3QDRB

Structural characterization of the interaction of colicin a, colicin n, and tolb with the tolaiii translocon
Total Genus 0
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
0
sequence length
49
structure length
49
Chain Sequence
SYNTPWGKVIINAAGQPTMNGTVMTADNSSMVPYGRGFTRVLNSLVNNP

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Evidence That Colicin A Protein Binds to a Novel Binding Site of TolA Protein in Escherichia coli Periplasm.
pubmed doi rcsb
molecule keywords Protein tolA
molecule tags Protein transport/toxin
source organism Escherichia coli
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2011-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.970 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3qdrB00
3QDRB
chains in the Genus database with same CATH superfamily
3VS5A 1WI7A 2SRCA 3VRYA 4LXCA 4OVAA 4LDXA 2VUBA 2RQUA 1IGUA 2PQWA 2DD5A 2IVWA 2PU9B 4ME7A 1N8RR 1VQLT 1WXBA 4JRPA 4MZTA 3SD4A 2HCKA 2XU8A 5LJ3e 5GAN8 4HVUA 2VGNA 3SWNB 1HXDA 3G4ST 2RHIA 4CC7A 5IH2A 2M02A 1VQ6A 3L2VA 2WSCE 3HPWA 4M7AF 1RAFB 4NL3A 3JCMX 3HRTA 1O75A 5LJ5d 1GRIA 1QWEA 2LQKA 2KRMA 2QG9B 4TVRA 3ZFJA 2BZ8A 1SSFA 4HCZA 2HBPA 2D1XA 3X24B 4E7JA 2L3QA 5HK3A 4EDUA 1X6OA 3EG3A 1V1CA 4D8KA 4A63B 1B34A 2A3LA 1K76A 3A8MB 5D7UA 1YITA 1CSKA 2OTJQ 1YJNA 2GFUA 4N4GA 4J6XA 1KQ2A 2JXBA 1KIKA 2O9SA 4OB2B 3PNWC 1X27A 3LWHA 4IKFA 4PJOC 1ZUUA 1IZ6A 4RCCA 1PWTA 3S6WA 4Z89A 2JMCA 4PNOA 1BK2A 4J6YA 1S72Q 1AZGB 1GXIE 2XKOC 1RAAB 3JB9H 2HQHA 1MGQA 3L1AA 2K3BA 2DYBA 9ATCB 1X6BA 2K3XA 5GMKm 1KC8U 3DKMA 4ELYC 2V8JA 2YUPA 2OAUA 2RPNA 5GANg 2KNBB 4DOVA 1NE8A 1NM7A 1U1TA 5GAMf 3QYGB 1OZ3A 4GBQA 1YCSB 2FPFA 4RG2A 3JB9D 2QYZA 1Q86U 1M1GA 1QMCA 2KXDA 3CC7Q 2O88A 1MMDA 2P4RA 5DLQE 1SHGA 5I2SA 1NJIU 2R58A 3M58A 1GCPA 2E64A 2K5LA 1V76A 3PT9A 2LCLA 3PTAA 1K73U 3CXCS 2I2LA 3JCMJ 4J5YA 3BDLA 2J6OA 2QEXQ 2BUDA 2DTOA 1Q81R 2YUNA 2XDDA 4PJOA 2GBQA 1M3BA 4OB0B 3MJXA 1ZUKA 4PFPA 4C8QC 3TREA 2NUTB 1D3BA 2VC8A 1VQ6T 1K1ZA 1I8FA 1I5OB 1WX6A 3CBPA 2K6DA 1NLOC 1GL5A 2HD0A 3P8HA 3CCQQ 4QVDA 1K9MU 1WJSA 2E6NA 1TU0B 1MHNA 2X4XA 4EMKC 4PFOA 4IUTA 2RMOA 1YN8A 2DL7A 4M78C 3RR6A 1KQSS 1LNXA 2WSEE 1PKSA 1VQ8Q 2DBMA 1W1FA 1YITT 1YJNT 2DNUA 2P0PA 1VQ9A 4N4IA 3KFVA 2RJEA 3OY9A 2F2VA 2K5FA 1K0XA 5CAIA 1YJ9A 3O8VA 4DA4A 1JXOA 2XICA 1FYNA 2WSFE 1N6AA 3TSWA 4XU1A 3VS1A 2AZVA 2ROLA 1D0YA 2C06A 2YRCA 3MHXA 4C8QA 3SFMA 2M0OA 3OB9A 1Z9QA 4M75G 4DEYA 4DBQA 4II1A 2EYWA 3V7RA 4OMMA 5I2MA 4IURA 5C0MA 2O01E 1QW1A 4ANJA 2QA4A 1RAEB 4XTWA 3CCMQ 4F16A 1YIJA 2J7IA 1VQNA 1Q82U 3C12A 4F7UA 4EMKA 3CCEQ 4FYVB 2RHZA 4WF2A 4C92C 4JRIA 2QQSA 3NGPA 3OSSC 4M78A 1PD0A 3ER0A 3QG1A 2ZPFB 3DB3A 3WXMB 2YRVA 2O4XB 3M4GA 3LH5A 2PVGB 2KRSA 3MPUB 3CCJA 3CCVA 2DIQA 3CMAQ 1OX8A 2M1HA 3M0UA 1BB9A 3R6OA 3M54A 3HTRA 1M2OA 2L8DA 2C0TA 1VQ7A 2JTFA 2CZ1B 4DBRA 3I5RA 3E9GA 5AYFA 4AG2C 4LE9A 5GMKi 3CCUA 2OX7A 1VQ4Q 1SF9A 2RQRA 4Y91A 4C8QE 1QP2A 4E7IA 4KULA 2VXFA 4BY6B 2YRDA 4KH1B 3H9NA 1Y0MA 3H41A 3FC3A 4RTUA 2HQEA 2DA9A 4M7AG 2PTKA 4ZGDB 4IUUA 1M1KU 4PL6A 4MDWA 3G71T 2KK4A 1LOJA 1EIFA 2RHYA 1WLPB 3GPLA 4NL2A 5KYWA 2DZCA 3DB4A 3PMTA 2EQIA 3LLRA 4M77G 4J9DA 1X2QA 2E4HA 2QQAA 4A4FA 1WHKA 2M16A 1ACMB 2E12A 4FM4B 4FW2A 4ZTJA 5KYXB 5I21A 3NFCA 4ZNXA 1V29B 1VQ9T 4C92A 1M3CA 4M75B 1KC8R 4LN2A 1ZSGA 3URGA 1WXTA 4AFSC 4BD3A 1MMGA 3I56Q 4PJJA 2YDLA 4FSSA 1IB8A 2DZ9A 5FWCA 5IXBA 2DJZA 2JMAA 1VQMA 4C8QF 1Q86R 1XOVA 4J6WA 1NYGA 2IPOB 1VA7A 1VOMA 2LQNA 2PZ1A 1K73R 1SG5A 1QKWA 4LUDA 2ZAEA 1IHVA 3S3MA 2QA4T 3VS3A 1OEBA 5GAMg 1YIJT 4A4EA 2GF7A 4AFQC 4FIBA 3EFRA 4M78F 1QVFS 1ZSZC 2DAQA 5KCOA 1QKXA 3L2RA 3A8LB 1G3WA 2YWWA 3REBB 3CPWS 3FDRA 1PSEA 3OMCA 1TXQA 2FZGB 2MK5A 2CSQA 4M7AB 3CXCP 3CCVT 1XQHA 1ABOA 2D0NA 5GAN2 2C0OA 5ECAA 1RAIB 2EYQA 4J9BA 1VQOA 1K9MR 3RKWA 2ROTA 1VQ7T 2XI9A 2COWA 5CQXA 2RK2A 3G4SQ 3G6EA 1G3TA 1TOVA 2HAXA 1XTDA 3CCUT 3IQLA 5LJ3h 3OS1A 2V1RA 5KE2A 5GANf 4AG1C 2YUQA 3OYEA 1PG5B 1XJWB 3ME9A 1G2BA 3L42A 4XQ3A 1WA7A 1E6HA 5J39A 4CRIA 2L89A 1YHQA 5GANj 3QIIA 4ZGJB 1PSFA 2E41A 2LTOA 4VUBA 3V7SA 2FRYA 3QDFA 4M77D 3TVTA 2LX7A 4BDYA 2DVEA 2EIFA 3M0PA 1FWZA 4LNPA 2CUBA 3SEMA 2LNHB 1U3OA 2MWOA 2QI2A 1KQSP 3L2QA 4PJLA 4E7HA 4PFZA 4C92F 2OTLT 1J3TA 5LJ5g 4JJCA 2HKQB 1ZSZA 3RBBB 1SEMA 4QW2A 1SPKA 1BI3A 3S3NA 5CR2A 1VQ5A 3JCMW 3M56A 5GJWB 1TTHB 1VQMT 2VYTA 1K4US 1CKAA 1Q82R 1RL2A 2EYYA 3I35A 4OMOA 2MCNA 1Q7YC 1KK7A 2GCXA 3GBQA 2G3RA 3JCMe 4QKUA 3JCMP 2CP0A 3RNJA 2EKHA 3MEUA 3QZ9B 3D7SB 3C0CA 3I9QA 3OYYA 4HXJA 2OJ2A 2PUKB 4BE1A 4E6RA 3QWXX 4BI8B 4MMKA 1N8RC 2A37A 4HCCA 4MMLA 3ULRB 2YXYA 1TG0A 1JXMA 4DBHA 1NG2A 2MPXC 4UC4A 1WQ7A 4D6WA 1YFNA 3RUXA 3C4SA 5KYYA 5FWBA 3EGXA 2CYZB 4X34A 1VQOT 5CKFA 3JAME 1BIAA 3L2UA 3G6ET 2FPDA 1TUDA 2KROA 4Y28E 4ZGEB 4HCKA 3OQ5A 2RH2A 2MMPA 4PKCC 3H8ZA 2CP5A 2CZ0B 4AT1B 3H0FA 2R57A 2RN8A 1QVFA 1KHCA 5GAOq 3CMEQ 4AFZC 5L8RE 3QXEB 4DQ2A 2EW3A 2KT8A 3M5AA 3MO8A 1YHQT 1M9SA 4QT7A 2NUPA 1E6GA 4C0DC 4J9CA 2V26A 2VB6A 3UA6A 2DILA 1ZX6A 2DTIA 1N27A 1YJNQ 1PRLC 1RABB 3G7ZA 4DOWA 4BE2A 4IUVA 3QSUA 3JB9I 2JVVA 2EJ9A 4D8DA 2CT4A 4JLGA 3V8LA 1K8AU 4IUPA 1VQ5T 2DF6A 1AD5A 1R77A 1Y71A 2LX9A 4JDSA 1TH7A 1SRMA 2V8KA 4M7DA 1OPKA 2A0FB 5FRNA 4C5GA 1N9SA 1Y57A 2LP5A 2KR3A 2DXTA 3HP9A 1AEYA 5GMKh 3CEYA 3CC4A 1UGPB 3OYKA 3CC2A 3SWNC 2ESWA 2EFIA 2X3WD 1VQKT 3LWIA 4IUQA 3OYFA 2RNAA 2NLUA 1Q81C 4Z88A 5FROA 1A0NB 2OAWA 1D3BB 2BE7D 1BIBA 2F5KA 1QVFP 2L5QA 4LDVA 3WVDB 5GAN5 1IGQA 3CPWP 1VUBA 4WCIA 2EQJA 2B8AA 2BZYA 4ZN3A 3C94A 2XK0A 1MMAA 4M7DE 3MEVA 1ZBXA 3SDZA 2J6FA 4CC2A 3LH0A 3LX7A 4CI0C 1S1NA 2FHDA 3JV3A 3QZ5B 3NMZC 4F17A 1HSQA 2VV5A 3A8OB 2EQMA 2VWFA 4X1VA 1QVPA 3VS6A 2E10A 3VJPA 1IHWA 4Z8AA 1I81A 4RTXA 4RMOA 1WDXA 5CK9A 2VVKA 1JQQA 2DO3A 1OPLA 2L3PA 4LUEA 4JRQA 2COZA 3CD6T 1M2VA 1F1BB 2BKDN 2D8HA 5GAMj 3MCAB 2DETA 2BIVA 5IXFA 1AHJB 4N0AC 1ZHIA 2LZ6B 4J9FA 3JRZA 3JCMb 4PJMA 2F69A 1KHIA 3VYGA 3MEWA 1YBYA 4C8QB 1YJ9Q 2KBTA 2ZPHB 1QP3A 2QDLA 1U8RA 2DPPB 1YWOA 2FL7A 3OA6A 5KYNA 3TEEA 1I5LA 4KUDK 2OTJA 4M7DF 3O5ZA 1MNDA 2RM4A 1HJDA 1X6GA 2MIOA 2A08A 2DJQA 1MNEA 1D1CA 3PVQA 3CCRT 2KYBA 2LT4A 1LPLA 2AZSA 2V8IA 2EYXA 4FSXA 3G71A 2A7YA 4MZMA 2COYA 3X25B 