3QDRB

Structural characterization of the interaction of colicin a, colicin n, and tolb with the tolaiii translocon
Total Genus 0
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
0
sequence length
49
structure length
49
Chain Sequence
SYNTPWGKVIINAAGQPTMNGTVMTADNSSMVPYGRGFTRVLNSLVNNP

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Evidence That Colicin A Protein Binds to a Novel Binding Site of TolA Protein in Escherichia coli Periplasm.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport/toxin
molecule keywords Protein tolA
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2011-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.970 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3qdrB00
3QDRB
chains in the Genus database with same CATH superfamily
1VQ7Q 4M7DD 2JS0A 1H8KA 4OMPA 4XAXB 5GAN6 2KRNA 5CKHA 2E3HA 5IT9E 4O6JA 2DFUA 1WGSA 3OYYA 4DOWA 4M78F 1X27A 3OMGA 2XD0A 1OPKA 2R5AA 1VQPA 4PLLA 2LJ0A 4JLGA 2QA4A 5GAN8 3T9NA 1RUWA 1Y7XA 1WHGA 1B34A 1VUBA 3LGLA 1QQJA 2FPFA 3RKYA 2ROTA 1W2BA 1Q86U 1YP5A 3LLRA 2X4XA 3VJPA 1MMDA 3A5ZB 1OPLA 2RI5A 2EWNA 4RMOA 1MGQA 1QKXA 4J6WA 2VYTA 4LN2A 5EG2A 1RLPC 1VQMA 4FYYB 3OBYA 1Q86R 3RERA 1KQSS 2GGRA 2OI3A 4F04B 4RTZA 3JCMQ 2ESWA 4E7LA 3SWNA 2CZ7B 2EJ9A 2RHUA 2AK5A 2OAUA 5DLQE 1SPKA 3KXTA 3I56A 4L5GA 3OYIA 2WACA 3IQLA 2XHCA 2EYXA 2K3YA 2D6FA 4L59A 2COWA 3RBBB 4ORZA 5KYWA 2K5IA 4C92C 5HKCA 1OZ2A 3M57A 2KY9A 3I55A 1KG1A 2HSPA 1IGQA 3HTRA 3JSCA 5L8RE 1AWJA 1OX9A 2MWOA 1H92A 1ZSGA 4AG1C 4FW2A 4ZN3A 2BTTA 2VGMA 2E41A 3EGDA 2L3QA 2C0TA 2RHIA 5IHIA 1VQPT 1YWPA 3LGFA 4M78D 2K2MA 1MNEA 2DL8A 4II1A 4J6YA 1PNJA 3JCMV 2RJEA 1YCYA 1YWOA 2BE9B 4WCIA 4RCBA 5CKEA 1PM3A 1WPYA 1TH7A 1X2KA 1EFNA 4XTYA 5CK9A 2JMAA 2LJ1A 3EG9A 1ZSZA 2ROLA 2DAQA 1YJ9T 1NJIC 1M2VA 1RAHB 2JT4A 1PKTA 2M0OA 5CKDA 5HK3A 2O01E 2B8AA 2DBKA 3BFMA 1AHJB 2A36A 1U3OA 1WJRA 2A28A 2E1HA 3PNWC 4M75G 2ENMA 1VQ7A 2YRVA 4EPCA 3FJ5A 1NJIR 1KC8U 4DEYA 2RHZA 5GAMd 3TVTA 5GAMf 3SWNC 1VQ9A 2CZ1B 1OU9A 5CVIA 2HCKA 4PJOD 3CCEQ 2DMOA 5LJ3f 5KE3A 1UGSB 1PD1A 4Y92A 2AZVA 3FDRA 1K73U 2ZPFB 2MMPA 1H3HA 4TVRA 2DJZA 3TEEA 2M51A 4FSXA 1OQKA 4FW1A 3CCLA 1YITA 1ZBXA 1XQHA 3VS3A 5GANh 2QYZA 2DVJA 2RH2A 3PMIA 2FZGB 1IXDA 2FVUA 1D09B 2LRQA 2QGGA 4KT0E 1FMKA 4NS5A 1G3WA 4CI0C 2FYKA 1VQKA 4QT7A 2EKOA 4R55A 4IUQA 3BE3A 3QWXX 2QGFB 4KH0B 5A0DA 2GTOA 3QUIA 3JB9F 2VXFA 4OF1A 4AFQC 4C92F 3A1PA 2AZSA 2JS2A 1N9RA 2EJFA 2L3SA 4AFZC 1U1SA 4E7IA 2HKQB 1IB8A 3P8BB 2BZXA 2E65A 2PVDB 2V26A 5D6WA 1E7OA 2FHDA 2O2OA 3UATA 1Y0MA 5GAOp 2ED0A 3M0PA 4HCKA 4M77D 1Q82R 4OGEA 4IURA 4IIOA 1QP3A 2ZPIB 2EIFA 1AOJA 1GCQC 1AT1B 1M30A 3GBQA 2DTIA 2KVQG 4OVAA 1FX7A 3GOXA 1V29B 1UGRB 4D8KA 2IG0A 5KYUB 4X34A 3RNJA 1KHIA 1LJOA 4M7AF 2V8JA 5GAN4 2LT1A 3X24B 4OB3B 3PE0A 1N6AA 5DM7R 3G7ZA 1ZHIA 2L2PA 2HQXA 1VYTA 4RTXA 1ARKA 1TWBA 4JS5A 3FC3A 2PUOB 2EW3A 2JVVA 1YCSB 2HBPA 3M0SA 1X75C 4OMQA 4C0FA 3CMEQ 4DEXA 3I55Q 5FRMA 4EMKA 3OW2P 2YLCA 4E7JA 4AFSC 2O88A 1VQ7T 1BYMA 2J6KA 3I56Q 3QHSA 3OW2A 3VU3C 2KMTA 4F7UG 3CC7A 4ELZC 1PCXA 2COZA 2ZCFB 1HK9A 1XNIA 2YT6A 3H0FA 3CCUT 1VQ5A 3V7RA 1E6GA 2HKNA 4YTLA 2YWWA 3BY7A 3DKMA 3WVDB 1YJWQ 3HRUA 1BI0A 3SDZA 3BW1A 5KYXB 1UFFA 4CC2A 1JO8A 1SRLA 1YJ9A 3G6EA 1TG0A 2QEXT 2DEUA 3CPFA 2RI2A 2RB6A 4M7DA 1FYNA 3SHWA 3CCRQ 2MOXA 4FYVB 3HP9A 1A0NB 3CCMQ 2GBQA 3VV0A 1B7TA 4EMKB 3OYFA 4M7DF 1M8VA 1WNLA 2KT1A 1VQ9T 2DD5A 1KD1R 2NUTB 1UECA 1Y71A 2CH4W 1WJSA 3A8MB 2PZ1A 1J3TA 4BACA 1X69A 4XU3A 1TXQA 1PRLC 4M75A 5GANd 1KIKA 1VQOQ 5I11A 4MMLA 4OMLA 2EYZA 2O9VA 1WJQA 2DF6A 4M77A 4C0DC 2Y4XA 4HCZA 1KC8C 1UHCA 4XU0A 4E6RA 2RJCA 1HSQA 2DXCA 4JJDA 2OTJT 4AG2C 4BI8B 3TSZA 4FYWB 1X6OA 1TUGB 3J80E 5EC7A 5FLXE 4C92D 5FROA 4JDSA 1RACB 2E6ZA 1NBEB 3G1JA 3M0QA 1S72T 2JMCA 4N4HA 2D8HA 3FRNA 2QTXA 3PTAA 4Z02A 1ABQA 3CPWA 4N4GA 4QQDA 3X20B 5IHKA 1Q7YU 1YITQ 5DLOA 1RAIB 1I07A 4ZGJB 5CIUA 3EHQA 1K1ZA 3VS2A 3G4SA 4MMKA 3FB9A 1KQSA 5ECAA 1M2VB 3NHNA 1OI1A 3CC2Q 3C0CA 3OYBA 3EFOB 4F16A 2BZ8A 2E70A 1KC8R 1NJIU 4EIKA 3RIRA 5HCKA 2DM1A 3CCET 2BUDA 1T0JA 4QKUA 3QBYA 4HT8A 1R0BG 2KAFA 2X3WD 2L3PA 1BIBA 3L42A 1GBQA 2YRDA 4M78G 1SEMA 1M27C 3FEOA 1X6BA 2DILA 3SD4A 1QVFS 2K9GA 3G4SQ 4CC3A 1T3LA 3G6ET 2RQUA 3EH1A 4QVZA 3VRYA 1JJ2A 5GAOn 2BZYA 1UGVA 4DA4A 2O9SA 3UDCA 2QASA 1ZUUA 3G4ST 4JJBA 1BU1A 2D8JA 1UEBA 4Z88A 3QO3A 2K5LA 5LL6S 5GAN7 1VQ9Q 3CD6A 1VQ8A 3CXCS 4JRIA 1JRIA 3OYAA 1D3BB 4F7UB 2XDBA 3S3OA 3C4SA 1I4K1 2DX1A 2XG8D 2HNIA 1WI7A 4M77G 1PC0A 3JCMd 3JCMh 4PFZA 1JJ2S 4J9EA 1K9MC 4XTUA 1Q86C 3JB9G 2XI9A 5LJ5f 3CBMA 4PJOC 1MUZA 3CCLQ 1W6XA 5L23A 1M3CA 5GAOq 1UB4A 1KD1U 1BBZA 2CP0A 3EAEA 2CYZB 3CCQT 2MIOA 1ZA2B 1M1KC 2RK2A 4ZNXA 4OB0B 4K11A 5CAIA 1Z9QA 4N0AA 1FXXA 1Q82C 3M4YA 1W70A 2K3BA 5I2SA 4PLIA 4F7UF 1N8RR 2HAXA 2V8IA 5IHNA 3ZFJA 1ZQ1A 3QIIA 3CCSA 2XIDA 3LH0A 2E4HA 3OS0A 2CUBA 2K3XA 8AT1B 4A4KA 3ASKA 2JXBA 1OOTA 2YUPA 3RKXA 4NL3A 4C8QE 1TTHB 2DE0X 3G6EQ 1IGUA 4KH1B 4J9GA 2LCCA 1D0XA 3M0TA 2FL7A 5GAOm 4ZTFA 2OTLA 5GMKi 2KT8A 1YBYA 1ZSZB 2MK5A 4GBQA 1EZZB 1C1AA 3EGDB 4PL6A 3QZ5B 1UTIA 1M5Q1 2XICA 1WFWA 1SKUB 4M75E 3JCMf 3H6ZA 2F2VA 4GY5A 1OU8A 3OYCA 1P92A 3OS1A 4XTZA 2LP5A 4CC4B 1RADB 4LD9K 1G83A 1GRIA 4M77C 3RMSA 3NTKA 1QP2A 5C6SA 1AWXA 4N4IA 2DNUA 3CMAQ 4FIBA 3META 1YJWT 4NOYA 3PVLA 4Z8AA 2EQKA 4B9WA 1QKWA 4IUUA 4DQ2A 2AT1B 3JB9I 3CCST 4PJOB 2FB7A 1G3TA 4C0DB 3UA6A 3M0RA 3JB9H 2PVOB 5IXFA 3L2QA 4OMFB 2EQUA 3I35A 4FL6A 1KJWA 2LNHB 1U8RA 4D8DA 2EYQA 2DJQA 2HMAA 2DXBA 1UJYA 2I2LA 2X3XD 2F69A 2K2VA 3OSSC 2LQWA 2DL3A 4RTVA 3A8LB 3OB9A 2RN8A 2NUTA 2EGAA 5GJWB 3QJ6A 3NGPA 2MF2A 1V1CA 3LX7A 1K0SA 1TS9A 2D0NA 3GPLA 1OYXA 4HKEA 3L2ZA 1BI3A 2A08A 3ZL7C 4BY6B 1XTDA 2M02A 1AWWA 3UPUA 3RMQA 1VQ4A 2VKNA 4MZTA 2RK1A 3HRSA 5CQXA 1VQ8Q 3NTHA 3A8OB 5J39A 1KHCA 2JJ9A 4EMHA 4ZGEB 4C8QC 1TSFA 2WSFE 3CCVA 2J6FA 2GNCA 5CQYA 1BCMA 2KROA 4M7DE 2LCLA 1JB0E 2EFIA 3CBPA 5FU7B 2VGNA 5GANe 3PIOA 1VQ4T 2KSSA 5FU6B 1K8AU 3P8DA 2IVWA 1W1FA 3L2WA 5IH2A 1MMGA 4DBHA 3TQ7P 4KGVB 4QQ6A 5GANf 2KXDA 4FCYA 2QI2A 2FO0A 4C0ZA 1CSKA 1R0CB 3PT9A 2E6NA 4X9DA 4JJNK 1S1NA 1Q7YC 3RESA 1OZ3A 4OMOA 3JCMe 2JTFA 5GMKl 2M16A 4C8QG 3OS2A 1Q82U 5GMKh 1N9SA 