3ZIV A;  4L0W A;  1XVQ A;  4ZB6 A;  3HDC A;  4NPB A;  1T3B A;  4MMM A;  1W4V A;  3KD0 A;  2VL2 C;  4G9H A;  4WXT A;  2I3Y A;  4JU5 A;  4Q5N A;  3EPT A;  3GRX A;  4PUA A;  3D0Z A;  3CMI A;  3I9V 2;  2DJ1 A;  1TRU A;  4EL1 A;  3BCK A;  1MDI A;  4ECC A;  1XVW A;  2LKU A;  2X64 A;  3D6I A;  2C3Q A;  1V40 A;  3LEF A;  3PR8 A;  4NHZ A;  5HR3 A;  4XS1 A;  4POK A;  3F4S A;  4YQM A;  5AIS A;  4N10 A;  3L4N A;  2KHP A;  5A4W A;  4ECJ A;  1A0F A;  4ZIL A;  3BBY A;  1GSS A;  3P8W A;  3FZA A;  5J3R A;  3HJP A;  1U3I A;  2FWE A;  1BG5 A;  5B6M A;  2FWF A;  3CRU A;  3ZIJ A;  3GKK A;  2CX3 A;  4WBR D;  4HUA A;  3CTF A;  4X4J A;  1SK0 A;  3NOF A;  4EIQ A;  1YEP A;  3ZYW A;  5EPF A;  3VLN A;  3TUE A;  2JZT A;  3N5O A;  3UAP A;  1H75 A;  2VM2 A;  3MAK A;  1XOA A;  1JLW A;  3L9U A;  1OVN A;  2MMZ A;  1NW2 A;  1SU9 A;  5IPH A;  2FNO A;  2LRC A;  2LJK A;  2V6K A;  3GKN A;  3ISO A;  3KJY A;  5D9X A;  3F8U A;  4QL7 A;  2YP6 A;  1YF0 A;  3P7X A;  2L4C A;  3GN3 A;  1EWX A;  4LLR A;  2C1Y A;  3A2X A;  1O7U A;  2X8C A;  2N5A A;  5JCG A;  2YJ7 A;  2HSH A;  2QA2 A;  5ECN B;  3UOM A;  2V6O A;  3LOR A;  1SEN A;  1ZYQ B;  4HOJ A;  1TI3 A;  2K9F A;  3RHC A;  3F6F A;  2O85 A;  2VCX A;  1V2A A;  1JLV A;  4J2F A;  3DWV A;  1U6T A;  1K3L A;  4FQU A;  1HD2 A;  1A2J A;  5DBQ A;  2A2P A;  4KW6 A;  5JWR B;  1V9W A;  1W89 A;  4CY6 A;  2B5E A;  1BX9 A;  1EV4 A;  2OBI A;  4LMV A;  2B6M A;  5HFK A;  2F8F A;  3R3E A;  3KP9 A;  4TXV A;  2C4J A;  5KEJ A;  1YF1 A;  2DJK A;  2GTU A;  4HQZ A;  1UA5 A;  2PGT A;  2WS2 A;  1ILO A;  2I81 A;  4LA1 A;  3DIE A;  1WP0 A;  1TI1 A;  4I97 A;  1VF3 A;  5HFI A;  1T4Z A;  2YN1 A;  4EDY A;  4WR5 A;  5CRD A;  2HRK A;  3LG6 A;  1GTI A;  1JHB A;  2OAD A;  4OFT A;  4HQS A;  4KDU A;  4HU7 A;  5J41 A;  3VPQ A;  4TXO A;  1HQO A;  1AQW A;  2H76 A;  2OAC A;  3L78 A;  4GLT A;  3US3 A;  1PD2 1;  1XWA A;  2NVL A;  2MMA A;  8GSS A;  3G7Y A;  4MCU A;  3ZVJ D;  2H6X A;  4RQX A;  2L6C A;  2H74 A;  4V1A g;  1DSB A;  1USB A;  2IMK A;  1XWC A;  1KTE A;  3FR3 A;  4EE0 A;  2LRN A;  2E0Q A;  2JZS A;  1G7E A;  3CSH A;  2FUG 2;  1OC9 B;  2IL3 A;  2YV7 A;  1OC9 A;  2AYT A;  3CSJ A;  3QAW A;  4L8E A;  1TDI A;  2YZU A;  3GSS A;  3KCM A;  5DAL B;  2F3M A;  1WPI A;  5GZZ B;  1TK0 B;  1M9A A;  2FWG A;  1FO5 A;  1O85 A;  3TKR A;  4WKW A;  1K0N A;  3FYG A;  2F51 A;  1R4W A;  1VF2 A;  4PGT A;  1XG8 A;  4MP4 A;  4RUV A;  5JCW A;  4DSS B;  2R37 A;  3LGC A;  4DSS A;  1OKT A;  4G0L A;  5FHI A;  3TJK A;  1KBN A;  1SL2 B;  4X0X A;  2JL4 A;  4HI7 A;  3E3E A;  5IMC A;  3NZN A;  3DYR A;  2RLI