3CC4T 4MZPA 3OBWA 3DLLA 2G6FX 1YIJQ 3CCLT 3CC2T 4A4HA 1VQNQ 2R5MA 2YSQA 4JRKA 2LJ0A 4AFUC 4MDXA 2B86A 4ELZC 3E2UA 2LDMA 5LJ5f 2I0NA 1O9SA 1I0CA 2DL8A 4JZ3A 3A8HB 4C5EA 4B9WA 4R55A 1YJWA 3CCJQ 4N0AA 5LJ3d 3WVEB 4BUGA 3CC7A 4PJOE 5LJ5j 3E19A 3V8KA 4FCYA 4JJNK 1VQ7Q 1RADB 3BY7A 4NOYA 3I55Q 3UT1A 3PE0A 3AT1B 4E2FB 1OV3A 2FRWA 1C0MA 2CSIA 1M1FA 4EIKA 2AT1B 3LW5E 4L5GA 5GAN6 5GMKe 1VYTA 4HVVA 2QEXA 4J8OA 2HNIA 1VQPQ 4J9EA 3A5ZB 2ED0A 3VUBA 2F2WA 1YI2Q 5A0LA 2E5KA 1ZA1B 4JZ4A 2L2PA 1ARKA 3M4YA 5GAOn 1KSWA 3EG1A 2ZZDA 3VS7A 3F70A 1R0CB 3UF4A 2M51A 1M3AA 2D0QB 3OMGA 5CIUA 2ZCFB 4BI4A 4YTLA 5FW9A 1K8AR 2E1HA 4X9CA 3EGDA 1KC8C 1NPRA 2CDTA 4F14A 3UA7A 2NUTA 1WJQA 2ABLA 5IAYA 2PVOB 2X4WA 1IO6A 4J9GA 1N5ZA 2HKNA 3OYBA 3FIFA 4B6MA 4PJOF 1UEBA 1Q86C 2CGHA 1SRLA 1WHMA 2QAZA 2OTJT 4BACA 1OQKA 1NJIC 2QDYB 4OGEA 3ZBDA 2K79A 2XG8D 3REAB 1K73C 1BI0A 2FVUA 3QJYA 3VS4A 4CC3A 1H8KA 4XAXB 2JTEA 2QXFA 2GNCA 3HFNA 3BFMA 1R8OB 2GTJA 4C5HA 2A36A 2RJFA 2XMFA 3CXCA 1JB0E 5LL6S 2J6KA 1S72T 2X35A 2LNVA 3OYLA 4E7ZA 2QQRA 3JCMc 2FG0A 3MEAA 2RQVA 4F7UE 3JCMh 4RCBA 2QK0A 4L59A 2KSSA 3SB2A 6AT1B 2XDBA 5FU6B 1M90U 2ZGWA 1OU9A 4M78E 1I07A 1N9RA 1X01A 2HBWA 3JB9F 4BY6C 2JS0A 2OTLA 1UGQB 3M9QA 1K9MC 1PRMC 5DLOA 1YJWT 3RDVA 2GQVA 4CC4B 5D6WA 3CC7T 2H8HA 3FEOA 2IIMA 1VQOQ 2HEQA 2KQWA 2RK1A 1Y7XA 4O5VA 3X28B 2HL5C 2IG0A 1H641 3RMQA 1G5VA 2HZYA 4LD6A 5KYUB 2W0ZA 1TUGB 4M75D 3LYIA 1KQSA 2EBPA 2QEXT 5GAN4 1NJIR 3CMAA 1AWJA 3G1JA 5GAMe 3DLMA 5LJ3f 2HQXA 4M75C 2L0AA 3EFOA 4RUGA 3EHRA 3TU4K 1JO8A 4XTYA 2X9HA 4Y92A 1VQ4A 3PFSA 2KEAA 4OMNA 3PIPA 4F7UF 1ZSZB 4KRTA 1KG1A 3QDRB 1M30A 3NTHA 1RAGB 2JTMA 5CO7A 4L6V5 2DD4A 4Q5WA 2MWPA 2KYMA 5CCAA 1K9AA 3GOXA 4C92E 4QQGA 3OS5A 4E7KA 1KJWA 1D1AA 1VQLQ 1AWOA 1AWWA 4XTZA 2RHUA 4FW1A 5J26A 2PNIA 2AK5A 4DBFA 2OI3A 3GF5A 2A28A 3EG9B 1Q82C 1VQ8T 4HKEA 1UHCA 2YLCA 1OZ2A 3T9NA 4PLLA 2YUOA 4B9XA 2EVRA 1BCOA 3VYHB 3A1PA 1X69A 4F04B 4M7AD 4M7DG 1DJ7B 1FX7A 1NPPA 2WACA 3NTKA 3JSCA 2EAYA 1WHJA 5M9OA 2HSPA 2HL3A 4O6JA 3OSVA 4M7AC 4ORZA 1KD1U 2K57A 4K11A 3QO3A 1VYUA 2XHCA 1LVKA 3QPHA 4J83A 3M55A 2FYKA 5KYYB 3EGXB 4M77C 2FZKB 4FU6A 1WGSA 1AVZC 2FO0A 4HVWA 3VRZA 4OMQA 1IXDA 1M1KC 1WPYA 2DEUA 1ABQA 5IHNA 2K2VA 3HL8A 1YCYA 1G8XA 5FLXE 1GFCA 1I4K1 1W4SA 3CCET 1C6VX 4A4GA 8AT1B 4HT8A 1WHLA 4BDZA 3H0IA 1UHFA 2NUPB 4KGZB 2BTTA 2LQWA 2Y4YA 2JJ9A 3THKA 2E6ZA 3HRSA 1WHHA 3CMAT 5GANh 1RI0A 3OYMA 1D09B 3FJPA 3QJ6A 1Y07A 1VQ4T 3MP6A 2GQIA 3CCSA 1AOJA 1YNZA 3PIOA 1PCXA 3ZEHA 1VQKA 2KMTA 2D6FA 1BI2A 5J3BA 1TUCA 2QTXA 4FL6A 2RF0A 3TQ7P 3J81E 2CT3A 2LQ8A 1MV0B 4M77A 2KI7A 4M7DB 3PGGA 3UWNA 3JCMV 2DLPA 2DTHA 2Y4XA 5C6SA 3ASKA 2RQWA 1GBRA 2O9VA 5FU7B 2VGMA 3VS0A 4DEXA 2AKKA 1M1KR 4OMLA 2JM9A 1VQ6Q 2CH4W 4PJOG 3MP8A 2MOXA 2CP2A 2CP7A 1IRXA 2EJGA 4RTTA 2JN0A 4FYXB 4XTVA 1B34B 1OULA 3BE3A 1M90R 2EQKA 2M0YA 4QQDA 4XTXA 2D9TA 3CPWA 3CC4Q 4P5NA 1UECA 2LJ1A 4KGVB 1RAHB 3OS0A 3CD6A 2QQ9A 3UDCA 1QCOA 3OBYA 4BB7A 5GAOl 1FXXA 5I22A 3J7AF 1YITQ 4JUVA 1WXUA 3HFOA 1P92A 1XNIA 4M77E 2E3IA 2SEMA 5EG2A 1K0SA 2QTVA 2RJCA 3OW2P 1LJOA 3JB9G 1M4ZA 1GBQA 5DM7R 1OOTA 2JS2A 3L2WA 1UG1A 5IHKA 1AWXA 2CS7A 3GNGA 2E5QA 2X3XD 4KT0E 1EZZB 1GCQC 5IN1A 2CUDA 1G3YA 2ZPGB 3CCRA 3CBMA 3HSBA 1M2VB 2H3EB 2DXUA 2W10A 5L23A 2KY9A 4C0ZA 1CKBA 4XU2A 4C8QG 1Z9ZA 3EH2A 4E7LA 4A53A 3V8JA 4J9HA 2FPEA 2ECZA 2DX1A 3M53A 2Y90A 1YWPA 1H3HA 4XU3A 1HK9A 2BE9B 3BW1A 5LJ3g 3CCLA 2DM1A 3CCST 2RO0A 2PUOB 2VKNA 2DXBA 2CP6A 8ATCB 4PJOB 3CMEA 4F7UG 1Y96A 4M77F 4V2SA 2LJ3A 2JZ2A 3H6ZA 3PVLA 2KAFA 2K9GA 1UGSB 4C0FA 1JJ2P 3M0TA 4M78G 3PMIA 5EC7A 1KFZA 2MAMA 2YHTA 5AT1B 1R0BG 4EPCA 2RI3A 2DE0X 4PJOD 2EGCA 2CREA 4EMGA 1KD1R 5GANe 2DEQA 1OI1A 1NEGA 4ATOA 4OB3B 2RD1A 1NEBA 2RB6A 5CQYA 1D1BA 2DXCA 4JS5A 2HDAA 1M27C 1LCKA 3JCMd 1GCQA 4IIMA 5HY6A 5CKEA 3G71Q 4FT2A 3OYDA 2DIGA 2JM8A 2X51A 2K2MA 1UB4A 1M8MA 1T0HA 1WHGA 4J7FA 1T3SA 2CKKA 3LGLA 2KE9A 3NHNA 4C5IA 2DK3A 4IIOA 1MMNA 2L3SA 1AZEA 4FT4A 5GJVB 3SWNA 3NTIA 1MUZA 4QVZA 1VQ9Q 1FMKA 4LDWA 2ZPIB 1UGVA 3MKDA 2AIRB 1YJWQ 1WFWA 3FB9A 3OYNA 4C92G 1QVGS 3OYJA 3EH1A 4JPBW 1H92A 2M9UA 4LD9K 2K3YA 1BCMA 2ZPBB 3I5SA 1UUEA 3M0QA 3CQTA 1UDLA 4KUIA 2O31A 3U23A 4C8QD 1T0JA 3SHWA 4F7UB 3VKIA 4EMKB 2NUZA 2EGEA 4KH0B 2ATCB 3EGDB 1K8AC 1S72A 4M78B 2JT4A 2QA4Q 2DL5A 5IHIA 2GTOA 2DRMA 2VXEA 1BYMA 2XIDA 2RHXA 1UTIA 5GAMh 2EQUA 1QWFA 2DBKA 2HSEB 1JEGA 3QUIA 1EFNA 2KXCA 1B7TA 1WNLA 3CMET 1ZLMA 3S3OA 2XDPA 3AHUA 5CKDA 4M78D 3INZA 2RQTA 4R56A 2K5IA 3KBGA 1JBMA 3CCVQ 2FEIA 2ZPEB 3BDUA 4RTYA 1PNJA 4PJNA 4E7SA 2RI5A 2P4TA 1BU1A 1PD1A 2EPDA 4XU0A 1UJYA 3VU3C 3CCUQ 1D0ZA 3NPFA 1BKBA 5GAN7 4X9DA 2NYSA 2GFAA 5IT9E 1W2BS 5KYWB 4EMHA 1Q95G 1PKTA 3RMSA 2AHJB 1RUWA 2RJDA 5HCKA 4J7IA 4KGXB 1X43A 2JW4A 1ZA2B 2K7AA 2P0QA 1X75C 3J80E 2QGFB 1QQJA 2DL3A 1BI1A 4C92B 2LT1A 1FMVA 3FLGA 1B07A 1I1JA 3CCQA 1M8VA 4LDUA 2QASA 3M0RA 2DVJA 1W6XA 4JJDA 1WYXA 2OTLQ 1M5Q1 3JCMf 3QKJA 1RLQC 4C92D 5LJ5h 5CKBA 1QCNA 4HCBA 1HD3A 3HHTB 2YLBA 4OMPA 4JS4A 2JUFA 2FB7A 5A0GA 1RLPC 2MI6A 3FJ5A 5HKCA 1VQ8A 5GANd 3EFOB 1VQMQ 1UFFA 3CBOA 3GP8A 4OB1B 2F2XA 3GIBA 2QGGA 5GMKl 1KQ1A 3QYHB 5GAOp 2KT1A 4GLKA 3OYAA 1SHFA 4NS5A 3I55A 1RACB 3X26B 1OU8A 1QVGA 3RKXA 5DY9A 3N5BB 1VIEA 4Z02A 1SSHA 1VQPA 3OW2S 3QBYA 1YI2A 3A8GB 1PHTA 3P8BB 4LDYA 3JCMQ 2CZ7B 4RTVA 3CCMA 1IREB 3OYHA 2F1LA 4N4HA 3ZL7C 4RTWA 3CCEA 3X20B 3G6EQ 4M4ZA 1AT1B 5FU6C 1ZBJA 4FYWB 2CZ6B 3V7CA 2O2OA 1Q7YU 2E65A 1PM3A 4OF1A 1YJ9T 1G3SA 3MP1A 3OYGA 3VS2A 3HKSA 4PLIA 2D8JA 1YHQQ 1W70A 3QWYA 2QQBA 5KH6A 2JOYA 2O4XA 3EG0A 4XTUA 3C95A 2DFUA 1T3LA 1N8RU 5I11A 3EHQA 5LJ3j 5A2QE 3Q1JA 1WJRA 2DMOA 5KE3A 1QCFA 4RG8A 3RERA 2BZXA 3CCQT 4C0GA 1JJ2S 3UATA 1W2BA 3E9FA 2EGAA 1TWBA 1ZUYA 2X4JA 4BI3A 4ESRA 4WTOB 5GAOm 4AMCA 1VQNT 1VQ5Q 2DYIA 2HMAA 2DERA 1PC0A 3KUFA 1QVGP 3EGUA 3META 4JJBA 4GLMA 1OYXA 4FYYB 1FMWA 5FRMA 1WIEA 2Z0WA 3CCJT 3M57A 3I56A 4R0KA 1GFDA 3OYIA 5KYXA 3UPUA 4J9IA 2V1QA 2J06A 3I55T 5GAN3 3EAEA 3EFSA 3M59A 4ZN1A 1JRIA 1D0XA 4M75A 4M77B 3CCSQ 1U06A 4OGCA 1SKUB 2C0IA 1MV3A 2JNGA 3RIRA 1VQKQ 4PK4A 5LJ5e 2KDSA 1NBEB 1VQPT 2E3HA 5HK0A 2LCSA 2CP3A 4BE0A 1YI2T 4HA8A 1ZQ1A 5D6YA 1E7OA 2KVQG 5KYUA 1VIFA 2MYSA 3CCMT 3FRNA 2CH4A 5GAOr 1WQWA 1YP5A 3OS2A 2H3JA 2VASA 3QHSA 1VYVA 3CPFA 2XD0A 3RKYA 1NLPC 3A98A 2LMJA 1M90C 2GGRA 1B3QA 2NWMA 1VQLA 4RTZA 1UJ0A 4QVCA 2RI2A 1W2BP 2YT6A 3EG2A 3OW2A 2EJFA 3RESA 3P8DA 3OYCA 2KGTA 3G4SA 4M75E 2X4YA 2LCCA 1X2KA 3CD6Q 1EX4A 4M7AA 1OX9A 1BBZA 1G83A 2ED1A 4GY5A 1Q81U 2P0KA 3EG9A 4QQ6A 4KBMB 3E1SA 3LGFA 2EYZA 5CVIA 1NYFA 2DRKA 3M0SA 4A54A 3JCMg 1H3ZA 1U5SA 3H0HA 2KRNA 2EWNA 3R6NA 1QLYA 4XK8E 2F5TX 5D6XA 4E47A 2LC4A 1NZ9A 3GNFB 4OP0A 3JB9J 5A0DA 4M7DD 2P84A 3TCJA 1JU5C 2EKOA 2L3RA 2AKLA 3CCRQ 2DL4A 2RA2A 4ZTFA 1WZOA 2R5AA 2PVDB 2J05A 5GAMd 5KCHA 3I56T 1TS9A 3GLXA 4C0DB 1JJ2A 4M7DC 1UE9A 1UGRB 2FZCB 3VUZA 4HT9A 1Y96B 4M75F 5FU7C 3CCLQ 3CC2Q 4M7AE 4JLIA 2E70A 1TSFA 3TSZA 1C1AA 2MF2A 2ENMA 3L2ZA 4OMFB 1U1SA 3VV0A 2LVMA 3KXTA 2DKGA 3HRUA 4RKUE 5GMKj 1HYOA 5CKHA 4A4KA 2K4YA 7AT1B 1Q7YR 1KD1C 2LRQA 1RI9A
