3QEGH

Crystal structure of human n12-i2 fab, an adcc and neutralizing anti-hiv-1 env antibody
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
234
structure length
216
Chain Sequence
VQLVQSGAEVKKPGSSVKVSCRASRGTFSSYGITWVRQAPGQGLEWMGGIIPIFDVTNYAQNFQGRVAITTDAEMSTAYMELRSLKSEDSAVYYCASDSRDFSHYYNIMDVWGQGTTVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human N12-i2 Fab, an ADCC and neutralizing anti-HIV-1 Env antibody
rcsb
molecule tags Immune system
molecule keywords Fab fragment of human anti-HIV antibody N12-i2, heavy chain
total genus 37
structure length 216
sequence length 234
ec nomenclature
pdb deposition date 2011-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qegH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qegH01
5HDLA 4XCNA 5C0BE 5J4MA 5F72S 3X12A 5IM7A 5C0CB 3QXUA 5IBTH 3ARBB 3BP5A 2IQ9H 3K2UH 4KUZH 1Q9OA 4NZUH 2HTLD 1IAMA 5L2JA 5CHNB 2ADIA 4EQ2A 5AYUL 1TCRA 4N90D 2VDPL 4HIIA 3S37H 3DXAE 1AKJA 4PRPB 2JJWA 2VC2L 3RL2A 1XR9B 3VDBA 5CEZH 4YHPB 1VCAA 4RMWA 1VFAA 2BSTB 2B4CH 5K33A 1R24A 2XACC 3DSFL 4K2UL 4HWEH 4K7FA 4NZJA 3U9PH 4JFEE 4P9HL 3O6MH 3NA4A 1HOCB 5E8OB 4PPTA 2VZOA 2ITDB 4O58L 1PFCA 4R2GC 5BO1L 1I1AD 5SWQB 1A6UH 1FZMA 1Z5LA 3MGAA 1WFOA 3B8SA 4OZHA 1KJ3H 3QO1A 1GGCH 4OZFA 4S1SH 2HT2C 3RDTC 2XA8L 1KEMH 4P4RA 5DT1L 1R3LB 3NAAL 5D2LE 1A6ZA 1X5AA 4PRDB 1PSKH 4XP5L 5CSBA 2G5RA 5D5MF 2FZ3B 4R97C 4TSCH 5EBGA 1JPFA 4XBEL 5DZLA 4G9FA 5C71A 1KFAH 5JXED 2BOCA 5HGBB 4B7LA 4JDTH 4E42A 1B0GB 5C0AD 2O5YH 3G6JB 1CR9H 3SE4C 1SVCP 2GHWB 3M07A 4HCRL 1SJHA 1W8OA 1T20B 3ARBD 2X4PB 5FDYA 4YX2H 4ZFOA 4V2CB 4OGAC 5GS1C 2BOBA 4R90H 1TCMA 5E8NA 3KPRB 2YZ1A 1NAMH 1CVRA 2R4SH 3L95A 5EORL 2IH3A 3L5HA 3ZT7A 1EEZA 2B7DT 3UDWC 4WW2C 3IJYA 2Q20A 2YN3A 4PJ8A 4X4MA 4JO1L 1S3KL 1WBZA 1XR8B 1NQBA 1U42A 4GXUM 1I7TA 4JLRA 3BT2H 3P4OA 4GJTB 3CDFA 4UT9H 5ERWB 3QUXA 4MJ5A 1I1AC 1OGTB 1A1MA 3VRLF 5EU3A 4HKZB 4PP1D 4OM1L 3OL2A 2CDFA 4MXQC 