2DVEA 2QG9B 4LNPA 5D6XA 4ELYC 1I81A 5LJ3j 3I56T 2QQAA 4J9IA 2NUZA 1HD3A 2DL7A 3VS5A 2CZ0B 5J3BA 2L5QA 2CP7A 2G6FX 4ZN1A 1LOJA 2Y4YA 4KGZB 2A37A 2FPDA 2X4YA 2CREA 5I2MA 1NEBA 1VQMT 3CPWP 1VQOA 2LC4A 2DYBA 1RAEB 4UC4A 2BKDN 2JTMA 3HRTA 4Z89A 2K79A 3E1SA 1RL2A 4LXCA 3O5ZA 5D7UA 1D0YA 2QEXQ 1WA7A 4MDXA 3G71Q 2VB6A 3CCJA 1Z9ZA 1Q81R 1PKSA 4QW2A 2ECZA 3O8VA 4BI3A 1QCNA 2BIVA 2RJFA 4PJMA 1ZUKA 4A53A 3GP8A 2RO0A 3EFSA 2E5QA 5KYXA 2ED1A 2J6OA 4M78B 7AT1B 4C92G 4HT9A 3CC7T 2L3RA 2JZ2A 3X25B 2CP3A 5KCOA 2OTLT 2H3JA 1T3SA 3OYMA 4A4EA 2RNAA 3INZA 2CP6A 3UT1A 2AIRB 1H3ZA 3PGGA 1MV0B 1SHFA 2X51A 2CKKA 3SB2A 2DA9A 4M7DC 2NYSA 2IPOB 1GXIE 2DZ9A 3FIFA 4BE0A 3I55T 4ME7A 3J81E 4E7HA 1G3SA 3MKDA 2LNVA 4M75B 1U06A 2MWPA 4E7KA 1JXMA 3E9GA 2CP5A 1BKBA 1VQMQ 2GTJA 1Y07A 4KBMB 3CCQA 1WHKA 3L1AA 1ABOA 2HQHA 2RQVA 3KFVA 5CKFA 5FWCA 2PNIA 2D0QB 1WQ7A 2KRSA 5CR2A 4B6MA 1E6HA 3CCQQ 5IXBA 4QVDA 3EHRA 3FLGA 3CCUQ 1QVGP 1JXOA 1QVGA 2O4XA 4XTWA 3LYIA 3OYLA 3VRZA 5HK0A 2F2XA 2E5KA 2D1XA 3RR6A 3HL8A 4FU6A 1M90R 3JCMg 1K73R 4M78A 4BDYA 4J9FA 1YHQA 2X4JA 3CMET 2A3LA 1ZSZC 3REAB 4DOVA 4J8OA 1PSEA 4C5IA 1VQ5T 2HL3A 1Q81C 4CC7A 2QQRA 4M77F 2P4TA 1KD1C 3KUFA 2XDDA 4B9XA 1NYFA 2DYIA 2QK0A 5GAN5 1N27A 3EFOA 3QYHB 2L8DA 3JCMb 1G2BA 4XU1A 4M7AC 3VS1A 1R77A 1CKBA 3HFNA 4PJOA 4J83A 2DO3A 2M1HA 4Q5WA 4E7SA 5IAYA 3EG2A 1SSHA 4E47A 1Q81U 3TREA 4HXJA 5KYNA 1UUEA 3CC7Q 2RF0A 1V76A 4VUBA 1W2BP 2K5FA 5GJVB 5LJ5h 3TU4K 3CPWS 4QVCA 4F7UA 3BDLA 2ZPHB 4IUTA 2DD4A 2GF7A 3CCEA 5D6YA 3GNFB 4FM4B 1NG2A 4RG8A 3MCAB 2F2WA 1FWZA 5AT1B 4RTTA 1VQLT 4KRTA 3C95A 1HXDA 1YI2T 1IO6A 3NPFA 3MPUB 4XU2A 1WX6A 1QWEA 3UWNA 3ME9A 2RA2A 1CKAA 2WSCE 2OJ2A 2JN0A 1VIEA 4JJCA 2J7IA 2K7AA 1WHHA 1BI2A 2CGHA 2JTEA 4HVWA 1YFNA 5CO7A 3EG0A 2KK4A 3QZ9B 1W4SA 5IN1A 1TOVA 2X9HA 4E2FB 4JPBW 5FU6C 1YHQT 4JLIA 1PG5B 4RCCA 3OW2S 1JBMA 3EGUA 2NWMA 3PFSA 3MP1A 8ATCB 4HCCA 1B34B 2KYBA 3H41A 3THKA 1VQNA 4M4ZA 3MP8A 3CCJT 1NLPC 4A4GA 4OB2B 1YHQQ 1Y96A 4JRKA 4PJLA 2QAZA 5CCAA 1NPPA 1VYVA 4KUDK 1O9SA 2V8KA 3WVEB 4LDYA 1ZA1B 5GMKm 2COYA 1VQ4Q 3X28B 2H3EB 4C0GA 3VS7A 5GAOr 4GLMA 4IUPA 2EYWA 3NTIA 1UE9A 1JJ2P 1VQOT 1C6VX 1UJ0A 4P5NA 4BE1A 2HD0A 1WZOA 2AHJB 4WTOB 1OULA 1ZLMA 2DK3A 3WXMB 1OV3A 4LDUA 1YI2Q 1IRXA 2GFAA 3CCSQ 2HL5C 3P8HA 5KCHA 1M3AA 2EBPA 1I8FA 1WQWA 1WXUA 2DBMA 1NPRA 4OGCA 1G5VA 2KXCA 1QMCA 1WHJA 4J7IA 5GMKe 4M7AB 1UGPB 4EMGA 2KDSA 1I5OB 2M0YA 4WF2A 4LUDA 2P4RA 5GAMj 3SEMA 3OS5A 3MEVA 2NUPB 4C5EA 4E7ZA 3JRZA 4MZPA 2QDLA 1WXBA 1FMWA 1ZX6A 5GAMe 4RTUA 1B3QA 3A8HB 5J26A 1Q7YR 2RPNA 1MHNA 4DBQA 2LX9A 3M59A 2FRWA 2W10A 2HQEA 1M2OA 2RHYA 4BUGA 1GFDA 5GAN2 2CSQA 2PU9B 3S3MA 1TU0B 1AWOA 2BE7D 3JCMc 1OX8A 5DY9A 3PMTA 1VQNQ 2J06A 3OSVA 2KRMA 3ZEHA 2MCNA 4PJNA 1TUDA 3OBWA 4J9HA 5AYFA 2JM8A 3C12A 4F17A 2A7YA 2C0OA 4ANJA 4PFOA 1XOVA 2OTLQ 2DRKA 1SRMA 1U5SA 2JOYA 1MNDA 5LJ3h 2DEQA 4KUIA 1BB9A 3HSBA 1QCOA 2CS7A 3V7CA 2FRYA 1QVPA 4Y91A 4M7AA 1M8MA 2OTJA 2YUQA 4M7DB 3JCMW 2YUOA 1FMVA 1KQ2A 3CXCA 3GIBA 4PJJA 3DB4A 1LNXA 1SSFA 1AZGB 2C0IA 4JZ4A 2QEXA 2FPEA 3G71T 3CQTA 2QTVA 2LTOA 2J05A 2G3RA 4X9CA 2ABLA 4XQ3A 5A0GA 1SG5A 2GQIA 2RM4A 1DJ7B 4M78C 2PUKB 2HZYA 2DETA 4RTYA 2F5KA 2LJ3A 2M9UA 2XMFA 1YJNQ 5A0LA 2EPDA 4M77E 5CKBA 2QXFA 1M9SA 4BDZA 2VVKA 1AEYA 2OX7A 2LQKA 3E2UA 1VQNT 1X01A 1K0XA 2QQBA 1M1FA 1W2BS 2P0KA 2XK0A 1D1CA 4LE9A 2EQIA 1S72Q 4ZGDB 3CC2A 1MV3A 5GAMg 4BE2A 3J7AF 3LWHA 2MI6A 2JNGA 1KSWA 4BB7A 2QQSA 4XK8E 4C92B 3L2UA 4BD3A 3I5SA 2P0PA 5KH6A 2KBTA 2LZ6B 4HCBA 4HVUA 1VQ6Q 3JCMJ 4C8QA 3VUZA 4AT1B 4F14A 1YIJT 3CCVQ 2QDYB 1VQLA 3QJYA 2LCSA 2HDAA 2F5TX 2DXTA 3A8GB 3M0UA 5LJ5e 4RKUE 4C8QF 2MYSA 4JRQA 4MZMA 2ZAEA 2KYMA 3VYHB 1Y57A 2LQNA 2I0NA 3VKIA 2E12A 3H0HA 1BIAA 2EGEA 1EX4A 1VA7A 5GAN3 2GFUA 2ZPEB 4ESRA 2VUBA 3URGA 1YJWA 5LJ3d 2D9TA 2YDLA 2R5MA 4M75F 2VWFA 4NL2A 1VQ5Q 1JU5C 2KR3A 1UGQB 4AFUC 5LJ3g 1HYOA 2X4WA 4C8QB 4CRIA 1B07A 4KGXB 3LWIA 2K57A 1D1AA 2RI3A 4O5VA 3CCMA 2EJGA 1X6GA 4FSSA 3QKJA 2SEMA 3FJPA 1KK7A 2JM9A 3EGXA 3M58A 1ZBJA 1M4ZA 3RDVA 3H0IA 4AMCA 1YIJQ 3CC4T 2YUNA 4M78E 5GAOl 2DRMA 2LDMA 4J9CA 1YJNT 3EG9B 2GCXA 3PVQA 2XU8A 4V2SA 3CMAT 5GANg 5FWBA 3R6OA 1VQKT 2FG0A 2MAMA 1GFCA 4DBFA 1BCOA 4M77B 1MMNA 1RI0A 3QDRB 2KE9A 1AVZC 1K73C 2EYYA 2YSQA 4PK4A 1WYXA 2HEQA 1YNZA 1GCQA 2E10A 2JUFA 3RKWA 1QWFA 1NZ9A 1G8XA 6AT1B 2H8HA 2LQ8A 3CCRA 1HJDA 2RJDA 3OYEA 2ZGWA 2Y90A 1RABB 2KI7A 4IIMA 5GANj 4X1VA 3D7SB 5KYYA 1GCPA 3OMCA 3M55A 3MJXA 1JQQA 1PWTA 2RHXA 4LUEA 3KBGA 2RQWA 2AKKA 2SRCA 4EDUA 4A4HA 3R6NA 3A98A 1YJ9Q 1YN8A 9ATCB 4QQGA 1OEBA 3VS6A 2DIGA 3CC4A 1I0CA 1KFZA 3QG1A 3G71A 3OQ5A 4C5GA 1VQLQ 3VUBA 3OYNA 2HSEB 2DZCA 3ER0A 1X2QA 3JB9J 3EH2A 3M5AA 3GNGA 2MPXC 2KQWA 2QA4Q 1M90C 2DKGA 4RTWA 1YITT 4PJOF 5FRNA 3JCMX 2P0QA 3DLMA 3H8ZA 2VXEA 1LVKA 4PNOA 1K9MR 5LJ3e 1N8RC 3QWYA 1LCKA 1YIJA 3MO8A 1RLQC 4JZ3A 5M9OA 4L6V5 1SHGA 3CCJQ 3CD6Q 3PIPA 4ATOA 1WXTA 1D1BA 3HHTB 1NYGA 3E19A 3V8KA 1D3BA 1BI1A 3JCMP 3CD6T 2FEIA 3QYGB 3Q1JA 1EIFA 3HPWA 4A63B 1K8AR 2RD1A 3OY9A 2E3IA 2ZPBB 3V7SA 5I21A 1VQPQ 1QVFA 1KQ1A 3QXEB 1GBRA 1BK2A 1Y96B 4PJOE 3LH5A 3OYGA 1QVFP 2DPPB 3CBOA 4LDVA 1QW1A 5HY6A 4J5YA 2DIQA 4HA8A 3TCJA 3MEUA 2KEAA 4FT2A 4RUGA 1PRMC 1M1KR 2EQJA 2CP2A 2LVMA 3UA7A 1M1GA 2QA4T 1K9AA 2FZCB 2CSIA 3I5RA 1ZUYA 2HBWA 2YLBA 3QSUA 3MEAA 1VIFA 1IHVA 2A0FB 1K76A 4LDWA 1RAAB 3M4GA 4OP0A 2EGCA 2KGTA 4C92A 3LW5E 4J6XA 1NLOC 4N0AC 2YXYA 2L89A 2LMJA 2R58A 3QDFA 3CCUA 3TSWA 2NLUA 5C0MA 3VS4A 2DTOA 5GAMh 1U1TA 2ATCB 1S72A 5LJ5g 1SF9A 2DERA 2O31A 3CCRT 4JS4A 5FU7C 3JAME 2CH4A 1X43A 3UF4A 3EG1A 2DXUA 2QQ9A 1K9MU 3S3NA 3V8LA 2K4YA 3VYGA 1WHLA 2GQVA 1QVGS 2V1QA 3OYKA 1MMAA 3HKSA 3CCVT 4ZTJA 2PQWA 1O75A 1YJNA 1RAGB 2OAWA 4J7FA 2DTHA 3E9FA 3SFMA 1M1KU 1VYUA 1ACMB 4EMKC 5KYWB 3OA6A 4DBRA 3CCLT 4BI4A 3OYJA 3ZBDA 3NFCA 1UHFA 1K8AC 1H641 2VASA 2Z0WA 1WHMA 4F7UE 5KYUA 4M7AE 4MDWA 4D6WA 2JW4A 1AZEA 2LX7A 2W0ZA 2OTJQ 4IUVA 3CC4Q 1IZ6A 3AHUA 1F1BB 3EGXB 2XKOC 3CMAA 4JUVA 3QPHA 3CCMT 3EFRA 3AT1B 3X26B 2EVRA 4XTVA 1NEGA 2LT4A 5LJ5d 1N8RU 1R8OB 3JB9D 1NM7A 1VQ6T 4M7DG 5I22A 4KULA 1N5ZA 3MP6A 2F1LA 2CDTA 3CMEA 1XJWB 2DLPA 1VQ8T 3REBB 3OYHA 1IHWA 1IREB 4M7AD 2RQTA 4C8QD 4FYXB 4C5HA 1Q95G 2P84A 3L2VA 1JEGA 4LDXA 1D0ZA 4OMMA 1AD5A 2CUDA 5KYYB 2X35A 4A54A 5FW9A 5KE2A 3RUXA 2DL4A 2RQRA 2PTKA 2CT3A 2KNBB 3VS0A 3EG3A 3N5BB 3S6WA 1WIEA 1KQSP 4XTXA 2PVGB 3U23A 1I5LA 3M9QA 2AKLA 4PJOG 2NUPA 1G3YA 3OYDA 4IKFA 1VOMA 2RMOA 5LJ5j 3JV3A 3BDUA 2E64A 2CT4A 4M75C 4PKCC 2B86A 2YHTA 2L0AA 2R57A 1QLYA 1VQ6A 2DL5A 3DLLA 2VC8A 1GL5A 4JRPA 3CC2T 4HVVA 1UG1A 2EAYA 1YI2A 2ZPGB 4R56A 3M54A 4J9DA 1LPLA 2O4XB 3CXCP 4OB1B 3GF5A 4M7AG 3DB3A 2WSEE 1M90U 1PSFA 1PHTA 1M3BA 4LD6A 1C0MA 1UDLA 3HFOA 5GMKj 1VQKQ 3M53A 1TUCA 4Y28E 2C06A 2XDPA 3L2RA 2EQMA 2ZZDA 2CZ6B 2FZKB 4J9BA 1K4US 4PFPA 3M56A 2VV5A 2YRCA 4FT4A 4BY6C 4M75D 3GLXA 4C92E 1RI9A 2K6DA 1T0HA 2EKHA 3CEYA 3V8JA 3H9NA 4R0KA 4A4FA 1NE8A 4OMNA 2IIMA 4RG2A 2V1RA 4GLKA 3I9QA 3NMZC 5A2QE 1QCFA 1WDXA 1WLPB 3MEWA 1I1JA 3C94A 3ULRB 3MHXA 3F70A 1PD0A 3SWNB 1RAFB