chains in the Genus database with same CATH topology
2E41A 4XAXB 2LTOA 2QXFA 3HFNA 2ZPBB 4VUBA 3V7SA 3BFMA 1R8OB 4M77D 4C5HA 4KUIA 2RJFA 4BDYA 3CXCA 1JB0E 4OVAA 2DVEA 2EIFA 5LL6S 4C8QD 4LDXA 2VUBA 1S72T 1FWZA 2X35A 2LNVA 3OYLA 2PQWA 2DD5A 4F7UB 2QQRA 3VKIA 4EMKB 2IVWA 2PU9B 3JCMc 4ME7A 1VQLT 3MEAA 4F7UE 3JCMh 4RCBA 1K8AC 2MWOA 2QI2A 4JRPA 4L59A 3SB2A 2KSSA 3L2QA 4M78B 4E7HA 1S72A 4C92F 4MZTA 2OTLT 3SD4A 5LJ3e 2XU8A 5FU6B 5GAN8 2XDBA 1M90U 2VXEA 2ZGWA 2VGNA 4M78E 5LJ5g 1N9RA 2XIDA 1X01A 1HXDA 2RHXA 3SWNB 1BYMA 3JB9F 5GAMh 4BY6C 2EQUA 4QW2A 3G4ST 2RHIA 2OTLA 1UGQB 3M9QA 1VQ6A 3L2VA 1K9MC 3S3NA 1BI3A 3QUIA 5CR2A 2WSCE 3HPWA 3JCMW 1VQ5A 4M7AF 4NL3A 1WNLA 3JCMX 5DLOA 1YJWT 3HRTA 3CMET 2GQVA 2XDPA 3M56A 3S3OA 5CKDA 1O75A 5D6WA 3CC7T 3AHUA 4M78D 5LJ5d 3INZA 3FEOA 2LQKA 1VQMT 4TVRA 3ZFJA 2KQWA 2RK1A 4R56A 2VYTA 2K5IA 1SSFA 1Y7XA 3KBGA 1JBMA 4HCZA 4O5VA 2HBPA 3X28B 3X24B 4E7JA 2ZPEB 3BDUA 2IG0A 1H641 3RMQA 1G5VA 1RL2A 4EDUA 5HK3A 1X6OA 1Q7YC 2GCXA 2G3RA 2RI5A 4LD6A 3JCMe 2P4TA 4M75D 3JCMP 3LYIA 1KQSA 4XU0A 1B34A 3MEUA 3VU3C 2A3LA 3QZ9B 1BKBA 5GAN4 5GAN7 2QEXT 3A8MB 4X9DA 2GFAA 3CMAA 3OYYA 5IT9E 2PUKB 1YITA 1W2BS 5GAMe 3DLMA 5LJ3f 2HQXA 4BE1A 4M75C 1YJNA 4EMHA 2GFUA 4N4GA 4J6XA 3TU4K 1KQ2A 3RMSA 2AHJB 4BI8B 2RJDA 4MMKA 4XTYA 4J7IA 1N8RC 4OB2B 3PNWC 3LWHA 4IKFA 1VQ4A 4PJOC 3PFSA 3PIPA 4HCCA 1IZ6A 4F7UF 4MMLA 1KG1A 4RCCA 3QDRB 3S6WA 2P0QA 1X75C 3J80E 3NTHA 2JTMA 5CO7A 4PNOA 4L6V5 4UC4A 1BI1A 2DD4A 1WQ7A 4C92B 2LT1A 4Q5WA 4D6WA 4J6YA 2MWPA 3RUXA 3C4SA 1GXIE 3FLGA 2XKOC 5CCAA 4C92E 3GOXA 3JB9H 4QQGA 3OS5A 4E7KA 1MGQA 2CYZB 3L1AA 4X34A 3CCQA 4XTZA 2RHUA 4LDUA 1VQOT 5CKFA 3JAME 3CCQT 1M8VA 5J26A 1BIAA 3L2UA 2K3XA 5GMKm 3G6ET 1KC8U 3DKMA 1M5Q1 3JCMf 3QKJA 4ELYC 2V8JA 2OAUA 4Y28E 5GANg 4ZGEB 3GF5A 4C92D 4DOVA 5LJ5h 3OQ5A 5CKBA 1Q82C 1NE8A 2RH2A 4HKEA 1VQ8T 2YLCA 2MMPA 3H8ZA 1OZ2A 3HHTB 2CZ0B 4PKCC 4PLLA 3T9NA 1U1TA 5GAMf 3QYGB 2YLBA 1OZ3A 2R57A 4JS4A 4RG2A 4B9XA 2JUFA 3JB9D 1KHCA 2FB7A 5A0GA 1QVFA 5GAOq 3VYHB 2MI6A 1Q86U 5HKCA 1VQ8A 5L8RE 1M1GA 3QXEB 4DQ2A 5GANd 4M7AD 3M5AA 3MO8A 4M7DG 1YHQT 1M9SA 3CBOA 1DJ7B 1FX7A 5DLQE 1NPPA 2WACA 3NTKA 3GP8A 3JSCA 2EAYA 4OB1B 5I2SA 1NJIU 2R58A 4C0DC 3M58A 5M9OA 2E64A 2K5LA 4O6JA 3PT9A 3PTAA 2LCLA 1K73U 3GIBA 3OSVA 4M7AC 5GMKl 1KD1U 1KQ1A 3CXCS 2I2LA 2DTIA 3JCMJ 1N27A 2K57A 3QO3A 3QYHB 4J5YA 4GLKA 5GAOp 3OYAA 3BDLA 4NS5A 3I55A 2XHCA 2BUDA 2DTOA 3QPHA 4J83A 3X26B 3M55A 2FYKA 2XDDA 4PJOA 3G7ZA 4DOWA 4BE2A 4M77C 4IUVA 4OB0B 3QSUA 3JB9I 1QVGA 4FU6A 3RKXA 1WGSA 2EJ9A 2JVVA 5DY9A 3N5BB 3TREA 4JLGA 4C8QC 1D3BA 2VC8A 3V8LA 1VQ6T 1VIEA 1K8AU 4IUPA 1M1KC 1I8FA 1WPYA 1VQ5T 4Z02A 1VQPA 3CBPA 1Y71A 2K2VA 3OW2S 3HL8A 3QBYA 1YI2A 2LX9A 3A8GB 1TH7A 1YCYA 4JDSA 2HD0A 2V8KA 4M7DA 3P8BB 3P8HA 5FLXE 1I4K1 1W4SA 4LDYA 3JCMQ 2CZ7B 3CCET 3CCMA 4A4GA 4QVDA 1K9MU 5FRNA 4C5GA 1WJSA 1N9SA 1IREB 3OYHA 4HT8A 4N4HA 1JJ2A 2E6NA 1MHNA 2X4XA 4BDZA 3CCEA 1NJIC 4EMKC 2DXTA 3HP9A 3X20B 2Y4YA 5GMKh 4IUTA 3CEYA 4M78C 3CC4A 2E6ZA 1UGPB 5FU6C 1KQSS 3HRSA 1LNXA 3OYKA 2WSEE 3CMAT 5GANh 2CZ6B 1RI0A 3V7CA 1YITT 3CC2A 3OYMA 3SWNC 1YJNT 1Q7YU 2E65A 2EFIA 2P0PA 4OF1A 3FJPA 3QJ6A 1VQ9A 4N4IA 1YJ9T 1Y07A 1G3SA 1VQKT 3MP1A 2RJEA 3OY9A 3OYGA 3LWIA 1VQ4T 4IUQA 3HKSA 3OYFA 3MP6A 2K5FA 4PLIA 3CCSA 2NLUA 1Q81C 5CAIA 2QQBA 3PIOA 1YJ9A 3O8VA 4DA4A 5FROA 3ZEHA 2XICA 5KH6A 2JOYA 1D3BB 2KMTA 2WSFE 1VQKA 2D6FA 1BIBA 1BI2A 1N6AA 2F5KA 2O4XA 4XTUA 5J3BA 2L5QA 3C95A 4XU1A 4LDVA 1N8RU 3WVDB 2QTXA 5GAN5 4FL6A 5LJ3j 5A2QE 3J81E 3Q1JA 1WJRA 5KE3A 1VUBA 4RG8A 2LQ8A 2C06A 4M77A 4M7DB 3RERA 3PGGA 3UWNA 3JCMV 3MHXA 2EQJA 2B8AA 2DTHA 2Y4XA 2M0OA 3SFMA 4C0GA 4C8QA 3ASKA 4ZGJB 5C6SA 1JJ2S 4ZN3A 3OB9A 3C94A 2XK0A 4M7DE 3MEVA 1W2BA 3E9FA 5FU7B 1ZBXA 4M75G 3SDZA 4II1A 4CI0C 3LH0A 3LX7A 5I2MA 2VGMA 4IURA 3V7RA 2X4JA 2FHDA 3QZ5B 5C0MA 2O01E 1QW1A 4BI3A 2VV5A 3A8OB 5GAOm 2EQMA 4PJOG 3MP8A 1QVPA 1VQNT 2QA4A 2E10A 4XTWA 3VJPA 1I81A 4RMOA 5CK9A 1YIJA 2EJGA 3KUFA 2JN0A 4XTVA 1VQNA 1B34B 1Q82U 3C12A 4F7UA 4EMKA 3META 2DO3A 2EQKA 2RHZA 4QQDA 4WF2A 4C92C 4JRIA 2QQSA 4JRQA 1OYXA 4XTXA 5FRMA 1VQ7T 3CD6T 2D9TA 3CPWA 3OSSC 4M78A 3CCJT 3ER0A 3QG1A 2ZPFB 4P5NA 3M57A 3I56A 3DB3A 2BKDN 5GAMj 3MCAB 3WXMB 3OYIA 2YRVA 2O4XB 3M4GA 3UPUA 3OS0A 3CD6A 2BIVA 2PVGB 2QQ9A 3UDCA 3CCJA 3CCVA 2DIQA 3I55T 3OBYA 4BB7A 1AHJB 4N0AC 1ZHIA 5GAN3 5GAOl 3EAEA 3EFSA 3M59A 1FXXA 2M1HA 4ZN1A 1JRIA 3JRZA 3JCMb 3J7AF 3R6OA 3M54A 4JUVA 4M75A 2L8DA 2F69A 4M77B 1KHIA 1VQ7A 3VYGA 3HFOA 1P92A 3MEWA 4OGCA 1YBYA 2JNGA 2JTFA 2CZ1B 3RIRA 4C8QB 1XNIA 4M77E 3E9GA 2ZPHB 5AYFA 1QP3A 3CCUA 5GMKi 1U8RA 4Y91A 2DPPB 4C8QE 1QP2A 5LJ5e 4KULA 2FL7A 2KDSA 5EG2A 4E7IA 2RJCA 3OA6A 2OTJA 3TEEA 1I5LA 1VQPT 1LJOA 5HK0A 2VXFA 4BY6B 3JB9G 1M4ZA 4KUDK 4M7DF 4BE0A 5DM7R 1YI2T 4HA8A 1ZQ1A 5D6YA 3FC3A 2RM4A 3L2WA 2HQEA 2KVQG 1VIFA 4M7AG 4ZGDB 3CCMT 4IUUA 4LD9K 1M1KU 3FRNA 2CS7A 3GNGA 4MDWA 4PL6A 2E5QA 3G71T 2KK4A 3CCRT 1LOJA 5GAOr 1WQWA 1EIFA 2LT4A 2H3JA 3OS2A 2RHYA 4KT0E 3QHSA 3CPFA 3GPLA 2V8IA 4NL2A 2XD0A 2DZCA 4FSXA 3DB4A 3PMTA 5IN1A 1G3YA 3RKYA 2A7YA 2ZPGB 3CBMA 3G71A 3CCRA 3LLRA 3HSBA 1M90C 4M77G 2DXUA 4MZMA 2KY9A 4C0ZA 3X25B 3CC4T 2QQAA 4MZPA 4XU2A 4A4FA 3OBWA 4C8QG 3DLLA 2M16A 2E12A 4E7LA 4A53A 4FM4B 1VQLA 4ZTJA 3CCLT 3CC2T 3V8JA 4A4HA 5I21A 3NFCA 2R5MA 3M53A 2Y90A 