4OF0A 3VRJA 5DHXB 5BS0D 1JPTH 4WTZG 2VDML 3RUGF 3EOBB 3VXTA 4FTVB 1EAJA 4QT5B 5BZDB 2NNAB 4Z7QE 4KROD 3C60D 1JZ7A 3NFSH 4FQLL 2A6JB 4JHZA 5E2JA 4FTVE 4PJCE 3UBXB 1G7LB 2MKLC 1ONQB 5E56A 2F8XC 1MHPH 3QUZC 1UWEL 1XF4A 5CZXC 1F2XK 3BQUB 4S1QH 1OCWH 1HDMB 1PKQB 3BN9C 2C7UB 3GSQA 5E1HB 2VUYA 2FO4B 1WEJH 3VI4E 4GW5A 3FMGH 5GJSH 3FZUC 1EJOL 4KDWA 1RUPH 4X6DB 1D5XA 3D2UB 1NFDA 3RPKA 2EDFA 5F3HB 1SJEB 2AJVL 5CUSL 1SMAA 3W39B 3ULVF 4R90L 5E7FA 4UI2A 1JWSA 2PXYC 3EDJA 2Q1EA 3RJDA 1AC0A 2MNUA 3VXQA 2H6PB 1KCVL 4GG6F 4CGTA 4OCRH 1KELH 4Z0XB 3OKLB 2HN7A 1BIIB 2EDXA 3KPTA 1ZLVK 4IMKC 3BKJH 2KL6A 5EC2B 2MCPH 1JV5B 2F8OA 4WUKL 4H8WH 5J1AA 5EB9A 5GHWL 5JLZB 3HRZA 4GAJH 2H41A 1RUAH 1MY7A 3CLFL 5LGJB 3S36H 3WDHA 2RCSL 4P2RA 2GJ6D 5IFHH 5GRWA 4OKVA 4OZHF 1KTDA 5DMIH 4LDLB 1MRCL 4GRMA 3MGTA 5HXMA 3U2SB 3E3QC 3D69B 1MFCL 4Z7WB 2A6IB 1YEKH 2IQAB 4CL7A 3E6FA 2FATL 5EC1B 1PAMA 1QSFE 3U48A 4TTDD 1D5MA 4U1IA 3L3IB 3VGBA 2JTDA 2QR0B 4FABL 2ZUTA 2J6EA 1X4ZA 4ZQKA 1BBJA 4WW2A 4U0RC 3LPFA 3VXPB 1KBGL 2CGRL 1OL0A 1WBXB 5J3HD 1Z3GH 4NNYA 4NDMB 2AI0H 4K8RH 1QLRA 3VMOA 4ZXBB 1IJ9A 4KY1H 5ADPL 1MFEL 3TJHC 2LU3A 4L1HA 3ARUA 4IHOA 4MDIA 5CINH 1WQVT 4TN9A 1RJZB 3TT1L 3C5SA 4I18C 4PGZA 2QQLL 5C0CA 1WCQA 12E8L 1TJIL 4R97B 4IIQB 4QHLA 2HJLB 1T04B 4OFYD 3DX7B 1J0ZA 5AZ2H 4J23A 3ET9F 1K5NB 1X5JA 1JMZA 5T1DH 5DEGA 1JVKA 1MFDH 3MJ9H 4YR6A 3MA7A 3LEVL 5C6PB 3T4AB 4DTGL 1JYWA 4M03A 1RHHA 5E03A 3WFEL 4PJGA 5C8JB 1DBKL 2IANA 1EXUB 5EO9B 5BJTA 1YC8A 1VFAB 3JTTA 4RISH 4A2MA 5HI5D 1JGDB 1V7MH 4ELMF 5T1MA 1QFHA 3ARXA 3DMMC 3VFUA 5TGBA 1X4XA 4KUCD 4JDVB 4X83A 1NMCB 3HE6C 3T0EB 4PLJD 3WNNA 4OLXL 2YPKB 4FXGA 4BQ6A 3RX8A 5IM7B 5FOBB 4Y5XC 3Q2CA 4M7ZB 1UWGH 2VLJA 3MRRB 4Y19E 2I5YL 2AJSH 3DECA 1YYMH 4ZS6D 5EUOE 3A67H 1T2XA 5IQ7H 4F80A 3QUYC 4KJYB 3MJ7A 3VGGA 4PRPA 3AM8A 5F88B 3UTQB 1DBAH 3LQAL 3RX5A 2R0KL 2DWDB 5T33L 2ATPA 2GY5A 1DQDH 3NGBB 3ZE1F 1MCOL 1UVQB 3KYNA 1U8HA 4F58L 3C5ZC 3TT1H 