chains in the Genus database with same CATH topology
5GAOl 2LDMA 3HL8A 4FU6A 1YJNT 3G4SA 4M7DD 3JCMg 4MMKA 3FB9A 4M78A 1KQSA 2GCXA 4BDYA 4XAXB 5GAN6 2XU8A 4V2SA 3CMAT 5CKHA 5GANg 5IT9E 1YHQA 2X4JA 3R6OA 4O6JA 1OI1A 3CMET 2A3LA 1VQKT 2MAMA 3OYBA 4M77B 1WGSA 1RI0A 4J8OA 1PSEA 4C5IA 4DOVA 2E70A 3OYYA 3QDRB 1VQ5T 1Q81C 4DOWA 2QQRA 4M77F 2P4TA 1NJIU 4M78F 1K73C 1KD1C 3KUFA 3OMGA 2XDDA 2XD0A 3RIRA 2R5AA 4B9XA 1VQPA 3CCET 3RKWA 2E10A 2JUFA 2BUDA 1NZ9A 5GAN5 3QBYA 4HT8A 1N27A 2LQ8A 4PLLA 2KAFA 3CCRA 2RJDA 3QYHB 3OYEA 2L8DA 4JLGA 2ZGWA 2QA4A 3JCMb 1BIBA 5GAN8 4XU1A 3T9NA 4M7AC 2Y90A 3L42A 4PJOA 1Y7XA 3HFNA 4M78G 5GANj 1B34A 4J83A 2DO3A 2M1HA 3FEOA 4Q5WA 5IAYA 4E47A 1VUBA 3LGLA 3SD4A 1QVFS 1Q81U 3TREA 3OMCA 3RKYA 3M55A 3G6ET 1W2BA 1Q86U 4QVZA 3LLRA 2X4XA 1JJ2A 3VJPA 2RHXA 3KBGA 5GAOn 4DA4A 4VUBA 2K5FA 5LJ5h 3TU4K 3A5ZB 3UDCA 4EDUA 3CPWS 4A4HA 4QVCA 4F7UA 3BDLA 2RI5A 2ZPHB 4QQGA 3G4ST 4IUTA 2EWNA 2DIGA 1UEBA 2DD4A 4RMOA 1MGQA 4J6WA 3CC4A 2VYTA 3QO3A 2GF7A 2K5LA 5LL6S 5D6YA 3QG1A 5GAN7 3CCEA 3G71A 3OQ5A 4C5GA 3VUBA 3CD6A 3GNFB 4FM4B 5EG2A 4RG8A 3OYNA 1VQ8A 3CXCS 3MCAB 4JRIA 1JRIA 3OBYA 3OYAA 1VQMA 3RERA 1D3BB 4F7UB 1KQSS 2XDBA 2DZCA 3S3OA 3C4SA 1I4K1 2XG8D 2HNIA 3ER0A 3JCMQ 1FWZA 4M77G 3JB9J 3JCMd 4E7LA 3SWNA 1VQLT 3C95A 2CZ7B 3JCMh 1HXDA 3M5AA 2EJ9A 2RHUA 2KQWA 3GNGA 4XTUA 1YI2T 1K9MC 1JJ2S 2OAUA 5DLQE 1Q86C 3JB9G 2XI9A 1M90C 3KXTA 2DKGA 5LJ5f 3I56A 3CBMA 1YITT 4PJOF 5FRNA 4L5GA 4PJOC 3OYIA 2WACA 3JCMX 4XU2A 2P0QA 2XHCA 3DLMA 3H8ZA 2K3YA 3UWNA 3ME9A 2RA2A 2VXEA 2D6FA 2WSCE 4L59A 4PNOA 5LJ3e 5GAOq 1UB4A 2JN0A 1KD1U 1VIEA 3EAEA 1N8RC 2K5IA 2CYZB 4C92C 5HKCA 1BI2A 3CCQT 1M1KC 2CGHA 2RK2A 1OZ2A 1YIJA 3M57A 2KY9A 4OB0B 3I55A 3MO8A 5CAIA 5CO7A 1KG1A 5M9OA 4N0AA 4L6V5 2KK4A 1FXXA 1Q82C 3M4YA 3QZ9B 5I2SA 4PLIA 1W4SA 5IN1A 4F7UF 2HAXA 3PIPA 3JSCA 2V8IA 5L8RE 5FU6C 4ATOA 1YHQT 4JLIA 3OW2S 2MWOA 1ZQ1A 1JBMA 3QIIA 4RCCA 2XIDA 3LH0A 3PFSA 3ZFJA 3OS0A 2K3XA 3MP1A 3CCSA 4HCCA 4A4KA 1B34B 3ASKA 3HHTB 4ZN3A 3E19A 3V8KA 1VQNA 3MP8A 1D3BA 2VGMA 3RKXA 1BI1A 2E41A 4NL3A 3CCJT 3JCMP 4C8QE 3CD6T 3QYGB 4A4GA 4OB2B 2RHIA 1VQPT 3LGFA 3Q1JA 1EIFA 3HPWA 4M78D 1Y96A 2LCCA 4JRKA 2FL7A 5GAOm 4II1A 5CCAA 4ZTFA 1NPPA 2OTLA 4J6YA 4KUDK 5GMKi 2RD1A 1YBYA 3OY9A 1O9SA 2V8KA 3WVEB 4LDYA 4PL6A 3QZ5B 5GMKm 2ZPBB 3V7SA 3X28B 3JCMV 5I21A 2RJEA 1M5Q1 2XICA 1QVFA 1KQ1A 1YCYA 3QXEB 4C0GA 3J7AF 4M75E 4RCBA 5CKEA 3JCMf 5GAOr 1Y96B 3H6ZA 4PJOE 3OYGA 4IUPA 4GY5A 2DPPB 1WPYA 3CBOA 1TH7A 4LDVA 1QW1A 5HY6A 3NTIA 2DIQA 4HA8A 4J5YA 3TCJA 3MEUA 4XTYA 5CK9A 4FT2A 1VQOT 1YJ9T 2DAQA 3OYCA 1P92A 4P5NA 2HD0A 3OS1A 4XTZA 4BE1A 1NJIC 2AHJB 2EQJA 2LVMA 2M0OA 4LD9K 2DK3A 5CKDA 5HK3A 2O01E 2B8AA 3WXMB 4M77C 3BFMA 3NTKA 1AHJB 4LDUA 3RMSA 1M1GA 2QA4T 1WJRA 2E1HA 1QP2A 3PNWC 4M75G 5C6SA 1VQ7A 2GFAA 2YRVA 4N4IA 4EPCA 3P8HA 1KC8U 4FIBA 3META 5KCHA 1YJWT 2RHZA 4NOYA 5GAMd 2YLBA 3QSUA 2EQKA 5GAMf 1I8FA 1WQWA 4IUUA 3SWNC 4B9WA 3MEAA 1VIFA 1NPRA 4OGCA 1G5VA 1VQ9A 4DQ2A 3JB9I 2CZ1B 4LDWA 4J7IA 5CVIA 5GMKe 4M7AB 3CCST 4PJOB 1UGPB 2FB7A 4EMGA 4PJOD 3M4GA 1G3TA 2KDSA 4OP0A 4C0DB 4C92A 3LW5E 4WF2A 3JB9H 2PVOB 4J6XA 5LJ3f 5KE3A 3L2QA 4OMFB 1UGSB 4N0AC 2EQUA 5GAMj 2L89A 3OS5A 4FL6A 3MEVA 2R58A 4C5EA 1U8RA 3FDRA 3JRZA 4MZPA 1K73U 2EYQA 3CCUA 5GAMe 2ZPFB 2NLUA 5C0MA 2DXBA 2MMPA 2I2LA 4TVRA 2DJZA 3TEEA 4FSXA 2DTOA 5GAMh 2F69A 3A8HB 2K2VA 5J26A 3CCLA 1U1TA 3OSSC 1YITA 1ZBXA 1XQHA 1MHNA 5LJ5g 1S72A 2LX9A 5GANh 3CCRT 4JS4A 2RH2A 3PMIA 3A8LB 3M59A 5FU7C 3JAME 2HQEA 2RHYA 3OB9A 2FVUA 4BUGA 3QJ6A 2DXUA 2QQ9A 1K9MU 2LRQA 5GAN2 3S3NA 3V8LA 2K4YA 4KT0E 3VYGA 2GQVA 2PU9B 4NS5A 3S3MA 1G3WA 1QVGS 4CI0C 2FYKA 3OYKA 1VQKA 2MF2A 3LX7A 2EKOA 3HKSA 3JCMc 4R55A 4IUQA 5DY9A 3CCVT 3PMTA 3OSVA 3GPLA 3ZEHA 1OYXA 4ZTJA 4HKEA 3L2ZA 1BI3A 2PQWA 1O75A 4BY6B 5A0DA 1XTDA 1YJNA 3OBWA 5AYFA 4J7FA 3C12A 3QUIA 3JB9F 2DTHA 2VXFA 3UPUA 3RMQA 2A7YA 3E9FA 4OF1A 3SFMA 1VQ4A 4C92F 1M1KU 4MZTA 1N9RA 2EJFA 4E7IA 1U1SA 2RK1A 1XOVA 3HRSA 3P8BB 5CQXA 3NTHA 3A8OB 2E65A 2PVDB 4EMKC 5J39A 1KHCA 3OA6A 4EMHA 5D6WA 4ZGEB 2JOYA 5LJ3h 4C8QC 3CCLT 4BI4A 2WSFE 3OYJA 2FHDA 3ZBDA 3NFCA 3CCVA 1K8AC 2DEQA 4KUIA 5CQYA 1H641 3HSBA 5GAOp 4M7DE 2LCLA 1JB0E 4M77D 2EFIA 3CBPA 5FU7B 4OGEA 4IURA 4F7UE 4M7AE 4MDWA 2VGNA 2CS7A 1QP3A 2ZPIB 4D6WA 2EIFA 3V7CA 5GANe 3PIOA 1VQ4T 2KSSA 5FU6B 1QVPA 4Y91A 4M7AA 1K8AU 2OTJA 3P8DA 2IVWA 4M7DB 2DTIA 2KVQG 4IUVA 1FX7A 4OVAA 3L2WA 3JCMW 1IZ6A 3GOXA 3AHUA 1V29B 1KQ2A 3CXCA 1UGRB 3GIBA 3DB4A 1LNXA 1SSFA 2IG0A 4QQ6A 5GANf 2XKOC 4X34A 1KHIA 1LJOA 2QI2A 4JUVA 4C0ZA 3CMAA 2V8JA 3QPHA 3CCMT 3EFRA 3PT9A 5GAN4 4M7AF 2E6NA 4X9DA 3X26B 3G71T 2QEXA 2LT1A 3X24B 4OB3B 4JJNK 4XTVA 2LTOA 1N6AA 2LT4A 2G3RA 5LJ5d 1Q7YC 4X9CA 1OZ3A 4XQ3A 3RESA 5A0GA 5DM7R 1N8RU 3G7ZA 1R8OB 1ZHIA 2RM4A 3JB9D 1VQ6T 2HQXA 1DJ7B 3JCMe 4M7DG 4M78C 2JTFA 5GMKl 2M16A 2PUKB 4KULA 4C8QG 3MP6A 2F5KA 3OS2A 3CMEA 4JS5A 3FC3A 1Q82U 2PUOB 5GMKh 2JVVA 1N9SA 2DVEA 2M9UA 1VQ8T 5D6XA 4ELYC 1I81A 2HBPA 5LJ3j 3I56T 5A0LA 4M77E 3OYHA 2QQAA 1IREB 5CKBA 2QXFA 4M7AD 1X75C 2CZ0B 1M9SA 4C8QD 4BDZA 5J3BA 4C0FA 4C5HA 2L5QA 2LQKA 4ZN1A 1VQNT 5FRMA 1X01A 4EMKA 1LOJA 2Y4YA 2YLCA 4E7JA 3L2VA 1BYMA 2QQBA 1M1FA 2X4YA 1W2BS 2P0KA 5I2MA 3OW2A 1VQ7T 2XK0A 3QHSA 3VU3C 1VQMT 4LDXA 2KMTA 4F7UG 1VQOA 3CC7A 2LC4A 4ELZC 2ZCFB 4ZGDB 1HK9A 1XNIA 3CCUT 4UC4A 