A;  2L6D A;  1DUG A;  2XC2 A;  3KZQ A;  2HFD A;  3VK9 A;  5CAX A;  3LXZ A;  3ZVJ A;  3TCO A;  3D4T A;  4MF7 A;  4TVE A;  4FYB A;  3G7I A;  2K8V A;  5HQP A;  2LV3 A;  3DRN A;  5H5S A;  4KCA A;  2FA8 A;  2LJR A;  1XWB A;  2CZ2 A;  1K0A A;  2LUS A;  4BIK A;  3M3M A;  3TRX A;  2FWH A;  5B8A A;  1J9B A;  3MYD A;  2DJJ A;  5BMU A;  4Z2T A;  4K7O A;  4YKF A;  2OKA A;  2DC5 A;  2AHE A;  4K1F A;  1XPV A;  4OCE A;  2H73 A;  3F4T A;  2I9H A;  2DLX A;  4EO3 A;  4K2X A;  5KN2 A;  3TJB A;  1F9M A;  1XIY A;  2HZE B;  2CX4 A;  2YJH A;  5G1K A;  2GT6 A;  1EOG A;  2H72 A;  5AN1 A;  1ERU A;  1QFN A;  2DJ3 A;  4QQ7 A;  1TRS A;  2MBT A;  4MK3 A;  2YV9 A;  3DD3 A;  5JWQ B;  1B4P A;  1JZD A;  2ALB A;  3UIW A;  4XS4 B;  4K5S A;  4ZBB A;  2E2M A;  4XS4 A;  2PWJ A;  1SYX A;  1SK2 A;  2H75 A;  2VL9 A;  3EU3 A;  4KSM A;  2AV4 A;  1ZYN A;  1XXU A;  1TKD B;  4N0V A;  3Q18 A;  6GSW A;  4G0I A;  4ICY A;  2HE3 A;  4HDE A;  5CO3 A;  3HVV A;  1GWC A;  3ZRD A;  2GSR A;  2L5L A;  1ZYP A;  4MLY A;  4NHW A;  2KUC A;  3K8N A;  1FB0 A;  1YKC A;  2LNS A;  3LW9 A;  1LU4 A;  2YPM A;  2DSA A;  4O5Q A;  4MF5 A;  4OO5 A;  4Q5Q A;  1ZYE A;  4ZB8 A;  1ACV A;  3DVX A;  3D4M A;  3GL3 A;  3TOU A;  4EF0 A;  1AQV A;  4IJI A;  1TK5 B;  2WRT A;  2RM6 A;  2LNT A;  2VLT A;  4JE1 A;  4JED A;  2VD1 A;  4PUR A;  1EEJ A;  1JFU A;  2H1B A;  2R0C A;  16GS A;  2XBQ A;  6GSY A;  3KM6 A;  1IYH A;  4LL4 B;  3W8J A;  1PKW A;  2PVQ A;  2VD0 A;  3M0F A;  4I5Q A;  1FG4 A;  2VL3 A;  2GZY A;  2B7J A;  3GIX A;  1WJK A;  1XWG A;  4JBB A;  5DAK B;  2AUV A;  4AF2 A;  3VPT A;  2O8V B;  3ME8 A;  2GZP A;  2FHE A;  3F4R A;  2VUP A;  4MAB A;  3L9S A;  2CVK A;  3C73 A;  2HSY A;  4J57 E;  4IW9 A;  22GS A;  3EWL A;  2L59 A;  2PU9 C;  4D73 B;  2IFQ B;  3IRA A;  4D73 A;  2GLR A;  2IFQ A;  1FVK A;  1YQ1 A;  2HXK A;  4TR3 A;  3J7Y k;  4E8E A;  1NHY A;  1URM A;  4PUF C;  2WB9 A;  2IN3 A;  1V98 A;  3LYK A;  2IIY A;  4K0G A;  3C71 A;  2A2S A;  2B5Y A;  2H0G A;  5CRH A;  4ZBD A;  4GCI A;  2GQL A;  3CYN A;  4IQ1 A;  2H66 A;  1GH2 A;  1SYR A;  1XWK A;  2YWI A;  1SKS B;  3APQ A;  5D96 A;  4I2U A;  5G2Z A;  5AIX A;  1O8X A;  1B4Q A;  3BJ5 A;  3VI7 A;  4K7N A;  5FT3 A;  2AJQ B;  4V1A p;  2M80 A;  4K6X A;  1U88 A;  1O81 A;  1K0D A;  3H8Q A;  1PA3 A;  1S3R A;  4JR6 A;  5IMF A;  2HI7 A;  1PL1 A;  1TOF A;  1T1V A;  5GST A;  2HZF A;  3QR6 A;  1SJ6 A;  4MNN A;  1GSY A;  3TJJ A;  2KP1 A;  3M1G A;  3E9J B;  3HZ8 A;  1A2L A;  3M9J A;  3PGT A;  2H19 A;  1QQ2 A;  2FLS A;  2N5F A;  5EL8 A;  4MZB A;  5AIV A;  3FW2 A;  4G0K A;  1FOH A;  4KE3 A;  