1VSCA 4LLVB 2VITB 1NCWH 3HB3C 4HXAL 4Z7UE 1F11A 1R3HA 2AJYH 3P9WB 4OM0L 1EEZB 1PY9A 5GRZA 1M6OA 2H9GA 3STZA 3C6LD 4HZLB 1JRHH 1FORH 2OP4H 3VDCA 2QHRH 1HHHA 1I9IH 2JELH 4OZFG 2XNAA 4M6NH 4I0PD 1ZT1A 4QXUH 1U91A 4L4TE 2Q7YA 4KK6C 4OZFH 1OP9A 3SBWA 5J1TC 5DRXB 4KK5C 3BZEB 1NAMA 2GITB 3NZ8A 3DARA 4Y4HA 4FZ8L 1RZKL 4XCNB 1G7QA 1NGXB 4W4OC 3NIFF 4WO4D 5DI8A 2I60H 1P4IH 2Z8WC 4YHLL 1AR2A 4X6EA 4WFHD 5GS2H 1BQLH 3UBXA 4XPHL 3FT2B 4BA8A 1M7XA 3D3VA 3VXMB 3GMRA 4PJ8B 1GPOL 3OJDB 1F8TH 2NY5L 4XCYB 4X7FC 4YGVB 2WV3A 4Q74A 4XVUC 5HD8C 4Z7VF 4YEEA 4M7LT 2CLRA 2IBGA 3MRMB 4U1MB 5H8DA 1XGYH 4YHOL 3FQWB 1MJ8H 3ALWA 4PLNC 3PHOA 4RAUB 3T1WA 5E5MA 5F3HA 1HI6A 3LRGA 5C7XH 1G1CA 4MVBD 4JKPL 1HQ4A 2DQTH 3OKDB 4U1KB 3TH4T 3IFPB 4GAFB 4F7EB 1OAYH 3DETC 5I19L 4X9GA 4GAYA 5T1LA 4LSSH 5L2KD 3OAUH 4KV5E 3BKYH 4YXLL 1SM3L 5HHNB 2GY7B 3H8NA 1UACL 1T03H 4R2GB 3MLSL 4GG8B 1NDGB 5DSCA 2Q7NA 2PXYA 3KHQA 3QO0A 3V2AR 5LGKA 2AXFB 2Q87A 1AD0B 4HX1A 5FO9A 2WUCL 4XCCL 2P5ED 3BDYL 5I1DB 3OXSB 4R3SA 1WFUA 1FG2A 3QUML 3WIFA 3IS0X 3EOTL 3LKSB 3FRUA 4WO4B 1T20A 4ZFOB 2R8SH 4WY7H 4NSKA 1U6AL 1YUHB 3L9RA 1T2QH 2GJ6E 1LEKB 1JWSB 5MEQA 4D0BB 3R4DA 2YD6A 4Y16D 1MAML 2PXYD 4XCEA 2JCCB 3THMH 1REIA 4KK8C 1NMAL 4DEPC 3STLA 2E8YA 3LQMA 3V4UL 4APQA 5KN5A 4GUPB 5EOQL 5FUOL 4XPHH 3QPXH 3O41A 4KQ4H 2F74A 1OAZL 1MAJA 4QOKE 3MRDB 1CBVH 1QSVA 2EDOA 4C4KT 4NRYB 1D9KD 1E4XH 3MV8A 2QR0A 4MS8C 2H45A 4X7DC 2YPLD 3VWJA 2B4CC 4P5KA 4OT1L 4PJDF 1NCDH 3BXNB 3HNSL 4NPYA 5D1ZB 2CR3A 4B53A 4CMHB 1KACB 2EEDA 4WWKD 4C83B 5I1CH 3DVFA 1DQTA 1QRNA 4MAYD 1QEWA 4PRAB 1C08A 3GSUA 1Z9MA 2CLVB 3C5ZB 3SBWC 3OAZH 1RVFL 1ZS8A 1TPXB 2OR9H 3PDGA 2YUZA 4QGYA 1TJHL 5MEPB 3VXRB 2FD6L 2FB4H 2XQBL 4R4FH 1RSFA 2WP3T 4GKZA 5DFTA 5CD3A 2A9MH 4PUBL 4LAJH 1FYHB 1HINH 4YNYB 1Y6KR 3F7QA 3EYOB 5BZWB 1LGVA 1FRGL 3DVIA 2R1WB 1D5MB 3CH1A 1RAMA 1CFVH 4EXPX 2EH7H 3S88L 1HZHL 5KSBF 5F6IC 1MCIA 4ZAKA 1PKOA 1YPZE 5I1IH 5GGSB 1K8DA 4YR6B 