3CC2A 2X35A 4A54A 5GAMg 4BE2A 3V7RA 2BKDN 2JTMA 3HRTA 3RUXA 5KE2A 3LWHA 1VQ5A 2MI6A 2JNGA 4YTLA 3E1SA 3BY7A 1RL2A 3DKMA 4BB7A 3WVDB 2QQSA 3HRUA 4XK8E 1BI0A 3N5BB 3S6WA 3SDZA 4C92B 4MDXA 3BW1A 3L2UA 3CCJA 4XTXA 4BD3A 2PVGB 1I5LA 4QW2A 3M9QA 3O8VA 4PJOG 4BI3A 1YJ9A 2BIVA 2P0PA 3G6EA 2RJFA 1G3YA 5KH6A 3OYDA 4A53A 3GP8A 4IKFA 4HCBA 2RO0A 3JCMJ 4C8QA 2QEXT 3VUZA 5LJ5j 3CPFA 2RI2A 2RB6A 2QDYB 3BDUA 1YIJT 3EFSA 1VQLA 4M7DA 2E64A 2E5QA 3QJYA 4M75C 4PKCC 2F5TX 2DXTA 2YHTA 3A8GB 4M78B 3HP9A 2R57A 4C92G 1VQ6A 4HT9A 5LJ5e 3CC7T 2L3RA 4RKUE 3DLLA 2VC8A 3VV0A 4C8QF 4JRQA 4EMKB 3OYFA 4MZMA 4M7DF 2JZ2A 1M8VA 3X25B 4JRPA 3CC2T 1WNLA 3VYHB 1VQ9T 5KCOA 2OTLT 2DD5A 2H3JA 3OYMA 2EAYA 1YI2A 3VKIA 2E12A 1Y71A 4A4EA 1WJSA 3INZA 2ZPGB 3A8MB 4R56A 3M54A 1BIAA 4BACA 2O4XB 4XU3A 3UT1A 4OB1B 1H3ZA 3PGGA 3GF5A 4M7AG 4M75A 5GAN3 2GFUA 2ZPEB 3DB3A 2WSEE 2CKKA 2VUBA 3SB2A 5GANd 1PSFA 1M90U 4M7DC 3URGA 1GXIE 1YJWA 4LD6A 2DZ9A 5LJ3d 2D9TA 4MMLA 3HFOA 3FIFA 5GMKj 4BE0A 2R5MA 3I55T 3M53A 4M75F 4ME7A 3J81E 4NL2A 4Y28E 1WJQA 4E7HA 1G3SA 2LNVA 4M75B 2C06A 2XDPA 1UGQB 3L2RA 4M77A 5LJ3g 2MWPA 2EQMA 2ZZDA 4C0DC 4E7KA 2Y4XA 2X4WA 4HCZA 4C8QB 3E9GA 2CZ6B 1BKBA 4XU0A 4CRIA 2RJCA 2DXCA 1KC8C 1Y07A 4KBMB 3CCQA 3M56A 3L1AA 2OTJT 4BI8B 2VV5A 4FT4A 3LWIA 1X6OA 2K57A 5CKFA 4BY6C 4M75D 3GLXA 4C92E 2D0QB 1WQ7A 5CR2A 4O5VA 2RI3A 5FLXE 3J80E 3CCMA 3CEYA 3V8JA 4C92D 5FROA 4JDSA 2E6ZA 2EJGA 1S72T 4QVDA 3FLGA 4A4FA 1NE8A 3QKJA 4N4HA 3FRNA 3PTAA 2QTXA 4RG2A 4Z02A 3CPWA 4N4GA 3FJPA 4GLKA 4QQDA 3X20B 1QVGA 3M58A 2O4XA 4XTWA 5A2QE 1Q7YU 1M4ZA 3MEWA 3C94A 3LYIA 3OYLA 5DLOA 3MHXA 4ZGJB 5CIUA 3CC4T 3F70A 5HK0A 3SWNB 4M78E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QDR B; 
#chains in the Genus database with same CATH topology
 1VQ7 Q;  4M7D D;  2JS0 A;  1H8K A;  4OMP A;  4XAX B;  5GAN 6;  2KRN A;  5CKH A;  2E3H A;  5IT9 E;  4O6J A;  2DFU A;  1WGS A;  3OYY A;  4DOW A;  4M78 F;  1X27 A;  3OMG A;  2XD0 A;  1OPK A;  2R5A A;  1VQP A;  4PLL A;  2LJ0 A;  4JLG A;  2QA4 A;  5GAN 8;  3T9N A;  1RUW A;  1Y7X A;  1WHG A;  1B34 A;  1VUB A;  3LGL A;  1QQJ A;  2FPF A;  3RKY A;  2ROT A;  1W2B A;  1Q86 U;  1YP5 A;  3LLR A;  2X4X A;  3VJP A;  1MMD A;  3A5Z B;  1OPL A;  2RI5 A;  2EWN A;  4RMO A;  1MGQ A;  1QKX A;  4J6W A;  2VYT A;  4LN2 A;  5EG2 A;  1RLP C;  1VQM A;  4FYY B;  3OBY A;  1Q86 R;  3RER A;  1KQS S;  2GGR A;  2OI3 A;  4F04 B;  4RTZ A;  3JCM Q;  2ESW A;  4E7L A;  3SWN A;  2CZ7 B;  2EJ9 A;  2RHU A;  2AK5 A;  2OAU A;  5DLQ E;  1SPK A;  3KXT A;  3I56 A;  4L5G A;  3OYI A;  2WAC A;  3IQL A;  2XHC A;  2EYX A;  2K3Y A;  2D6F A;  4L59 A;  2COW A;  3RBB B;  4ORZ A;  5KYW A;  2K5I A;  4C92 C;  5HKC A;  1OZ2 A;  3M57 A;  2KY9 A;  3I55 A;  1KG1 A;  2HSP A;  1IGQ A;  3HTR A;  3JSC A;  5L8R E;  1AWJ A;  1OX9 A;  2MWO A;  1H92 A;  1ZSG A;  4AG1 C;  4FW2 A;  4ZN3 A;  2BTT A;  2VGM A;  2E41 A;  3EGD A;  2L3Q A;  2C0T A;  2RHI A;  5IHI A;  1VQP T;  1YWP A;  3LGF A;  4M78 D;  2K2M A;  1MNE A;  2DL8 A;  4II1 A;  4J6Y A;  1PNJ A;  3JCM V;  2RJE A;  1YCY A;  1YWO A;  2BE9 B;  4WCI A;  4RCB A;  5CKE A;  1PM3 A;  1WPY A;  1TH7 A;  1X2K A;  1EFN A;  4XTY A;  5CK9 A;  2JMA A;  2LJ1 A;  3EG9 A;  1ZSZ A;  2ROL A;  2DAQ A;  1YJ9 T;  1NJI C;  1M2V A;  1RAH B;  2JT4 A;  1PKT A;  2M0O A;  5CKD A;  5HK3 A;  2O01 E;  2B8A A;  2DBK A;  3BFM A;  1AHJ B;  2A36 A;  1U3O A;  1WJR A;  2A28 A;  2E1H A;  3PNW C;  4M75 G;  2ENM A;  1VQ7 A;  2YRV A;  4EPC A;  3FJ5 A;  1NJI R;  1KC8 U;  4DEY A;  2RHZ A;  5GAM d;  3TVT A;  5GAM f;  3SWN C;  1VQ9 A;  2CZ1 B;  1OU9 A;  5CVI A;  2HCK A;  4PJO D;  3CCE Q;  2DMO A;  5LJ3 f;  5KE3 A;  1UGS B;  1PD1 A;  4Y92 A;  2AZV A;  3FDR A;  1K73 U;  2ZPF B;  2MMP A;  1H3H A;  4TVR A;  2DJZ A;  3TEE A;  2M51 A;  4FSX A;  1OQK A;  4FW1 A;  3CCL A;  1YIT A;  1ZBX A;  1XQH A;  3VS3 A;  5GAN h;  2QYZ A;  2DVJ A;  2RH2 A;  3PMI A;  2FZG B;  1IXD A;  2FVU A;  1D09 B;  2LRQ A;  2QGG A;  4KT0 E;  1FMK A;  4NS5 A;  1G3W A;  4CI0 C;  2FYK A;  1VQK A;  4QT7 A;  2EKO A;  4R55 A;  4IUQ A;  3BE3 A;  3QWX X;  2QGF B;  4KH0 B;  5A0D A;  2GTO A;  3QUI A;  3JB9 F;  2VXF A;  4OF1 A;  4AFQ C;  4C92 F;  3A1P A;  2AZS A;  2JS2 A;  1N9R A;  2EJF A;  2L3S A;  4AFZ C;  1U1S A;  4E7I A;  2HKQ B;  1IB8 A;  3P8B B;  2BZX A;  2E65 A;  2PVD B;  2V26 A;  5D6W A;  1E7O A;  2FHD A;  2O2O A;  3UAT A;  1Y0M A;  5GAO p;  2ED0 A;  3M0P A;  4HCK A;  4M77 D;  1Q82 R;  4OGE A;  4IUR A;  4IIO A;  1QP3 A;  2ZPI B;  2EIF A;  1AOJ A;  1GCQ C;  1AT1 B;  1M30 A;  3GBQ A;  2DTI A;  2KVQ G;  4OVA A;  1FX7 A;  3GOX A;  1V29 B;  1UGR B;  4D8K A;  2IG0 A;  5KYU B;  4X34 A;  3RNJ A;  1KHI A;  1LJO A;  4M7A F;  2V8J A;  5GAN 4;  2LT1 A;  3X24 B;  4OB3 B;  3PE0 A;  1N6A A;  5DM7 R;  3G7Z A;  1ZHI A;  2L2P A;  2HQX A;  1VYT A;  4RTX A;  1ARK A;  1TWB A;  4JS5 A;  3FC3 A;  2PUO B;  2EW3 A;  2JVV A;  1YCS B;  2HBP A;  3M0S A;  1X75 C;  4OMQ A;  4C0F A;  3CME Q;  4DEX A;  3I55 Q;  5FRM A;  4EMK A;  3OW2 P;  2YLC A;  4E7J A;  4AFS C;  2O88 A;  1VQ7 T;  1BYM A;  2J6K A;  3I56 Q;  3QHS A;  3OW2 A;  3VU3 C;  2KMT A;  4F7U G;  3CC7 A;  4ELZ C;  1PCX A;  2COZ A;  2ZCF B;  1HK9 A;  1XNI A;  2YT6 A;  3H0F A;  3CCU T;  1VQ5 A;  3V7R A;  1E6G A;  2HKN A;  4YTL A;  2YWW A;  3BY7 A;  3DKM A;  3WVD B;  1YJW Q;  3HRU A;  1BI0 A;  3SDZ A;  3BW1 A;  5KYX B;  1UFF A;  4CC2 A;  1JO8 A;  1SRL A;  1YJ9 A;  3G6E A;  1TG0 A;  2QEX T;  2DEU A;  3CPF A;  2RI2 A;  2RB6 A;  4M7D A;  1FYN A;  3SHW A;  3CCR Q;  2MOX A;  4FYV B;  3HP9 A;  1A0N B;  3CCM Q;  2GBQ A;  3VV0 A;  1B7T A;  4EMK B;  3OYF A;  4M7D F;  1M8V A;  1WNL A;  2KT1 A;  1VQ9 T;  2DD5 A;  1KD1 R;  2NUT B;  1UEC A;  1Y71 A;  2CH4 W;  1WJS A;  3A8M B;  2PZ1 A;  1J3T A;  4BAC A;  1X69 A;  4XU3 A;  1TXQ A;  1PRL C;  4M75 A;  5GAN d;  1KIK A;  1VQO Q;  5I11 A;  4MML A;  4OML A;  2EYZ A;  2O9V A;  1WJQ A;  2DF6 A;  4M77 A;  4C0D C;  2Y4X A;  4HCZ A;  1KC8 C;  1UHC A;  4XU0 A;  4E6R A;  2RJC A;  1HSQ A;  2DXC A;  4JJD A;  2OTJ T;  4AG2 C;  4BI8 B;  3TSZ A;  4FYW B;  1X6O A;  1TUG B;  3J80 E;  5EC7 A;  5FLX E;  4C92 D;  5FRO A;  4JDS A;  1RAC B;  