1V29B 4JRKA 4QVCA 2RI2A 4XU3A 1VQ9T 1HK9A 3BW1A 5LJ3g 4MDXA 4C92A 3OW2A 2EJFA 3CCLA 4ELZC 4M75B 3RESA 3P8DA 3OYCA 2LDMA 5LJ5f 3G4SA 3CCST 2RO0A 4HCBA 1O9SA 2PUOB 3URGA 4BD3A 4M75E 2DXBA 2X4YA 3A8HB 2LCCA 4PJOB 4C5EA 2DZ9A 4B9WA 4R55A 3CMEA 1YJWA 4M7AA 4F7UG 2DJZA 1Y96A 4N0AA 5LJ3d 3WVEB 4BUGA 3CC7A 4PJOE 4M77F 4V2SA 4GY5A 5LJ5j 2JZ2A 3E19A 2P0KA 3H6ZA 3V8KA 4JJNK 2KAFA 4C8QF 1VQMA 1Q81U 1UGSB 4C0FA 1XOVA 3BY7A 4J6WA 4NOYA 4KBMB 4M78G 4QQ6A 3E1SA 3PMIA 3UT1A 2MAMA 3LGFA 2YHTA 1M1FA 4EPCA 5CVIA 2RI3A 3LW5E 4L5GA 5GAN6 4PJOD 5GMKe 4A54A 3JCMg 1H3ZA 4EMGA 2QEXA 5GANe 4J8OA 2DEQA 2HNIA 3S3MA 2EWNA 2QA4T 1OI1A 4XK8E 2F5TX 5D6XA 4ATOA 4OB3B 4E47A 2RD1A 2RB6A 2LC4A 1NZ9A 3A5ZB 3VUBA 5GAMg 5CQYA 3GNFB 4A4EA 5A0LA 1YIJT 2GF7A 4FIBA 4OP0A 3JB9J 2DXCA 3EFRA 4JS5A 3M4YA 3JCMd 5GAOn 5A0DA 5HY6A 4M7DD 2ZZDA 3TCJA 2EKOA 2L3RA 4M78F 3F70A 5CKEA 1QVFS 4FT2A 3OYDA 2DAQA 5KCOA 2D0QB 2DIGA 2RA2A 4ZTFA 3OMGA 2R5AA 2ZCFB 3A8LB 1G3WA 5CIUA 4YTLA 2PVDB 4BI4A 3L2RA 1UB4A 5GAMd 5KCHA 3I56T 4J7FA 2E1HA 3GLXA 4X9CA 3FDRA 4C0DB 3CPWS 1PSEA 1KC8C 2CKKA 1NPRA 3LGLA 3OMCA 4M7DC 1UGRB 3VUZA 4HT9A 1WJQA 4M7AB 4C5IA 3CCVT 1XQHA 1Y96B 2DK3A 4M75F 2PVOB 5FU7C 5IAYA 5GAN2 2X4WA 4FT4A 2EYQA 4M7AE 1VQOA 3SWNA 3RKWA 4JLIA 2E70A 2XI9A 5CQXA 2RK2A 3OYBA 3FIFA 3NTIA 1G3TA 3G6EA 4QVZA 4PJOF 2HAXA 1UEBA 2MF2A 4LDWA 1Q86C 1XTDA 2ZPIB 3L2ZA 3CCUT 4OMFB 2CGHA 5LJ3h 3OS1A 1U1SA 5KE2A 3VV0A 5GANf 2LVMA 3KXTA 3OYEA 2OTJT 2DKGA 4BACA 3FB9A 3OYNA 2QDYB 3HRUA 3ME9A 4OGEA 3L42A 4C92G 1QVGS 4XQ3A 3ZBDA 2XG8D 4RKUE 5GMKj 3OYJA 1K73C 1BI0A 2FVUA 3QJYA 5CKHA 4A4KA 2K4YA 5J39A 4CRIA 2L89A 1KD1C 2M9UA 2LRQA 5GANj 1YHQA 2K3YA 3QIIA 1PSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QDR B; 
#chains in the Genus database with same CATH topology
 3VS5 A;  1WI7 A;  2SRC A;  3VRY A;  4LXC A;  4OVA A;  4LDX A;  2VUB A;  2RQU A;  1IGU A;  2PQW A;  2DD5 A;  2IVW A;  2PU9 B;  4ME7 A;  1N8R R;  1VQL T;  1WXB A;  4JRP A;  4MZT A;  3SD4 A;  2HCK A;  2XU8 A;  5LJ3 e;  5GAN 8;  4HVU A;  2VGN A;  3SWN B;  1HXD A;  3G4S T;  2RHI A;  4CC7 A;  5IH2 A;  2M02 A;  1VQ6 A;  3L2V A;  2WSC E;  3HPW A;  4M7A F;  1RAF B;  4NL3 A;  3JCM X;  3HRT A;  1O75 A;  5LJ5 d;  1GRI A;  1QWE A;  2LQK A;  2KRM A;  2QG9 B;  4TVR A;  3ZFJ A;  2BZ8 A;  1SSF A;  4HCZ A;  2HBP A;  2D1X A;  3X24 B;  4E7J A;  2L3Q A;  5HK3 A;  4EDU A;  1X6O A;  3EG3 A;  1V1C A;  4D8K A;  4A63 B;  1B34 A;  2A3L A;  1K76 A;  3A8M B;  5D7U A;  1YIT A;  1CSK A;  2OTJ Q;  1YJN A;  2GFU A;  4N4G A;  4J6X A;  1KQ2 A;  2JXB A;  1KIK A;  2O9S A;  4OB2 B;  3PNW C;  1X27 A;  3LWH A;  4IKF A;  4PJO C;  1ZUU A;  1IZ6 A;  4RCC A;  1PWT A;  3S6W A;  4Z89 A;  2JMC A;  4PNO A;  1BK2 A;  4J6Y A;  1S72 Q;  1AZG B;  1GXI E;  2XKO C;  1RAA B;  3JB9 H;  2HQH A;  1MGQ A;  3L1A A;  2K3B A;  2DYB A;  9ATC B;  1X6B A;  2K3X A;  5GMK m;  1KC8 U;  3DKM A;  4ELY C;  2V8J A;  2YUP A;  2OAU A;  2RPN A;  5GAN g;  2KNB B;  4DOV A;  1NE8 A;  1NM7 A;  1U1T A;  5GAM f;  3QYG B;  1OZ3 A;  4GBQ A;  1YCS B;  2FPF A;  4RG2 A;  3JB9 D;  2QYZ A;  1Q86 U;  1M1G A;  1QMC A;  2KXD A;  3CC7 Q;  2O88 A;  1MMD A;  2P4R A;  5DLQ E;  1SHG A;  5I2S A;  1NJI U;  2R58 A;  3M58 A;  1GCP A;  2E64 A;  2K5L A;  1V76 A;  3PT9 A;  2LCL A;  3PTA A;  1K73 U;  3CXC S;  2I2L A;  3JCM J;  4J5Y A;  3BDL A;  2J6O A;  2QEX Q;  2BUD A;  2DTO A;  1Q81 R;  2YUN A;  2XDD A;  4PJO A;  2GBQ A;  1M3B A;  4OB0 B;  3MJX A;  1ZUK A;  4PFP A;  4C8Q C;  3TRE A;  2NUT B;  1D3B A;  2VC8 A;  1VQ6 T;  1K1Z A;  1I8F A;  1I5O B;  1WX6 A;  3CBP A;  2K6D A;  1NLO C;  1GL5 A;  2HD0 A;  3P8H A;  3CCQ Q;  4QVD A;  1K9M U;  1WJS A;  2E6N A;  1TU0 B;  1MHN A;  2X4X A;  4EMK C;  4PFO A;  4IUT A;  2RMO A;  1YN8 A;  2DL7 A;  4M78 C;  3RR6 A;  1KQS S;  1LNX A;  2WSE E;  1PKS A;  1VQ8 Q;  2DBM A;  1W1F A;  1YIT T;  1YJN T;  2DNU A;  2P0P A;  1VQ9 A;  4N4I A;  3KFV A;  2RJE A;  3OY9 A;  2F2V A;  2K5F A;  1K0X A;  5CAI A;  1YJ9 A;  3O8V A;  4DA4 A;  1JXO A;  2XIC A;  1FYN A;  2WSF E;  1N6A A;  3TSW A;  4XU1 A;  3VS1 A;  2AZV A;  2ROL A;  1D0Y A;  2C06 A;  2YRC A;  3MHX A;  4C8Q A;  3SFM A;  2M0O A;  3OB9 A;  1Z9Q A;  4M75 G;  4DEY A;  4DBQ A;  4II1 A;  2EYW A;  3V7R A;  4OMM A;  5I2M A;  4IUR A;  5C0M A;  2O01 E;  1QW1 A;  4ANJ A;  2QA4 A;  1RAE B;  4XTW A;  3CCM Q;  4F16 A;  1YIJ A;  2J7I A;  1VQN A;  1Q82 U;  3C12 A;  4F7U A;  4EMK A;  3CCE Q;  4FYV B;  2RHZ A;  4WF2 A;  4C92 C;  4JRI A;  2QQS A;  3NGP A;  3OSS C;  4M78 A;  1PD0 A;  3ER0 A;  3QG1 A;  2ZPF B;  3DB3 A;  3WXM B;  2YRV A;  2O4X B;  3M4G A;  3LH5 A;  2PVG B;  2KRS A;  3MPU B;  3CCJ A;  3CCV A;  2DIQ A;  3CMA Q;  1OX8 A;  2M1H A;  3M0U A;  1BB9 A;  3R6O A;  3M54 A;  3HTR A;  1M2O A;  2L8D A;  2C0T A;  1VQ7 A;  2JTF A;  2CZ1 B;  4DBR A;  3I5R A;  3E9G A;  5AYF A;  4AG2 C;  4LE9 A;  5GMK i;  3CCU A;  2OX7 A;  1VQ4 Q;  1SF9 A;  2RQR A;  4Y91 A;  4C8Q E;  1QP2 A;  4E7I A;  4KUL A;  2VXF A;  4BY6 B;  2YRD A;  4KH1 B;  3H9N A;  1Y0M A;  3H41 A;  3FC3 A;  4RTU A;  2HQE A;  2DA9 A;  4M7A G;  2PTK A;  4ZGD B;  4IUU A;  1M1K U;  4PL6 A;  4MDW A;  3G71 T;  2KK4 A;  1LOJ A;  1EIF A;  2RHY A;  1WLP B;  3GPL A;  4NL2 A;  5KYW A;  2DZC A;  3DB4 A;  3PMT A;  2EQI A;  3LLR A;  4M77 G;  4J9D A;  1X2Q A;  2E4H A;  2QQA A;  4A4F A;  1WHK A;  2M16 A;  1ACM B;  2E12 A;  4FM4 B;  4FW2 A;  4ZTJ A;  5KYX B;  5I21 A;  3NFC A;  4ZNX A;  1V29 B;  1VQ9 T;  4C92 A;  1M3C A;  4M75 B;  1KC8 R;  4LN2 A;  1ZSG A;  3URG A;  1WXT A;  4AFS C;  4BD3 A;  1MMG A;  3I56 Q;  4PJJ A;  2YDL A;  4FSS A;  1IB8 A;  2DZ9 A;  5FWC A;  5IXB A;  2DJZ A;  2JMA A;  1VQM A;  4C8Q F;  1Q86 R;  1XOV A;  4J6W A;  1NYG A;  2IPO B;  1VA7 A;  1VOM A;  2LQN A;  2PZ1 A;  1K73 R;  1SG5 A;  1QKW A;  4LUD A;  2ZAE A;  1IHV A;  3S3M A;  2QA4 T;  3VS3 A;  1OEB A;  5GAM g;  1YIJ T;  4A4E A;  2GF7 A;  4AFQ C;  4FIB A;  3EFR A;  4M78 F;  1QVF S;  1ZSZ C;  2DAQ A;  5KCO A;  1QKX A;  3L2R A;  3A8L B;  1G3W A;  2YWW A;  3REB B;  3CPW S;  3FDR A;  1PSE A;  3OMC A;  1TXQ A;  2FZG B;  2MK5 A;  2CSQ A;  4M7A B;  3CXC P;  3CCV T;  1XQH A;  1ABO A;  2D0N A;  5GAN 2;  2C0O