1LE5B 3U7YL 4MZ2A 4S0TD 3EBAA 1I1FB 4KXZI 5J13B 4Z77B 2BRRH 4NWTH 4I13B 3MZTA 4HH9A 1BLNA 1BEYL 2Y72A 4M02A 4Q0XL 3VGEA 4PJHA 3IKCA 2UY7A 2PO6A 3B9AA 1P7QA 3ARDA 3ARSA 1A9EB 5I1LA 1ZGLM 1I1CA 4JDVA 1KCVH 4HK0A 4LSDA 4RGNC 4CADB 4JRXA 1ZKAA 2EKSB 5DO2D 4MDIB 7CGTA 5AD0B 4KI1A 1DL7L 2VYRE 3L7EA 4KJWC 5T3ZE 1Q72H 3G5ZB 2DQHL 4P2RB 3JV4A 1S7WB 5FA4A 5IFAL 1SEQH 5BQ7A 3E2HB 3B4NA 3W11D 1KJ2H 3Q5TA 4CN4A 4XRCA 1FL3A 4OIIH 4TPRL 2VL5B 3QXWA 4JM2C 5ICYA 4Z7WA 4W4NA 1MIEH 3G08B 3ECBA 5C07D 4ONOA 5I8KH 3FTGB 3DROB 5EC1A 1ZV5A 4OFVA 4U1NB 4F7PB 2VWEE 3LSOA 2BK8A 2FYYA 1HWHB 3IFLL 3MUGA 5JDSB 4YDVA 2BY2A 5GGRA 5J13C 5JHDA 3BZFA 3PQYA 3V52H 5IESH 2F19H 4ZNEA 4X7CC 4MSWA 3PWNB 4XAWH 5DHVH 2AK4D 1ZHKA 2O5ZL 2NTSP 4FG6C 4ZUUB 4TNWK 4GKSB 1TVBB 4F33B 3GBLA 2X5PA 5D93C 2XG4A 4NZTH 5DQ9B 3IJSA 1ZT1B 5IP4A 1RFDL 4X6FA 3QWQB 4WFFD 1RZJC 3C2SA 4LQ1A 4K3EL 4UQ3A 1KSRA 2YBRA 2DAVA 3PDDA 3W0WA 3RUGB 5JO5A 3VG9C 1FNEB 1GZQA 4KI5C 3VD3A 2AV7B 4Y5XA 4U1LB 2AEPL 4TVSa 2Z35B 4BSWB 2G9HB 5IB2A 3IB4A 5IVXA 4KXZH 1Y18A 4CVXB 4U1HA 3GFUA 4LKCB 3O2DA 4YK4B 1TJIH 1FJ1A 4ENEC 3MLZL 5IFAH 3PV6A 3UTZB 3BKCH 1YECH 3AC0A 5J9PB 4LSPH 4XCYA 4PGCA 4LOUD 4B5EA 3G6DL 2XNAB 4K3GA 4DOHB 4ZYKB 4NZRL 3WFCH 2V5SA 4NN6B 3DRQB 4HBQA 5IHUH 1BWMA 1QSEB 1A6TB 1FBIL 1UENA 5I8CB 2EH8H 3S8WA 1NUFA 1FG9C 2AGJL 2R1XA 3ZDYF 1RULL 2J6EL 1RMFH 1I9JL 5DMGC 3KJ6L 4P99A 5HDQL 5E1AA 4BJLA 2V7NA 1TZHA 4U1GB 4EJ1C 3QJHB 5C0ND 3RNQA 1HSAB 2QV2A 3MNWB 5AWNL 5C6TL 3U46B 3FB7A 3OV6A 4TVPL 3OJDA 2GTZB 4FRWA 3UTQA 3O2DL 2DLGA 4Y89A 5CJXA 3QPQD 1RIHH 4XHQA 3ARFB 4I3SH 5DD6A 2Y7QA 5DUPL 1LWRA 2VDLL 2QSTA 5ISZB 1ND0B 2VDNH 3AREA 4JO2L 4NSKB 1MELA 3VCLA 3IXAB 3LY6A 4X9HA 1OAXL 1HQ4B 3MUJA 5F9WB 2BHYA 4NQEB 4L3CA 1JHKH 1F11B 1SY6A 5LAXA 4R7DA 2O93L 1QVOA 1ZEAL 1BP3B 1Q1JH 5JW5B 1MFNA 4WFHE 2CMRH 2GUOB 1IKFH 1XF2A 4QXTA 3O45B 1UA6L 5DLMH 3NH7H 4FQJL 2YUXA 1X9QA 2QEJA 4LU5H 1Y0LA 3SE9H 3UZEA 3CX2A 3KXFE 2GT9B 