3QDRB

Structural characterization of the interaction of colicin a, colicin n, and tolb with the tolaiii translocon
Total Genus 0
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
0
sequence length
49
structure length
49
Chain Sequence
SYNTPWGKVIINAAGQPTMNGTVMTADNSSMVPYGRGFTRVLNSLVNNP

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein tolA
publication title Structural Evidence That Colicin A Protein Binds to a Novel Binding Site of TolA Protein in Escherichia coli Periplasm.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport/toxin
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2011-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.970 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3qdrB00
3QDRB
chains in the Genus database with same CATH superfamily
2YUPA 4C92A 2NWMA 1UFFA 1ZSZB 2DMOA 2HQHA 3PIPA 1KJWA 2OTLQ 3C0CA 1M30A 1H3HA 1M90C 4KRTA 1GL5A 4F14A 5GAN7 1K9AA 4Z02A 1WPYA 2YDLA 2O88A 2E65A 3QKJA 3JCMQ 2OTJA 3JCMV 3CCEQ 4E7HA 4M77G 3SD4A 2XKOC 3RESA 2QQBA 5M9OA 3PT9A 4RTWA 1AWWA 1NEBA 3LH0A 5GANj 4J8OA 4KBMB 4Z88A 4BI8B 5FLXE 1QCNA 4J9FA 1QKWA 1KIKA 2VYTA 1YJNQ 3A8LB 4J6WA 4RCCA 2YRCA 3CMAT 3CCMQ 2V8JA 3I56A 1VQKA 3M4GA 1LCKA 2DXTA 3X26B 3JCMf 5FW9A 1M3CA 4HKEA 4PJOE 2C0OA 2QA4A 5A0LA 3JB9G 2JXBA 4JLGA 2O9VA 2D9TA 1NG2A 1SG5A 2CZ7B 2WSEE 2JZ2A 1QCFA 4BUGA 2X4YA 3E1SA 3V8KA 4JJNK 3P8DA 4LXCA 4P5NA 2YSQA 4LDXA 4IUTA 4M7DA 1ZLMA 2MPXC 3U23A 2FPDA 4ELZC 4F7UF 3FC3A 1RLPC 2NUZA 1D0ZA 1VQNT 1X69A 3WXMB 5CKDA 3CC4A 4FYWB 5LJ3g 4QQDA 1QWEA 2KROA 5IXFA 5CO7A 3QG1A 3OW2S 5GAOq 1OU9A 2VC8A 2RJEA 4KUDK 1R0BG 1K76A 2X3XD 5GAN2 2CH4A 2CP0A 2M16A 1FMKA 1TU0B 1BCOA 3A5ZB 1PM3A 2HMAA 4IUUA 3TSWA 2PQWA 2OTJT 2HKQB 1VQ4Q 1VQ8A 3MEAA 1ZHIA 2RJDA 2JJ9A 3NMZC 3V8LA 1I5LA 2RJCA 5D7UA 1WIEA 5CQXA 1EX4A 1N9RA 1W70A 1C6VX 2WSFE 2DTHA 1PG5B 5KH6A 2X35A 3OYAA 4NS5A 1JQQA 4XU2A 1QVGA 1N8RU 3OYHA 3EGXA 4C5GA 2C06A 5GANe 1IHVA 2A37A 3PVQA 1BB9A 2HEQA 4RMOA 4CRIA 1K8AU 1M90U 4N4IA 4PLLA 5GAMf 3SWNA 1KQ2A 1OZ2A 4PKCC 1K9MR 5IAYA 3ER0A 1X2KA 3I56T 1BIAA 1NE8A 3EG2A 1A0NB 2CZ6B 1WJQA 1VQKT 5LJ5h 3M0QA 3EAEA 1BYMA 2F2XA 1BCMA 1Q7YC 2QA4T 2B8AA 4M7DC 2HCKA 4BDZA 1PRLC 2DL8A 2XHCA 3PMTA 2DIGA 4M77F 2PZ1A 4BY6C 3CQTA 3HRSA 1AT1B 3P8HA 3HHTB 2KVQG 3VYHB 4HVUA 1WQ7A 5GMKl 1MV0B 1YCSB 2J6KA 3L2ZA 3L2VA 3OA6A 3L2WA 2D6FA 4FM4B 1M27C 1VQ6A 4XTXA 4J9IA 3CCUT 1KD1U 4BACA 3OB9A 2KE9A 3OYYA 1BBZA 3L2QA 2KT1A 4N4GA 3T9NA 1M2VB 2P4TA 3L1AA 5KYNA 3C95A 3EG0A 3FIFA 2LVMA 2HSEB 5CQYA 1XJWB 1PC0A 1Y71A 1Q82R 2BZYA 1VQ8T 2DZ9A 3VS5A 2FHDA 3UF4A 4FW2A 4RTYA 2COYA 1Q86U 3QHSA 4K11A 3EG9B 5A0GA 1KHIA 2DD5A 1XQHA 1R77A 1HSQA 3SFMA 2K6DA 2CT3A 4XK8E 4BI4A 5IN1A 4M7DE 5L23A 3CCSA 4E7JA 3SDZA 3OMCA 4FYVB 3FRNA 2C0IA 2B86A 2LCSA 4BB7A 2A28A 4M7AF 2ZPHB 1WI7A 4FT4A 1E7OA 5IH2A 2J05A 2JOYA 2H3JA 3RIRA 1VQMA 5EG2A 2OAUA 3FLGA 1I1JA 1K73C 3R6NA 4BE2A 2FB7A 3OBYA 3NFCA 2CUBA 1C1AA 1VQ7A 2RJFA 5GAN5 3QIIA 2DNUA 2X51A 5CIUA 5GAOn 1ABQA 4PLIA 1AWOA 3VS2A 3EFOB 4J9HA 1MGQA 1OQKA 1OOTA 1UB4A 4FIBA 2DXUA 4M78D 2LP5A 1VQ6T 4XTYA 5LJ5g 1KSWA 3IQLA 3NHNA 4V2SA 4EPCA 3I5RA 1Q7YU 4HVVA 2EQMA 2M0OA 4M77A 3HKSA 3EHRA 3G6EQ 2VV5A 2KYMA 4PJOF 3D7SB 4RCBA 2FPFA 2DLPA 4GY5A 1VQPA 2LJ1A 4C92D 4GLMA 1WLPB 2L8DA 2KRNA 3EFRA 3CMAQ 4ZGEB 1XNIA 3MJXA 4IURA 1UHCA 4OGEA 4QQ6A 3CCQA 4KH0B 2AK5A 4OB3B 1RI9A 4M7DG 3BFMA 2QQRA 4PJMA 4J9DA 2BZXA 1Y7XA 4JPBW 3BDLA 3CCST 1TOVA 1QQJA 1U1TA 1JRIA 2JW4A 1H3ZA 1OX8A 1M1GA 1LJOA 2AHJB 2K5IA 2FL7A 3M54A 2V1RA 2HNIA 4XU3A 1UDLA 1VQMT 1OU8A 1GCQC 2EYWA 2AIRB 1VQNQ 2DA9A 2JUFA 4BE1A 1TSFA 4C8QC 1RAGB 4JRPA 1VQ7T 4C5EA 1D1BA 2A7YA 2VB6A 2AZSA 4F7UE 2KGTA 2RN8A 4M7AA 3CC7A 2DILA 1HYOA 1F1BB 3VV0A 2OTJQ 1MNDA 4A54A 4HT8A 5FU7B 2PNIA 1M90R 4RG2A 4M75D 2BTTA 3JCMc 1Y0MA 1KFZA 3L2UA 1UGPB 1RADB 3FJPA 1NYFA 4MZTA 4OP0A 3PTAA 1YWOA 5FRNA 3V7RA 4A4GA 3OYFA 2K3XA 2DTIA 2FZKB 3TQ7P 1M1KU 3S3NA 4HCZA 2DVEA 5ECAA 2LT4A 1FXXA 4XAXB 1VQPT 3VS4A 1V29B 1HD3A 2R58A 3OS0A 2QK0A 3CEYA 4XQ3A 2HL5C 5FU6B 3JCMb 2V8KA 4EMKA 3I56Q 3URGA 3RERA 1VQKQ 4UC4A 3PFSA 3CD6A 3KFVA 3CCQT 3UWNA 1VQ5A 4IUPA 2F2WA 2DZCA 1T3SA 2QA4Q 2RI5A 5I22A 2GF7A 4JRIA 3C12A 3VUZA 2ED1A 3NTIA 4C8QE 2EJ9A 4PJOA 3CCVA 5C6SA 2RI3A 2IIMA 4RG8A 1LVKA 4ANJA 3Q1JA 2RQWA 2XDBA 1GCPA 4Z89A 2RH2A 1ACMB 2JTFA 1IHWA 1MNEA 1M1FA 5CK9A 5GAOl 2IVWA 3CCUQ 4M7AC 2RQUA 4C0FA 2DF6A 1LPLA 3PIOA 3M0PA 2EIFA 5LJ5d 3ZBDA 4F7UG 1G5VA 2LDMA 1VIEA 2HQEA 3RMQA 1K0SA 4ATOA 1W4SA 4M78B 1NPPA 2NUPA 2VWFA 2HDAA 4OF1A 3CC7T 2ZGWA 4OVAA 3S6WA 1YHQA 1QP2A 5KYUA 3MP6A 2EGAA 1PKTA 2MOXA 4XTWA 2LNHB 3CC2A 5LJ3h 3CPWP 2BE7D 5KCOA 3UDCA 3VKIA 4JZ4A 3VS7A 4EMKC 5I21A 4ELYC 4C92B 2CP6A 1O9SA 1NEGA 5IHIA 2ROTA 1V1CA 5GAMh 1PD0A 2JTMA 3VUBA 1KC8R 4LD9K 1SKUB 4ZN3A 2GFUA 2O31A 2QQSA 3CPWA 2CZ1B 4BE0A 4B6MA 1N9SA 2XK0A 1VQ5T 1WHKA 5D6YA 2JMCA 1C0MA 3CCJA 3DKMA 4OMQA 2EVRA 4C8QG 1N8RC 3HTRA 4M7AE 3THKA 5FROA 3HRTA 2P4RA 1Y96A 3CCVT 1K8AC 4FSSA 3L2RA 2PVGB 3TEEA 2GQVA 2VXEA 3PMIA 2BZ8A 4DOWA 2AKLA 1JU5C 3OSSC 4TVRA 4BI3A 1VQ6Q 4OMMA 3JCMg 1JEGA 5KYWA 3M5AA 3RKXA 2KRMA 2EQIA 4YTLA 2KXCA 1BI2A 3PVLA 3GF5A 3MCAB 1MHNA 1YN8A 2D8HA 1N5ZA 2OX7A 2ECZA 3BY7A 2R57A 2P0KA 2GNCA 1TG0A 1X2QA 3H0IA 4HCCA 4IKFA 2HKNA 4M75B 1QP3A 1YHQT 3GBQA 4DQ2A 1PRMC 1KD1C 2NYSA 1M2OA 2AT1B 3EG1A 2DL5A 1XOVA 4OB0B 3J80E 2EQKA 4AG2C 1UEBA 3MEUA 3CCRA 2RPNA 2DYBA 4M4ZA 3J81E 2K7AA 3OS1A 1S72A 3EGDB 4AMCA 1GBQA 1PSFA 2LTOA 1SSFA 2D8JA 5IHKA 1EIFA 5LL6S 4XTVA 3G7ZA 1Q86C 3DLMA 1D09B 4M77D 3OYBA 4MDWA 3BDUA 2EYQA 1WHMA 1WXUA 2R5MA 2JTEA 2K3BA 2M51A 4CC7A 3CCJT 3FJ5A 4M7AG 1YITA 3M56A 2XIDA 1G8XA 1D3BB 4GLKA 2DPPB 1VQ7Q 4RKUE 5GAOm 3EFSA 2ZPEB 3QYGB 4J6XA 3CBOA 1DJ7B 3CPWS 5GAN3 5GAMg 3E19A 1K73R 2W10A 2ZZDA 2LQWA 1UECA 2EKHA 3SWNB 6AT1B 5LJ5j 1YI2A 3CMEA 1ZUKA 3A1PA 4Y92A 1M3AA 3PE0A 3CCLA 1WA7A 1ZSZC 1G3TA 1KG1A 4RTXA 2JVVA 2LZ6B 3JB9D 2YLCA 2I0NA 3REBB 4X9DA 5HKCA 1UJYA 4FL6A 3LW5E 2AZVA 2XDDA 1VQLA 3OYKA 1NJIC 2KDSA 1FMWA 4MDXA 4AFUC 3O5ZA 2PTKA 3HL8A 7AT1B 1TH7A 1AEYA 3TVTA 3JAME 3RKWA 2J7IA 4C8QF 4X34A 2QXFA 2LQ8A 1JXMA 3V7SA 2P0PA 4JS5A 1FMVA 1Q81R 2XD0A 1GRIA 3GNGA 4PJOG 3G4SA 2A36A 3MPUB 