2E6Z A;  1NBE B;  3G1J A;  3M0Q A;  1S72 T;  2JMC A;  4N4H A;  2D8H A;  3FRN A;  2QTX A;  3PTA A;  4Z02 A;  1ABQ A;  3CPW A;  4N4G A;  4QQD A;  3X20 B;  5IHK A;  1Q7Y U;  1YIT Q;  5DLO A;  1RAI B;  1I07 A;  4ZGJ B;  5CIU A;  3EHQ A;  1K1Z A;  3VS2 A;  3G4S A;  4MMK A;  3FB9 A;  1KQS A;  5ECA A;  1M2V B;  3NHN A;  1OI1 A;  3CC2 Q;  3C0C A;  3OYB A;  3EFO B;  4F16 A;  2BZ8 A;  2E70 A;  1KC8 R;  1NJI U;  4EIK A;  3RIR A;  5HCK A;  2DM1 A;  3CCE T;  2BUD A;  1T0J A;  4QKU A;  3QBY A;  4HT8 A;  1R0B G;  2KAF A;  2X3W D;  2L3P A;  1BIB A;  3L42 A;  1GBQ A;  2YRD A;  4M78 G;  1SEM A;  1M27 C;  3FEO A;  1X6B A;  2DIL A;  3SD4 A;  1QVF S;  2K9G A;  3G4S Q;  4CC3 A;  1T3L A;  3G6E T;  2RQU A;  3EH1 A;  4QVZ A;  3VRY A;  1JJ2 A;  5GAO n;  2BZY A;  1UGV A;  4DA4 A;  2O9S A;  3UDC A;  2QAS A;  1ZUU A;  3G4S T;  4JJB A;  1BU1 A;  2D8J A;  1UEB A;  4Z88 A;  3QO3 A;  2K5L A;  5LL6 S;  5GAN 7;  1VQ9 Q;  3CD6 A;  1VQ8 A;  3CXC S;  4JRI A;  1JRI A;  3OYA A;  1D3B B;  4F7U B;  2XDB A;  3S3O A;  3C4S A;  1I4K 1;  2DX1 A;  2XG8 D;  2HNI A;  1WI7 A;  4M77 G;  1PC0 A;  3JCM d;  3JCM h;  4PFZ A;  1JJ2 S;  4J9E A;  1K9M C;  4XTU A;  1Q86 C;  3JB9 G;  2XI9 A;  5LJ5 f;  3CBM A;  4PJO C;  1MUZ A;  3CCL Q;  1W6X A;  5L23 A;  1M3C A;  5GAO q;  1UB4 A;  1KD1 U;  1BBZ A;  2CP0 A;  3EAE A;  2CYZ B;  3CCQ T;  2MIO A;  1ZA2 B;  1M1K C;  2RK2 A;  4ZNX A;  4OB0 B;  4K11 A;  5CAI A;  1Z9Q A;  4N0A A;  1FXX A;  1Q82 C;  3M4Y A;  1W70 A;  2K3B A;  5I2S A;  4PLI A;  4F7U F;  1N8R R;  2HAX A;  2V8I A;  5IHN A;  3ZFJ A;  1ZQ1 A;  3QII A;  3CCS A;  2XID A;  3LH0 A;  2E4H A;  3OS0 A;  2CUB A;  2K3X A;  8AT1 B;  4A4K A;  3ASK A;  2JXB A;  1OOT A;  2YUP A;  3RKX A;  4NL3 A;  4C8Q E;  1TTH B;  2DE0 X;  3G6E Q;  1IGU A;  4KH1 B;  4J9G A;  2LCC A;  1D0X A;  3M0T A;  2FL7 A;  5GAO m;  4ZTF A;  2OTL A;  5GMK i;  2KT8 A;  1YBY A;  1ZSZ B;  2MK5 A;  4GBQ A;  1EZZ B;  1C1A A;  3EGD B;  4PL6 A;  3QZ5 B;  1UTI A;  1M5Q 1;  2XIC A;  1WFW A;  1SKU B;  4M75 E;  3JCM f;  3H6Z A;  2F2V A;  4GY5 A;  1OU8 A;  3OYC A;  1P92 A;  3OS1 A;  4XTZ A;  2LP5 A;  4CC4 B;  1RAD B;  4LD9 K;  1G83 A;  1GRI A;  4M77 C;  3RMS A;  3NTK A;  1QP2 A;  5C6S A;  1AWX A;  4N4I A;  2DNU A;  3CMA Q;  4FIB A;  3MET A;  1YJW T;  4NOY A;  3PVL A;  4Z8A A;  2EQK A;  4B9W A;  1QKW A;  4IUU A;  4DQ2 A;  2AT1 B;  3JB9 I;  3CCS T;  4PJO B;  2FB7 A;  1G3T A;  4C0D B;  3UA6 A;  3M0R A;  3JB9 H;  2PVO B;  5IXF A;  3L2Q A;  4OMF B;  2EQU A;  3I35 A;  4FL6 A;  1KJW A;  2LNH B;  1U8R A;  4D8D A;  2EYQ A;  2DJQ A;  2HMA A;  2DXB A;  1UJY A;  2I2L A;  2X3X D;  2F69 A;  2K2V A;  3OSS C;  2LQW A;  2DL3 A;  4RTV A;  3A8L B;  3OB9 A;  2RN8 A;  2NUT A;  2EGA A;  5GJW B;  3QJ6 A;  3NGP A;  2MF2 A;  1V1C A;  3LX7 A;  1K0S A;  1TS9 A;  2D0N A;  3GPL A;  1OYX A;  4HKE A;  3L2Z A;  1BI3 A;  2A08 A;  3ZL7 C;  4BY6 B;  1XTD A;  2M02 A;  1AWW A;  3UPU A;  3RMQ A;  1VQ4 A;  2VKN A;  4MZT A;  2RK1 A;  3HRS A;  5CQX A;  1VQ8 Q;  3NTH A;  3A8O B;  5J39 A;  1KHC A;  2JJ9 A;  4EMH A;  4ZGE B;  4C8Q C;  1TSF A;  2WSF E;  3CCV A;  2J6F A;  2GNC A;  5CQY A;  1BCM A;  2KRO A;  4M7D E;  2LCL A;  1JB0 E;  2EFI A;  3CBP A;  5FU7 B;  2VGN A;  5GAN e;  3PIO A;  1VQ4 T;  2KSS A;  5FU6 B;  1K8A U;  3P8D A;  2IVW A;  1W1F A;  3L2W A;  5IH2 A;  1MMG A;  4DBH A;  3TQ7 P;  4KGV B;  4QQ6 A;  5GAN f;  2KXD A;  4FCY A;  2QI2 A;  2FO0 A;  4C0Z A;  1CSK A;  1R0C B;  3PT9 A;  2E6N A;  4X9D A;  4JJN K;  1S1N A;  1Q7Y C;  3RES A;  1OZ3 A;  4OMO A;  3JCM e;  2JTF A;  5GMK l;  2M16 A;  4C8Q G;  3OS2 A;  1Q82 U;  5GMK h;  1N9S A;  2DVE A;  2QG9 B;  4LNP A;  5D6X A;  4ELY C;  1I81 A;  5LJ3 j;  3I56 T;  2QQA A;  4J9I A;  2NUZ A;  1HD3 A;  2DL7 A;  3VS5 A;  2CZ0 B;  5J3B A;  2L5Q A;  2CP7 A;  2G6F X;  4ZN1 A;  1LOJ A;  2Y4Y A;  4KGZ B;  2A37 A;  2FPD A;  2X4Y A;  2CRE A;  5I2M A;  1NEB A;  1VQM T;  3CPW P;  1VQO A;  2LC4 A;  2DYB A;  1RAE B;  4UC4 A;  2BKD N;  2JTM A;  3HRT A;  4Z89 A;  2K79 A;  3E1S A;  1RL2 A;  4LXC A;  3O5Z A;  5D7U A;  1D0Y A;  2QEX Q;  1WA7 A;  4MDX A;  3G71 Q;  2VB6 A;  3CCJ A;  1Z9Z A;  1Q81 R;  1PKS A;  4QW2 A;  2ECZ A;  3O8V A;  4BI3 A;  1QCN A;  2BIV A;  2RJF A;  4PJM A;  1ZUK A;  4A53 A;  3GP8 A;  2RO0 A;  3EFS A;  2E5Q A;  5KYX A;  2ED1 A;  2J6O A;  4M78 B;  7AT1 B;  4C92 G;  4HT9 A;  3CC7 T;  2L3R A;  2JZ2 A;  3X25 B;  2CP3 A;  5KCO A;  2OTL T;  2H3J A;  1T3S A;  3OYM A;  4A4E A;  2RNA A;  3INZ A;  2CP6 A;  3UT1 A;  2AIR B;  1H3Z A;  3PGG A;  1MV0 B;  1SHF A;  2X51 A;  2CKK A;  3SB2 A;  2DA9 A;  4M7D C;  2NYS A;  2IPO B;  1GXI E;  2DZ9 A;  3FIF A;  4BE0 A;  3I55 T;  4ME7 A;  3J81 E;  4E7H A;  1G3S A;  3MKD A;  2LNV A;  4M75 B;  1U06 A;  2MWP A;  4E7K A;  1JXM A;  3E9G A;  2CP5 A;  1BKB A;  1VQM Q;  2GTJ A;  1Y07 A;  4KBM B;  3CCQ A;  1WHK A;  3L1A A;  1ABO A;  2HQH A;  2RQV A;  3KFV A;  5CKF A;  5FWC A;  2PNI A;  2D0Q B;  1WQ7 A;  2KRS A;  5CR2 A;  4B6M A;  1E6H A;  3CCQ Q;  5IXB A;  4QVD A;  3EHR A;  3FLG A;  3CCU Q;  1QVG P;  1JXO A;  1QVG A;  2O4X A;  4XTW A;  3LYI A;  3OYL A;  3VRZ A;  5HK0 A;  2F2X A;  2E5K A;  2D1X A;  3RR6 A;  3HL8 A;  4FU6 A;  1M90 R;  3JCM g;  1K73 R;  4M78 A;  4BDY A;  4J9F A;  1YHQ A;  2X4J A;  3CME T;  2A3L A;  1ZSZ C;  3REA B;  4DOV A;  4J8O A;  1PSE A;  4C5I A;  1VQ5 T;  2HL3 A;  1Q81 C;  4CC7 A;  2QQR A;  4M77 F;  2P4T A;  1KD1 C;  3KUF A;  2XDD A;  4B9X A;  1NYF A;  2DYI A;  2QK0 A;  5GAN 5;  1N27 A;  3EFO A;  3QYH B;  2L8D A;  3JCM b;  1G2B A;  4XU1 A;  4M7A C;  3VS1 A;  1R77 A;  1CKB A;  3HFN A;  4PJO A;  4J83 A;  2DO3 A;  2M1H A;  4Q5W A;  4E7S A;  5IAY A;  3EG2 A;  1SSH A;  4E47 A;  1Q81 U;  3TRE A;  4HXJ A;  5KYN A;  1UUE A;  3CC7 Q;  2RF0 A;  1V76 A;  4VUB A;  1W2B P;  2K5F A;  5GJV B;  5LJ5 h;  3TU4 K;  3CPW S;  4QVC A;  4F7U A;  3BDL A;  2ZPH B;  4IUT A;  2DD4 A;  2GF7 A;  3CCE A;  5D6Y A;  3GNF B;  4FM4 B;  1NG2 A;  4RG8 A;  3MCA B;  2F2W A;  1FWZ A;  5AT1 B;  4RTT A;  1VQL T;  4KRT A;  3C95 A;  1HXD A;  1YI2 T;  1IO6 A;  3NPF A;  3MPU B;  4XU2 A;  1WX6 A;  1QWE A;  3UWN A;  3ME9 A;  2RA2 A;  1CKA A;  2WSC E;  2OJ2 A;  