2VXQH 4M5YL 3WEXB 4XNZB 4PJIA 4M8QB 2X4SA 1OY3B 3P77A 4U7KA 3MV01 3S5LB 2EH8L 3GMLB 2C1PB 4FP8L 2BCKB 2BMKA 4RGNB 4R9HA 3QNYA 3SCMA 4OZGA 3FCTA 5LJYH 3QH3A 3BRDA 2Y07L 4CW1B 5HDBE 5HTSA 4K3JH 2ARJQ 2WWKT 3KPSD 4K7FB 4U6VH 3JV6A 4M1DH 2R2HA 4FFZL 2YHGA 4DUXA 1ZHLA 5CEZD 3CNKA 1HH6B 4FQCL 3F58L 4LF3A 1JPGB 5EZOL 3QWRD 2NY7L 2DLFL 3HI1A 1R3LA 3PHOB 4C59B 2GIYA 4BQ9A 5K9KA 1QFOA 3KPSA 5L0QC 4G8IB 3FQNB 1PZ5B 2WQRA 1B0GA 4H5SB 3VE0B 4YHNB 1Q1JL 2CLVA 3C5ZA 4KPHH 5HD8D 5HI4C 3VXRA 5CILH 5I1JH 3GUTB 2DQEH 3OAUL 2BY0A 4IRJB 3VI3F 4YXKL 3VFGH 5M7QA 1WICA 1FGNH 4L3EE 2ADIB 1EBAA 1WIUA 5HGHA 3RY6A 4Q9RH 5HSFA 4GBXC 3ARDC 5DHYB 15C8H 5EU7C 3BDYH 2CQVA 5IBLC 4ZFGL 5D7IA 3I6GA 5B3NA 3QJFA 2XN9B 5FEBA 4I2XB 5SX5H 5D2LB 3DURB 2E8ZA 4QRPD 3OAZK 5MEQB 1FE8H 1KJMB 3P9LB 2ZUXA 4JFHE 1IGIL 3OZ9H 3STLB 5E5RB 1BLNB 5K9OB 2V2TA 4Q9QL 4LSUH 5CCKL 1L6XA 1N0XL 3SDYL 2YSSB 2H26A 2PO6B 1AXTL 5DJ8B 4U1NA 4F7PA 3ZTJG 4Y4KA 1NC4D 1IM9B 4HGWB 5L7XH 1T1ZA 4X5WB 1NCBH 1TJGH 4QT5A 5F3BB 4WI5A 4UIMA 3R1GH 2BDNL 3ZTJH 4IRJC 5BRZA 4M6AA 1XGPB 2F54E 4UT6L 3TEUA 1WWCA 4P4KA 4P2OC 4HJ0C 1YNLL 4GSDL 5I2IB 3GSNA 4NJAH 3SGJA 5B22A 4KTDL 2AJUL 5FA4B 5IHZA 4N8VA 5BXFA 5IR1A 5GGVH 3EFFA 4ODSL 2FO4A 2Y06H 4K94L 4U1SB 2BJML 3L3GB 4UILH 1KCUH 4D9RE 1F4YH 1I7RA 1L0QA 2VERN 4AM0B 3G08A 4OFKA 1N5YH 4G6AD 2BNQD 2WBJA 4PY7A 4NC0B 4JRYE 4YNYA 4ZOEA 3MJ6A 5C09E 2R2EA 4ODHL 4HBCL 5GS0H 2APVA 4OTXH 1U8JB 3KYMB 3QUMA 1K2DA 3KWWB 4J4PA 3V6OC 5E70A 1AH1A 4Y16A 1CFVL 3VD5A 3S88H 3PV6B 3ARGB 3PWNA 4APQD 1RU9L 1BJ8A 4KVNL 4YJZL 5FHBL 4IOSD 4NO2A 1LE9B 3BRGC 2YEZB 1VADB 3U0PB 2ADGA 1HWGB 1A9EA 3ZHDA 1FFPA 5EBWA 1SYVB 3AU1B 3D2UD 2J4WL 1NBYA 2QQKH 4QRUA 3MMEB 3F12A 3QDMB 5DJYA 5L7XL 3TO4C 4FFVD 1JTOA 2A1WL 2BVOA 1K85A 1DANT 3JUZA 4JFFE 4JFDB 1UM6H 4EVNA 5JOEA 3G04B 1PQZB 3EW3B 4GLRH 1OOAA 1YEDB 4LRNL 4E41D 3KR3H 5DDHB 5IW6A 1LO5A 2BNUB 3MJ8B 1INQB 1G7IB 5AYQA 2W9DH 4N0CD 5AZEH 1MCDA 2VMFA 3CK0L 