2KI7A 3CCRT 3CCQQ 1R0CB 3LWHA 2K57A 1JO8A 3M9QA 2G3RA 5GAN6 2RHZA 4J83A 2YWWA 2YRVA 3OMGA 2KRSA 1FWZA 5CCAA 2CP2A 1VQOA 3MEVA 2A0FB 2CYZB 1X6BA 3JCMP 1VYVA 5I2SA 1KK7A 2OJ2A 2X4XA 4ME7A 3CC4T 4X1VA 1QVPA 1X01A 1YITT 3QBYA 1B34A 4HCKA 1KQ1A 4E7SA 1OZ3A 1IREB 2RNAA 5C0MA 3JCMd 2MMPA 3NTHA 4A4HA 5GJVB 4J5YA 3CCEA 1ZA1B 2PVOB 4KUIA 3CBMA 2RHUA 4JJCA 5KYYA 2CGHA 2GCXA 3CC7Q 4F7UA 4JJDA 1AZEA 5CKBA 1YI2T 1FX7A 2KMTA 2SRCA 4J7IA 5LJ5e 3CCLT 1IO6A 2KT8A 2QYZA 1Z9QA 1SHGA 5CVIA 5DLQE 1T0JA 3QDFA 4CI0C 1VQLT 1PCXA 3FDRA 2LQKA 3CCMA 4PFPA 1QVFP 2XI9A 2KAFA 2BIVA 1SSHA 4XU1A 2SEMA 4HT9A 2RK1A 3JCMJ 4HVWA 1HK9A 3VRZA 1XTDA 1M8MA 5GMKh 3AT1B 1IZ6A 1RACB 3QZ5B 1OX9A 3QPHA 3G4ST 3M0TA 4CC3A 1X75C 1QVFA 1AD5A 1VQ5Q 5GANf 3OSVA 1LOJA 5HK3A 4KGVB 1LNXA 2KXDA 2M9UA 4PJLA 5D6XA 1M1KC 4C0DB 3MO8A 2X9HA 4DOVA 1H641 5LJ3d 2YLBA 3X25B 1GCQA 4M77B 2EWNA 1NJIU 3CCVQ 1AWJA 4AG1C 1VQOT 4A53A 2E4HA 2Z0WA 3WVDB 2XDPA 1CKAA 3QJYA 2CZ0B 2MI6A 2V1QA 3G71A 4C8QA 1UG1A 1UGQB 2NUTB 1GXIE 1QWFA 2EFIA 4KT0E 5GAMd 1QMCA 1K0XA 4AT1B 4FU6A 3OYNA 4II1A 2FEIA 5GAOr 4QKUA 3M57A 2PUKB 1Y57A 2L3RA 3V8JA 4DBQA 3JCMW 1I0CA 4Q5WA 1QW1A 3HFNA 3QO3A 2ROLA 4PFOA 3LH5A 1YHQQ 1JB0E 4OGCA 1NBEB 1X6OA 3JV3A 5A0DA 3EFOA 2DRKA 2XG8D 3E9FA 2FZGB 1VA7A 5FRMA 3L42A 1HXDA 3TU4K 1RAEB 1OI1A 3WVEB 4R0KA 4IUQA 1E6GA 2XMFA 1FYNA 2RM4A 3BW1A 5FWBA 4WTOB 1P92A 4CC4B 3R6OA 1M9SA 1NLOC 4IUVA 2Y4XA 8AT1B 2QTVA 2GTJA 1BI0A 1TXQA 2DFUA 2J6FA 3CCJQ 2LCLA 3JSCA 1R8OB 3C94A 2GBQA 2DE0X 1YJ9A 2O9SA 3A8GB 3QSUA 1V76A 1ZSGA 1OPKA 3DB3A 2HBPA 1PD1A 2RK2A 3G71T 2QI2A 5I2MA 3FEOA 1YIJA 1PKSA 1N8RR 1QVFS 2L0AA 2YXYA 4EIKA 1K8AR 3HSBA 1JJ2P 2RD1A 2X4JA 1ZUYA 4MMKA 2O4XA 2LQNA 1B3QA 1D0XA 1VOMA 4KGZB 4HCBA 2CSIA 2QQ9A 4QQGA 4M7DD 3ZEHA 1MUZA 4J9CA 1NLPC 4LUEA 3RKYA 2YT6A 2A3LA 2KEAA 4J9BA 2DO3A 2G6FX 4N4HA 2X4WA 4LUDA 1JJ2A 4PJOB 2LC4A 3C4SA 3MEWA 4JLIA 2QEXA 3LGFA 4X9CA 2DVJA 2RI2A 1SRMA 5CAIA 2DEQA 2QASA 3JCMh 1UJ0A 2E64A 1K4US 1I5OB 2RQRA 5GAOp 3CCRQ 2E5KA 2EAYA 2P0QA 1KD1R 4LDUA 2DETA 1ZQ1A 2DAQA 2KBTA 2LMJA 4J6YA 2DK3A 2FRWA 2NUPB 4ORZA 1ARKA 2PUOB 4JS4A 2K4YA 4QW2A 1K9MU 4JRKA 1OPLA 3VS6A 1M5Q1 3MP1A 5KYUB 3SEMA 3JB9H 5LJ3j 3CC4Q 3UA6A 3VS1A 1YITQ 3X24B 1Q86R 1YJ9T 4AFQC 4C0ZA 2LCCA 4Y28E 1RI0A 1B07A 1UGVA 3E9GA 1UHFA 5GAMj 2KNBB 2CP5A 1BK2A 5DY9A 5J26A 1YIJT 2V8IA 5KYXA 2WACA 3META 2EYXA 1VQ8Q 2EQUA 1J3TA 3RUXA 1RL2A 4QVCA 2LRQA 3H0FA 4F16A 1I8FA 1TTHB 1YI2Q 4JUVA 2D0QB 3G6EA 3KXTA 3CCLQ 2JNGA 2M1HA 4M75F 4FYYB 2FRYA 4FT2A 3S3OA 4QVDA 1SF9A 2E5QA 4CC2A 4A4EA 2JS0A 2QQAA 1VQLQ 3CMAA 2A08A 2L3QA 5HCKA 4C5HA 2QEXT 2Y90A 3LYIA 2FZCB 5FU7C 3RMSA 2WSCE 1WXBA 3GPLA 1Q82U 1BKBA 3BE3A 1UUEA 1ABOA 1U3OA 3M59A 4RTTA 1Z9ZA 1NJIR 3CD6T 3I35A 1M3BA 1GFCA 3G4SQ 3GP8A 2YUNA 2E70A 4PJNA 3VYGA 5KYWB 2VKNA 4MMLA 1JJ2S 2DJZA 2MIOA 1AVZC 1I07A 2EKOA 2QG9B 4J9EA 5CKHA 1Q7YR 2DRMA 1VQ9A 2E1HA 3M55A 1VQOQ 5FU6C 4EMGA 3DB4A 4ZN1A 4F17A 2QAZA 1N27A 1YFNA 3M4YA 1CSKA 4LE9A 3N5BB 4E7IA 2LJ0A 3RBBB 5IT9E 1CKBA 5LJ3e 2FG0A 2VUBA 3A8OB 4D6WA 3H6ZA 1YJWA 3LLRA 5GAMe 2RHYA 5GAN4 3ZFJA 2DKGA 1ZSZA 4PNOA 1SPKA 2LT1A 2JM8A 3X20B 2E10A 3GOXA 2K2VA 3OQ5A 4M7DB 1U5SA 3G6ET 3TCJA 2MAMA 4RUGA 2NLUA 2VXFA 3CC2T 3NPFA 4KULA 2JT4A 2RMOA 2QDLA 4BY6B 4VUBA 4C8QD 1ZX6A 4M78C 2K9GA 1T3LA 4B9WA 4J9GA 2E6NA 2L3SA 3E2UA 3CCSQ 1MMNA 3H8ZA 3MP8A 2CUDA 3UPUA 3DLLA 1PNJA 5CKFA 4OMLA 2LNVA 3ULRB 2EJGA 4L5GA 2RQTA 1RAAB 2E3IA 1UGSB 1VQMQ 1IB8A 2HBWA 4DA4A 4LDYA 5GANh 1VYUA 4M75A 3M0SA 1OYXA 3QDRB 4E7KA 2KR3A 3GIBA 4LD6A 2AKKA 1O75A 4EMHA 4C92C 1BU1A 3OYMA 1K1ZA 3HRUA 2MCNA 4O5VA 1NPRA 1ZBJA 1VQ9T 4Y91A 3UATA 3EGXB 3M58A 4OMNA 2K79A 3GNFB 3CCUA 3REAB 4ZTJA 2BKDN 4GBQA 3G71Q 3EH1A 4DBRA 2RF0A 3EGDA 2X3WD 3OYIA 3LGLA 3I55A 1M1KR 1IXDA 2CSQA 2L5QA 1Q95G 1W2BP 1MMAA 1MV3A 1BI3A 1PHTA 3FB9A 2KY9A 4JDSA 1QVGP 5I11A 1YJWT 1YCYA 1YBYA 4ZTFA 4N0AA 4E6RA 1WNLA 4M78E 2ZPFB 3OYLA 1W2BA 1D3BA 3OYGA 1VQPQ 4LN2A 2EYYA 1KC8C 5LJ3f 4XTZA 2KQWA 8ATCB 2GQIA 2DXCA 4KH1B 1MMDA 3PNWC 4M7AD 4EDUA 5CR2A 2VGNA 3AHUA 2COZA 3OYDA 1S72T 1W1FA 1WDXA 4E2FB 1B34B 2QDYB 3V7CA 5D6WA 1G2BA 4OMFB 4A4FA 3JCMX 4M75C 4C92E 4WF2A 5GAN8 1BI1A 2J06A 2ATCB 1U06A 1VUBA 4LDWA 3G1JA 5KYYB 2E41A 2FYKA 4OMPA 2YHTA 4F7UB 2RB6A 2OTLA 1D1AA 1U1SA 3PGGA 1YNZA 4D8DA 4RTUA 1D1CA 1GFDA 4B9XA 3MHXA 2MWPA 1B7TA 2DBMA 1WQWA 2O2OA 4NOYA 1WX6A 5KCHA 3CXCP 1YJ9Q 2DL4A 1EFNA 3X28B 4NL3A 2KSSA 4R55A 2DXBA 3F70A 5KE2A 2COWA 1ZBXA 4DEXA 4E47A 5GMKj 2CS7A 1YIJQ 3I55T 5DM7R 3KBGA 4FYXB 4FSXA 1T0HA 4N0AC 3CMET 2V26A 4HXJA 3CXCA 2RHIA 1S1NA 2W0ZA 4PJOD 2H3EB 5GANg 1X6GA 1AHJB 2XICA 3M0RA 1RLQC 2CH4W 1YJNA 2RHXA 2ENMA 4QT7A 2DX1A 3JB9F 3H0HA 4M78G 1D0YA 5GMKi 1TUGB 2LX9A 3HFOA 2DL7A 1QCOA 1ZUUA 4DBHA 2VGMA 1M2VA 3QYHB 3KUFA 2OAWA 1YP5A 3SWNC 2QEXQ 1EZZB 4M75E 3LWIA 4C8QB 3NTKA 2ABLA 5KE3A 1UTIA 3VS3A 3CD6Q 3QZ9B 2DTOA 2HD0A 4WCIA 2JN0A 3UT1A 2IG0A 1W2BS 4C92G 3EG9A 2D1XA 2LJ3A 3MKDA 1QVGS 4XU0A 2E3HA 2D0NA 5J39A 3NGPA 1AWXA 1WHLA 3A8MB 5AT1B 2HQXA 1RAIB 4JZ3A 2EW3A 2OTLT 3EH2A 1KC8U 2YUQA 1M8VA 2MK5A 4IIOA 4AFZC 2E6ZA 2M02A 1KQSP 2MYSA 2HAXA 1PSEA 1VQ4A 3CCET 2M0YA 2QTXA 2ED0A 3I9QA 1G3WA 4FCYA 1JXOA 4RTVA 2EGCA 1W6XA 1G3SA 1SHFA 4KGXB 2MWOA 4E7LA 3QWXX 1KQSA 2J6OA 3SB2A 3J7AF 5GMKe 1K9MC 1KHCA 2DM1A 5EC7A 2DJQA 2C0TA 3H9NA 3UA7A 1Q81C 3OY9A 2DYIA 4OMOA 3CC2Q 2CREA 1YJNT 2NUTA 1I81A 3OBWA 2EPDA 2EGEA 2F5TX 3CCMT 3M0UA 1TUDA 4BD3A 1WJRA 5AYFA 3ASKA 4L59A 4D8KA 2HZYA 3OYJA 2I2LA 4M75G 3CXCS 5LJ5f 1IGQA 5J3BA 2MF2A 4M7AB 4ZGJB 1TWBA 3ME9A 5HK0A 2CP7A 2LX7A 1SEMA 5FWCA 2O01E 2GGRA 1Y07A 4L6V5 5L8RE 4R56A 2BE9B 2F1LA 2GFAA 4O6JA 4A4KA 1H92A 1WHJA 1OULA 2O4XB 1TS9A 2ZCFB 2DL3A 3JRZA 2DBKA 2K2MA 1G83A 2P84A 1SRLA 1VQ9Q 1MMGA 5GMKm 1TUCA 1Q82C 2ZPIB 4XTUA 1WHGA 2RA2A 3QWYA 3LX7A 4C0GA 4M78F 2EYZA 4BDYA 1UGRB 2VASA 4EMKB 2KYBA 4ZGDB 2R5AA 4AFSC 4C0DC 5HY6A 2HSPA 1VQ4T 3HPWA 5GANd 1RABB 4RTZA 4M77C 2E12A 3QUIA 2FVUA 1YJWQ 4DBFA 2RO0A 2K3YA 4A63B 2DD4A 3JB9J 3VRYA 1I4K1 2QGFB 1GBRA 5DLOA 2BUDA 2JMAA 1K73U 1AOJA 2VVKA 1RUWA 2YUOA 2EJFA 3TSZA 2H8HA 4C92F 2PU9B 4DEYA 4NL2A 3CPFA 1NYGA 1N6AA 3SHWA 3ZL7C 2DIQA 3OYEA 4MZMA 3RDVA 4LDVA 3I5SA 1AZGB 1G3YA 1X27A 5IHNA 2F2VA 1S72Q 1NZ9A 1QLYA 1KQSS 4MZPA 4J7FA 2CP3A 1U8RA 2YRDA 1OV3A 4IIMA 3HP9A 2JS2A 4F04B 2GTOA 3EGUA 1RAHB 5KYXB 2ZAEA 3VJPA 1OEBA 1H8KA 2EQJA 2FO0A 3RR6A 2ZPBB 3EG3A 2K5LA 2RQVA 1JBMA 1Q81U 4PJJA 2HL3A 1WGSA 2L3PA 2OI3A 3A8HB 1ZA2B 1WFWA 4OB1B 2XU8A 2F5KA 2DEUA 2DERA 4PFZA 4M77E 2QGGA 3GLXA 2L89A 4C5IA 3P8BB 4ESRA 4E7ZA 4PK4A 1RAFB 2K5FA 1UE9A 2ZPGB 5CKEA 3I55Q 1PWTA 2EBPA 4QVZA 3INZA 3CMEQ 3JCMe 1VIFA 2L2PA 3M53A 5IXBA 1M4ZA 2FPEA 4HA8A 1WJSA 4PL6A 2CKKA 3OS5A 2Y4YA 2ESWA 1BIBA 4Z8AA 2JM9A 1IGUA 5A2QE 4M7DF 1HJDA 5GJWB 3O8VA 4FW1A 3OW2P 1Y96B 4ZNXA 1NM7A 1WZOA 3A98A 1VYTA 1IRXA 3JB9I 4JRQA 4JJBA 4M78A 3OYCA 3TREA 1WXTA 1WHHA 2KK4A 4LNPA 3RNJA 2IPOB 1X43A 3OW2A 3QJ6A 3OS2A 2F69A 3S3MA 9ATCB 3VS0A 4OB2B 2CT4A 1E6HA 3H41A 3VU3C 1WYXA 3CBPA 1QKXA 2CDTA 4PJOC 3QXEB 1VQNA 2PVDB 3EHQA 1YWPA