A;  5ECA A;  1RAI B;  2EYQ A;  4J9B A;  1VQO A;  1K9M R;  3RKW A;  2ROT A;  1VQ7 T;  2XI9 A;  2COW A;  5CQX A;  2RK2 A;  3G4S Q;  3G6E A;  1G3T A;  1TOV A;  2HAX A;  1XTD A;  3CCU T;  3IQL A;  5LJ3 h;  3OS1 A;  2V1R A;  5KE2 A;  5GAN f;  4AG1 C;  2YUQ A;  3OYE A;  1PG5 B;  1XJW B;  3ME9 A;  1G2B A;  3L42 A;  4XQ3 A;  1WA7 A;  1E6H A;  5J39 A;  4CRI A;  2L89 A;  1YHQ A;  5GAN j;  3QII A;  4ZGJ B;  1PSF A;  2E41 A;  2LTO A;  4VUB A;  3V7S A;  2FRY A;  3QDF A;  4M77 D;  3TVT A;  2LX7 A;  4BDY A;  2DVE A;  2EIF A;  3M0P A;  1FWZ A;  4LNP A;  2CUB A;  3SEM A;  2LNH B;  1U3O A;  2MWO A;  2QI2 A;  1KQS P;  3L2Q A;  4PJL A;  4E7H A;  4PFZ A;  4C92 F;  2OTL T;  1J3T A;  5LJ5 g;  4JJC A;  2HKQ B;  1ZSZ A;  3RBB B;  1SEM A;  4QW2 A;  1SPK A;  1BI3 A;  3S3N A;  5CR2 A;  1VQ5 A;  3JCM W;  3M56 A;  5GJW B;  1TTH B;  1VQM T;  2VYT A;  1K4U S;  1CKA A;  1Q82 R;  1RL2 A;  2EYY A;  3I35 A;  4OMO A;  2MCN A;  1Q7Y C;  1KK7 A;  2GCX A;  3GBQ A;  2G3R A;  3JCM e;  4QKU A;  3JCM P;  2CP0 A;  3RNJ A;  2EKH A;  3MEU A;  3QZ9 B;  3D7S B;  3C0C A;  3I9Q A;  3OYY A;  4HXJ A;  2OJ2 A;  2PUK B;  4BE1 A;  4E6R A;  3QWX X;  4BI8 B;  4MMK A;  1N8R C;  2A37 A;  4HCC A;  4MML A;  3ULR B;  2YXY A;  1TG0 A;  1JXM A;  4DBH A;  1NG2 A;  2MPX C;  4UC4 A;  1WQ7 A;  4D6W A;  1YFN A;  3RUX A;  3C4S A;  5KYY A;  5FWB A;  3EGX A;  2CYZ B;  4X34 A;  1VQO T;  5CKF A;  3JAM E;  1BIA A;  3L2U A;  3G6E T;  2FPD A;  1TUD A;  2KRO A;  4Y28 E;  4ZGE B;  4HCK A;  3OQ5 A;  2RH2 A;  2MMP A;  4PKC C;  3H8Z A;  2CP5 A;  2CZ0 B;  4AT1 B;  3H0F A;  2R57 A;  2RN8 A;  1QVF A;  1KHC A;  5GAO q;  3CME Q;  4AFZ C;  5L8R E;  3QXE B;  4DQ2 A;  2EW3 A;  2KT8 A;  3M5A A;  3MO8 A;  1YHQ T;  1M9S A;  4QT7 A;  2NUP A;  1E6G A;  4C0D C;  4J9C A;  2V26 A;  2VB6 A;  3UA6 A;  2DIL A;  1ZX6 A;  2DTI A;  1N27 A;  1YJN Q;  1PRL C;  1RAB B;  3G7Z A;  4DOW A;  4BE2 A;  4IUV A;  3QSU A;  3JB9 I;  2JVV A;  2EJ9 A;  4D8D A;  2CT4 A;  4JLG A;  3V8L A;  1K8A U;  4IUP A;  1VQ5 T;  2DF6 A;  1AD5 A;  1R77 A;  1Y71 A;  2LX9 A;  4JDS A;  1TH7 A;  1SRM A;  2V8K A;  4M7D A;  1OPK A;  2A0F B;  5FRN A;  4C5G A;  1N9S A;  1Y57 A;  2LP5 A;  2KR3 A;  2DXT A;  3HP9 A;  1AEY A;  5GMK h;  3CEY A;  3CC4 A;  1UGP B;  3OYK A;  3CC2 A;  3SWN C;  2ESW A;  2EFI A;  2X3W D;  1VQK T;  3LWI A;  4IUQ A;  3OYF A;  2RNA A;  2NLU A;  1Q81 C;  4Z88 A;  5FRO A;  1A0N B;  2OAW A;  1D3B B;  2BE7 D;  1BIB A;  2F5K A;  1QVF P;  2L5Q A;  4LDV A;  3WVD B;  5GAN 5;  1IGQ A;  3CPW P;  1VUB A;  4WCI A;  2EQJ A;  2B8A A;  2BZY A;  4ZN3 A;  3C94 A;  2XK0 A;  1MMA A;  4M7D E;  3MEV A;  1ZBX A;  3SDZ A;  2J6F A;  4CC2 A;  3LH0 A;  3LX7 A;  4CI0 C;  1S1N A;  2FHD A;  3JV3 A;  3QZ5 B;  3NMZ C;  4F17 A;  1HSQ A;  2VV5 A;  3A8O B;  2EQM A;  2VWF A;  4X1V A;  1QVP A;  3VS6 A;  2E10 A;  3VJP A;  1IHW A;  4Z8A A;  1I81 A;  4RTX A;  4RMO A;  1WDX A;  5CK9 A;  2VVK A;  1JQQ A;  2DO3 A;  1OPL A;  2L3P A;  4LUE A;  4JRQ A;  2COZ A;  3CD6 T;  1M2V A;  1F1B B;  2BKD N;  2D8H A;  5GAM j;  3MCA B;  2DET A;  2BIV A;  5IXF A;  1AHJ B;  4N0A C;  1ZHI A;  2LZ6 B;  4J9F A;  3JRZ A;  3JCM b;  4PJM A;  2F69 A;  1KHI A;  3VYG A;  3MEW A;  1YBY A;  4C8Q B;  1YJ9 Q;  2KBT A;  2ZPH B;  1QP3 A;  2QDL A;  1U8R A;  2DPP B;  1YWO A;  2FL7 A;  3OA6 A;  5KYN A;  3TEE A;  1I5L A;  4KUD K;  2OTJ A;  4M7D F;  3O5Z A;  1MND A;  2RM4 A;  1HJD A;  1X6G A;  2MIO A;  2A08 A;  2DJQ A;  1MNE A;  1D1C A;  3PVQ A;  3CCR T;  2KYB A;  2LT4 A;  1LPL A;  2AZS A;  2V8I A;  2EYX A;  4FSX A;  3G71 A;  2A7Y A;  4MZM A;  2COY A;  3X25 B;  3CC4 T;  4MZP A;  3OBW A;  3DLL A;  2G6F X;  1YIJ Q;  3CCL T;  3CC2 T;  4A4H A;  1VQN Q;  2R5M A;  2YSQ A;  4JRK A;  2LJ0 A;  4AFU C;  4MDX A;  2B86 A;  4ELZ C;  3E2U A;  2LDM A;  5LJ5 f;  2I0N A;  1O9S A;  1I0C A;  2DL8 A;  4JZ3 A;  3A8H B;  4C5E A;  4B9W A;  4R55 A;  1YJW A;  3CCJ Q;  4N0A A;  5LJ3 d;  3WVE B;  4BUG A;  3CC7 A;  4PJO E;  5LJ5 j;  3E19 A;  3V8K A;  4FCY A;  4JJN K;  1VQ7 Q;  1RAD B;  3BY7 A;  4NOY A;  3I55 Q;  3UT1 A;  3PE0 A;  3AT1 B;  4E2F B;  1OV3 A;  2FRW A;  1C0M A;  2CSI A;  1M1F A;  4EIK A;  2AT1 B;  3LW5 E;  4L5G A;  5GAN 6;  5GMK e;  1VYT A;  4HVV A;  2QEX A;  4J8O A;  2HNI A;  1VQP Q;  4J9E A;  3A5Z B;  2ED0 A;  3VUB A;  2F2W A;  1YI2 Q;  5A0L A;  2E5K A;  1ZA1 B;  4JZ4 A;  2L2P A;  1ARK A;  3M4Y A;  5GAO n;  1KSW A;  3EG1 A;  2ZZD A;  3VS7 A;  3F70 A;  1R0C B;  3UF4 A;  2M51 A;  1M3A A;  2D0Q B;  3OMG A;  5CIU A;  2ZCF B;  4BI4 A;  4YTL A;  5FW9 A;  1K8A R;  2E1H A;  4X9C A;  3EGD A;  1KC8 C;  1NPR A;  2CDT A;  4F14 A;  3UA7 A;  2NUT A;  1WJQ A;  2ABL A;  5IAY A;  2PVO B;  2X4W A;  1IO6 A;  4J9G A;  1N5Z A;  2HKN A;  3OYB A;  3FIF A;  4B6M A;  4PJO F;  1UEB A;  1Q86 C;  2CGH A;  1SRL A;  1WHM A;  2QAZ A;  2OTJ T;  4BAC A;  1OQK A;  1NJI C;  2QDY B;  4OGE A;  3ZBD A;  2K79 A;  2XG8 D;  3REA B;  1K73 C;  1BI0 A;  2FVU A;  3QJY A;  3VS4 A;  4CC3 A;  1H8K A;  4XAX B;  2JTE A;  2QXF A;  2GNC A;  3HFN A;  3BFM A;  1R8O B;  2GTJ A;  4C5H A;  2A36 A;  2RJF A;  2XMF A;  3CXC A;  1JB0 E;  5LL6 S;  2J6K A;  1S72 T;  2X35 A;  2LNV A;  3OYL A;  4E7Z A;  2QQR A;  3JCM c;  2FG0 A;  3MEA A;  2RQV A;  4F7U E;  3JCM h;  4RCB A;  2QK0 A;  4L59 A;  2KSS A;  3SB2 A;  6AT1 B;  2XDB A;  5FU6 B;  1M90 U;  2ZGW A;  1OU9 A;  4M78 E;  1I07 A;  1N9R A;  1X01 A;  2HBW A;  3JB9 F;  4BY6 C;  2JS0 A;  2OTL A;  1UGQ B;  3M9Q A;  1K9M C;  1PRM C;  5DLO A;  1YJW T;  3RDV A;  2GQV A;  4CC4 B;  5D6W A;  3CC7 T;  2H8H A;  3FEO A;  2IIM A;  1VQO Q;  2HEQ A;  2KQW A;  2RK1 A;  1Y7X A;  4O5V A;  3X28 B;  2HL5 C;  2IG0 A;  1H64 1;  3RMQ A;  1G5V A;  2HZY A;  4LD6 A;  5KYU B;  2W0Z A;  1TUG B;  4M75 D;  3LYI A;  1KQS A;  2EBP A;  2QEX T;  5GAN 4;  1NJI R;  3CMA A;  1AWJ A;  3G1J A;  5GAM e;  3DLM A;  5LJ3 f;  2HQX A;  4M75 C;  2L0A A;  3EFO A;  4RUG A;  3EHR A;  3TU4 K;  1JO8 A;  4XTY A;  2X9H A;  4Y92 A;  1VQ4 A;  3PFS A;  2KEA A;  4OMN A;  3PIP A;  4F7U F;  1ZSZ B;  4KRT A;  1KG1 A;  3QDR B;  1M30 A;  3NTH A;  1RAG B;  2JTM A;  5CO7 A;  4L6V 5;  2DD4 A;  4Q5W A;  2MWP A;  2KYM A;  5CCA A;  1K9A A;  