2JN0 A;  1VIE A;  4JJC A;  2J7I A;  2K7A A;  1WHH A;  1BI2 A;  2CGH A;  2JTE A;  4HVW A;  1YFN A;  5CO7 A;  3EG0 A;  2KK4 A;  3QZ9 B;  1W4S A;  5IN1 A;  1TOV A;  2X9H A;  4E2F B;  4JPB W;  5FU6 C;  1YHQ T;  4JLI A;  1PG5 B;  4RCC A;  3OW2 S;  1JBM A;  3EGU A;  2NWM A;  3PFS A;  3MP1 A;  8ATC B;  4HCC A;  1B34 B;  2KYB A;  3H41 A;  3THK A;  1VQN A;  4M4Z A;  3MP8 A;  3CCJ T;  1NLP C;  4A4G A;  4OB2 B;  1YHQ Q;  1Y96 A;  4JRK A;  4PJL A;  2QAZ A;  5CCA A;  1NPP A;  1VYV A;  4KUD K;  1O9S A;  2V8K A;  3WVE B;  4LDY A;  1ZA1 B;  5GMK m;  2COY A;  1VQ4 Q;  3X28 B;  2H3E B;  4C0G A;  3VS7 A;  5GAO r;  4GLM A;  4IUP A;  2EYW A;  3NTI A;  1UE9 A;  1JJ2 P;  1VQO T;  1C6V X;  1UJ0 A;  4P5N A;  4BE1 A;  2HD0 A;  1WZO A;  2AHJ B;  4WTO B;  1OUL A;  1ZLM A;  2DK3 A;  3WXM B;  1OV3 A;  4LDU A;  1YI2 Q;  1IRX A;  2GFA A;  3CCS Q;  2HL5 C;  3P8H A;  5KCH A;  1M3A A;  2EBP A;  1I8F A;  1WQW A;  1WXU A;  2DBM A;  1NPR A;  4OGC A;  1G5V A;  2KXC A;  1QMC A;  1WHJ A;  4J7I A;  5GMK e;  4M7A B;  1UGP B;  4EMG A;  2KDS A;  1I5O B;  2M0Y A;  4WF2 A;  4LUD A;  2P4R A;  5GAM j;  3SEM A;  3OS5 A;  3MEV A;  2NUP B;  4C5E A;  4E7Z A;  3JRZ A;  4MZP A;  2QDL A;  1WXB A;  1FMW A;  1ZX6 A;  5GAM e;  4RTU A;  1B3Q A;  3A8H B;  5J26 A;  1Q7Y R;  2RPN A;  1MHN A;  4DBQ A;  2LX9 A;  3M59 A;  2FRW A;  2W10 A;  2HQE A;  1M2O A;  2RHY A;  4BUG A;  1GFD A;  5GAN 2;  2CSQ A;  2PU9 B;  3S3M A;  1TU0 B;  1AWO A;  2BE7 D;  3JCM c;  1OX8 A;  5DY9 A;  3PMT A;  1VQN Q;  2J06 A;  3OSV A;  2KRM A;  3ZEH A;  2MCN A;  4PJN A;  1TUD A;  3OBW A;  4J9H A;  5AYF A;  2JM8 A;  3C12 A;  4F17 A;  2A7Y A;  2C0O A;  4ANJ A;  4PFO A;  1XOV A;  2OTL Q;  2DRK A;  1SRM A;  1U5S A;  2JOY A;  1MND A;  5LJ3 h;  2DEQ A;  4KUI A;  1BB9 A;  3HSB A;  1QCO A;  2CS7 A;  3V7C A;  2FRY A;  1QVP A;  4Y91 A;  4M7A A;  1M8M A;  2OTJ A;  2YUQ A;  4M7D B;  3JCM W;  2YUO A;  1FMV A;  1KQ2 A;  3CXC A;  3GIB A;  4PJJ A;  3DB4 A;  1LNX A;  1SSF A;  1AZG B;  2C0I A;  4JZ4 A;  2QEX A;  2FPE A;  3G71 T;  3CQT A;  2QTV A;  2LTO A;  2J05 A;  2G3R A;  4X9C A;  2ABL A;  4XQ3 A;  5A0G A;  1SG5 A;  2GQI A;  2RM4 A;  1DJ7 B;  4M78 C;  2PUK B;  2HZY A;  2DET A;  4RTY A;  2F5K A;  2LJ3 A;  2M9U A;  2XMF A;  1YJN Q;  5A0L A;  2EPD A;  4M77 E;  5CKB A;  2QXF A;  1M9S A;  4BDZ A;  2VVK A;  1AEY A;  2OX7 A;  2LQK A;  3E2U A;  1VQN T;  1X01 A;  1K0X A;  2QQB A;  1M1F A;  1W2B S;  2P0K A;  2XK0 A;  1D1C A;  4LE9 A;  2EQI A;  1S72 Q;  4ZGD B;  3CC2 A;  1MV3 A;  5GAM g;  4BE2 A;  3J7A F;  3LWH A;  2MI6 A;  2JNG A;  1KSW A;  4BB7 A;  2QQS A;  4XK8 E;  4C92 B;  3L2U A;  4BD3 A;  3I5S A;  2P0P A;  5KH6 A;  2KBT A;  2LZ6 B;  4HCB A;  4HVU A;  1VQ6 Q;  3JCM J;  4C8Q A;  3VUZ A;  4AT1 B;  4F14 A;  1YIJ T;  3CCV Q;  2QDY B;  1VQL A;  3QJY A;  2LCS A;  2HDA A;  2F5T X;  2DXT A;  3A8G B;  3M0U A;  5LJ5 e;  4RKU E;  4C8Q F;  2MYS A;  4JRQ A;  4MZM A;  2ZAE A;  2KYM A;  3VYH B;  1Y57 A;  2LQN A;  2I0N A;  3VKI A;  2E12 A;  3H0H A;  1BIA A;  2EGE A;  1EX4 A;  1VA7 A;  5GAN 3;  2GFU A;  2ZPE B;  4ESR A;  2VUB A;  3URG A;  1YJW A;  5LJ3 d;  2D9T A;  2YDL A;  2R5M A;  4M75 F;  2VWF A;  4NL2 A;  1VQ5 Q;  1JU5 C;  2KR3 A;  1UGQ B;  4AFU C;  5LJ3 g;  1HYO A;  2X4W A;  4C8Q B;  4CRI A;  1B07 A;  4KGX B;  3LWI A;  2K57 A;  1D1A A;  2RI3 A;  4O5V A;  3CCM A;  2EJG A;  1X6G A;  4FSS A;  3QKJ A;  2SEM A;  3FJP A;  1KK7 A;  2JM9 A;  3EGX A;  3M58 A;  1ZBJ A;  1M4Z A;  3RDV A;  3H0I A;  4AMC A;  1YIJ Q;  3CC4 T;  2YUN A;  4M78 E;  5GAO l;  2DRM A;  2LDM A;  4J9C A;  1YJN T;  3EG9 B;  2GCX A;  3PVQ A;  2XU8 A;  4V2S A;  3CMA T;  5GAN g;  5FWB A;  3R6O A;  1VQK T;  2FG0 A;  2MAM A;  1GFC A;  4DBF A;  1BCO A;  4M77 B;  1MMN A;  1RI0 A;  3QDR B;  2KE9 A;  1AVZ C;  1K73 C;  2EYY A;  2YSQ A;  4PK4 A;  1WYX A;  2HEQ A;  1YNZ A;  1GCQ A;  2E10 A;  2JUF A;  3RKW A;  1QWF A;  1NZ9 A;  1G8X A;  6AT1 B;  2H8H A;  2LQ8 A;  3CCR A;  1HJD A;  2RJD A;  3OYE A;  2ZGW A;  2Y90 A;  1RAB B;  2KI7 A;  4IIM A;  5GAN j;  4X1V A;  3D7S B;  5KYY A;  1GCP A;  3OMC A;  3M55 A;  3MJX A;  1JQQ A;  1PWT A;  2RHX A;  4LUE A;  3KBG A;  2RQW A;  2AKK A;  2SRC A;  4EDU A;  4A4H A;  3R6N A;  3A98 A;  1YJ9 Q;  1YN8 A;  9ATC B;  4QQG A;  1OEB A;  3VS6 A;  2DIG A;  3CC4 A;  1I0C A;  1KFZ A;  3QG1 A;  3G71 A;  3OQ5 A;  4C5G A;  1VQL Q;  3VUB A;  3OYN A;  2HSE B;  2DZC A;  3ER0 A;  1X2Q A;  3JB9 J;  3EH2 A;  3M5A A;  3GNG A;  2MPX C;  2KQW A;  2QA4 Q;  1M90 C;  2DKG A;  4RTW A;  1YIT T;  4PJO F;  5FRN A;  3JCM X;  2P0Q A;  3DLM A;  3H8Z A;  2VXE A;  1LVK A;  4PNO A;  1K9M R;  5LJ3 e;  1N8R C;  3QWY A;  1LCK A;  1YIJ A;  3MO8 A;  1RLQ C;  4JZ3 A;  5M9O A;  4L6V 5;  1SHG A;  3CCJ Q;  3CD6 Q;  3PIP A;  4ATO A;  1WXT A;  1D1B A;  3HHT B;  1NYG A;  3E19 A;  3V8K A;  1D3B A;  1BI1 A;  3JCM P;  3CD6 T;  2FEI A;  3QYG B;  3Q1J A;  1EIF A;  3HPW A;  4A63 B;  1K8A R;  2RD1 A;  3OY9 A;  2E3I A;  2ZPB B;  3V7S A;  5I21 A;  1VQP Q;  1QVF A;  1KQ1 A;  3QXE B;  1GBR A;  1BK2 A;  1Y96 B;  4PJO E;  3LH5 A;  3OYG A;  1QVF P;  2DPP B;  3CBO A;  4LDV A;  1QW1 A;  5HY6 A;  4J5Y A;  2DIQ A;  4HA8 A;  3TCJ A;  3MEU A;  2KEA A;  4FT2 A;  4RUG A;  1PRM C;  1M1K R;  2EQJ A;  2CP2 A;  2LVM A;  3UA7 A;  1M1G A;  2QA4 T;  1K9A A;  2FZC B;  2CSI A;  3I5R A;  1ZUY A;  2HBW A;  2YLB A;  3QSU A;  3MEA A;  1VIF A;  1IHV A;  2A0F B;  1K76 A;  4LDW A;  1RAA B;  3M4G A;  4OP0 A;  2EGC A;  2KGT A;  4C92 A;  3LW5 E;  4J6X A;  1NLO C;  4N0A C;  2YXY A;  2L89 A;  2LMJ A;  2R58 A;  3QDF A;  3CCU A;  3TSW A;  2NLU A;  5C0M A;  3VS4 A;  2DTO A;  5GAM h;  1U1T A;  2ATC B;  1S72 A;  5LJ5 g;  1SF9 A;  2DER A;  2O31 A;  3CCR T;  4JS4 A;  5FU7 C;  3JAM E;  2CH4 A;  1X43 A;  3UF4 A;  3EG1 A;  2DXU A;  2QQ9 A;  1K9M U;  3S3N A;  3V8L A;  2K4Y A;  3VYG A;  1WHL A;  2GQV A;  1QVG S;  2V1Q A;  3OYK A;  1MMA A;  3HKS A;  3CCV T;  4ZTJ A;  2PQW A;  1O75 A;  1YJN A;  1RAG B;  2OAW A;  4J7F A;  2DTH A;  3E9F A;  3SFM A;  1M1K U;  1VYU A;  1ACM B;  4EMK C;  5KYW B;  3OA6 A;  4DBR A;  3CCL T;  4BI4 A;  3OYJ A;  3ZBD A;  3NFC A;  1UHF A;  1K8A C;  1H64 1;  2VAS A;  