1OC8 A;  2C80 A;  4KGI A;  3CRT A;  2FY6 A;  4PTS A;  3L0H A;  1AUC A;  1ERT A;  2GVP A;  3APS A;  3S9F A;  4L0U A;  4HS1 A;  1GP1 A;  4FIW A;  1S3C A;  4OFN A;  3JCM L;  1WE0 A;  1XW9 A;  3BCI A;  4KUN A;  3O76 A;  6GSX A;  4XTS A;  4F2I A;  3EYT A;  4USS A;  4P3Y B;  1GSF A;  4K5R A;  2VCV A;  5HR2 A;  2H71 A;  3IPZ A;  1I5G A;  2CAQ A;  1RQM A;  1TXX A;  2EIQ A;  3GNJ A;  1T8E B;  3H4K A;  2H6Z A;  3MIX A;  2GZZ A;  2X49 A;  1O8W A;  1Q4J A;  4H86 A;  1GLQ A;  3MDK A;  1F3B A;  4NV2 A;  3KGK A;  1EOH A;  1FAA A;  2I4A A;  2H0I A;  2OA7 A;  3O3T A;  1PKZ A;  3UBK A;  4K0N A;  1WRY A;  4NMU A;  1V58 A;  5IMV A;  1EP8 A;  3IAM 2;  3TKS A;  2B1L A; 
#chains in the Genus database with same CATH homology
 1SKR B;  2VCW A;  1SL1 B;  2HT9 A;  5ENU A;  5ECK B;  5ABR A;  2TIR A;  5ECQ B;  5F8B A;  4XRD A;  4N30 A;  4I2T A;  4YAP A;  5KOX A;  1M2A A;  3ZMK A;  2YZH A;  2BMX A;  2EC4 A;  10GS A;  2YNX A;  2RUE A;  3QFB C;  3ZFB A;  1GSU A;  1X0R A;  5DJL A;  1HNC A;  1J0F A;  4IS0 A;  2JSY A;  2C3N A;  2A2R A;  4F0B A;  4L5O A;  3GUS A;  1X9W B;  4PNF A;  1EGR A;  2JAC A;  1ZL9 A;  3M8N A;  1TP9 A;  1SL0 B;  1ZGN A;  4YH2 A;  1A23 A;  3QCP A;  2J9H A;  1OYJ A;  4BPY A;  5ECR B;  2MZC A;  3FY7 A;  1BJX A;  2X4A A;  1ZOF A;  4AJ8 A;  3I69 A;  5HR1 A;  4TW5 A;  2R0P A;  5A5K A;  3A2V A;  1WMJ A;  4ZBA A;  1GTB A;  1EV9 A;  1AAZ A;  4EKZ A;  3ERG A;  19GS A;  3KMO A;  2JU5 A;  2HRA A;  2FA4 A;  2H6Y A;  5DQY A;  4Q5R A;  3UVH A;  2E7P A;  1RK4 A;  2RII A;  5E59 A;  2OJL A;  5CYY A;  3P2A A;  4G19 A;  1K0M A;  1WWJ A;  4TXO B;  1HYU A;  1EP7 A;  2VIM A;  4TRX A;  1PQN A;  3BD2 A;  4KDX A;  4WBJ A;  4GF0 A;  1ZMA A;  2V41 A;  4XCS A;  3W6G A;  2GSS A;  3IDV A;  5GAP D;  4MA9 A;  1THX A;  5F06 A;  5ECL B;  2VAF A;  4K2D A;  3ZML A;  5KN1 A;  3EU4 A;  3SBC A;  1VGL A;  2MBS A;  5G1L A;  4WEY A;  2ZCT A;  3HJO A;  14GS A;  1XOB A;  5L71 A;  5G31 A;  3WT1 A;  1G7O A;  1BQ7 A;  18GS A;  4PX1 A;  3BOA A;  3GL5 A;  3IA1 A;  3FK8 A;  4GST A;  5D9W A;  1T00 A;  1BYE A;  3QAV A;  5J9C A;  1Y6E A;  1BED A;  2G0F A;  2WJU A;  2I1U A;  2YWM A;  4KH7 A;  4OMV A;  1CQH A;  1DE2 A;  4HEA 2;  3IAS 2;  3MSZ A;  2EIR A;  1B8X A;  1GUH A;  4ZL9 A;  2B5X A;  2R3X A;  5IOX A;  1A24 A;  2R4V A;  2VOC A;  4J56 E;  4WET A;  2LQQ A;  3TRQ A;  2K8S A;  4POL A;  4KF9 A;  1GNE A;  1AC1 A;  4ULX A;  3WT2 A;  1E2Y A;  5LCZ A;  1XBS A;  4O5U A;  1SD8 A;  4TR1 B;  2LEG A;  1FVJ A;  3VWV A;  1F3A A;  4TR1 A;  3KIJ A;  3WYW A;  4FYC A;  3IXR A;  5IMA A;  2WCI A;  1MDK A;  4XIH A;  3DVW