3GOX A;  4C92 E;  4QQG A;  3OS5 A;  4E7K A;  1KJW A;  1D1A A;  1VQL Q;  1AWO A;  1AWW A;  4XTZ A;  2RHU A;  4FW1 A;  5J26 A;  2PNI A;  2AK5 A;  4DBF A;  2OI3 A;  3GF5 A;  2A28 A;  3EG9 B;  1Q82 C;  1VQ8 T;  4HKE A;  1UHC A;  2YLC A;  1OZ2 A;  3T9N A;  4PLL A;  2YUO A;  4B9X A;  2EVR A;  1BCO A;  3VYH B;  3A1P A;  1X69 A;  4F04 B;  4M7A D;  4M7D G;  1DJ7 B;  1FX7 A;  1NPP A;  2WAC A;  3NTK A;  3JSC A;  2EAY A;  1WHJ A;  5M9O A;  2HSP A;  2HL3 A;  4O6J A;  3OSV A;  4M7A C;  4ORZ A;  1KD1 U;  2K57 A;  4K11 A;  3QO3 A;  1VYU A;  2XHC A;  1LVK A;  3QPH A;  4J83 A;  3M55 A;  2FYK A;  5KYY B;  3EGX B;  4M77 C;  2FZK B;  4FU6 A;  1WGS A;  1AVZ C;  2FO0 A;  4HVW A;  3VRZ A;  4OMQ A;  1IXD A;  1M1K C;  1WPY A;  2DEU A;  1ABQ A;  5IHN A;  2K2V A;  3HL8 A;  1YCY A;  1G8X A;  5FLX E;  1GFC A;  1I4K 1;  1W4S A;  3CCE T;  1C6V X;  4A4G A;  8AT1 B;  4HT8 A;  1WHL A;  4BDZ A;  3H0I A;  1UHF A;  2NUP B;  4KGZ B;  2BTT A;  2LQW A;  2Y4Y A;  2JJ9 A;  3THK A;  2E6Z A;  3HRS A;  1WHH A;  3CMA T;  5GAN h;  1RI0 A;  3OYM A;  1D09 B;  3FJP A;  3QJ6 A;  1Y07 A;  1VQ4 T;  3MP6 A;  2GQI A;  3CCS A;  1AOJ A;  1YNZ A;  3PIO A;  1PCX A;  3ZEH A;  1VQK A;  2KMT A;  2D6F A;  1BI2 A;  5J3B A;  1TUC A;  2QTX A;  4FL6 A;  2RF0 A;  3TQ7 P;  3J81 E;  2CT3 A;  2LQ8 A;  1MV0 B;  4M77 A;  2KI7 A;  4M7D B;  3PGG A;  3UWN A;  3JCM V;  2DLP A;  2DTH A;  2Y4X A;  5C6S A;  3ASK A;  2RQW A;  1GBR A;  2O9V A;  5FU7 B;  2VGM A;  3VS0 A;  4DEX A;  2AKK A;  1M1K R;  4OML A;  2JM9 A;  1VQ6 Q;  2CH4 W;  4PJO G;  3MP8 A;  2MOX A;  2CP2 A;  2CP7 A;  1IRX A;  2EJG A;  4RTT A;  2JN0 A;  4FYX B;  4XTV A;  1B34 B;  1OUL A;  3BE3 A;  1M90 R;  2EQK A;  2M0Y A;  4QQD A;  4XTX A;  2D9T A;  3CPW A;  3CC4 Q;  4P5N A;  1UEC A;  2LJ1 A;  4KGV B;  1RAH B;  3OS0 A;  3CD6 A;  2QQ9 A;  3UDC A;  1QCO A;  3OBY A;  4BB7 A;  5GAO l;  1FXX A;  5I22 A;  3J7A F;  1YIT Q;  4JUV A;  1WXU A;  3HFO A;  1P92 A;  1XNI A;  4M77 E;  2E3I A;  2SEM A;  5EG2 A;  1K0S A;  2QTV A;  2RJC A;  3OW2 P;  1LJO A;  3JB9 G;  1M4Z A;  1GBQ A;  5DM7 R;  1OOT A;  2JS2 A;  3L2W A;  1UG1 A;  5IHK A;  1AWX A;  2CS7 A;  3GNG A;  2E5Q A;  2X3X D;  4KT0 E;  1EZZ B;  1GCQ C;  5IN1 A;  2CUD A;  1G3Y A;  2ZPG B;  3CCR A;  3CBM A;  3HSB A;  1M2V B;  2H3E B;  2DXU A;  2W10 A;  5L23 A;  2KY9 A;  4C0Z A;  1CKB A;  4XU2 A;  4C8Q G;  1Z9Z A;  3EH2 A;  4E7L A;  4A53 A;  3V8J A;  4J9H A;  2FPE A;  2ECZ A;  2DX1 A;  3M53 A;  2Y90 A;  1YWP A;  1H3H A;  4XU3 A;  1HK9 A;  2BE9 B;  3BW1 A;  5LJ3 g;  3CCL A;  2DM1 A;  3CCS T;  2RO0 A;  2PUO B;  2VKN A;  2DXB A;  2CP6 A;  8ATC B;  4PJO B;  3CME A;  4F7U G;  1Y96 A;  4M77 F;  4V2S A;  2LJ3 A;  2JZ2 A;  3H6Z A;  3PVL A;  2KAF A;  2K9G A;  1UGS B;  4C0F A;  1JJ2 P;  3M0T A;  4M78 G;  3PMI A;  5EC7 A;  1KFZ A;  2MAM A;  2YHT A;  5AT1 B;  1R0B G;  4EPC A;  2RI3 A;  2DE0 X;  4PJO D;  2EGC A;  2CRE A;  4EMG A;  1KD1 R;  5GAN e;  2DEQ A;  1OI1 A;  1NEG A;  4ATO A;  4OB3 B;  2RD1 A;  1NEB A;  2RB6 A;  5CQY A;  1D1B A;  2DXC A;  4JS5 A;  2HDA A;  1M27 C;  1LCK A;  3JCM d;  1GCQ A;  4IIM A;  5HY6 A;  5CKE A;  3G71 Q;  4FT2 A;  3OYD A;  2DIG A;  2JM8 A;  2X51 A;  2K2M A;  1UB4 A;  1M8M A;  1T0H A;  1WHG A;  4J7F A;  1T3S A;  2CKK A;  3LGL A;  2KE9 A;  3NHN A;  4C5I A;  2DK3 A;  4IIO A;  1MMN A;  2L3S A;  1AZE A;  4FT4 A;  5GJV B;  3SWN A;  3NTI A;  1MUZ A;  4QVZ A;  1VQ9 Q;  1FMK A;  4LDW A;  2ZPI B;  1UGV A;  3MKD A;  2AIR B;  1YJW Q;  1WFW A;  3FB9 A;  3OYN A;  4C92 G;  1QVG S;  3OYJ A;  3EH1 A;  4JPB W;  1H92 A;  2M9U A;  4LD9 K;  2K3Y A;  1BCM A;  2ZPB B;  3I5S A;  1UUE A;  3M0Q A;  3CQT A;  1UDL A;  4KUI A;  2O31 A;  3U23 A;  4C8Q D;  1T0J A;  3SHW A;  4F7U B;  3VKI A;  4EMK B;  2NUZ A;  2EGE A;  4KH0 B;  2ATC B;  3EGD B;  1K8A C;  1S72 A;  4M78 B;  2JT4 A;  2QA4 Q;  2DL5 A;  5IHI A;  2GTO A;  2DRM A;  2VXE A;  1BYM A;  2XID A;  2RHX A;  1UTI A;  5GAM h;  2EQU A;  1QWF A;  2DBK A;  2HSE B;  1JEG A;  3QUI A;  1EFN A;  2KXC A;  1B7T A;  1WNL A;  3CME T;  1ZLM A;  3S3O A;  2XDP A;  3AHU A;  5CKD A;  4M78 D;  3INZ A;  2RQT A;  4R56 A;  2K5I A;  3KBG A;  1JBM A;  3CCV Q;  2FEI A;  2ZPE B;  3BDU A;  4RTY A;  1PNJ A;  4PJN A;  4E7S A;  2RI5 A;  2P4T A;  1BU1 A;  1PD1 A;  2EPD A;  4XU0 A;  1UJY A;  3VU3 C;  3CCU Q;  1D0Z A;  3NPF A;  1BKB A;  5GAN 7;  4X9D A;  2NYS A;  2GFA A;  5IT9 E;  1W2B S;  5KYW B;  4EMH A;  1Q95 G;  1PKT A;  3RMS A;  2AHJ B;  1RUW A;  2RJD A;  5HCK A;  4J7I A;  4KGX B;  1X43 A;  2JW4 A;  1ZA2 B;  2K7A A;  2P0Q A;  1X75 C;  3J80 E;  2QGF B;  1QQJ A;  2DL3 A;  1BI1 A;  4C92 B;  2LT1 A;  1FMV A;  3FLG A;  1B07 A;  1I1J A;  3CCQ A;  1M8V A;  4LDU A;  2QAS A;  3M0R A;  2DVJ A;  1W6X A;  4JJD A;  1WYX A;  2OTL Q;  1M5Q 1;  3JCM f;  3QKJ A;  1RLQ C;  4C92 D;  5LJ5 h;  5CKB A;  1QCN A;  4HCB A;  1HD3 A;  3HHT B;  2YLB A;  4OMP A;  4JS4 A;  2JUF A;  2FB7 A;  5A0G A;  1RLP C;  2MI6 A;  3FJ5 A;  5HKC A;  1VQ8 A;  5GAN d;  3EFO B;  1VQM Q;  1UFF A;  3CBO A;  3GP8 A;  4OB1 B;  2F2X A;  3GIB A;  2QGG A;  5GMK l;  1KQ1 A;  3QYH B;  5GAO p;  2KT1 A;  4GLK A;  3OYA A;  1SHF A;  4NS5 A;  3I55 A;  1RAC B;  3X26 B;  1OU8 A;  1QVG A;  3RKX A;  5DY9 A;  3N5B B;  1VIE A;  4Z02 A;  1SSH A;  1VQP A;  3OW2 S;  3QBY A;  1YI2 A;  3A8G B;  1PHT A;  3P8B B;  4LDY A;  3JCM Q;  2CZ7 B;  4RTV A;  3CCM A;  1IRE B;  3OYH A;  2F1L A;  4N4H A;  3ZL7 C;  4RTW A;  3CCE A;  3X20 B;  3G6E Q;  4M4Z A;  1AT1 B;  5FU6 C;  1ZBJ A;  4FYW B;  2CZ6 B;  3V7C A;  2O2O A;  1Q7Y U;  2E65 A;  1PM3 A;  4OF1 A;  1YJ9 T;  1G3S A;  3MP1 A;  3OYG A;  3VS2 A;  3HKS A;  4PLI A;  2D8J A;  1YHQ Q;  1W70 A;  3QWY A;  2QQB A;  5KH6 A;  2JOY A;  2O4X A;  3EG0 A;  4XTU A;  3C95 A;  2DFU A;  1T3L A;  1N8R U;  5I11 A;  3EHQ A;  5LJ3 j;  5A2Q E;  3Q1J A;  1WJR A;  2DMO A;  5KE3 A;  1QCF A;  4RG8 A;  3RER A;  2BZX A;  3CCQ T;  4C0G A;  1JJ2 S;  3UAT A;  1W2B A;  3E9F A;  2EGA A;  1TWB A;  1ZUY A;  2X4J A;  4BI3 A;  4ESR A;  4WTO B;  5GAO m;  4AMC A;  1VQN T;  1VQ5 Q;  2DYI A;  2HMA A;  2DER A;  1PC0 A;  3KUF A;  1QVG P;  3EGU A;  3MET A;  4JJB A;  4GLM A;  1OYX A;  4FYY B;  