chains in the Genus database with same CATH topology
1WNLA 2YLBA 4M78E 3X25B 3OYFA 4M77B 2EWNA 1NJIU 2ZPFB 4C92A 2K3XA 3OYLA 1D3BA 1W2BA 2DTIA 3OYGA 1M1KU 3PIPA 1VQOT 4A53A 3S3NA 4HCZA 2DVEA 3WVDB 2LT4A 1FXXA 2XDPA 3QJYA 2CZ0B 2MI6A 1KC8C 3G71A 4C8QA 5LJ3f 4XAXB 4XTZA 1M90C 1VQPT 1UGQB 2KQWA 1GXIE 1V29B 5GAN7 2EFIA 4KT0E 4Z02A 2R58A 5GAMd 1WPYA 3OS0A 3CEYA 2DXCA 4XQ3A 5FU6B 3PNWC 4M7AD 4EDUA 2E65A 5CR2A 2VGNA 3AHUA 3JCMb 2V8KA 3QKJA 4FU6A 4EMKA 3JCMQ 3URGA 4II1A 3OYNA 3OYDA 3JCMV 1S72T 3RERA 4E7HA 2OTJA 4M77G 1B34B 4UC4A 2QDYB 3PFSA 3CD6A 3SD4A 3CCQT 5GAOr 3UWNA 1VQ5A 3V7CA 5D6WA 4IUPA 4OMFB 2XKOC 2DZCA 4A4FA 3JCMX 3RESA 2QQBA 3M57A 5M9OA 3PT9A 4M75C 2RI5A 4C92E 2PUKB 2GF7A 2L3RA 4JRIA 1BI1A 3C12A 4WF2A 3V8JA 3VUZA 5GAN8 3JCMW 1VUBA 4LDWA 3NTIA 4C8QE 3LH0A 2EJ9A 4Q5WA 4PJOA 3CCVA 1QW1A 5GANj 3HFNA 4J8OA 3QO3A 4KBMB 5C6SA 2E41A 2FYKA 2RI3A 4BI8B 2YHTA 4F7UB 2RB6A 5FLXE 2OTLA 4RG8A 1U1SA 1JB0E 3PGGA 3Q1JA 4OGCA 2XDBA 2VYTA 1X6OA 2RH2A 2JTFA 5A0DA 4B9XA 3MHXA 2MWPA 3A8LB 4J6WA 2XG8D 3E9FA 4RCCA 1M1FA 5CK9A 3CMAT 1WQWA 5FRMA 3L42A 4NOYA 5KCHA 1HXDA 2IVWA 2V8JA 5GAOl 3I56A 4M7AC 4C0FA 3X28B 4NL3A 3TU4K 1VQKA 2KSSA 3M4GA 4R55A 3PIOA 2DXBA 2EIFA 1OI1A 3F70A 3WVEB 2DXTA 3ZBDA 3JCMf 3X26B 4F7UG 5KE2A 5LJ5d 4IUQA 4HKEA 2LDMA 1G5VA 4PJOE 1ZBXA 2QA4A 1VIEA 2HQEA 4E47A 3RMQA 2CS7A 5A0LA 5GMKj 3JB9G 4ATOA 3I55T 4JLGA 5DM7R 1W4SA 2D9TA 3KBGA 4M78B 1NPPA 2CZ7B 2RM4A 2WSEE 3BW1A 1P92A 2JZ2A 4FSXA 4OF1A 4N0AC 3CMET 3CC7T 4BUGA 2X4YA 2RHIA 3E1SA 3CXCA 3R6OA 3V8KA 1M9SA 2ZGWA 5GANg 3P8DA 4OVAA 3S6WA 4JJNK 4P5NA 4PJOD 1AHJB 4IUVA 1YHQA 2Y4XA 1QP2A 2XICA 4LDXA 1BI0A 4IUTA 3MP6A 4M7DA 1YJNA 2RHXA 4ELZC 4F7UF 3FC3A 4XTWA 2LCLA 1VQNT 3JSCA 3JB9F 1R8OB 4M78G 3C94A 3CC2A 3WXMB 1YJ9A 5GMKi 5LJ3h 2LX9A 3HFOA 5CKDA 5KCOA 3CC4A 3UDCA 3A8GB 3VKIA 5LJ3g 2VGMA 3QSUA 4QQDA 3QYHB 5CO7A 3DB3A 4EMKC 3KUFA 3QG1A 2HBPA 5I21A 4ELYC 4C92B 3OW2S 5GAOq 3SWNC 1O9SA 2RK2A 3G71T 2VC8A 2QI2A 2RJEA 4KUDK 4M75E 5I2MA 3FEOA 1YIJA 3LWIA 5GAMh 4C8QB 5GAN2 3NTKA 1QVFS 2JTMA 2M16A 3VUBA 5KE3A 4LD9K 4ZN3A 2GFUA 3A5ZB 3QZ9B 2QQSA 4IUUA 3CPWA 2DTOA 2HD0A 3HSBA 2CZ1B 2PQWA 2OTJT 2RD1A 2JN0A 4BE0A 1VQ8A 2X4JA 3MEAA 4MMKA 2O4XA 1N9SA 3UT1A 4HCBA 2XK0A 1VQ5T 2IG0A 1ZHIA 2RJDA 5D6YA 1W2BS 2QQ9A 4C92G 4QQGA 3V8LA 1I5LA 4M7DD 2RJCA 3ZEHA 3CCJA 3DKMA 5CQXA 1N9RA 4C8QG 1N8RC 2WSFE 3RKYA 2DTHA 1QVGS 2A3LA 4XU0A 4M7AE 5FROA 3HRTA 2X35A 5KH6A 1Y96A 4NS5A 5J39A 3OYAA 3CCVT 2DO3A 1QVGA 3A8MB 4XU2A 4N4HA 2X4WA 2HQXA 1K8AC 1N8RU 1JJ2A 3OYHA 4PJOB 2LC4A 3C4SA 3MEWA 4JLIA 2OTLT 2QEXA 4C5GA 3LGFA 4X9CA 2PVGB 3TEEA 5GANe 3L2RA 1KC8U 2C06A 2GQVA 2VXEA 4RMOA 1M90U 4CRIA 1K8AU 2RI2A 1M8VA 3PMIA 4N4IA 2E6ZA 4PLLA 4DOWA 5CAIA 2DEQA 5GAMf 3SWNA 3OSSC 4TVRA 1OZ2A 4PKCC 3JCMh 4BI3A 1KQ2A 5IAYA 2HAXA 3ER0A 1PSEA 3JCMg 3I56T 1BIAA 1NE8A 1VQ4A 3M5AA 3CCET 2E64A 2CZ6B 1WJQA 2QTXA 1VQKT 3RKXA 1G3WA 5GAOp 4YTLA 5LJ5h 3EAEA 2EAYA 1BI2A 2P0QA 1BYMA 4LDUA 3GF5A 1ZQ1A 1G3SA 1Q7YC 2QA4T 3MCAB 1MHNA 2B8AA 4M7DC 2DAQA 2MWOA 4E7LA 1KQSA 4J6YA 3SB2A 4BDZA 3J7AF 2DK3A 5GMKe 3BY7A 2XHCA 1K9MC 2R57A 1KHCA 3PMTA 2DIGA 4M77F 2P0KA 4BY6C 2PUOB 4HCCA 4IKFA 3HRSA 4M75B 3P8HA 4JS4A 3HHTB 1QP3A 2KVQG 1YHQT 2K4YA 4DQ2A 4QW2A 3VYHB 1Q81C 1WQ7A 1K9MU 3OY9A 4JRKA 1M5Q1 5GMKl 1YJNT 1KD1C 3MP1A 3JB9H 5LJ3j 1I81A 3L2ZA 3L2VA 3OA6A 3L2WA 1XOVA 3OBWA 2F5TX 2D6FA 4FM4B 3CCMT 3X24B 4XTXA 1VQ6A 4OB0B 3J80E 3CCUT 1YJ9T 1KD1U 4BACA 2EQKA 3OB9A 4BD3A 1UEBA 3OYYA 1WJRA 4C0ZA 3MEUA 2LCCA 3ASKA 5AYFA 4Y28E 3CCRA 3J81E 4L59A 1RI0A 3L2QA 4N4GA 3T9NA 3OYJA 3OS1A 3E9GA 2I2LA 4M75G 5GAMj 3CXCS 5LJ5f 1S72A 2P4TA 3L1AA 1PSFA 2MF2A 5J3BA 5DY9A 5J26A 1YIJT 3C95A 4M7AB 2LTOA 1SSFA 4ZGJB 2V8IA 2WACA 3META 3FIFA 3ME9A 2LVMA 5HK0A 5CQYA 2O01E 1Y07A 1EIFA 4L6V5 2EQUA 5L8RE 4R56A 5LL6S 3RUXA 1RL2A 4XTVA 1Y71A 2LRQA 3G7ZA 4QVCA 1Q86C 1I8FA 3DLMA 1VQ8T 2DZ9A 4M77D 2FHDA 2GFAA 2D0QB 4JUVA 4O6JA 3G6EA 4A4KA 3OYBA 4MDWA 3KXTA 2JNGA 2O4XB 1Q86U 3BDUA 2M1HA 2EYQA 3QHSA 2R5MA 2ZCFB 4FT2A 4M75F 3S3OA 3CCJT 4QVDA 2E5QA 4M7AG 5A0GA 1KHIA 2DD5A 3M56A 3JRZA 1YITA 4A4EA 2XIDA 1XQHA 2QQAA 3SFMA 1D3BB 4GLKA 2DPPB 4RKUE 3CMAA 5GAOm 3EFSA 5GMKm 1Q82C 2ZPIB 2ZPEB 3QYGB 4J6XA 4XTUA 4XK8E 4BI4A 3CBOA 5IN1A 4C5HA 1DJ7B 3CPWS 5GAN3 2RA2A 5GAMg 2Y90A 2QEXT 3LYIA 3LX7A 4C0GA 3E19A 5FU7C 3RMSA 2WSCE 3GPLA 4M7DE 1Q82U 1BKBA 3CCSA 2ZZDA 4E7JA 4M78F 3SDZA 3M59A 3OMCA 3FRNA 4BDYA 1UGRB 4EMKB 3CD6T 4BB7A 4ZGDB 2R5AA 4M7AF 5LJ5j 3SWNB 2ZPHB 4C0DC 1YI2A 4FT4A 5HY6A 3GP8A 1VQ4T 3HPWA 2E70A 3VYGA 3CMEA 5GANd 2JOYA 4M77C 2H3JA 3RIRA 4A4GA 2E12A 5EG2A 1VQMA 2OAUA 3QUIA 3CCLA 2FVUA 3FLGA 4MMLA 1G3TA 1KG1A 2RO0A 2K3YA 1JJ2S 2DJZA 2JVVA 3JB9D 1YI2T 2YLCA 1K73C 2DD4A 4X9DA 5HKCA 4BE2A 2FB7A 3OBYA 3JB9J 3NFCA 4FL6A 2EKOA 3LW5E 1I4K1 2XDDA 1VQLA 3OYKA 1NJIC 1VQ7A 5CKHA 2RJFA 5DLOA 2KDSA 2BUDA 3QIIA 5GAN5 1VQ9A 1K73U 2E1HA 3M55A 4MDXA 5FU6C 2EJFA 5CIUA 5GAOn 4EMGA 3DB4A 3HL8A 4C92F 4PLIA 2PU9B 4NL2A 4ZN1A 1TH7A 3JAME 3RKWA 1N27A 3CPFA 1MGQA 3M4YA 4C8QF 4X34A 2QXFA 1N6AA 2LQ8A 2DIQA 3OYEA 3V7SA 4MZMA 2P0PA 1UB4A 4FIBA 4JS5A 4LDVA 2DXUA 3N5BB 4M78D 1G3YA 4E7IA 2XD0A 3GNGA 4PJOG 1VQ6T 3G4SA 5IT9E 5LJ3e 4XTYA 5LJ5g 1NZ9A 2VUBA 3A8OB 4D6WA 1KQSS 3CCRT 4MZPA 3LWHA 4J7FA 2K57A 4V2SA 3H6ZA 1YJWA 3LLRA 3M9QA 1U8RA 4EPCA 2G3RA 1Q7YU 3HP9A 5GAN6 