A;  3F9U A;  4YAV A;  3ERF A;  2CVD A;  2C8U A;  3P90 A;  3QOU A;  1O73 A;  5IPG A;  3M9K A;  9GSS A;  4I6X A;  2IMI A;  3HA9 A;  2V2G A;  4MF6 A;  3HXS A;  2KLX A;  3KH7 A;  1YZX A;  2P5R A;  2C0E A;  4BL7 B;  2PVO C;  4G10 A;  4BL7 A;  3RPN A;  5B8B A;  3GX0 A;  2F9S A;  2GDR A;  1ERV A;  2C0D A;  3TDG A;  3QPM A;  4POM A;  2P0G A;  2R2J A;  5G30 A;  1E6B A;  3HKR A;  2M46 A;  3U5R E;  4IVF A;  4E8H A;  4YKG A;  17GS A;  1AIU A;  1PGT A;  2F8A A;  2XPD A;  5A4U A;  1YEX A;  1GL8 A;  1O6J A;  1PN0 A;  4TR4 A;  2TRC P;  4KDY A;  4RI6 A;  4CHS A;  4ECB A;  2MMN A;  4KAE A;  2BTO T;  4KND A;  4V2L A;  1TTZ A;  3DEX A;  3MNG A;  2JZR A;  1AXD A;  2L5O A;  1XW6 A;  1EZK A;  5D9V A;  2WGR A;  2L57 A;  4EDZ A;  4OO4 A;  3RPP A;  4AJ7 A;  1PRX A;  3DXB A;  1GUM A;  2WFC A;  4RQR A;  3H1N A;  1T4Y A;  2TRX A;  2GGT A;  2DIZ A;  3FR9 A;  2N5B A;  4EC0 A;  1H4O A;  1ON4 A;  1QXH A;  2NPB A;  4MZW A;  4GSS A;  3TJF A;  2NTO A;  5A4V A;  2X8G A;  3QDN A;  1G0T A;  3WD6 A;  1TJD A;  4MDC A;  1OE7 A;  5KN0 A;  3I6A A;  3VFI A;  4A5P A;  5KOW A;  4IJ3 A;  1F2E A;  5C04 A;  2UZ8 A;  5D73 A;  1ML6 A;  1XCC A;  5DDL A;  3RAZ A;  4LL1 B;  1N8J A;  3ZLP A;  2YCD A;  5IM9 A;  5ECM B;  3G9B A;  2OBK A;  3HD5 A;  2WDU A;  2MMO A;  1M0U A;  4IGJ A;  3VI5 A;  3ERW A;  4OCF A;  3IC4 A;  5IOW A;  5D9T A;  1VF1 A;  2O89 A;  3KP8 A;  2CVB A;  4WF5 A;  2ZUP A;  2V1M A;  4AGS A;  1DBY A;  1B48 A;  3GH6 A;  1OAZ A;  6GSU A;  3FMW A;  4ACS A;  1IYI A;  2H01 A;  1M2D A;  1GTA A;  4IQA A;  1T7P B;  1GNW A;  3EE2 A;  2REM A;  4HU9 A;  3OR5 A;  1OKD A;  3G7J A;  2CQ9 A;  2QSI A;  1J08 A;  1XZO A;  4ML6 A;  4MH3 A;  3QFA C;  1XFL A;  4ZIJ A;  4F82 A;  1YKA A;  3C7M A;  5IO0 A;  3TKQ A;  4JRR A;  3ZFL A;  3EIN A;  4K9Z A;  2OE0 A;  3GFK A;  2DKI A;  3ED3 A;  3HY2 A;  2YOI A;  2VLU A;  3R2Q A;  1Z6N A;  1PL2 A;  1R5P A;  1GSQ A;  5CP1 A;  1OC3 A;  3GMF A;  1X5C A;  1K3O A;  2HNL A;  4O32 A;  3L9V A;  3D21 A;  1K0C A;  3EVI A;  3C1R A;  2HYX A;  1BAY A;  2DJ0 A;  1M99 A;  2DBC A;  2LST A;  3TKS C;  2E2G A;  1TK8 B;  4GXZ A;  1R5A A;  20GS A;  3HVX A;  4TR0 A;  2LS5 A;  3HYP A;  4L5L A;  3LWA A;  3PPU A;  4POB A;  4YQV A;  1U3A A;  4HJ2 A;  2QA1 A;  1S3A A;  2B3S A;  3ZIT A;  1UVZ A;  4BVX B;  1WOU A;  3HVS A;  4N11 A;  2BJX A;  4BVX A;  3GH9 A;  2VM1 A;  4DEJ A;  3GST A;  2C0G A;  1GUL A;  3TKS E;  2A4V A;  4PQ1 A;  1LJR A;  4IEL A;  3KEB A;  2H0H A;  12GS A;  5HFG A;  2HSM A;  5GSS A;  3ZL5 A;  4NV5 A;  3LFL A;  3UVT A;  4O92 A;  3RBT A;  3EC3 A;  3FZ9 A;  4ILF A;  2GST A;  