4JQVC 3E6HB 1BOGB 1DN2A 3QCUL 4WEUD 5ACZB 4FQXC 5GGUB 3K46A 1IL1B 1SEQL 4P2OB 1GCFA 3MRIA 4UILL 1DDHB 2Y7QB 1MCKA 4O9HH 1U8LB 2V5YA 1ZLUH 1WAAA 3LN5B 4NM4L 4Z7QF 1AGFB 3BJLA 1KC5L 3OKNB 4ZXBA 4ZOBA 4OB5L 5I1EH 3L5WA 4YE4H 1FNHA 5L9DH 1G7MB 4O2FB 1A8JH 2AVGA 2IH1A 4IEFB 4ALAL 3F62A 4Z95L 5C2UB 3HKFA 4I48B 5HHOD 5CJ8A 4L1DA 5HHOE 4RMTA 4S0SD 3B8YA 2F5AL 4OLVH 1A9BA 2YMXH 5IB4B 2FGWH 4DWHA 1UM5L 3CFKA 3G9AB 4GT7A 3X11A 5DD0H 5C0AB 1Q9KB 2GJZA 4OKVB 1OB1B 3HNVH 3OG4B 2ZOLB 4LFHG 4GRMB 4ODUA 3DUUB 4KDVA 2X1OA 4KZEL 4NQXA 1HNGA 4OLYH 2X70B 2HT2D 3SCMB 3FCTB 1VEPA 2H1PH 5LQBH 2OJEB 1FC1A 5B8CC 3Q1SL 2RFXA 4U6XA 2NY5C 5E6IA 3HG1D 4V1DA 1T5XB 4N9OB 3KR3L 3RVTD 3OR7A 2VQTA 3UTSA 1S5HA 1YMMD 3KPQB 5CIPH 4XHJC 1NLBL 3PF2A 2MKWA 4OCLC 2IFFH 4FXGB 2YPKA 3MLWH 4ZFZB 1WWWX 3VWJD 4DQOH 1O7SA 1MJ7H 1ZE3C 1U3YA 3BAEL 3O8XD 1RQ5A 4ZYKA 4XXDB 4U6TA 4OF7A 5C9KA 5M94B 1A4KB 1M4KA 5IVOA 2DQGL 1C16A 5DJZB 1PDKA 3QDGA 3GSNH 3UPCA 5T3XD 4MAYA 4GS7C 1UXSB 4RDQF 4WUUB 4Z7NE 5ISZE 3KPSB 3QIBD 2GSIA 2AK4A 5EFIB 2R1XB 1Q94B 3GMLA 4I3RL 2C1PA 2IAMB 4M6MH 5MERA 5TFSH 2B20A 1Q9LA 2P43B 4JN1H 5KS9A 5DTFB 4FOMA 4YPJA 5I8OL 1U41A 2YC1A 1JGEA 2GSGA 3F7VA 4YC2B 3IKKA 3MROB 3O9WC 3QHFL 1CQYA 2VXTH 4KMTH 3RTQB 4CVWA 4HUUA 5KJRH 2LABA 3U9UB 4PY8I 3HA0A 1K5NA 4PD4K 5C2BL 5DJCB 4NBZB 2DLEA 2FIKB 1U8MA 1F6AB 4U0RB 2NY6B 5DYOB 5DGQA 4M48L 5I1HH 5C08E 1D5IL 4YBQD 1XF5A 4AEIL 3VJ6B 3S34H 3AREB 3P4LA 1TITA 4I2XA 2EXWC 2X4TB 1U36A 4CKVX 1U91B 2DICA 1UCBL 3FO0H 1MPAH 1BWWA 3DV6B 2DWEB 2FWOB 2VDOL 2NY1C 3GSRB 3NZ8B 4JEGB 3ULVD 3WKNA 5SX4H 4QF1B 2V9TA 3L3HB 2AXGB 1VEMA 3QQ3B 3T65B 4WFEE 2B1HH 4XMPH 1WUNT 4ETQA 4ERSH 3OGCB 2K7PA 1UH2A 1P7KB 5HYSB 2X05A 5IV2A 3NH7L 3GSOB 1YEHH 4AIZA 5I0ZA 4LPCA 4Y4FA 1FSKC 5DHYA 2J8HA 3QYCA 3NFNA 2CKNA 3BISA 2NXZD 4NKDA 2WIIB 1NMBL 3BW9A 4R8WL 5GZOC 1I3GL 2P49B 1XMWA 2OI9B 2OL3L 4Z7OE 2XWBB 5DQJA 4DFHA 3TJEL 1RIVL 4L29B 1B4JL 5ANME 4OCNC 4RGOH 5KSAB 