2RHZA 4J83A 2EQMA 2M0OA 2RHYA 4M77A 2YRVA 5GAMe 3OMGA 5GAN4 3ZFJA 2DKGA 3HKSA 4PNOA 1FWZA 3VJPA 5CCAA 2LT1A 3X20B 1VQOA 2E10A 2VV5A 3GOXA 2EQJA 3MEVA 2K2VA 4PJOF 2CYZB 4RCBA 3JCMP 2ZPBB 3OQ5A 4M7DB 2K5LA 4GY5A 1JBMA 3G6ET 1VQPA 1Q81U 3TCJA 2MAMA 2NLUA 2VXFA 5I2SA 4C92D 3CC2T 2L8DA 4KULA 1WGSA 2X4XA 4ME7A 3CC4T 1QVPA 4BY6B 4VUBA 3EFRA 1X01A 3A8HB 4C8QD 1YITT 3QBYA 1B34A 1XNIA 4ZGEB 1KQ1A 4M78C 4B9WA 1OZ3A 1IREB 4IURA 4OGEA 4QQ6A 4OB1B 5C0MA 3JCMd 2XU8A 2E6NA 2F5KA 2MMPA 3CCQA 4M77E 3NTHA 4A4HA 4OB3B 3GLXA 3H8ZA 2L89A 4J5YA 2PVOB 4C5IA 3BFMA 3P8BB 3CCEA 4M7DG 4KUIA 2QQRA 3CBMA 2RHUA 3MP8A 2K5FA 1Y7XA 2ZPGB 5CKEA 3BDLA 3CCST 3UPUA 3DLLA 5CKFA 2CGHA 4QVZA 2LNVA 3INZA 1U1TA 2GCXA 2EJGA 4L5GA 1JRIA 4F7UA 3JCMe 1H3ZA 1VIFA 3M53A 1UGSB 1M1GA 1LJOA 2AHJB 1FX7A 2K5IA 5CKBA 2FL7A 4DA4A 3M54A 1M4ZA 4LDYA 2HNIA 4HA8A 2KMTA 4XU3A 1WJSA 5GANh 4J7IA 4PL6A 2CKKA 4M75A 5LJ5e 3OS5A 1OYXA 3QDRB 4E7KA 3CCLT 1VQMT 2Y4YA 3GIBA 1BIBA 4LD6A 1O75A 4EMHA 4C92C 5A2QE 3OYMA 4M7DF 3O8VA 3HRUA 2JUFA 5CVIA 4O5VA 1Y96B 4BE1A 1NPRA 5DLQE 4C8QC 4CI0C 4JRPA 1VQLT 3FDRA 1VQ7T 1VQ9T 4Y91A 2LQKA 3CCMA 4C5EA 3JB9I 3M58A 3GNFB 2XI9A 2KAFA 2BIVA 3CCUA 4JRQA 4ZTJA 2A7YA 4XU1A 2BKDN 4M78A 4F7UE 3OYCA 4HT9A 2RK1A 3OYIA 3LGLA 3I55A 3TREA 3JCMJ 1HK9A 2KK4A 1XTDA 4M7AA 2L5QA 5GMKh 3CC7A 1IZ6A 3OW2A 3QZ5B 3VV0A 3QJ6A 3QPHA 3OS2A 3G4ST 2F69A 4A54A 4HT8A 1BI3A 3S3MA 5FU7B 4OB2B 1X75C 1QVFA 3FB9A 2KY9A 4JDSA 3VU3C 3CBPA 4RG2A 5GANf 3OSVA 4M75D 1YJWT 1LOJA 1YCYA 3JCMc 5HK3A 4PJOC 3L2UA 1LNXA 1YBYA 1UGPB 2M9UA 3QXEB 4N0AA 3FJPA 5D6XA 4ZTFA 1M1KC 1VQNA 2PVDB 4MZTA 4OP0A 4C0DB 3PTAA 3MO8A 5FRNA 3V7RA 4DOVA 1H641 5LJ3d
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QDR B; 
#chains in the Genus database with same CATH topology
 2YUP A;  4C92 A;  2NWM A;  1UFF A;  1ZSZ B;  2DMO A;  2HQH A;  3PIP A;  1KJW A;  2OTL Q;  3C0C A;  1M30 A;  1H3H A;  1M90 C;  4KRT A;  1GL5 A;  4F14 A;  5GAN 7;  1K9A A;  4Z02 A;  1WPY A;  2YDL A;  2O88 A;  2E65 A;  3QKJ A;  3JCM Q;  2OTJ A;  3JCM V;  3CCE Q;  4E7H A;  4M77 G;  3SD4 A;  2XKO C;  3RES A;  2QQB A;  5M9O A;  3PT9 A;  4RTW A;  1AWW A;  1NEB A;  3LH0 A;  5GAN j;  4J8O A;  4KBM B;  4Z88 A;  4BI8 B;  5FLX E;  1QCN A;  4J9F A;  1QKW A;  1KIK A;  2VYT A;  1YJN Q;  3A8L B;  4J6W A;  4RCC A;  2YRC A;  3CMA T;  3CCM Q;  2V8J A;  3I56 A;  1VQK A;  3M4G A;  1LCK A;  2DXT A;  3X26 B;  3JCM f;  5FW9 A;  1M3C A;  4HKE A;  4PJO E;  2C0O A;  2QA4 A;  5A0L A;  3JB9 G;  2JXB A;  4JLG A;  2O9V A;  2D9T A;  1NG2 A;  1SG5 A;  2CZ7 B;  2WSE E;  2JZ2 A;  1QCF A;  4BUG A;  2X4Y A;  3E1S A;  3V8K A;  4JJN K;  3P8D A;  4LXC A;  4P5N A;  2YSQ A;  4LDX A;  4IUT A;  4M7D A;  1ZLM A;  2MPX C;  3U23 A;  2FPD A;  4ELZ C;  4F7U F;  3FC3 A;  1RLP C;  2NUZ A;  1D0Z A;  1VQN T;  1X69 A;  3WXM B;  5CKD A;  3CC4 A;  4FYW B;  5LJ3 g;  4QQD A;  1QWE A;  2KRO A;  5IXF A;  5CO7 A;  3QG1 A;  3OW2 S;  5GAO q;  1OU9 A;  2VC8 A;  2RJE A;  4KUD K;  1R0B G;  1K76 A;  2X3X D;  5GAN 2;  2CH4 A;  2CP0 A;  2M16 A;  1FMK A;  1TU0 B;  1BCO A;  3A5Z B;  1PM3 A;  2HMA A;  4IUU A;  3TSW A;  2PQW A;  2OTJ T;  2HKQ B;  1VQ4 Q;  1VQ8 A;  3MEA A;  1ZHI A;  2RJD A;  2JJ9 A;  3NMZ C;  3V8L A;  1I5L A;  2RJC A;  5D7U A;  1WIE A;  5CQX A;  1EX4 A;  1N9R A;  1W70 A;  1C6V X;  2WSF E;  2DTH A;  1PG5 B;  5KH6 A;  2X35 A;  3OYA A;  4NS5 A;  1JQQ A;  4XU2 A;  1QVG A;  1N8R U;  3OYH A;  3EGX A;  4C5G A;  2C06 A;  5GAN e;  1IHV A;  2A37 A;  3PVQ A;  1BB9 A;  2HEQ A;  4RMO A;  4CRI A;  1K8A U;  1M90 U;  4N4I A;  4PLL A;  5GAM f;  3SWN A;  1KQ2 A;  1OZ2 A;  4PKC C;  1K9M R;  5IAY A;  3ER0 A;  1X2K A;  3I56 T;  1BIA A;  1NE8 A;  3EG2 A;  1A0N B;  2CZ6 B;  1WJQ A;  1VQK T;  5LJ5 h;  3M0Q A;  3EAE A;  1BYM A;  2F2X A;  1BCM A;  1Q7Y C;  2QA4 T;  2B8A A;  4M7D C;  2HCK A;  4BDZ A;  1PRL C;  2DL8 A;  2XHC A;  3PMT A;  2DIG A;  4M77 F;  2PZ1 A;  4BY6 C;  3CQT A;  3HRS A;  1AT1 B;  3P8H A;  3HHT B;  2KVQ G;  3VYH B;  4HVU A;  1WQ7 A;  5GMK l;  1MV0 B;  1YCS B;  2J6K A;  3L2Z A;  3L2V A;  3OA6 A;  3L2W A;  2D6F A;  4FM4 B;  1M27 C;  1VQ6 A;  4XTX A;  4J9I A;  3CCU T;  1KD1 U;  4BAC A;  3OB9 A;  2KE9 A;  3OYY A;  1BBZ A;  3L2Q A;  2KT1 A;  4N4G A;  3T9N A;  1M2V B;  2P4T A;  3L1A A;  5KYN A;  3C95 A;  3EG0 A;  3FIF A;  2LVM A;  2HSE B;  5CQY A;  1XJW B;  1PC0 A;  1Y71 A;  1Q82 R;  2BZY A;  1VQ8 T;  2DZ9 A;  3VS5 A;  2FHD A;  3UF4 A;  4FW2 A;  4RTY A;  2COY A;  1Q86 U;  3QHS A;  4K11 A;  3EG9 B;  5A0G A;  1KHI A;  2DD5 A;  1XQH A;  1R77 A;  1HSQ A;  3SFM A;  2K6D A;  2CT3 A;  4XK8 E;  4BI4 A;  5IN1 A;  4M7D E;  5L23 A;  3CCS A;  4E7J A;  3SDZ A;  3OMC A;  4FYV B;  3FRN A;  2C0I A;  2B86 A;  2LCS A;  4BB7 A;  2A28 A;  4M7A F;  2ZPH B;  1WI7 A;  4FT4 A;  1E7O A;  5IH2 A;  2J05 A;  2JOY A;  2H3J A;  3RIR A;  1VQM A;  5EG2 A;  2OAU A;  3FLG A;  1I1J A;  1K73 C;  3R6N A;  4BE2 A;  2FB7 A;  3OBY A;  3NFC A;  2CUB A;  1C1A A;  1VQ7 A;  2RJF A;  5GAN 5;  3QII A;  2DNU A;  2X51 A;  5CIU A;  5GAO n;  1ABQ A;  4PLI A;  1AWO A;  3VS2 A;  3EFO B;  4J9H A;  1MGQ A;  1OQK A;  1OOT A;  1UB4 A;  4FIB A;  2DXU A;  4M78 D;  2LP5 A;  1VQ6 T;  4XTY A;  5LJ5 g;  1KSW A;  3IQL A;  3NHN A;  4V2S A;  4EPC A;  3I5R A;  1Q7Y U;  4HVV A;  2EQM A;  2M0O A;  4M77 A;  3HKS A;  3EHR A;  3G6E Q;  2VV5 A;  2KYM A;  4PJO F;  3D7S B;  4RCB A;  2FPF A;  2DLP A;  4GY5 A;  1VQP A;  2LJ1 A;  4C92 D;  4GLM A;  1WLP B;  2L8D A;  2KRN A;  3EFR A;  3CMA Q;  4ZGE B;  1XNI A;  3MJX A;  4IUR A;  1UHC A;  4OGE A;  4QQ6 A;  3CCQ A;  4KH0 B;  2AK5 A;  4OB3 B;  1RI9 A;  4M7D G;  3BFM A;  2QQR A;  4PJM A;  4J9D A;  2BZX A;  1Y7X A;  4JPB W;  3BDL A;  3CCS T;  1TOV A;  1QQJ A;  1U1T A;  1JRI A;  2JW4 A;  1H3Z A;  1OX8 A;  1M1G A;  1LJO A;  2AHJ B;  2K5I A;  2FL7 A;  3M54 A;  2V1R A;  2HNI A;  4XU3 A;  1UDL A;  1VQM T;  1OU8 A;  1GCQ C;  2EYW A;  2AIR B;  1VQN Q;  2DA9 A;  2JUF A;  4BE1 A;  1TSF A;  4C8Q C;  1RAG B;  4JRP A;  1VQ7 T;  4C5E A;  1D1B A;  2A7Y A;  2VB6 A;  2AZS A;  4F7U E;  2KGT A;  2RN8 A;  4M7A A;  3CC7 A;  2DIL A;  1HYO A;  1F1B B;  3VV0 A;  2OTJ Q;  1MND A;  4A54 A;  4HT8 