1TW9 A;  4ML1 A;  2LQO A;  3D5J A;  3HCZ A;  2VLV A;  2IPA A;  3IC8 A;  5GAN D;  5DCG A;  5IIZ A;  5CRE A;  1SK1 A;  5G5F A;  1Q98 A;  3VWW A;  1MDJ A;  1JZW A;  3IV4 A;  2GSQ A;  3LSZ A;  4NXI A;  2VL2 A;  3UJ1 A;  5J5N A;  6GST A;  2IJY A;  1XW5 A;  4EVM A;  1SD9 A;  1C72 A;  1Z7R A;  5IQY A;  2ES7 A;  2HRN A;  4XS6 A;  3FKF A;  2KP2 A;  2WZ9 A;  1VF4 A;  3A3T A;  5H5R A;  4IKH A;  2CV4 A;  4V2M A;  5H5Q A;  1N2A A;  2B1K A;  3C1S A;  3HJM A;  2X8H A;  4DSR A;  2JSZ A;  2PER A;  3TJG A;  4FYU A;  3ME7 A;  1TU8 A;  3TOT A;  2VCT A;  3KTL A;  3KMN A;  3LQ7 A;  4PXO A;  1NHO A;  4Z2U A;  4NAX A;  3GHA A;  1A8Y A;  3RHB A;  4TKY A;  1ABA A;  5ECH B;  1KNG A;  5D93 A;  1TRV A;  3CSI A;  3QD9 A;  5ELG A;  2M72 A;  2DMM A;  2HRF A;  1WIK A;  3APO A;  4ID0 A;  4OD7 A;  2ON5 A;  5HR0 A;  5ID2 B;  3IBH A;  4BWS A;  4V2N A;  5ID2 A;  5IO2 A;  5FWG A;  1HNB A;  4F0C A;  1R7H A;  3H79 A;  1R26 A;  4IN0 A;  2P5Q A;  2VCZ A;  4Q5F A;  2CA8 A;  1EEM A;  3A2W A;  3WGE A;  4O7H A;  3ZTL A;  4G2E A;  3PH9 A;  1QMV A;  4ZXG A;  1LBK A;  1JZO A;  1A8L A;  2GQM A;  3F3Q A;  3TB2 A;  5CRW A;  4LMW A;  4WR4 A;  2QKE A;  4O5R A;  1ERW A;  5F0G A;  3H93 A;  4IP6 A;  1YJ6 A;  3IHQ A;  1AQX A;  2K18 A;  2JAD A;  5B7C A;  3AY8 A;  3GV1 A;  6GSS A;  3VWU A;  2O87 A;  4NWY A;  3W8S A;  1RW1 A;  3HZ4 A;  3GKX A;  4OFM A;  1ZCP A;  2PN8 A;  5DJM A;  3LYP A;  2O7K A;  5JCU A;  1I9D A;  4K8M A;  2H1A A;  4CDO A;  2H30 A;  3I43 A;  2Z9S A;  2NBS A;  4X1U A;  5ECP B;  3TRP A;  5AGY A;  2B7K A;  2RUF A;  1ST9 A;  5BRT A;  1X5D A;  5CRG A;  2DIY A;  2FGX A;  3Q19 A;  4CY8 A;  1JZR A;  1OE8 A;  2LJA A;  5DAL A;  3FRC A;  4F03 A;  2RM5 A;  4FO5 A;  5ECI B;  5DVB A;  1U87 A;  2H1D A;  3ZZX A;  4MPG A;  1MTC A;  5F07 A;  1PSQ A;  1V57 A;  3A5I A;  1X9S B;  5CNW A;  1MD3 A;  1YY7 A;  5COH A;  3HHV A;  4F9Z A;  2MYG A;  1K0O A;  3ZRE A;  1VRS D;  13GS A;  2H8L A;  1S3D A;  4MZC A;  3QMX A;  1A0R P;  2AAW A;  1PMT A;  1SJZ A;  2WUL A;  1PN9 A;  2DJ2 A;  2CZ3 A;  2ON7 A;  3CTG A;  3D22 A;  1KEB A;  4IHU A;  4RI7 A;  3VUR A;  4HZ4 A;  4MJB A;  4WF4 A;  3MWH A;  4MJE A;  3A5W A;  3FR6 A;  4HZ2 A;  3J7Y b;  2A4H A;  2DKH A;  2YWN A;  4BA7 A;  3UAR A;  3E0U A;  1Y25 A;  2PPT A;  1Z6M A;  4TOP A;  2NDO A;  2R0G A;  4DVC A;  4ZB9 A;  4OWY A;  3F3R A;  2C3T A;  1M2B A;  4K7I A;  5ECS A;  3UBL A;  1HNA A;  3KXO A;  2R5G A;  3C8E A;  3QAG A;  2GQK A;  1Z9H A;  2HZE A;  4KA0 A;  1THO A;  2G2Q A;  4Z7X A;  3WGD A;  4PQH A;  2AB6 A;  5F05 A;  1TRW A;  3UEM A;  3UMA A;  4QL9 A;  4ECI A;  2QGV A;  