5TE7L 3EOAA 3KNBA 5FB8B 2GFBB 2YKLH 1BZQK 3W2DL 1S8DB 3QXAA 4MXVE 5IB3B 1PVHA 2H26B 5EU4A 5CEZL 1INDH 1KN2H 4NN7C 3TO4B 4POYA 1MIMH 2APBA 4XP6H 1T1ZB 2EZ0D 2X9WA 4X5WA 4YQXH 4X6CA 2D31B 4PJHF 1X3DA 4GW4B 3D9AL 3T0EE 5INCA 3B2UD 4E41B 1NDGA 1FQ9C 5DSCB 2VE6A 5TDPB 3NA9H 4AMKL 4TRPL 4LEXH 2BSSB 3OXRA 4K9EL 1FNAA 2HYMA 4F37K 5FM5O 5DQDL 1R3IH 2NLJA 3D0LB 5SWQA 1DBMH 4TOYL 1CXHA 4X5XB 1UCBH 3VD4A 4EN3B 5IMKA 4XPFH 2QKIA 4WU5A 4ELKB 2NY4B 4CRPA 3M45A 3FONB 4RZCB 1D5ZA 5JR1L 3SKOB 3N1QC 3WS6A 4M1CD 1OT1A 4JPWH 1CXEA 1AQDA 3GIVA 2Y6SD 1WC7A 4JZJB 5D7LE 4MS8D 5I9QB 1EMTL 3AY4A 3VW3L 4AENA 3ZL4L 1ERNA 4R96A 3T8XB 4MA3B 1OSZB 1A3RH 2FJHB 3FQRB 4F7CA 1B2WH 2LV4A 1FLRL 1FP5A 4NRZA 4LHQB 1CXKA 5D6DA 4RNRB 3TFKD 4LOUC 1R6VA 3BWAA 5IK3A 1RZKC 1RV6X 3B5HA 5GRXG 1SJVA 2EDNA 4D3CH 3W0WD 1KCSL 3WL9B 2ZJSH 1WFNA 1N6QH 1CLZH 4LLWB 2Z4QB 3RGVA 1JGUH 3IYLW 2YPLE 4YC2C 5MHSE 1G7MA 1IGTB 1KGCE 4OSUH 4OZ4A 3TBWA 3CAFA 5J89A 4HKZA 3SDAC 4UNVA 4OM1H 5KS9F 2FJFA 3FQXA 3WIHA 4PTTA 3CFKB 1JPTL 4OGYH 2R1WA 4G8EA 4QCIB 4U7MA 4MNGE 4PG9B 3VFPA 3CD4A 4PJ5A 2OZ4H 4WFED 3O6KH 1E4KA 4JRXE 2JJUA 5CAYB 2DM2A 2UZXB 3D18A 1GGIL 4Z77A 1OAKL 3UYRL 2W92A 3SKNB 1FFOB 1WEJL 1E6JL 3NIFE 4LSTH 3D25A 4TSBL 1QBLH 4E41E 2DTSA 3KPQA 4CADA 3EFDH 3U30C 3WNKA 4YDLB 1I8MB 1OSPL 5F9OH 3BPLB 3I3BA 5AD0A 4PJBE 3RQ3A 3X3FL 4Z6AT 1A2YB 3FHQA 1QRKA 3VG0L 1UWXK 1WBYB 5BQ7B 2IGFH 4PRHA 4G8GD 4WDIA 3E3QE 4ODUB 3P0YL 2GW5A 2IPKA 4KVCL 4NOBA 4MXWH 3GM8A 5FA3A 1CLYH 1MF2L 3I50H 1G9ML 2BXYA 1X5HA 3GHBL 5FUZH 4DZ8B 1IM3B 4Q9BA 5JQHC 3NPSB 2F54D 2C1OB 4GMTL 5GRYA 4PJ9B 1G7IA 3BD3A 4LHUG 4KUCF 2HKHH 3IS1X 1EO8L 1Y6NR 2IAMD 4L4VA 3U9UA 3WYRA 1BOGA 4UB0H 1IEAB 2E7BA 4TTGA 3EO0A 4WCYH 1U8MB 1Z5LB 2OZ4L 3MFFB 4PJEF 1ZGLB 4OJFL 3P0VH 2EC8A 3U83A 3SDDB 4P46A 3LN5A 5CIPA 3PWPD 2XKNA 2NY3D 4NHUA 2EYRB 1ADQH 4WUUA 1MREH 4O4YL 4NKIL 1EIBA 3OQ3B 2ZCKH 2P8LB 4EN3D 2IAMA 5MERB 2WNGA 3DMMA 1AGBB 1L7IH 2E7MA 1I8KA 