1FMW A;  5FRM A;  1WIE A;  2Z0W A;  3CCJ T;  3M57 A;  3I56 A;  4R0K A;  1GFD A;  3OYI A;  5KYX A;  3UPU A;  4J9I A;  2V1Q A;  2J06 A;  3I55 T;  5GAN 3;  3EAE A;  3EFS A;  3M59 A;  4ZN1 A;  1JRI A;  1D0X A;  4M75 A;  4M77 B;  3CCS Q;  1U06 A;  4OGC A;  1SKU B;  2C0I A;  1MV3 A;  2JNG A;  3RIR A;  1VQK Q;  4PK4 A;  5LJ5 e;  2KDS A;  1NBE B;  1VQP T;  2E3H A;  5HK0 A;  2LCS A;  2CP3 A;  4BE0 A;  1YI2 T;  4HA8 A;  1ZQ1 A;  5D6Y A;  1E7O A;  2KVQ G;  5KYU A;  1VIF A;  2MYS A;  3CCM T;  3FRN A;  2CH4 A;  5GAO r;  1WQW A;  1YP5 A;  3OS2 A;  2H3J A;  2VAS A;  3QHS A;  1VYV A;  3CPF A;  2XD0 A;  3RKY A;  1NLP C;  3A98 A;  2LMJ A;  1M90 C;  2GGR A;  1B3Q A;  2NWM A;  1VQL A;  4RTZ A;  1UJ0 A;  4QVC A;  2RI2 A;  1W2B P;  2YT6 A;  3EG2 A;  3OW2 A;  2EJF A;  3RES A;  3P8D A;  3OYC A;  2KGT A;  3G4S A;  4M75 E;  2X4Y A;  2LCC A;  1X2K A;  3CD6 Q;  1EX4 A;  4M7A A;  1OX9 A;  1BBZ A;  1G83 A;  2ED1 A;  4GY5 A;  1Q81 U;  2P0K A;  3EG9 A;  4QQ6 A;  4KBM B;  3E1S A;  3LGF A;  2EYZ A;  5CVI A;  1NYF A;  2DRK A;  3M0S A;  4A54 A;  3JCM g;  1H3Z A;  1U5S A;  3H0H A;  2KRN A;  2EWN A;  3R6N A;  1QLY A;  4XK8 E;  2F5T X;  5D6X A;  4E47 A;  2LC4 A;  1NZ9 A;  3GNF B;  4OP0 A;  3JB9 J;  5A0D A;  4M7D D;  2P84 A;  3TCJ A;  1JU5 C;  2EKO A;  2L3R A;  2AKL A;  3CCR Q;  2DL4 A;  2RA2 A;  4ZTF A;  1WZO A;  2R5A A;  2PVD B;  2J05 A;  5GAM d;  5KCH A;  3I56 T;  1TS9 A;  3GLX A;  4C0D B;  1JJ2 A;  4M7D C;  1UE9 A;  1UGR B;  2FZC B;  3VUZ A;  4HT9 A;  1Y96 B;  4M75 F;  5FU7 C;  3CCL Q;  3CC2 Q;  4M7A E;  4JLI A;  2E70 A;  1TSF A;  3TSZ A;  1C1A A;  2MF2 A;  2ENM A;  3L2Z A;  4OMF B;  1U1S A;  3VV0 A;  2LVM A;  3KXT A;  2DKG A;  3HRU A;  4RKU E;  5GMK j;  1HYO A;  5CKH A;  4A4K A;  2K4Y A;  7AT1 B;  1Q7Y R;  1KD1 C;  2LRQ A;  1RI9 A; 
#chains in the Genus database with same CATH homology
 2E41 A;  4XAX B;  2LTO A;  2QXF A;  3HFN A;  2ZPB B;  4VUB A;  3V7S A;  3BFM A;  1R8O B;  4M77 D;  4C5H A;  4KUI A;  2RJF A;  4BDY A;  3CXC A;  1JB0 E;  4OVA A;  2DVE A;  2EIF A;  5LL6 S;  4C8Q D;  4LDX A;  2VUB A;  1S72 T;  1FWZ A;  2X35 A;  2LNV A;  3OYL A;  2PQW A;  2DD5 A;  4F7U B;  2QQR A;  3VKI A;  4EMK B;  2IVW A;  2PU9 B;  3JCM c;  4ME7 A;  1VQL T;  3MEA A;  4F7U E;  3JCM h;  4RCB A;  1K8A C;  2MWO A;  2QI2 A;  4JRP A;  4L59 A;  3SB2 A;  2KSS A;  3L2Q A;  4M78 B;  4E7H A;  1S72 A;  4C92 F;  4MZT A;  2OTL T;  3SD4 A;  5LJ3 e;  2XU8 A;  5FU6 B;  5GAN 8;  2XDB A;  1M90 U;  2VXE A;  2ZGW A;  2VGN A;  4M78 E;  5LJ5 g;  1N9R A;  2XID A;  1X01 A;  1HXD A;  2RHX A;  3SWN B;  1BYM A;  3JB9 F;  5GAM h;  4BY6 C;  2EQU A;  4QW2 A;  3G4S T;  2RHI A;  2OTL A;  1UGQ B;  3M9Q A;  1VQ6 A;  3L2V A;  1K9M C;  3S3N A;  1BI3 A;  3QUI A;  5CR2 A;  2WSC E;  3HPW A;  3JCM W;  1VQ5 A;  4M7A F;  4NL3 A;  1WNL A;  3JCM X;  5DLO A;  1YJW T;  3HRT A;  3CME T;  2GQV A;  2XDP A;  3M56 A;  3S3O A;  5CKD A;  1O75 A;  5D6W A;  3CC7 T;  3AHU A;  4M78 D;  5LJ5 d;  3INZ A;  3FEO A;  2LQK A;  1VQM T;  4TVR A;  3ZFJ A;  2KQW A;  2RK1 A;  4R56 A;  2VYT A;  2K5I A;  1SSF A;  1Y7X A;  3KBG A;  1JBM A;  4HCZ A;  4O5V A;  2HBP A;  3X28 B;  3X24 B;  4E7J A;  2ZPE B;  3BDU A;  2IG0 A;  1H64 1;  3RMQ A;  1G5V A;  1RL2 A;  4EDU A;  5HK3 A;  1X6O A;  1Q7Y C;  2GCX A;  2G3R A;  2RI5 A;  4LD6 A;  3JCM e;  2P4T A;  4M75 D;  3JCM P;  3LYI A;  1KQS A;  4XU0 A;  1B34 A;  3MEU A;  3VU3 C;  2A3L A;  3QZ9 B;  1BKB A;  5GAN 4;  5GAN 7;  2QEX T;  3A8M B;  4X9D A;  2GFA A;  3CMA A;  3OYY A;  5IT9 E;  2PUK B;  1YIT A;  1W2B S;  5GAM e;  3DLM A;  5LJ3 f;  2HQX A;  4BE1 A;  4M75 C;  1YJN A;  4EMH A;  2GFU A;  4N4G A;  4J6X A;  3TU4 K;  1KQ2 A;  3RMS A;  2AHJ B;  4BI8 B;  2RJD A;  4MMK A;  4XTY A;  4J7I A;  1N8R C;  4OB2 B;  3PNW C;  3LWH A;  4IKF A;  1VQ4 A;  4PJO C;  3PFS A;  3PIP A;  4HCC A;  1IZ6 A;  4F7U F;  4MML A;  1KG1 A;  4RCC A;  3QDR B;  3S6W A;  2P0Q A;  1X75 C;  3J80 E;  3NTH A;  2JTM A;  5CO7 A;  4PNO A;  4L6V 5;  4UC4 A;  1BI1 A;  2DD4 A;  1WQ7 A;  4C92 B;  2LT1 A;  4Q5W A;  4D6W A;  4J6Y A;  2MWP A;  3RUX A;  3C4S A;  1GXI E;  3FLG A;  2XKO C;  5CCA A;  4C92 E;  3GOX A;  3JB9 H;  4QQG A;  3OS5 A;  4E7K A;  1MGQ A;  2CYZ B;  3L1A A;  4X34 A;  3CCQ A;  4XTZ A;  2RHU A;  4LDU A;  1VQO T;  5CKF A;  3JAM E;  3CCQ T;  1M8V A;  5J26 A;  1BIA A;  3L2U A;  2K3X A;  5GMK m;  3G6E T;  1KC8 U;  3DKM A;  1M5Q 1;  3JCM f;  3QKJ A;  4ELY C;  2V8J A;  2OAU A;  4Y28 E;  5GAN g;  4ZGE B;  3GF5 A;  4C92 D;  4DOV A;  5LJ5 h;  3OQ5 A;  5CKB A;  1Q82 C;  1NE8 A;  2RH2 A;  4HKE A;  1VQ8 T;  2YLC A;  2MMP A;  3H8Z A;  1OZ2 A;  3HHT B;  2CZ0 B;  4PKC C;  4PLL A;  3T9N A;  1U1T A;  5GAM f;  3QYG B;  2YLB A;  1OZ3 A;  2R57 A;  4JS4 A;  4RG2 A;  4B9X A;  2JUF A;  3JB9 D;  1KHC A;  2FB7 A;  5A0G A;  1QVF A;  5GAO q;  3VYH B;  2MI6 A;  1Q86 U;  5HKC A;  1VQ8 A;  5L8R E;  1M1G A;  3QXE B;  4DQ2 A;  5GAN d;  4M7A D;  3M5A A;  3MO8 A;  4M7D G;  1YHQ T;  1M9S A;  3CBO A;  1DJ7 B;  1FX7 A;  5DLQ E;  1NPP A;  2WAC A;  3NTK A;  3GP8 A;  3JSC A;  2EAY A;  4OB1 B;  5I2S A;  1NJI U;  2R58 A;  4C0D C;  3M58 A;  5M9O A;  2E64 A;  2K5L A;  4O6J A;  3PT9 A;  3PTA A;  2LCL A;  1K73 U;  3GIB A;  3OSV A;  4M7A C;  5GMK l;  1KD1 U;  1KQ1 A;  3CXC S;  2I2L A;  2DTI A;  3JCM J;  1N27 A;  2K57 A;  3QO3 A;  3QYH B;  4J5Y A;  4GLK A;  5GAO p;  3OYA A;  3BDL A;  4NS5 A;  3I55 A;  2XHC A;  2BUD A;  2DTO A;  3QPH A;  4J83 A;  3X26 B;  3M55 A;  2FYK A;  2XDD A;  4PJO A;  3G7Z A;  4DOW A;  4BE2 A;  4M77 C;  4IUV A;  4OB0 B;  3QSU A;  3JB9 I;  1QVG A;  4FU6 A;  3RKX A;  1WGS A;  2EJ9 A;  2JVV A;  5DY9 A;  3N5B B;  3TRE A;  4JLG A;  4C8Q C;  1D3B A;  2VC8 A;  3V8L A;  1VQ6 T;  1VIE A;  1K8A U;  4IUP A;  1M1K C;  1I8F A;  1WPY A;  1VQ5 T;  4Z02 A;  1VQP A;  3CBP A;  1Y71 A;  2K2V A;  3OW2 S;  3HL8 A;  3QBY A;  1YI2 A;  2LX9 A;  3A8G B;  1TH7 A;  1YCY A;  4JDS A;  2HD0 A;  2V8K A;  4M7D A;  3P8B B;  3P8H A;  5FLX E;  1I4K 1;  1W4S A;  4LDY A;  3JCM Q;  2CZ7 B;  3CCE T;  3CCM A;  4A4G A;  4QVD A;  1K9M U;  5FRN A;  4C5G A;  1WJS A;  1N9S A;  1IRE B;  3OYH A;  4HT8 A;  4N4H A;  1JJ2 A;  2E6N A;  1MHN