5DCH A;  2VO4 A;  3TGZ A;  3GA4 A;  4GWR A;  2XHF A;  4GQC A;  3O6T A;  1GRX A;  2FD3 A;  6GSV A;  3FZ5 A;  5LD0 A;  3F6D A;  4ZL8 A;  1GSD A;  2GT5 A;  1SKW B;  3PIN A;  4XRA A;  4X43 A;  1QUW A;  4CW9 A;  1G6W A;  2PBJ A;  2FCH A;  5B6N A;  1M9B A;  1K0B A;  4ISD A;  3IHG A;  3DGQ A;  2H70 A;  3F63 A;  3EMP A;  2GS3 A;  1UN2 A;  1EGO A;  1M7T A;  1X5E A;  1NSW A;  4HJM A;  4IBP A;  1GTU A;  1Z5Y E;  4BVY B;  1DE1 A;  3RDW A;  4YQU A;  4BVY A;  1A2M A;  4PQI A;  2IME A;  5E4W A;  3FEU A;  4KSO A;  4MJC A;  5IMZ A;  4GQF A;  1PX6 A;  4DSQ A;  4XHM A;  1FB6 A;  3DML A;  3CBU A;  4EUY A;  4KX4 A;  1GUK A;  1GSE A;  2PMT A;  2CT6 A;  2IMD A;  1NM3 A;  3VWX A;  3FHK A;  7GSS A;  4Z2R A;  2XPE A;  3KH9 A;  4TN8 A;  2V32 A;  4I8B A;  2IMF A;  4KB3 A;  3GYK A;  3LJR A;  2EIO A;  2R6K A;  1UC7 A;  2J23 A;  2LTK A;  4GSN A;  3Q6O A;  1YDK A;  5LNK e;  3IE3 A;  3SWL A;  2ZNM A;  2DML A;  3EUR A;  3F0I A;  4GTU A;  4N0Z A;  3N9J A;  5DAK A;  4JZQ A;  3TKP A;  2PUK C;  3U6V A;  1F6M C;  4BWQ A;  2HLS A;  1MD4 A;  1GLP A;  4AJ6 A;  1QGV A;  1PX7 A;  4IP1 A;  2K6V A;  3GUR A;  2C0F A;  3WGX A;  3V1W A;  2H1G A;  2OE3 A;  2XBI A;  5JWO B;  1B9X C;  2LRT A;  5IMD A;  3Q74 A;  2KOK A;  5INY A;  5ELA A;  5KN3 A;  1CQG A;  2YWO A;  4FH8 A;  1Z3E A;  3IK7 A;  3GKM A;  1Z7P A;  2P31 A;  3GTU B;  5DQS A;  5J9B A;  5EVO A;  3GTU A;  2YAN A;  3DKS A;  3UL3 A;  5D8I A;  2D2Z A;  5ECO B;  4EIP A;  1B9Y C;  1X9M B;  4MH2 A;  3GX8 A;  1SJI A;  2VCQ A;  4GRF A;  3NIV A;  2CAI A;  2QC7 A;  11GS A;  1AW9 A;  2IWT A;  3IOS A;  1K3Y A;  4KCE A;  2L4Q A;  3KTB A;  4MJA A;  1TU7 A;  1MEK A;  4EXJ A;  5EY6 A;  4PNG A;  3FZ4 A;  4MPF A;  1F37 A;  1G6Y A;  2OE1 A;  1FOV A;  3LXT A;  3CXG A;  5J4U A;  1FHE A;  4ZL7 A;  5C00 A;  1FW1 A;  3EMX A;  4JR4 A;  5G5E A;  1ZZY A;  1QK8 A;  3IR4 A;  3IK9 A;  2X99 A;  3ZIV A;  4L0W A;  1XVQ A;  4ZB6 A;  3HDC A;  4NPB A;  1T3B A;  4MMM A;  1W4V A;  3KD0 A;  2VL2 C;  4G9H A;  4WXT A;  2I3Y A;  4JU5 A;  4Q5N A;  3EPT A;  3GRX A;  4PUA A;  3D0Z A;  3CMI A;  3I9V 2;  2DJ1 A;  1TRU A;  4EL1 A;  3BCK A;  1MDI A;  4ECC A;  1XVW A;  2LKU A;  2X64 A;  3D6I A;  2C3Q A;  1V40 A;  3LEF A;  3PR8 A;  4NHZ A;  5HR3 A;  4XS1 A;  4POK A;  3F4S A;  4YQM A;  5AIS A;  4N10 A;  3L4N A;  2KHP A;  5A4W A;  4ECJ A;  1A0F A;  4ZIL A;  3BBY A;  1GSS A;  3P8W A;  3FZA A;  5J3R A;  3HJP A;  1U3I A;  2FWE A;  1BG5 A;  5B6M A;  2FWF A;  3CRU A;  3ZIJ A;  3GKK A;  2CX3 A;  4WBR D;  4HUA A;  3CTF A;  4X4J A;  1SK0 A;  3NOF A;  4EIQ A;  1YEP A;  3ZYW A;  5EPF A;  3VLN