A;  5FU7 B;  2PNI A;  1M90 R;  4RG2 A;  4M75 D;  2BTT A;  3JCM c;  1Y0M A;  1KFZ A;  3L2U A;  1UGP B;  1RAD B;  3FJP A;  1NYF A;  4MZT A;  4OP0 A;  3PTA A;  1YWO A;  5FRN A;  3V7R A;  4A4G A;  3OYF A;  2K3X A;  2DTI A;  2FZK B;  3TQ7 P;  1M1K U;  3S3N A;  4HCZ A;  2DVE A;  5ECA A;  2LT4 A;  1FXX A;  4XAX B;  1VQP T;  3VS4 A;  1V29 B;  1HD3 A;  2R58 A;  3OS0 A;  2QK0 A;  3CEY A;  4XQ3 A;  2HL5 C;  5FU6 B;  3JCM b;  2V8K A;  4EMK A;  3I56 Q;  3URG A;  3RER A;  1VQK Q;  4UC4 A;  3PFS A;  3CD6 A;  3KFV A;  3CCQ T;  3UWN A;  1VQ5 A;  4IUP A;  2F2W A;  2DZC A;  1T3S A;  2QA4 Q;  2RI5 A;  5I22 A;  2GF7 A;  4JRI A;  3C12 A;  3VUZ A;  2ED1 A;  3NTI A;  4C8Q E;  2EJ9 A;  4PJO A;  3CCV A;  5C6S A;  2RI3 A;  2IIM A;  4RG8 A;  1LVK A;  4ANJ A;  3Q1J A;  2RQW A;  2XDB A;  1GCP A;  4Z89 A;  2RH2 A;  1ACM B;  2JTF A;  1IHW A;  1MNE A;  1M1F A;  5CK9 A;  5GAO l;  2IVW A;  3CCU Q;  4M7A C;  2RQU A;  4C0F A;  2DF6 A;  1LPL A;  3PIO A;  3M0P A;  2EIF A;  5LJ5 d;  3ZBD A;  4F7U G;  1G5V A;  2LDM A;  1VIE A;  2HQE A;  3RMQ A;  1K0S A;  4ATO A;  1W4S A;  4M78 B;  1NPP A;  2NUP A;  2VWF A;  2HDA A;  4OF1 A;  3CC7 T;  2ZGW A;  4OVA A;  3S6W A;  1YHQ A;  1QP2 A;  5KYU A;  3MP6 A;  2EGA A;  1PKT A;  2MOX A;  4XTW A;  2LNH B;  3CC2 A;  5LJ3 h;  3CPW P;  2BE7 D;  5KCO A;  3UDC A;  3VKI A;  4JZ4 A;  3VS7 A;  4EMK C;  5I21 A;  4ELY C;  4C92 B;  2CP6 A;  1O9S A;  1NEG A;  5IHI A;  2ROT A;  1V1C A;  5GAM h;  1PD0 A;  2JTM A;  3VUB A;  1KC8 R;  4LD9 K;  1SKU B;  4ZN3 A;  2GFU A;  2O31 A;  2QQS A;  3CPW A;  2CZ1 B;  4BE0 A;  4B6M A;  1N9S A;  2XK0 A;  1VQ5 T;  1WHK A;  5D6Y A;  2JMC A;  1C0M A;  3CCJ A;  3DKM A;  4OMQ A;  2EVR A;  4C8Q G;  1N8R C;  3HTR A;  4M7A E;  3THK A;  5FRO A;  3HRT A;  2P4R A;  1Y96 A;  3CCV T;  1K8A C;  4FSS A;  3L2R A;  2PVG B;  3TEE A;  2GQV A;  2VXE A;  3PMI A;  2BZ8 A;  4DOW A;  2AKL A;  1JU5 C;  3OSS C;  4TVR A;  4BI3 A;  1VQ6 Q;  4OMM A;  3JCM g;  1JEG A;  5KYW A;  3M5A A;  3RKX A;  2KRM A;  2EQI A;  4YTL A;  2KXC A;  1BI2 A;  3PVL A;  3GF5 A;  3MCA B;  1MHN A;  1YN8 A;  2D8H A;  1N5Z A;  2OX7 A;  2ECZ A;  3BY7 A;  2R57 A;  2P0K A;  2GNC A;  1TG0 A;  1X2Q A;  3H0I A;  4HCC A;  4IKF A;  2HKN A;  4M75 B;  1QP3 A;  1YHQ T;  3GBQ A;  4DQ2 A;  1PRM C;  1KD1 C;  2NYS A;  1M2O A;  2AT1 B;  3EG1 A;  2DL5 A;  1XOV A;  4OB0 B;  3J80 E;  2EQK A;  4AG2 C;  1UEB A;  3MEU A;  3CCR A;  2RPN A;  2DYB A;  4M4Z A;  3J81 E;  2K7A A;  3OS1 A;  1S72 A;  3EGD B;  4AMC A;  1GBQ A;  1PSF A;  2LTO A;  1SSF A;  2D8J A;  5IHK A;  1EIF A;  5LL6 S;  4XTV A;  3G7Z A;  1Q86 C;  3DLM A;  1D09 B;  4M77 D;  3OYB A;  4MDW A;  3BDU A;  2EYQ A;  1WHM A;  1WXU A;  2R5M A;  2JTE A;  2K3B A;  2M51 A;  4CC7 A;  3CCJ T;  3FJ5 A;  4M7A G;  1YIT A;  3M56 A;  2XID A;  1G8X A;  1D3B B;  4GLK A;  2DPP B;  1VQ7 Q;  4RKU E;  5GAO m;  3EFS A;  2ZPE B;  3QYG B;  4J6X A;  3CBO A;  1DJ7 B;  3CPW S;  5GAN 3;  5GAM g;  3E19 A;  1K73 R;  2W10 A;  2ZZD A;  2LQW A;  1UEC A;  2EKH A;  3SWN B;  6AT1 B;  5LJ5 j;  1YI2 A;  3CME A;  1ZUK A;  3A1P A;  4Y92 A;  1M3A A;  3PE0 A;  3CCL A;  1WA7 A;  1ZSZ C;  1G3T A;  1KG1 A;  4RTX A;  2JVV A;  2LZ6 B;  3JB9 D;  2YLC A;  2I0N A;  3REB B;  4X9D A;  5HKC A;  1UJY A;  4FL6 A;  3LW5 E;  2AZV A;  2XDD A;  1VQL A;  3OYK A;  1NJI C;  2KDS A;  1FMW A;  4MDX A;  4AFU C;  3O5Z A;  2PTK A;  3HL8 A;  7AT1 B;  1TH7 A;  1AEY A;  3TVT A;  3JAM E;  3RKW A;  2J7I A;  4C8Q F;  4X34 A;  2QXF A;  2LQ8 A;  1JXM A;  3V7S A;  2P0P A;  4JS5 A;  1FMV A;  1Q81 R;  2XD0 A;  1GRI A;  3GNG A;  4PJO G;  3G4S A;  2A36 A;  3MPU B;  2KI7 A;  3CCR T;  3CCQ Q;  1R0C B;  3LWH A;  2K57 A;  1JO8 A;  3M9Q A;  2G3R A;  5GAN 6;  2RHZ A;  4J83 A;  2YWW A;  2YRV A;  3OMG A;  2KRS A;  1FWZ A;  5CCA A;  2CP2 A;  1VQO A;  3MEV A;  2A0F B;  2CYZ B;  1X6B A;  3JCM P;  1VYV A;  5I2S A;  1KK7 A;  2OJ2 A;  2X4X A;  4ME7 A;  3CC4 T;  4X1V A;  1QVP A;  1X01 A;  1YIT T;  3QBY A;  1B34 A;  4HCK A;  1KQ1 A;  4E7S A;  1OZ3 A;  1IRE B;  2RNA A;  5C0M A;  3JCM d;  2MMP A;  3NTH A;  4A4H A;  5GJV B;  4J5Y A;  3CCE A;  1ZA1 B;  2PVO B;  4KUI A;  3CBM A;  2RHU A;  4JJC A;  5KYY A;  2CGH A;  2GCX A;  3CC7 Q;  4F7U A;  4JJD A;  1AZE A;  5CKB A;  1YI2 T;  1FX7 A;  2KMT A;  2SRC A;  4J7I A;  5LJ5 e;  3CCL T;  1IO6 A;  2KT8 A;  2QYZ A;  1Z9Q A;  1SHG A;  5CVI A;  5DLQ E;  1T0J A;  3QDF A;  4CI0 C;  1VQL T;  1PCX A;  3FDR A;  2LQK A;  3CCM A;  4PFP A;  1QVF P;  2XI9 A;  2KAF A;  2BIV A;  1SSH A;  4XU1 A;  2SEM A;  4HT9 A;  2RK1 A;  3JCM J;  4HVW A;  1HK9 A;  3VRZ A;  1XTD A;  1M8M A;  5GMK h;  3AT1 B;  1IZ6 A;  1RAC B;  3QZ5 B;  1OX9 A;  3QPH A;  3G4S T;  3M0T A;  4CC3 A;  1X75 C;  1QVF A;  1AD5 A;  1VQ5 Q;  5GAN f;  3OSV A;  1LOJ A;  5HK3 A;  4KGV B;  1LNX A;  2KXD A;  2M9U A;  4PJL A;  5D6X A;  1M1K C;  4C0D B;  3MO8 A;  2X9H A;  4DOV A;  1H64 1;  5LJ3 d;  2YLB A;  3X25 B;  1GCQ A;  4M77 B;  2EWN A;  1NJI U;  3CCV Q;  1AWJ A;  4AG1 C;  1VQO T;  4A53 A;  2E4H A;  2Z0W A;  3WVD B;  2XDP A;  1CKA A;  3QJY A;  2CZ0 B;  2MI6 A;  2V1Q A;  3G71 A;  4C8Q A;  1UG1 A;  1UGQ B;  2NUT B;  1GXI E;  1QWF A;  2EFI A;  4KT0 E;  5GAM d;  1QMC A;  1K0X A;  4AT1 B;  4FU6 A;  3OYN A;  4II1 A;  2FEI A;  5GAO r;  4QKU A;  3M57 A;  2PUK B;  1Y57 A;  2L3R A;  3V8J A;  4DBQ A;  3JCM W;  1I0C A;  4Q5W A;  1QW1 A;  3HFN A;  3QO3 A;  2ROL A;  4PFO A;  3LH5 A;  1YHQ Q;  1JB0 E;  4OGC A;  1NBE B;  1X6O A;  3JV3 A;  5A0D A;  3EFO A;  2DRK A;  2XG8 D;  3E9F A;  2FZG B;  1VA7 A;  5FRM A;  3L42 A;  1HXD A;  3TU4 K;  1RAE B;  1OI1 A;  3WVE B;  4R0K A;  4IUQ A;  1E6G A;  2XMF A;  1FYN A;  2RM4 A;  3BW1 A;  5FWB A;  4WTO B;  1P92 A;  4CC4 B;  3R6O A;  1M9S A;  1NLO C;  4IUV A;  2Y4X A;  8AT1 B;  2QTV A;  2GTJ A;  1BI0 A;  1TXQ A;  2DFU A;  2J6F A;  3CCJ Q;  2LCL A;  3JSC A;  1R8O B;  3C94 A;  2GBQ A;  2DE0 X;  1YJ9 A;  2O9S A;  3A8G B;  3QSU A;  1V76 A;  1ZSG A;  1OPK A;  3DB3 A;  2HBP A;  1PD1 A;  2RK2 A;  3G71 T;  2QI2 A;  5I2M A;  3FEO A;  1YIJ A;  1PKS A;  1N8R R;  1QVF S;  2L0A A;  2YXY A;  4EIK A;  1K8A R;  3HSB A;  1JJ2 P;  2RD1 A;  2X4J A;  1ZUY A;  4MMK A;  