2Z0W A;  1WHM A;  4F7U E;  5KYU A;  4M7A E;  4MDW A;  4D6W A;  2JW4 A;  1AZE A;  2LX7 A;  2W0Z A;  2OTJ Q;  4IUV A;  3CC4 Q;  1IZ6 A;  3AHU A;  1F1B B;  3EGX B;  2XKO C;  3CMA A;  4JUV A;  3QPH A;  3CCM T;  3EFR A;  3AT1 B;  3X26 B;  2EVR A;  4XTV A;  1NEG A;  2LT4 A;  5LJ5 d;  1N8R U;  1R8O B;  3JB9 D;  1NM7 A;  1VQ6 T;  4M7D G;  5I22 A;  4KUL A;  1N5Z A;  3MP6 A;  2F1L A;  2CDT A;  3CME A;  1XJW B;  2DLP A;  1VQ8 T;  3REB B;  3OYH A;  1IHW A;  1IRE B;  4M7A D;  2RQT A;  4C8Q D;  4FYX B;  4C5H A;  1Q95 G;  2P84 A;  3L2V A;  1JEG A;  4LDX A;  1D0Z A;  4OMM A;  1AD5 A;  2CUD A;  5KYY B;  2X35 A;  4A54 A;  5FW9 A;  5KE2 A;  3RUX A;  2DL4 A;  2RQR A;  2PTK A;  2CT3 A;  2KNB B;  3VS0 A;  3EG3 A;  3N5B B;  3S6W A;  1WIE A;  1KQS P;  4XTX A;  2PVG B;  3U23 A;  1I5L A;  3M9Q A;  2AKL A;  4PJO G;  2NUP A;  1G3Y A;  3OYD A;  4IKF A;  1VOM A;  2RMO A;  5LJ5 j;  3JV3 A;  3BDU A;  2E64 A;  2CT4 A;  4M75 C;  4PKC C;  2B86 A;  2YHT A;  2L0A A;  2R57 A;  1QLY A;  1VQ6 A;  2DL5 A;  3DLL A;  2VC8 A;  1GL5 A;  4JRP A;  3CC2 T;  4HVV A;  1UG1 A;  2EAY A;  1YI2 A;  2ZPG B;  4R56 A;  3M54 A;  4J9D A;  1LPL A;  2O4X B;  3CXC P;  4OB1 B;  3GF5 A;  4M7A G;  3DB3 A;  2WSE E;  1M90 U;  1PSF A;  1PHT A;  1M3B A;  4LD6 A;  1C0M A;  1UDL A;  3HFO A;  5GMK j;  1VQK Q;  3M53 A;  1TUC A;  4Y28 E;  2C06 A;  2XDP A;  3L2R A;  2EQM A;  2ZZD A;  2CZ6 B;  2FZK B;  4J9B A;  1K4U S;  4PFP A;  3M56 A;  2VV5 A;  2YRC A;  4FT4 A;  4BY6 C;  4M75 D;  3GLX A;  4C92 E;  1RI9 A;  2K6D A;  1T0H A;  2EKH A;  3CEY A;  3V8J A;  3H9N A;  4R0K A;  4A4F A;  1NE8 A;  4OMN A;  2IIM A;  4RG2 A;  2V1R A;  4GLK A;  3I9Q A;  3NMZ C;  5A2Q E;  1QCF A;  1WDX A;  1WLP B;  3MEW A;  1I1J A;  3C94 A;  3ULR B;  3MHX A;  3F70 A;  1PD0 A;  3SWN B;  1RAF B; 
#chains in the Genus database with same CATH homology
 5GAO l;  2LDM A;  3HL8 A;  4FU6 A;  1YJN T;  3G4S A;  4M7D D;  3JCM g;  4MMK A;  3FB9 A;  4M78 A;  1KQS A;  2GCX A;  4BDY A;  4XAX B;  5GAN 6;  2XU8 A;  4V2S A;  3CMA T;  5CKH A;  5GAN g;  5IT9 E;  1YHQ A;  2X4J A;  3R6O A;  4O6J A;  1OI1 A;  3CME T;  2A3L A;  1VQK T;  2MAM A;  3OYB A;  4M77 B;  1WGS A;  1RI0 A;  4J8O A;  1PSE A;  4C5I A;  4DOV A;  2E70 A;  3OYY A;  3QDR B;  1VQ5 T;  1Q81 C;  4DOW A;  2QQR A;  4M77 F;  2P4T A;  1NJI U;  4M78 F;  1K73 C;  1KD1 C;  3KUF A;  3OMG A;  2XDD A;  2XD0 A;  3RIR A;  2R5A A;  4B9X A;  1VQP A;  3CCE T;  3RKW A;  2E10 A;  2JUF A;  2BUD A;  1NZ9 A;  5GAN 5;  3QBY A;  4HT8 A;  1N27 A;  2LQ8 A;  4PLL A;  2KAF A;  3CCR A;  2RJD A;  3QYH B;  3OYE A;  2L8D A;  4JLG A;  2ZGW A;  2QA4 A;  3JCM b;  1BIB A;  5GAN 8;  4XU1 A;  3T9N A;  4M7A C;  2Y90 A;  3L42 A;  4PJO A;  1Y7X A;  3HFN A;  4M78 G;  5GAN j;  1B34 A;  4J83 A;  2DO3 A;  2M1H A;  3FEO A;  4Q5W A;  5IAY A;  4E47 A;  1VUB A;  3LGL A;  3SD4 A;  1QVF S;  1Q81 U;  3TRE A;  3OMC A;  3RKY A;  3M55 A;  3G6E T;  1W2B A;  1Q86 U;  4QVZ A;  3LLR A;  2X4X A;  1JJ2 A;  3VJP A;  2RHX A;  3KBG A;  5GAO n;  4DA4 A;  4VUB A;  2K5F A;  5LJ5 h;  3TU4 K;  3A5Z B;  3UDC A;  4EDU A;  3CPW S;  4A4H A;  4QVC A;  4F7U A;  3BDL A;  2RI5 A;  2ZPH B;  4QQG A;  3G4S T;  4IUT A;  2EWN A;  2DIG A;  1UEB A;  2DD4 A;  4RMO A;  1MGQ A;  4J6W A;  3CC4 A;  2VYT A;  3QO3 A;  2GF7 A;  2K5L A;  5LL6 S;  5D6Y A;  3QG1 A;  5GAN 7;  3CCE A;  3G71 A;  3OQ5 A;  4C5G A;  3VUB A;  3CD6 A;  3GNF B;  4FM4 B;  5EG2 A;  4RG8 A;  3OYN A;  1VQ8 A;  3CXC S;  3MCA B;  4JRI A;  1JRI A;  3OBY A;  3OYA A;  1VQM A;  3RER A;  1D3B B;  4F7U B;  1KQS S;  2XDB A;  2DZC A;  3S3O A;  3C4S A;  1I4K 1;  2XG8 D;  2HNI A;  3ER0 A;  3JCM Q;  1FWZ A;  4M77 G;  3JB9 J;  3JCM d;  4E7L A;  3SWN A;  1VQL T;  3C95 A;  2CZ7 B;  3JCM h;  1HXD A;  3M5A A;  2EJ9 A;  2RHU A;  2KQW A;  3GNG A;  4XTU A;  1YI2 T;  1K9M C;  1JJ2 S;  2OAU A;  5DLQ E;  1Q86 C;  3JB9 G;  2XI9 A;  1M90 C;  3KXT A;  2DKG A;  5LJ5 f;  3I56 A;  3CBM A;  1YIT T;  4PJO F;  5FRN A;  4L5G A;  4PJO C;  3OYI A;  2WAC A;  3JCM X;  4XU2 A;  2P0Q A;  2XHC A;  3DLM A;  3H8Z A;  2K3Y A;  3UWN A;  3ME9 A;  2RA2 A;  2VXE A;  2D6F A;  2WSC E;  4L59 A;  4PNO A;  5LJ3 e;  5GAO q;  1UB4 A;  2JN0 A;  1KD1 U;  1VIE A;  3EAE A;  1N8R C;  2K5I A;  2CYZ B;  4C92 C;  5HKC A;  1BI2 A;  3CCQ T;  1M1K C;  2CGH A;  2RK2 A;  1OZ2 A;  1YIJ A;  3M57 A;  2KY9 A;  4OB0 B;  3I55 A;  3MO8 A;  5CAI A;  5CO7 A;  1KG1 A;  5M9O A;  4N0A A;  4L6V 5;  2KK4 A;  1FXX A;  1Q82 C;  3M4Y A;  3QZ9 B;  5I2S A;  4PLI A;  1W4S A;  5IN1 A;  4F7U F;  2HAX A;  3PIP A;  3JSC A;  2V8I A;  5L8R E;  5FU6 C;  4ATO A;  1YHQ T;  4JLI A;  3OW2 S;  2MWO A;  1ZQ1 A;  1JBM A;  3QII A;  4RCC A;  2XID A;  3LH0 A;  3PFS A;  3ZFJ A;  3OS0 A;  2K3X A;  3MP1 A;  3CCS A;  4HCC A;  4A4K A;  1B34 B;  3ASK A;  3HHT B;  4ZN3 A;  3E19 A;  3V8K A;  1VQN A;  3MP8 A;  1D3B A;  2VGM A;  3RKX A;  1BI1 A;  2E41 A;  4NL3 A;  3CCJ T;  3JCM P;  4C8Q E;  3CD6 T;  3QYG B;  4A4G A;  4OB2 B;  2RHI A;  1VQP T;  3LGF A;  3Q1J A;  1EIF A;  3HPW A;  4M78 D;  1Y96 A;  2LCC A;  4JRK A;  2FL7 A;  5GAO m;  4II1 A;  5CCA A;  4ZTF A;  1NPP A;  2OTL A;  4J6Y A;  4KUD K;  5GMK i;  2RD1 A;  1YBY A;  3OY9 A;  1O9S A;  2V8K A;  3WVE B;  4LDY A;  4PL6 A;  3QZ5 B;  5GMK m;  2ZPB B;  3V7S A;  3X28 B;  3JCM V;  5I21 A;  2RJE A;  1M5Q 1;  2XIC A;  1QVF A;  1KQ1 A;  1YCY A;  3QXE B;  4C0G A;  3J7A F;  4M75 E;  4RCB A;  5CKE A;  3JCM f;  5GAO r;  1Y96 B;  3H6Z A;  4PJO E;  3OYG A;  4IUP A;  4GY5 A;  2DPP B;  1WPY A;  3CBO A;  1TH7 A;  4LDV A;  1QW1 A;  5HY6 A;  3NTI A;  2DIQ A;  4HA8 A;  4J5Y A;  3TCJ A;  3MEU A;  4XTY A;  5CK9 A;  4FT2 A;  1VQO T;  1YJ9 T;  2DAQ A;  3OYC A;  1P92 A;  4P5N A;  2HD0 A;  3OS1 A;  4XTZ A;  4BE1 A;  1NJI C;  2AHJ B;  2EQJ A;  2LVM A;  2M0O A;  4LD9 K;  2DK3 A;  5CKD A;  5HK3 A;  2O01 E;  2B8A A;  3WXM B;  4M77 C;  3BFM A;  3NTK A;  1AHJ B;  4LDU A;  3RMS A;  1M1G A;  2QA4 T;  1WJR A;  2E1H A;  1QP2 A;  3PNW C;  4M75 G;  5C6S A;  1VQ7 A;  2GFA A;  2YRV A;  4N4I A;  4EPC A;  3P8H A;  1KC8 U;  4FIB A;  3MET A;  5KCH A;  1YJW T;  2RHZ A;  4NOY A;  5GAM d;  2YLB A;  3QSU A;  2EQK A;  5GAM f;  1I8F A;  