A;  3TUE A;  2JZT A;  3N5O A;  3UAP A;  1H75 A;  2VM2 A;  3MAK A;  1XOA A;  1JLW A;  3L9U A;  1OVN A;  2MMZ A;  1NW2 A;  1SU9 A;  5IPH A;  2FNO A;  2LRC A;  2LJK A;  2V6K A;  3GKN A;  3ISO A;  3KJY A;  5D9X A;  3F8U A;  4QL7 A;  2YP6 A;  1YF0 A;  3P7X A;  2L4C A;  3GN3 A;  1EWX A;  4LLR A;  2C1Y A;  3A2X A;  1O7U A;  2X8C A;  2N5A A;  5JCG A;  2YJ7 A;  2HSH A;  2QA2 A;  5ECN B;  3UOM A;  2V6O A;  3LOR A;  1SEN A;  1ZYQ B;  4HOJ A;  1TI3 A;  2K9F A;  3RHC A;  3F6F A;  2O85 A;  2VCX A;  1V2A A;  1JLV A;  4J2F A;  3DWV A;  1U6T A;  1K3L A;  4FQU A;  1HD2 A;  1A2J A;  5DBQ A;  2A2P A;  4KW6 A;  5JWR B;  1V9W A;  1W89 A;  4CY6 A;  2B5E A;  1BX9 A;  1EV4 A;  2OBI A;  4LMV A;  2B6M A;  5HFK A;  2F8F A;  3R3E A;  3KP9 A;  4TXV A;  2C4J A;  5KEJ A;  1YF1 A;  2DJK A;  2GTU A;  4HQZ A;  1UA5 A;  2PGT A;  2WS2 A;  1ILO A;  2I81 A;  4LA1 A;  3DIE A;  1WP0 A;  1TI1 A;  4I97 A;  1VF3 A;  5HFI A;  1T4Z A;  2YN1 A;  4EDY A;  4WR5 A;  5CRD A;  2HRK A;  3LG6 A;  1GTI A;  1JHB A;  2OAD A;  4OFT A;  4HQS A;  4KDU A;  4HU7 A;  5J41 A;  3VPQ A;  4TXO A;  1HQO A;  1AQW A;  2H76 A;  2OAC A;  3L78 A;  4GLT A;  3US3 A;  1PD2 1;  1XWA A;  2NVL A;  2MMA A;  8GSS A;  3G7Y A;  4MCU A;  3ZVJ D;  2H6X A;  4RQX A;  2L6C A;  2H74 A;  4V1A g;  1DSB A;  1USB A;  2IMK A;  1XWC A;  1KTE A;  3FR3 A;  4EE0 A;  2LRN A;  2E0Q A;  2JZS A;  1G7E A;  3CSH A;  2FUG 2;  1OC9 B;  2IL3 A;  2YV7 A;  1OC9 A;  2AYT A;  3CSJ A;  3QAW A;  4L8E A;  1TDI A;  2YZU A;  3GSS A;  3KCM A;  5DAL B;  2F3M A;  1WPI A;  5GZZ B;  1TK0 B;  1M9A A;  2FWG A;  1FO5 A;  1O85 A;  3TKR A;  4WKW A;  1K0N A;  3FYG A;  2F51 A;  1R4W A;  1VF2 A;  4PGT A;  4MP4 A;  4RUV A;  5JCW A;  4DSS B;  2R37 A;  3LGC A;  4DSS A;  1OKT A;  4G0L A;  5FHI A;  3TJK A;  1KBN A;  1SL2 B;  4X0X A;  2JL4 A;  4HI7 A;  3E3E A;  5IMC A;  3NZN A;  3DYR A;  2RLI A;  2L6D A;  1DUG A;  2XC2 A;  3KZQ A;  2HFD A;  3VK9 A;  5CAX A;  3LXZ A;  3ZVJ A;  3TCO A;  3D4T A;  4MF7 A;  4TVE A;  4FYB A;  3G7I A;  2K8V A;  5HQP A;  2LV3 A;  3DRN A;  5H5S A;  4KCA A;  2FA8 A;  2LJR A;  1XWB A;  2CZ2 A;  1K0A A;  2LUS A;  3M3M A;  3TRX A;  2FWH A;  5B8A A;  1J9B A;  3MYD A;  2DJJ A;  5BMU A;  4Z2T A;  4K7O A;  4YKF A;  2OKA A;  2DC5 A;  2AHE A;  4K1F A;  1XPV A;  4OCE A;  2H73 A;  3F4T A;  2I9H A;  2DLX A;  4EO3 A;  4K2X A;  5KN2 A;  3TJB A;  1F9M A;  1XIY A;  2HZE B;  2CX4 A;  2YJH A;  5G1K A;  2GT6 A;  1EOG A;  2H72 A;  5AN1 A;  1ERU A;  1QFN A;  2DJ3 A;  4QQ7 A;  1TRS A;  2MBT A;  4MK3 A;  2YV9 A;  3DD3 A;  5JWQ B;  1B4P A;  1JZD A;  2ALB A;  3UIW A;  