2O4X A;  2LQN A;  1B3Q A;  1D0X A;  1VOM A;  4KGZ B;  4HCB A;  2CSI A;  2QQ9 A;  4QQG A;  4M7D D;  3ZEH A;  1MUZ A;  4J9C A;  1NLP C;  4LUE A;  3RKY A;  2YT6 A;  2A3L A;  2KEA A;  4J9B A;  2DO3 A;  2G6F X;  4N4H A;  2X4W A;  4LUD A;  1JJ2 A;  4PJO B;  2LC4 A;  3C4S A;  3MEW A;  4JLI A;  2QEX A;  3LGF A;  4X9C A;  2DVJ A;  2RI2 A;  1SRM A;  5CAI A;  2DEQ A;  2QAS A;  3JCM h;  1UJ0 A;  2E64 A;  1K4U S;  1I5O B;  2RQR A;  5GAO p;  3CCR Q;  2E5K A;  2EAY A;  2P0Q A;  1KD1 R;  4LDU A;  2DET A;  1ZQ1 A;  2DAQ A;  2KBT A;  2LMJ A;  4J6Y A;  2DK3 A;  2FRW A;  2NUP B;  4ORZ A;  1ARK A;  2PUO B;  4JS4 A;  2K4Y A;  4QW2 A;  1K9M U;  4JRK A;  1OPL A;  3VS6 A;  1M5Q 1;  3MP1 A;  5KYU B;  3SEM A;  3JB9 H;  5LJ3 j;  3CC4 Q;  3UA6 A;  3VS1 A;  1YIT Q;  3X24 B;  1Q86 R;  1YJ9 T;  4AFQ C;  4C0Z A;  2LCC A;  4Y28 E;  1RI0 A;  1B07 A;  1UGV A;  3E9G A;  1UHF A;  5GAM j;  2KNB B;  2CP5 A;  1BK2 A;  5DY9 A;  5J26 A;  1YIJ T;  2V8I A;  5KYX A;  2WAC A;  3MET A;  2EYX A;  1VQ8 Q;  2EQU A;  1J3T A;  3RUX A;  1RL2 A;  4QVC A;  2LRQ A;  3H0F A;  4F16 A;  1I8F A;  1TTH B;  1YI2 Q;  4JUV A;  2D0Q B;  3G6E A;  3KXT A;  3CCL Q;  2JNG A;  2M1H A;  4M75 F;  4FYY B;  2FRY A;  4FT2 A;  3S3O A;  4QVD A;  1SF9 A;  2E5Q A;  4CC2 A;  4A4E A;  2JS0 A;  2QQA A;  1VQL Q;  3CMA A;  2A08 A;  2L3Q A;  5HCK A;  4C5H A;  2QEX T;  2Y90 A;  3LYI A;  2FZC B;  5FU7 C;  3RMS A;  2WSC E;  1WXB A;  3GPL A;  1Q82 U;  1BKB A;  3BE3 A;  1UUE A;  1ABO A;  1U3O A;  3M59 A;  4RTT A;  1Z9Z A;  1NJI R;  3CD6 T;  3I35 A;  1M3B A;  1GFC A;  3G4S Q;  3GP8 A;  2YUN A;  2E70 A;  4PJN A;  3VYG A;  5KYW B;  2VKN A;  4MML A;  1JJ2 S;  2DJZ A;  2MIO A;  1AVZ C;  1I07 A;  2EKO A;  2QG9 B;  4J9E A;  5CKH A;  1Q7Y R;  2DRM A;  1VQ9 A;  2E1H A;  3M55 A;  1VQO Q;  5FU6 C;  4EMG A;  3DB4 A;  4ZN1 A;  4F17 A;  2QAZ A;  1N27 A;  1YFN A;  3M4Y A;  1CSK A;  4LE9 A;  3N5B B;  4E7I A;  2LJ0 A;  3RBB B;  5IT9 E;  1CKB A;  5LJ3 e;  2FG0 A;  2VUB A;  3A8O B;  4D6W A;  3H6Z A;  1YJW A;  3LLR A;  5GAM e;  2RHY A;  5GAN 4;  3ZFJ A;  2DKG A;  1ZSZ A;  4PNO A;  1SPK A;  2LT1 A;  2JM8 A;  3X20 B;  2E10 A;  3GOX A;  2K2V A;  3OQ5 A;  4M7D B;  1U5S A;  3G6E T;  3TCJ A;  2MAM A;  4RUG A;  2NLU A;  2VXF A;  3CC2 T;  3NPF A;  4KUL A;  2JT4 A;  2RMO A;  2QDL A;  4BY6 B;  4VUB A;  4C8Q D;  1ZX6 A;  4M78 C;  2K9G A;  1T3L A;  4B9W A;  4J9G A;  2E6N A;  2L3S A;  3E2U A;  3CCS Q;  1MMN A;  3H8Z A;  3MP8 A;  2CUD A;  3UPU A;  3DLL A;  1PNJ A;  5CKF A;  4OML A;  2LNV A;  3ULR B;  2EJG A;  4L5G A;  2RQT A;  1RAA B;  2E3I A;  1UGS B;  1VQM Q;  1IB8 A;  2HBW A;  4DA4 A;  4LDY A;  5GAN h;  1VYU A;  4M75 A;  3M0S A;  1OYX A;  3QDR B;  4E7K A;  2KR3 A;  3GIB A;  4LD6 A;  2AKK A;  1O75 A;  4EMH A;  4C92 C;  1BU1 A;  3OYM A;  1K1Z A;  3HRU A;  2MCN A;  4O5V A;  1NPR A;  1ZBJ A;  1VQ9 T;  4Y91 A;  3UAT A;  3EGX B;  3M58 A;  4OMN A;  2K79 A;  3GNF B;  3CCU A;  3REA B;  4ZTJ A;  2BKD N;  4GBQ A;  3G71 Q;  3EH1 A;  4DBR A;  2RF0 A;  3EGD A;  2X3W D;  3OYI A;  3LGL A;  3I55 A;  1M1K R;  1IXD A;  2CSQ A;  2L5Q A;  1Q95 G;  1W2B P;  1MMA A;  1MV3 A;  1BI3 A;  1PHT A;  3FB9 A;  2KY9 A;  4JDS A;  1QVG P;  5I11 A;  1YJW T;  1YCY A;  1YBY A;  4ZTF A;  4N0A A;  4E6R A;  1WNL A;  4M78 E;  2ZPF B;  3OYL A;  1W2B A;  1D3B A;  3OYG A;  1VQP Q;  4LN2 A;  2EYY A;  1KC8 C;  5LJ3 f;  4XTZ A;  2KQW A;  8ATC B;  2GQI A;  2DXC A;  4KH1 B;  1MMD A;  3PNW C;  4M7A D;  4EDU A;  5CR2 A;  2VGN A;  3AHU A;  2COZ A;  3OYD A;  1S72 T;  1W1F A;  1WDX A;  4E2F B;  1B34 B;  2QDY B;  3V7C A;  5D6W A;  1G2B A;  4OMF B;  4A4F A;  3JCM X;  4M75 C;  4C92 E;  4WF2 A;  5GAN 8;  1BI1 A;  2J06 A;  2ATC B;  1U06 A;  1VUB A;  4LDW A;  3G1J A;  5KYY B;  2E41 A;  2FYK A;  4OMP A;  2YHT A;  4F7U B;  2RB6 A;  2OTL A;  1D1A A;  1U1S A;  3PGG A;  1YNZ A;  4D8D A;  4RTU A;  1D1C A;  1GFD A;  4B9X A;  3MHX A;  2MWP A;  1B7T A;  2DBM A;  1WQW A;  2O2O A;  4NOY A;  1WX6 A;  5KCH A;  3CXC P;  1YJ9 Q;  2DL4 A;  1EFN A;  3X28 B;  4NL3 A;  2KSS A;  4R55 A;  2DXB A;  3F70 A;  5KE2 A;  2COW A;  1ZBX A;  4DEX A;  4E47 A;  5GMK j;  2CS7 A;  1YIJ Q;  3I55 T;  5DM7 R;  3KBG A;  4FYX B;  4FSX A;  1T0H A;  4N0A C;  3CME T;  2V26 A;  4HXJ A;  3CXC A;  2RHI A;  1S1N A;  2W0Z A;  4PJO D;  2H3E B;  5GAN g;  1X6G A;  1AHJ B;  2XIC A;  3M0R A;  1RLQ C;  2CH4 W;  1YJN A;  2RHX A;  2ENM A;  4QT7 A;  2DX1 A;  3JB9 F;  3H0H A;  4M78 G;  1D0Y A;  5GMK i;  1TUG B;  2LX9 A;  3HFO A;  2DL7 A;  1QCO A;  1ZUU A;  4DBH A;  2VGM A;  1M2V A;  3QYH B;  3KUF A;  2OAW A;  1YP5 A;  3SWN C;  2QEX Q;  1EZZ B;  4M75 E;  3LWI A;  4C8Q B;  3NTK A;  2ABL A;  5KE3 A;  1UTI A;  3VS3 A;  3CD6 Q;  3QZ9 B;  2DTO A;  2HD0 A;  4WCI A;  2JN0 A;  3UT1 A;  2IG0 A;  1W2B S;  4C92 G;  3EG9 A;  2D1X A;  2LJ3 A;  3MKD A;  1QVG S;  4XU0 A;  2E3H A;  2D0N A;  5J39 A;  3NGP A;  1AWX A;  1WHL A;  3A8M B;  5AT1 B;  2HQX A;  1RAI B;  4JZ3 A;  2EW3 A;  2OTL T;  3EH2 A;  1KC8 U;  2YUQ A;  1M8V A;  2MK5 A;  4IIO A;  4AFZ C;  2E6Z A;  2M02 A;  1KQS P;  2MYS A;  2HAX A;  1PSE A;  1VQ4 A;  3CCE T;  2M0Y A;  2QTX A;  2ED0 A;  3I9Q A;  1G3W A;  4FCY A;  1JXO A;  4RTV A;  2EGC A;  1W6X A;  1G3S A;  1SHF A;  4KGX B;  2MWO A;  4E7L A;  3QWX X;  1KQS A;  2J6O A;  3SB2 A;  3J7A F;  5GMK e;  1K9M C;  1KHC A;  2DM1 A;  5EC7 A;  2DJQ A;  2C0T A;  3H9N A;  3UA7 A;  1Q81 C;  3OY9 A;  2DYI A;  4OMO A;  3CC2 Q;  2CRE A;  1YJN T;  2NUT A;  1I81 A;  3OBW A;  2EPD A;  2EGE A;  2F5T X;  3CCM T;  3M0U A;  1TUD A;  4BD3 A;  1WJR A;  5AYF A;  3ASK A;  4L59 A;  4D8K A;  2HZY A;  3OYJ A;  2I2L A;  4M75 G;  3CXC S;  5LJ5 f;  1IGQ A;  5J3B A;  2MF2 A;  4M7A B;  4ZGJ B;  1TWB A;  3ME9 A;  5HK0 A;  2CP7 A;  2LX7 A;  1SEM A;  5FWC A;  2O01 E;  2GGR A;  1Y07 A;  4L6V 5;  5L8R E;  4R56 A;  2BE9 B;  2F1L A;  2GFA A;  4O6J A;  4A4K A;  1H92 A;  1WHJ A;  1OUL A;  2O4X B;  1TS9 A;  2ZCF B;  2DL3 A;  3JRZ A;  2DBK A;  2K2M A;  1G83 A;  2P84 A;  1SRL A;  1VQ9 Q;  1MMG A;  5GMK m;  1TUC A;  1Q82 C;  2ZPI B;  4XTU A;  1WHG A;  2RA2 A;  3QWY A;  3LX7 A;  4C0G A;  4M78 F;  2EYZ A;  4BDY A;  1UGR B;  2VAS A;  