1WQW A;  4IUU A;  3SWN C;  4B9W A;  3MEA A;  1VIF A;  1NPR A;  4OGC A;  1G5V A;  1VQ9 A;  4DQ2 A;  3JB9 I;  2CZ1 B;  4LDW A;  4J7I A;  5CVI A;  5GMK e;  4M7A B;  3CCS T;  4PJO B;  1UGP B;  2FB7 A;  4EMG A;  4PJO D;  3M4G A;  1G3T A;  2KDS A;  4OP0 A;  4C0D B;  4C92 A;  3LW5 E;  4WF2 A;  3JB9 H;  2PVO B;  4J6X A;  5LJ3 f;  5KE3 A;  3L2Q A;  4OMF B;  1UGS B;  4N0A C;  2EQU A;  5GAM j;  2L89 A;  3OS5 A;  4FL6 A;  3MEV A;  2R58 A;  4C5E A;  1U8R A;  3FDR A;  3JRZ A;  4MZP A;  1K73 U;  2EYQ A;  3CCU A;  5GAM e;  2ZPF B;  2NLU A;  5C0M A;  2DXB A;  2MMP A;  2I2L A;  4TVR A;  2DJZ A;  3TEE A;  4FSX A;  2DTO A;  5GAM h;  2F69 A;  3A8H B;  2K2V A;  5J26 A;  3CCL A;  1U1T A;  3OSS C;  1YIT A;  1ZBX A;  1XQH A;  1MHN A;  5LJ5 g;  1S72 A;  2LX9 A;  5GAN h;  3CCR T;  4JS4 A;  2RH2 A;  3PMI A;  3A8L B;  3M59 A;  5FU7 C;  3JAM E;  2HQE A;  2RHY A;  3OB9 A;  2FVU A;  4BUG A;  3QJ6 A;  2DXU A;  2QQ9 A;  1K9M U;  2LRQ A;  5GAN 2;  3S3N A;  3V8L A;  2K4Y A;  4KT0 E;  3VYG A;  2GQV A;  2PU9 B;  4NS5 A;  3S3M A;  1G3W A;  1QVG S;  4CI0 C;  2FYK A;  3OYK A;  1VQK A;  2MF2 A;  3LX7 A;  2EKO A;  3HKS A;  3JCM c;  4R55 A;  4IUQ A;  5DY9 A;  3CCV T;  3PMT A;  3OSV A;  3GPL A;  3ZEH A;  1OYX A;  4ZTJ A;  4HKE A;  3L2Z A;  1BI3 A;  2PQW A;  1O75 A;  4BY6 B;  5A0D A;  1XTD A;  1YJN A;  3OBW A;  5AYF A;  4J7F A;  3C12 A;  3QUI A;  3JB9 F;  2DTH A;  2VXF A;  3UPU A;  3RMQ A;  2A7Y A;  3E9F A;  4OF1 A;  3SFM A;  1VQ4 A;  4C92 F;  1M1K U;  4MZT A;  1N9R A;  2EJF A;  4E7I A;  1U1S A;  2RK1 A;  1XOV A;  3HRS A;  3P8B B;  5CQX A;  3NTH A;  3A8O B;  2E65 A;  2PVD B;  4EMK C;  5J39 A;  1KHC A;  3OA6 A;  4EMH A;  5D6W A;  4ZGE B;  2JOY A;  5LJ3 h;  4C8Q C;  3CCL T;  4BI4 A;  2WSF E;  3OYJ A;  2FHD A;  3ZBD A;  3NFC A;  3CCV A;  1K8A C;  2DEQ A;  4KUI A;  5CQY A;  1H64 1;  3HSB A;  5GAO p;  4M7D E;  2LCL A;  1JB0 E;  4M77 D;  2EFI A;  3CBP A;  5FU7 B;  4OGE A;  4IUR A;  4F7U E;  4M7A E;  4MDW A;  2VGN A;  2CS7 A;  1QP3 A;  2ZPI B;  4D6W A;  2EIF A;  3V7C A;  5GAN e;  3PIO A;  1VQ4 T;  2KSS A;  5FU6 B;  1QVP A;  4Y91 A;  4M7A A;  1K8A U;  2OTJ A;  3P8D A;  2IVW A;  4M7D B;  2DTI A;  2KVQ G;  4IUV A;  1FX7 A;  4OVA A;  3L2W A;  3JCM W;  1IZ6 A;  3GOX A;  3AHU A;  1V29 B;  1KQ2 A;  3CXC A;  1UGR B;  3GIB A;  3DB4 A;  1LNX A;  1SSF A;  2IG0 A;  4QQ6 A;  5GAN f;  2XKO C;  4X34 A;  1KHI A;  1LJO A;  2QI2 A;  4JUV A;  4C0Z A;  3CMA A;  2V8J A;  3QPH A;  3CCM T;  3EFR A;  3PT9 A;  5GAN 4;  4M7A F;  2E6N A;  4X9D A;  3X26 B;  3G71 T;  2QEX A;  2LT1 A;  3X24 B;  4OB3 B;  4JJN K;  4XTV A;  2LTO A;  1N6A A;  2LT4 A;  2G3R A;  5LJ5 d;  1Q7Y C;  4X9C A;  1OZ3 A;  4XQ3 A;  3RES A;  5A0G A;  5DM7 R;  1N8R U;  3G7Z A;  1R8O B;  1ZHI A;  2RM4 A;  3JB9 D;  1VQ6 T;  2HQX A;  1DJ7 B;  3JCM e;  4M7D G;  4M78 C;  2JTF A;  5GMK l;  2M16 A;  2PUK B;  4KUL A;  4C8Q G;  3MP6 A;  2F5K A;  3OS2 A;  3CME A;  4JS5 A;  3FC3 A;  1Q82 U;  2PUO B;  5GMK h;  2JVV A;  1N9S A;  2DVE A;  2M9U A;  1VQ8 T;  5D6X A;  4ELY C;  1I81 A;  2HBP A;  5LJ3 j;  3I56 T;  5A0L A;  4M77 E;  3OYH A;  2QQA A;  1IRE B;  5CKB A;  2QXF A;  4M7A D;  1X75 C;  2CZ0 B;  1M9S A;  4C8Q D;  4BDZ A;  5J3B A;  4C0F A;  4C5H A;  2L5Q A;  2LQK A;  4ZN1 A;  1VQN T;  5FRM A;  1X01 A;  4EMK A;  1LOJ A;  2Y4Y A;  2YLC A;  4E7J A;  3L2V A;  1BYM A;  2QQB A;  1M1F A;  2X4Y A;  1W2B S;  2P0K A;  5I2M A;  3OW2 A;  1VQ7 T;  2XK0 A;  3QHS A;  3VU3 C;  1VQM T;  4LDX A;  2KMT A;  4F7U G;  1VQO A;  3CC7 A;  2LC4 A;  4ELZ C;  2ZCF B;  4ZGD B;  1HK9 A;  1XNI A;  3CCU T;  4UC4 A;  3CC2 A;  2X35 A;  4A54 A;  5GAM g;  4BE2 A;  3V7R A;  2BKD N;  2JTM A;  3HRT A;  3RUX A;  5KE2 A;  3LWH A;  1VQ5 A;  2MI6 A;  2JNG A;  4YTL A;  3E1S A;  3BY7 A;  1RL2 A;  3DKM A;  4BB7 A;  3WVD B;  2QQS A;  3HRU A;  4XK8 E;  1BI0 A;  3N5B B;  3S6W A;  3SDZ A;  4C92 B;  4MDX A;  3BW1 A;  3L2U A;  3CCJ A;  4XTX A;  4BD3 A;  2PVG B;  1I5L A;  4QW2 A;  3M9Q A;  3O8V A;  4PJO G;  4BI3 A;  1YJ9 A;  2BIV A;  2P0P A;  3G6E A;  2RJF A;  1G3Y A;  5KH6 A;  3OYD A;  4A53 A;  3GP8 A;  4IKF A;  4HCB A;  2RO0 A;  3JCM J;  4C8Q A;  2QEX T;  3VUZ A;  5LJ5 j;  3CPF A;  2RI2 A;  2RB6 A;  2QDY B;  3BDU A;  1YIJ T;  3EFS A;  1VQL A;  4M7D A;  2E64 A;  2E5Q A;  3QJY A;  4M75 C;  4PKC C;  2F5T X;  2DXT A;  2YHT A;  3A8G B;  4M78 B;  3HP9 A;  2R57 A;  4C92 G;  1VQ6 A;  4HT9 A;  5LJ5 e;  3CC7 T;  2L3R A;  4RKU E;  3DLL A;  2VC8 A;  3VV0 A;  4C8Q F;  4JRQ A;  4EMK B;  3OYF A;  4MZM A;  4M7D F;  2JZ2 A;  1M8V A;  3X25 B;  4JRP A;  3CC2 T;  1WNL A;  3VYH B;  1VQ9 T;  5KCO A;  2OTL T;  2DD5 A;  2H3J A;  3OYM A;  2EAY A;  1YI2 A;  3VKI A;  2E12 A;  1Y71 A;  4A4E A;  1WJS A;  3INZ A;  2ZPG B;  3A8M B;  4R56 A;  3M54 A;  1BIA A;  4BAC A;  2O4X B;  4XU3 A;  3UT1 A;  4OB1 B;  1H3Z A;  3PGG A;  3GF5 A;  4M7A G;  4M75 A;  5GAN 3;  2GFU A;  2ZPE B;  3DB3 A;  2WSE E;  2CKK A;  2VUB A;  3SB2 A;  5GAN d;  1PSF A;  1M90 U;  4M7D C;  3URG A;  1GXI E;  1YJW A;  4LD6 A;  2DZ9 A;  5LJ3 d;  2D9T A;  4MML A;  3HFO A;  3FIF A;  5GMK j;  4BE0 A;  2R5M A;  3I55 T;  3M53 A;  4M75 F;  4ME7 A;  3J81 E;  4NL2 A;  4Y28 E;  1WJQ A;  4E7H A;  1G3S A;  2LNV A;  4M75 B;  2C06 A;  2XDP A;  1UGQ B;  3L2R A;  4M77 A;  5LJ3 g;  2MWP A;  2EQM A;  2ZZD A;  4C0D C;  4E7K A;  2Y4X A;  2X4W A;  4HCZ A;  4C8Q B;  3E9G A;  2CZ6 B;  1BKB A;  4XU0 A;  4CRI A;  2RJC A;  2DXC A;  1KC8 C;  1Y07 A;  4KBM B;  3CCQ A;  3M56 A;  3L1A A;  2OTJ T;  4BI8 B;  2VV5 A;  4FT4 A;  3LWI A;  1X6O A;  2K57 A;  5CKF A;  4BY6 C;  4M75 D;  3GLX A;  4C92 E;  2D0Q B;  1WQ7 A;  5CR2 A;  4O5V A;  2RI3 A;  5FLX E;  3J80 E;  3CCM A;  3CEY A;  3V8J A;  4C92 D;  5FRO A;  4JDS A;  2E6Z A;  2EJG A;  1S72 T;  4QVD A;  3FLG A;  4A4F A;  1NE8 A;  3QKJ A;  4N4H A;  3FRN A;  3PTA A;  2QTX A;  4RG2 A;  4Z02 A;  3CPW A;  4N4G A;  3FJP A;  4GLK A;  4QQD A;  3X20 B;  1QVG A;  3M58 A;  2O4X A;  4XTW A;  5A2Q E;  1Q7Y U;  1M4Z A;  3MEW A;  3C94 A;  3LYI A;  3OYL A;  5DLO A;  3MHX A;  4ZGJ B;  5CIU A;  3CC4 T;  3F70 A;  5HK0 A;  3SWN B;  4M78 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...