A;  2X4X A;  4BDZ A;  3CCE A;  1NJI C;  4EMK C;  2DXT A;  3HP9 A;  3X20 B;  2Y4Y A;  5GMK h;  4IUT A;  3CEY A;  4M78 C;  3CC4 A;  2E6Z A;  1UGP B;  5FU6 C;  1KQS S;  3HRS A;  1LNX A;  3OYK A;  2WSE E;  3CMA T;  5GAN h;  2CZ6 B;  1RI0 A;  3V7C A;  1YIT T;  3CC2 A;  3OYM A;  3SWN C;  1YJN T;  1Q7Y U;  2E65 A;  2EFI A;  2P0P A;  4OF1 A;  3FJP A;  3QJ6 A;  1VQ9 A;  4N4I A;  1YJ9 T;  1Y07 A;  1G3S A;  1VQK T;  3MP1 A;  2RJE A;  3OY9 A;  3OYG A;  3LWI A;  1VQ4 T;  4IUQ A;  3HKS A;  3OYF A;  3MP6 A;  2K5F A;  4PLI A;  3CCS A;  2NLU A;  1Q81 C;  5CAI A;  2QQB A;  3PIO A;  1YJ9 A;  3O8V A;  4DA4 A;  5FRO A;  3ZEH A;  2XIC A;  5KH6 A;  2JOY A;  1D3B B;  2KMT A;  2WSF E;  1VQK A;  2D6F A;  1BIB A;  1BI2 A;  1N6A A;  2F5K A;  2O4X A;  4XTU A;  5J3B A;  2L5Q A;  3C95 A;  4XU1 A;  4LDV A;  1N8R U;  3WVD B;  2QTX A;  5GAN 5;  4FL6 A;  5LJ3 j;  5A2Q E;  3J81 E;  3Q1J A;  1WJR A;  5KE3 A;  1VUB A;  4RG8 A;  2LQ8 A;  2C06 A;  4M77 A;  4M7D B;  3RER A;  3PGG A;  3UWN A;  3JCM V;  3MHX A;  2EQJ A;  2B8A A;  2DTH A;  2Y4X A;  2M0O A;  3SFM A;  4C0G A;  4C8Q A;  3ASK A;  4ZGJ B;  5C6S A;  1JJ2 S;  4ZN3 A;  3OB9 A;  3C94 A;  2XK0 A;  4M7D E;  3MEV A;  1W2B A;  3E9F A;  5FU7 B;  1ZBX A;  4M75 G;  3SDZ A;  4II1 A;  4CI0 C;  3LH0 A;  3LX7 A;  5I2M A;  2VGM A;  4IUR A;  3V7R A;  2X4J A;  2FHD A;  3QZ5 B;  5C0M A;  2O01 E;  1QW1 A;  4BI3 A;  2VV5 A;  3A8O B;  5GAO m;  2EQM A;  4PJO G;  3MP8 A;  1QVP A;  1VQN T;  2QA4 A;  2E10 A;  4XTW A;  3VJP A;  1I81 A;  4RMO A;  5CK9 A;  1YIJ A;  2EJG A;  3KUF A;  2JN0 A;  4XTV A;  1VQN A;  1B34 B;  1Q82 U;  3C12 A;  4F7U A;  4EMK A;  3MET A;  2DO3 A;  2EQK A;  2RHZ A;  4QQD A;  4WF2 A;  4C92 C;  4JRI A;  2QQS A;  4JRQ A;  1OYX A;  4XTX A;  5FRM A;  1VQ7 T;  3CD6 T;  2D9T A;  3CPW A;  3OSS C;  4M78 A;  3CCJ T;  3ER0 A;  3QG1 A;  2ZPF B;  4P5N A;  3M57 A;  3I56 A;  3DB3 A;  2BKD N;  5GAM j;  3MCA B;  3WXM B;  3OYI A;  2YRV A;  2O4X B;  3M4G A;  3UPU A;  3OS0 A;  3CD6 A;  2BIV A;  2PVG B;  2QQ9 A;  3UDC A;  3CCJ A;  3CCV A;  2DIQ A;  3I55 T;  3OBY A;  4BB7 A;  1AHJ B;  4N0A C;  1ZHI A;  5GAN 3;  5GAO l;  3EAE A;  3EFS A;  3M59 A;  1FXX A;  2M1H A;  4ZN1 A;  1JRI A;  3JRZ A;  3JCM b;  3J7A F;  3R6O A;  3M54 A;  4JUV A;  4M75 A;  2L8D A;  2F69 A;  4M77 B;  1KHI A;  1VQ7 A;  3VYG A;  3HFO A;  1P92 A;  3MEW A;  4OGC A;  1YBY A;  2JNG A;  2JTF A;  2CZ1 B;  3RIR A;  4C8Q B;  1XNI A;  4M77 E;  3E9G A;  2ZPH B;  5AYF A;  1QP3 A;  3CCU A;  5GMK i;  1U8R A;  4Y91 A;  2DPP B;  4C8Q E;  1QP2 A;  5LJ5 e;  4KUL A;  2FL7 A;  2KDS A;  5EG2 A;  4E7I A;  2RJC A;  3OA6 A;  2OTJ A;  3TEE A;  1I5L A;  1VQP T;  1LJO A;  5HK0 A;  2VXF A;  4BY6 B;  3JB9 G;  1M4Z A;  4KUD K;  4M7D F;  4BE0 A;  5DM7 R;  1YI2 T;  4HA8 A;  1ZQ1 A;  5D6Y A;  3FC3 A;  2RM4 A;  3L2W A;  2HQE A;  2KVQ G;  1VIF A;  4M7A G;  4ZGD B;  3CCM T;  4IUU A;  4LD9 K;  1M1K U;  3FRN A;  2CS7 A;  3GNG A;  4MDW A;  4PL6 A;  2E5Q A;  3G71 T;  2KK4 A;  3CCR T;  1LOJ A;  5GAO r;  1WQW A;  1EIF A;  2LT4 A;  2H3J A;  3OS2 A;  2RHY A;  4KT0 E;  3QHS A;  3CPF A;  3GPL A;  2V8I A;  4NL2 A;  2XD0 A;  2DZC A;  4FSX A;  3DB4 A;  3PMT A;  5IN1 A;  1G3Y A;  3RKY A;  2A7Y A;  2ZPG B;  3CBM A;  3G71 A;  3CCR A;  3LLR A;  3HSB A;  1M90 C;  4M77 G;  2DXU A;  4MZM A;  2KY9 A;  4C0Z A;  3X25 B;  3CC4 T;  2QQA A;  4MZP A;  4XU2 A;  4A4F A;  3OBW A;  4C8Q G;  3DLL A;  2M16 A;  2E12 A;  4E7L A;  4A53 A;  4FM4 B;  1VQL A;  4ZTJ A;  3CCL T;  3CC2 T;  3V8J A;  4A4H A;  5I21 A;  3NFC A;  2R5M A;  3M53 A;  2Y90 A;  1V29 B;  4JRK A;  4QVC A;  2RI2 A;  4XU3 A;  1VQ9 T;  1HK9 A;  3BW1 A;  5LJ3 g;  4MDX A;  4C92 A;  3OW2 A;  2EJF A;  3CCL A;  4ELZ C;  4M75 B;  3RES A;  3P8D A;  3OYC A;  2LDM A;  5LJ5 f;  3G4S A;  3CCS T;  2RO0 A;  4HCB A;  1O9S A;  2PUO B;  3URG A;  4BD3 A;  4M75 E;  2DXB A;  2X4Y A;  3A8H B;  2LCC A;  4PJO B;  4C5E A;  2DZ9 A;  4B9W A;  4R55 A;  3CME A;  1YJW A;  4M7A A;  4F7U G;  2DJZ A;  1Y96 A;  4N0A A;  5LJ3 d;  3WVE B;  4BUG A;  3CC7 A;  4PJO E;  4M77 F;  4V2S A;  4GY5 A;  5LJ5 j;  2JZ2 A;  3E19 A;  2P0K A;  3H6Z A;  3V8K A;  4JJN K;  2KAF A;  4C8Q F;  1VQM A;  1Q81 U;  1UGS B;  4C0F A;  1XOV A;  3BY7 A;  4J6W A;  4NOY A;  4KBM B;  4M78 G;  4QQ6 A;  3E1S A;  3PMI A;  3UT1 A;  2MAM A;  3LGF A;  2YHT A;  1M1F A;  4EPC A;  5CVI A;  2RI3 A;  3LW5 E;  4L5G A;  5GAN 6;  4PJO D;  5GMK e;  4A54 A;  3JCM g;  1H3Z A;  4EMG A;  2QEX A;  5GAN e;  4J8O A;  2DEQ A;  2HNI A;  3S3M A;  2EWN A;  2QA4 T;  1OI1 A;  4XK8 E;  2F5T X;  5D6X A;  4ATO A;  4OB3 B;  4E47 A;  2RD1 A;  2RB6 A;  2LC4 A;  1NZ9 A;  3A5Z B;  3VUB A;  5GAM g;  5CQY A;  3GNF B;  4A4E A;  5A0L A;  1YIJ T;  2GF7 A;  4FIB A;  4OP0 A;  3JB9 J;  2DXC A;  3EFR A;  4JS5 A;  3M4Y A;  3JCM d;  5GAO n;  5A0D A;  5HY6 A;  4M7D D;  2ZZD A;  3TCJ A;  2EKO A;  2L3R A;  4M78 F;  3F70 A;  5CKE A;  1QVF S;  4FT2 A;  3OYD A;  2DAQ A;  5KCO A;  2D0Q B;  2DIG A;  2RA2 A;  4ZTF A;  3OMG A;  2R5A A;  2ZCF B;  3A8L B;  1G3W A;  5CIU A;  4YTL A;  2PVD B;  4BI4 A;  3L2R A;  1UB4 A;  5GAM d;  5KCH A;  3I56 T;  4J7F A;  2E1H A;  3GLX A;  4X9C A;  3FDR A;  4C0D B;  3CPW S;  1PSE A;  1KC8 C;  2CKK A;  1NPR A;  3LGL A;  3OMC A;  4M7D C;  1UGR B;  3VUZ A;  4HT9 A;  1WJQ A;  4M7A B;  4C5I A;  3CCV T;  1XQH A;  1Y96 B;  2DK3 A;  4M75 F;  2PVO B;  5FU7 C;  5IAY A;  5GAN 2;  2X4W A;  4FT4 A;  2EYQ A;  4M7A E;  1VQO A;  3SWN A;  3RKW A;  4JLI A;  2E70 A;  2XI9 A;  5CQX A;  2RK2 A;  3OYB A;  3FIF A;  3NTI A;  1G3T A;  3G6E A;  4QVZ A;  4PJO F;  2HAX A;  1UEB A;  2MF2 A;  4LDW A;  1Q86 C;  1XTD A;  2ZPI B;  3L2Z A;  3CCU T;  4OMF B;  2CGH A;  5LJ3 h;  3OS1 A;  1U1S A;  5KE2 A;  3VV0 A;  5GAN f;  2LVM A;  3KXT A;  3OYE A;  2OTJ T;  2DKG A;  4BAC A;  3FB9 A;  3OYN A;  2QDY B;  3HRU A;  3ME9 A;  4OGE A;  3L42 A;  4C92 G;  1QVG S;  4XQ3 A;  3ZBD A;  2XG8 D;  4RKU E;  5GMK j;  3OYJ A;  1K73 C;  1BI0 A;  2FVU A;  3QJY A;  5CKH A;  4A4K A;  2K4Y A;  5J39 A;  4CRI A;  2L89 A;  1KD1 C;  2M9U A;  2LRQ A;  5GAN j;  1YHQ A;  2K3Y A;  3QII A;  1PSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...