4EMK B;  2KYB A;  4ZGD B;  2R5A A;  4AFS C;  4C0D C;  5HY6 A;  2HSP A;  1VQ4 T;  3HPW A;  5GAN d;  1RAB B;  4RTZ A;  4M77 C;  2E12 A;  3QUI A;  2FVU A;  1YJW Q;  4DBF A;  2RO0 A;  2K3Y A;  4A63 B;  2DD4 A;  3JB9 J;  3VRY A;  1I4K 1;  2QGF B;  1GBR A;  5DLO A;  2BUD A;  2JMA A;  1K73 U;  1AOJ A;  2VVK A;  1RUW A;  2YUO A;  2EJF A;  3TSZ A;  2H8H A;  4C92 F;  2PU9 B;  4DEY A;  4NL2 A;  3CPF A;  1NYG A;  1N6A A;  3SHW A;  3ZL7 C;  2DIQ A;  3OYE A;  4MZM A;  3RDV A;  4LDV A;  3I5S A;  1AZG B;  1G3Y A;  1X27 A;  5IHN A;  2F2V A;  1S72 Q;  1NZ9 A;  1QLY A;  1KQS S;  4MZP A;  4J7F A;  2CP3 A;  1U8R A;  2YRD A;  1OV3 A;  4IIM A;  3HP9 A;  2JS2 A;  4F04 B;  2GTO A;  3EGU A;  1RAH B;  5KYX B;  2ZAE A;  3VJP A;  1OEB A;  1H8K A;  2EQJ A;  2FO0 A;  3RR6 A;  2ZPB B;  3EG3 A;  2K5L A;  2RQV A;  1JBM A;  1Q81 U;  4PJJ A;  2HL3 A;  1WGS A;  2L3P A;  2OI3 A;  3A8H B;  1ZA2 B;  1WFW A;  4OB1 B;  2XU8 A;  2F5K A;  2DEU A;  2DER A;  4PFZ A;  4M77 E;  2QGG A;  3GLX A;  2L89 A;  4C5I A;  3P8B B;  4ESR A;  4E7Z A;  4PK4 A;  1RAF B;  2K5F A;  1UE9 A;  2ZPG B;  5CKE A;  3I55 Q;  1PWT A;  2EBP A;  4QVZ A;  3INZ A;  3CME Q;  3JCM e;  1VIF A;  2L2P A;  3M53 A;  5IXB A;  1M4Z A;  2FPE A;  4HA8 A;  1WJS A;  4PL6 A;  2CKK A;  3OS5 A;  2Y4Y A;  2ESW A;  1BIB A;  4Z8A A;  2JM9 A;  1IGU A;  5A2Q E;  4M7D F;  1HJD A;  5GJW B;  3O8V A;  4FW1 A;  3OW2 P;  1Y96 B;  4ZNX A;  1NM7 A;  1WZO A;  3A98 A;  1VYT A;  1IRX A;  3JB9 I;  4JRQ A;  4JJB A;  4M78 A;  3OYC A;  3TRE A;  1WXT A;  1WHH A;  2KK4 A;  4LNP A;  3RNJ A;  2IPO B;  1X43 A;  3OW2 A;  3QJ6 A;  3OS2 A;  2F69 A;  3S3M A;  9ATC B;  3VS0 A;  4OB2 B;  2CT4 A;  1E6H A;  3H41 A;  3VU3 C;  1WYX A;  3CBP A;  1QKX A;  2CDT A;  4PJO C;  3QXE B;  1VQN A;  2PVD B;  3EHQ A;  1YWP A; 
#chains in the Genus database with same CATH homology
 1WNL A;  2YLB A;  4M78 E;  3X25 B;  3OYF A;  4M77 B;  2EWN A;  1NJI U;  2ZPF B;  4C92 A;  2K3X A;  3OYL A;  1D3B A;  1W2B A;  2DTI A;  3OYG A;  1M1K U;  3PIP A;  1VQO T;  4A53 A;  3S3N A;  4HCZ A;  2DVE A;  3WVD B;  2LT4 A;  1FXX A;  2XDP A;  3QJY A;  2CZ0 B;  2MI6 A;  1KC8 C;  3G71 A;  4C8Q A;  5LJ3 f;  4XAX B;  4XTZ A;  1M90 C;  1VQP T;  1UGQ B;  2KQW A;  1GXI E;  1V29 B;  5GAN 7;  2EFI A;  4KT0 E;  4Z02 A;  2R58 A;  5GAM d;  1WPY A;  3OS0 A;  3CEY A;  2DXC A;  4XQ3 A;  5FU6 B;  3PNW C;  4M7A D;  4EDU A;  2E65 A;  5CR2 A;  2VGN A;  3AHU A;  3JCM b;  2V8K A;  3QKJ A;  4FU6 A;  4EMK A;  3JCM Q;  3URG A;  4II1 A;  3OYN A;  3OYD A;  3JCM V;  1S72 T;  3RER A;  4E7H A;  2OTJ A;  4M77 G;  1B34 B;  4UC4 A;  2QDY B;  3PFS A;  3CD6 A;  3SD4 A;  3CCQ T;  5GAO r;  3UWN A;  1VQ5 A;  3V7C A;  5D6W A;  4IUP A;  4OMF B;  2XKO C;  2DZC A;  4A4F A;  3JCM X;  3RES A;  2QQB A;  3M57 A;  5M9O A;  3PT9 A;  4M75 C;  2RI5 A;  4C92 E;  2PUK B;  2GF7 A;  2L3R A;  4JRI A;  1BI1 A;  3C12 A;  4WF2 A;  3V8J A;  3VUZ A;  5GAN 8;  3JCM W;  1VUB A;  4LDW A;  3NTI A;  4C8Q E;  3LH0 A;  2EJ9 A;  4Q5W A;  4PJO A;  3CCV A;  1QW1 A;  5GAN j;  3HFN A;  4J8O A;  3QO3 A;  4KBM B;  5C6S A;  2E41 A;  2FYK A;  2RI3 A;  4BI8 B;  2YHT A;  4F7U B;  2RB6 A;  5FLX E;  2OTL A;  4RG8 A;  1U1S A;  1JB0 E;  3PGG A;  3Q1J A;  4OGC A;  2XDB A;  2VYT A;  1X6O A;  2RH2 A;  2JTF A;  5A0D A;  4B9X A;  3MHX A;  2MWP A;  3A8L B;  4J6W A;  2XG8 D;  3E9F A;  4RCC A;  1M1F A;  5CK9 A;  3CMA T;  1WQW A;  5FRM A;  3L42 A;  4NOY A;  5KCH A;  1HXD A;  2IVW A;  2V8J A;  5GAO l;  3I56 A;  4M7A C;  4C0F A;  3X28 B;  4NL3 A;  3TU4 K;  1VQK A;  2KSS A;  3M4G A;  4R55 A;  3PIO A;  2DXB A;  2EIF A;  1OI1 A;  3F70 A;  3WVE B;  2DXT A;  3ZBD A;  3JCM f;  3X26 B;  4F7U G;  5KE2 A;  5LJ5 d;  4IUQ A;  4HKE A;  2LDM A;  1G5V A;  4PJO E;  1ZBX A;  2QA4 A;  1VIE A;  2HQE A;  4E47 A;  3RMQ A;  2CS7 A;  5A0L A;  5GMK j;  3JB9 G;  4ATO A;  3I55 T;  4JLG A;  5DM7 R;  1W4S A;  2D9T A;  3KBG A;  4M78 B;  1NPP A;  2CZ7 B;  2RM4 A;  2WSE E;  3BW1 A;  1P92 A;  2JZ2 A;  4FSX A;  4OF1 A;  4N0A C;  3CME T;  3CC7 T;  4BUG A;  2X4Y A;  2RHI A;  3E1S A;  3CXC A;  3R6O A;  3V8K A;  1M9S A;  2ZGW A;  5GAN g;  3P8D A;  4OVA A;  3S6W A;  4JJN K;  4P5N A;  4PJO D;  1AHJ B;  4IUV A;  1YHQ A;  2Y4X A;  1QP2 A;  2XIC A;  4LDX A;  1BI0 A;  4IUT A;  3MP6 A;  4M7D A;  1YJN A;  2RHX A;  4ELZ C;  4F7U F;  3FC3 A;  4XTW A;  2LCL A;  1VQN T;  3JSC A;  3JB9 F;  1R8O B;  4M78 G;  3C94 A;  3CC2 A;  3WXM B;  1YJ9 A;  5GMK i;  5LJ3 h;  2LX9 A;  3HFO A;  5CKD A;  5KCO A;  3CC4 A;  3UDC A;  3A8G B;  3VKI A;  5LJ3 g;  2VGM A;  3QSU A;  4QQD A;  3QYH B;  5CO7 A;  3DB3 A;  4EMK C;  3KUF A;  3QG1 A;  2HBP A;  5I21 A;  4ELY C;  4C92 B;  3OW2 S;  5GAO q;  3SWN C;  1O9S A;  2RK2 A;  3G71 T;  2VC8 A;  2QI2 A;  2RJE A;  4KUD K;  4M75 E;  5I2M A;  3FEO A;  1YIJ A;  3LWI A;  5GAM h;  4C8Q B;  5GAN 2;  3NTK A;  1QVF S;  2JTM A;  2M16 A;  3VUB A;  5KE3 A;  4LD9 K;  4ZN3 A;  2GFU A;  3A5Z B;  3QZ9 B;  2QQS A;  4IUU A;  3CPW A;  2DTO A;  2HD0 A;  3HSB A;  2CZ1 B;  2PQW A;  2OTJ T;  2RD1 A;  2JN0 A;  4BE0 A;  1VQ8 A;  2X4J A;  3MEA A;  4MMK A;  2O4X A;  1N9S A;  3UT1 A;  4HCB A;  2XK0 A;  1VQ5 T;  2IG0 A;  1ZHI A;  2RJD A;  5D6Y A;  1W2B S;  2QQ9 A;  4C92 G;  4QQG A;  3V8L A;  1I5L A;  4M7D D;  2RJC A;  3ZEH A;  3CCJ A;  3DKM A;  5CQX A;  1N9R A;  4C8Q G;  1N8R C;  2WSF E;  3RKY A;  2DTH A;  1QVG S;  2A3L A;  4XU0 A;  4M7A E;  5FRO A;  3HRT A;  2X35 A;  5KH6 A;  1Y96 A;  4NS5 A;  5J39 A;  3OYA A;  3CCV T;  2DO3 A;  1QVG A;  3A8M B;  4XU2 A;  4N4H A;  2X4W A;  2HQX A;  1K8A C;  1N8R U;  1JJ2 A;  3OYH A;  4PJO B;  2LC4 A;  3C4S A;  3MEW A;  4JLI A;  2OTL T;  2QEX A;  4C5G A;  3LGF A;  4X9C A;  2PVG B;  3TEE A;  5GAN e;  3L2R A;  1KC8 U;  2C06 A;  2GQV A;  2VXE A;  4RMO A;  1M90 U;  4CRI A;  1K8A U;  2RI2 A;  1M8V A;  3PMI A;  4N4I A;  2E6Z A;  4PLL A;  4DOW A;  5CAI A;  2DEQ A;  5GAM f;  3SWN A;  3OSS C;  4TVR A;  1OZ2 A;  4PKC C;  3JCM h;  4BI3 A;  1KQ2 A;  5IAY A;  2HAX A;  3ER0 A;  1PSE A;  3JCM g;  3I56 T;  1BIA A;  1NE8 A;  1VQ4 A;  3M5A A;  3CCE T;  2E64 A;  2CZ6 B;  1WJQ A;  2QTX A;  1VQK T;  3RKX A;  1G3W A;  5GAO p;  4YTL A;  