4XS4 B;  4K5S A;  4ZBB A;  2E2M A;  4XS4 A;  2PWJ A;  1SYX A;  1SK2 A;  2H75 A;  2VL9 A;  3EU3 A;  4KSM A;  2AV4 A;  1ZYN A;  1XXU A;  1TKD B;  4N0V A;  3Q18 A;  6GSW A;  4G0I A;  4ICY A;  2HE3 A;  4HDE A;  5CO3 A;  3HVV A;  1GWC A;  3ZRD A;  2GSR A;  2L5L A;  1ZYP A;  4MLY A;  4NHW A;  2KUC A;  3K8N A;  1FB0 A;  1YKC A;  2LNS A;  3LW9 A;  1LU4 A;  2YPM A;  2DSA A;  4O5Q A;  4MF5 A;  4OO5 A;  4Q5Q A;  1ZYE A;  4ZB8 A;  1ACV A;  3DVX A;  3D4M A;  3GL3 A;  3TOU A;  4EF0 A;  1AQV A;  4IJI A;  1TK5 B;  2WRT A;  2RM6 A;  2LNT A;  2VLT A;  4JE1 A;  4JED A;  2VD1 A;  4PUR A;  1EEJ A;  1JFU A;  2H1B A;  2R0C A;  16GS A;  2XBQ A;  6GSY A;  3KM6 A;  1IYH A;  4LL4 B;  3W8J A;  1PKW A;  2PVQ A;  2VD0 A;  3M0F A;  4I5Q A;  1FG4 A;  2VL3 A;  2GZY A;  2B7J A;  3GIX A;  1WJK A;  1XWG A;  4JBB A;  5DAK B;  2AUV A;  4AF2 A;  3VPT A;  2O8V B;  3ME8 A;  2GZP A;  2FHE A;  3F4R A;  2VUP A;  4MAB A;  3L9S A;  2CVK A;  3C73 A;  2HSY A;  4J57 E;  4IW9 A;  22GS A;  3EWL A;  2L59 A;  2PU9 C;  4D73 B;  2IFQ B;  3IRA A;  4D73 A;  2GLR A;  2IFQ A;  1FVK A;  1YQ1 A;  2HXK A;  4TR3 A;  3J7Y k;  4E8E A;  1NHY A;  1URM A;  4PUF C;  2WB9 A;  2IN3 A;  1V98 A;  3LYK A;  2IIY A;  4K0G A;  3C71 A;  2A2S A;  2B5Y A;  2H0G A;  5CRH A;  4ZBD A;  4GCI A;  2GQL A;  3CYN A;  4IQ1 A;  2H66 A;  1GH2 A;  1SYR A;  1XWK A;  2YWI A;  1SKS B;  3APQ A;  5D96 A;  4I2U A;  5G2Z A;  5AIX A;  1O8X A;  1B4Q A;  3BJ5 A;  3VI7 A;  4K7N A;  5FT3 A;  2AJQ B;  4V1A p;  2M80 A;  4K6X A;  1U88 A;  1O81 A;  1K0D A;  3H8Q A;  1PA3 A;  4JR6 A;  5IMF A;  2HI7 A;  1PL1 A;  1TOF A;  1T1V A;  5GST A;  2HZF A;  3QR6 A;  1SJ6 A;  4MNN A;  1GSY A;  3TJJ A;  2KP1 A;  3M1G A;  3E9J B;  3HZ8 A;  1A2L A;  3M9J A;  3PGT A;  2H19 A;  1QQ2 A;  2FLS A;  2N5F A;  5EL8 A;  4MZB A;  5AIV A;  3FW2 A;  4G0K A;  1FOH A;  4KE3 A;  1OC8 A;  2C80 A;  4KGI A;  3CRT A;  2FY6 A;  4PTS A;  3L0H A;  1AUC A;  1ERT A;  2GVP A;  3APS A;  3S9F A;  4L0U A;  4HS1 A;  1GP1 A;  4FIW A;  1S3C A;  4OFN A;  3JCM L;  1WE0 A;  1XW9 A;  3BCI A;  4KUN A;  3O76 A;  6GSX A;  4XTS A;  4F2I A;  3EYT A;  4USS A;  4P3Y B;  1GSF A;  4K5R A;  2VCV A;  5HR2 A;  2H71 A;  3IPZ A;  1I5G A;  2CAQ A;  1RQM A;  1TXX A;  2EIQ A;  3GNJ A;  1T8E B;  3H4K A;  2H6Z A;  3MIX A;  2GZZ A;  2X49 A;  1O8W A;  1Q4J A;  4H86 A;  1GLQ A;  3MDK A;  1F3B A;  4NV2 A;  3KGK A;  1EOH A;  1FAA A;  2I4A A;  2H0I A;  2OA7 A;  3O3T A;  1PKZ A;  3UBK A;  4K0N A;  1WRY A;  4NMU A;  1V58 A;  5IMV A;  1EP8 A;  3IAM 2;  3TKS A;  2B1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...