5LJ5 h;  3EAE A;  2EAY A;  1BI2 A;  2P0Q A;  1BYM A;  4LDU A;  3GF5 A;  1ZQ1 A;  1G3S A;  1Q7Y C;  2QA4 T;  3MCA B;  1MHN A;  2B8A A;  4M7D C;  2DAQ A;  2MWO A;  4E7L A;  1KQS A;  4J6Y A;  3SB2 A;  4BDZ A;  3J7A F;  2DK3 A;  5GMK e;  3BY7 A;  2XHC A;  1K9M C;  2R57 A;  1KHC A;  3PMT A;  2DIG A;  4M77 F;  2P0K A;  4BY6 C;  2PUO B;  4HCC A;  4IKF A;  3HRS A;  4M75 B;  3P8H A;  4JS4 A;  3HHT B;  1QP3 A;  2KVQ G;  1YHQ T;  2K4Y A;  4DQ2 A;  4QW2 A;  3VYH B;  1Q81 C;  1WQ7 A;  1K9M U;  3OY9 A;  4JRK A;  1M5Q 1;  5GMK l;  1YJN T;  1KD1 C;  3MP1 A;  3JB9 H;  5LJ3 j;  1I81 A;  3L2Z A;  3L2V A;  3OA6 A;  3L2W A;  1XOV A;  3OBW A;  2F5T X;  2D6F A;  4FM4 B;  3CCM T;  3X24 B;  4XTX A;  1VQ6 A;  4OB0 B;  3J80 E;  3CCU T;  1YJ9 T;  1KD1 U;  4BAC A;  2EQK A;  3OB9 A;  4BD3 A;  1UEB A;  3OYY A;  1WJR A;  4C0Z A;  3MEU A;  2LCC A;  3ASK A;  5AYF A;  4Y28 E;  3CCR A;  3J81 E;  4L59 A;  1RI0 A;  3L2Q A;  4N4G A;  3T9N A;  3OYJ A;  3OS1 A;  3E9G A;  2I2L A;  4M75 G;  5GAM j;  3CXC S;  5LJ5 f;  1S72 A;  2P4T A;  3L1A A;  1PSF A;  2MF2 A;  5J3B A;  5DY9 A;  5J26 A;  1YIJ T;  3C95 A;  4M7A B;  2LTO A;  1SSF A;  4ZGJ B;  2V8I A;  2WAC A;  3MET A;  3FIF A;  3ME9 A;  2LVM A;  5HK0 A;  5CQY A;  2O01 E;  1Y07 A;  1EIF A;  4L6V 5;  2EQU A;  5L8R E;  4R56 A;  5LL6 S;  3RUX A;  1RL2 A;  4XTV A;  1Y71 A;  2LRQ A;  3G7Z A;  4QVC A;  1Q86 C;  1I8F A;  3DLM A;  1VQ8 T;  2DZ9 A;  4M77 D;  2FHD A;  2GFA A;  2D0Q B;  4JUV A;  4O6J A;  3G6E A;  4A4K A;  3OYB A;  4MDW A;  3KXT A;  2JNG A;  2O4X B;  1Q86 U;  3BDU A;  2M1H A;  2EYQ A;  3QHS A;  2R5M A;  2ZCF B;  4FT2 A;  4M75 F;  3S3O A;  3CCJ T;  4QVD A;  2E5Q A;  4M7A G;  5A0G A;  1KHI A;  2DD5 A;  3M56 A;  3JRZ A;  1YIT A;  4A4E A;  2XID A;  1XQH A;  2QQA A;  3SFM A;  1D3B B;  4GLK A;  2DPP B;  4RKU E;  3CMA A;  5GAO m;  3EFS A;  5GMK m;  1Q82 C;  2ZPI B;  2ZPE B;  3QYG B;  4J6X A;  4XTU A;  4XK8 E;  4BI4 A;  3CBO A;  5IN1 A;  4C5H A;  1DJ7 B;  3CPW S;  5GAN 3;  2RA2 A;  5GAM g;  2Y90 A;  2QEX T;  3LYI A;  3LX7 A;  4C0G A;  3E19 A;  5FU7 C;  3RMS A;  2WSC E;  3GPL A;  4M7D E;  1Q82 U;  1BKB A;  3CCS A;  2ZZD A;  4E7J A;  4M78 F;  3SDZ A;  3M59 A;  3OMC A;  3FRN A;  4BDY A;  1UGR B;  4EMK B;  3CD6 T;  4BB7 A;  4ZGD B;  2R5A A;  4M7A F;  5LJ5 j;  3SWN B;  2ZPH B;  4C0D C;  1YI2 A;  4FT4 A;  5HY6 A;  3GP8 A;  1VQ4 T;  3HPW A;  2E70 A;  3VYG A;  3CME A;  5GAN d;  2JOY A;  4M77 C;  2H3J A;  3RIR A;  4A4G A;  2E12 A;  5EG2 A;  1VQM A;  2OAU A;  3QUI A;  3CCL A;  2FVU A;  3FLG A;  4MML A;  1G3T A;  1KG1 A;  2RO0 A;  2K3Y A;  1JJ2 S;  2DJZ A;  2JVV A;  3JB9 D;  1YI2 T;  2YLC A;  1K73 C;  2DD4 A;  4X9D A;  5HKC A;  4BE2 A;  2FB7 A;  3OBY A;  3JB9 J;  3NFC A;  4FL6 A;  2EKO A;  3LW5 E;  1I4K 1;  2XDD A;  1VQL A;  3OYK A;  1NJI C;  1VQ7 A;  5CKH A;  2RJF A;  5DLO A;  2KDS A;  2BUD A;  3QII A;  5GAN 5;  1VQ9 A;  1K73 U;  2E1H A;  3M55 A;  4MDX A;  5FU6 C;  2EJF A;  5CIU A;  5GAO n;  4EMG A;  3DB4 A;  3HL8 A;  4C92 F;  4PLI A;  2PU9 B;  4NL2 A;  4ZN1 A;  1TH7 A;  3JAM E;  3RKW A;  1N27 A;  3CPF A;  1MGQ A;  3M4Y A;  4C8Q F;  4X34 A;  2QXF A;  1N6A A;  2LQ8 A;  2DIQ A;  3OYE A;  3V7S A;  4MZM A;  2P0P A;  1UB4 A;  4FIB A;  4JS5 A;  4LDV A;  2DXU A;  3N5B B;  4M78 D;  1G3Y A;  4E7I A;  2XD0 A;  3GNG A;  4PJO G;  1VQ6 T;  3G4S A;  5IT9 E;  5LJ3 e;  4XTY A;  5LJ5 g;  1NZ9 A;  2VUB A;  3A8O B;  4D6W A;  1KQS S;  3CCR T;  4MZP A;  3LWH A;  4J7F A;  2K57 A;  4V2S A;  3H6Z A;  1YJW A;  3LLR A;  3M9Q A;  1U8R A;  4EPC A;  2G3R A;  1Q7Y U;  3HP9 A;  5GAN 6;  2RHZ A;  4J83 A;  2EQM A;  2M0O A;  2RHY A;  4M77 A;  2YRV A;  5GAM e;  3OMG A;  5GAN 4;  3ZFJ A;  2DKG A;  3HKS A;  4PNO A;  1FWZ A;  3VJP A;  5CCA A;  2LT1 A;  3X20 B;  1VQO A;  2E10 A;  2VV5 A;  3GOX A;  2EQJ A;  3MEV A;  2K2V A;  4PJO F;  2CYZ B;  4RCB A;  3JCM P;  2ZPB B;  3OQ5 A;  4M7D B;  2K5L A;  4GY5 A;  1JBM A;  3G6E T;  1VQP A;  1Q81 U;  3TCJ A;  2MAM A;  2NLU A;  2VXF A;  5I2S A;  4C92 D;  3CC2 T;  2L8D A;  4KUL A;  1WGS A;  2X4X A;  4ME7 A;  3CC4 T;  1QVP A;  4BY6 B;  4VUB A;  3EFR A;  1X01 A;  3A8H B;  4C8Q D;  1YIT T;  3QBY A;  1B34 A;  1XNI A;  4ZGE B;  1KQ1 A;  4M78 C;  4B9W A;  1OZ3 A;  1IRE B;  4IUR A;  4OGE A;  4QQ6 A;  4OB1 B;  5C0M A;  3JCM d;  2XU8 A;  2E6N A;  2F5K A;  2MMP A;  3CCQ A;  4M77 E;  3NTH A;  4A4H A;  4OB3 B;  3GLX A;  3H8Z A;  2L89 A;  4J5Y A;  2PVO B;  4C5I A;  3BFM A;  3P8B B;  3CCE A;  4M7D G;  4KUI A;  2QQR A;  3CBM A;  2RHU A;  3MP8 A;  2K5F A;  1Y7X A;  2ZPG B;  5CKE A;  3BDL A;  3CCS T;  3UPU A;  3DLL A;  5CKF A;  2CGH A;  4QVZ A;  2LNV A;  3INZ A;  1U1T A;  2GCX A;  2EJG A;  4L5G A;  1JRI A;  4F7U A;  3JCM e;  1H3Z A;  1VIF A;  3M53 A;  1UGS B;  1M1G A;  1LJO A;  2AHJ B;  1FX7 A;  2K5I A;  5CKB A;  2FL7 A;  4DA4 A;  3M54 A;  1M4Z A;  4LDY A;  2HNI A;  4HA8 A;  2KMT A;  4XU3 A;  1WJS A;  5GAN h;  4J7I A;  4PL6 A;  2CKK A;  4M75 A;  5LJ5 e;  3OS5 A;  1OYX A;  3QDR B;  4E7K A;  3CCL T;  1VQM T;  2Y4Y A;  3GIB A;  1BIB A;  4LD6 A;  1O75 A;  4EMH A;  4C92 C;  5A2Q E;  3OYM A;  4M7D F;  3O8V A;  3HRU A;  2JUF A;  5CVI A;  4O5V A;  1Y96 B;  4BE1 A;  1NPR A;  5DLQ E;  4C8Q C;  4CI0 C;  4JRP A;  1VQL T;  3FDR A;  1VQ7 T;  1VQ9 T;  4Y91 A;  2LQK A;  3CCM A;  4C5E A;  3JB9 I;  3M58 A;  3GNF B;  2XI9 A;  2KAF A;  2BIV A;  3CCU A;  4JRQ A;  4ZTJ A;  2A7Y A;  4XU1 A;  2BKD N;  4M78 A;  4F7U E;  3OYC A;  4HT9 A;  2RK1 A;  3OYI A;  3LGL A;  3I55 A;  3TRE A;  3JCM J;  1HK9 A;  2KK4 A;  1XTD A;  4M7A A;  2L5Q A;  5GMK h;  3CC7 A;  1IZ6 A;  3OW2 A;  3QZ5 B;  3VV0 A;  3QJ6 A;  3QPH A;  3OS2 A;  3G4S T;  2F69 A;  4A54 A;  4HT8 A;  1BI3 A;  3S3M A;  5FU7 B;  4OB2 B;  1X75 C;  1QVF A;  3FB9 A;  2KY9 A;  4JDS A;  3VU3 C;  3CBP A;  4RG2 A;  5GAN f;  3OSV A;  4M75 D;  1YJW T;  1LOJ A;  1YCY A;  3JCM c;  5HK3 A;  4PJO C;  3L2U A;  1LNX A;  1YBY A;  1UGP B;  2M9U A;  3QXE B;  4N0A A;  3FJP A;  5D6X A;  4ZTF A;  1M1K C;  1VQN A;  2PVD B;  4MZT A;  4OP0 A;  4C0D B;  3PTA A;  3MO8 A;  5FRN A;  3V7R A;  4DOV A;  1H64 1;  5LJ3 d; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...