1FO0L 1MVUA 1N8ZA 4XI5C 3DI3B 2AV7A 1T1YA 2FX9H 2W65A 1CTOA 1VENA 1KG0B 2F58H 1JZ5A 1D5BA 1DP0A 3MRFA 3BGFC 3X11B 3I3DA 1CF8H 4L8SB 3S35H 5DGRA 1Q9OB 5KOVC 4QLRA 2YMXL 4MGXA 3FN0L 1KXQE 3UYPA 3MCLH 4BM7A 4P3DA 4Y4FB 2C26A 3QI9D 1IC4L 3EYVB 5DYOA 2BHZA 3MRLB 1IAII 3DMMD 1WBZB 3TPUB 3MBXH 1OW0A 5DHVB 1JZ2A 2YPLA 5ITBH 4WI9A 3EYQD 5JOFB 3C09B 1I8IA 4WUUE 2RFXB 4U6XB 3WFHA 4H20H 5AZ2L 3CZFA 5KSAA 1VFBA 5HYSG 2PYEA 4CNIB 3N85H 1F6FB 1QBMH 3AXLB 3AS3A 4P9ML 3R8BB 3QIWA 3FN9A 3VFTB 5IUSA 1A3QA 3PDOB 3WFEH 3QEGH 1JTPA 2QLVB 1XCQB 4JJ5B 5DURD 3CSGA 3VFRB 3DX6B 3QEQE 3LS5L 1XAUA 1QKZL 4XXDA 2PW1A 5J57B 2MQ0A 2HFEA 5B4MC 4PREB 3D3VE 2IFGA 4PJEE 4XP1L 3O3BA 4X6FB 1A6UL 4XH2A 3NFNB 3TZVA 3ILQD 2AK1H 4NKIH 2YBRB 5D7LA 1MJJB 3BVNA 4XNQB 3E0GA 3FO9B 3WBDA 4CVUA 4XPAH 2Q76A 1JZ4A 4BH7B 5DTFA 4EN3C 4G43A 3HFML 4RAVA 4P2YA 3I85A 1GGYA 4G7VH 3MV7E 5KG9B 3KPRA 3QXAB 4Y4HC 1NCCL 5F88A 3H0TA 2XV6B 2D0FA 1H3PL 1WSST 1G7PA 4L8BA 1KN4L 3FN0H 4OUUA 2A83A 2VXTL 5I75B 4HS6B 5T33H 2XZCL 1F58L 4U3HA 1QP1A 4M7KH 1A7NL 5L6YL 3X3GL 3MCG1 1CK0L 3MC0A 5ERWA 1JF1A 1N2RB 3QFJB 5I71C 4GBXB 3EJYD 2E6QA 1EHLL 3MV7B 2R1YA 4A6YA 3EDDA 8FABB 5IMLA 3QIUC 2Y1VA 3HZVA 1LO2L 2BVTA 5CJQH 1U95B 1KIRB 3GBML 5HVGB 4ETQB 1RZ8A 3VGHA 4R0LB 3SPVB 2YA0A 4OZIF 1OM3H 3CH8A 4UDTB 2IC2A 1FL6B 3A0OA 4WWKC 2IQAA 3QIUB 1UWXH 2CK0L 4EI5D 5EOTB 1MI5E 3FB7B 3T0BA 1SBBA 3G5YA 3LPGA 2E27L 4NKOB 1DZBA 4I5BA 5KTEH 2VLRE 3SJVD 4QRQA 2OTWB 4OV5B 4ZO9A 1HHJA 4LSRH 2XG5A 2QSCL 3ZE0E 4PG9A 5I6XB 2DIAA 2ICWB 1P4IL 4FFVC 4YHIA 5HBBA 4RGMC 3IDGB 4IRZL 2HT3C 1AR1C 3KPOA 1NEZB 1D7FA 3DTXB 3NVQA 2D2OA 5EU4B 3ROOB 3G5XA 4XGZA 1XIWC 2AQ2A 3MBED 3A6CH 1M7DB 1VGKB 3W2DH 3SKNA 4P2QA 1CG9A 2FECL 2K1MA 4MNQB 1ED3B 2VIRB 5DUMH 3D25B 3G6JF 4PJGE 4APQC 4CMMB 4KC3B 4JKPH 4IHOB 1QFWI 3IVKB 3BZ4B 2OZ4A 4HKBA 4N0UE 4M62L 4U33A 4JZOB 2HVJB 3VXSE 5E2VL 4LEXL 5I19H 4EDWH 2Z93A 1BOYA 2MCPL 5C0CE 2BNRB 5J6HB 1SBSH 2HT4D 2BMKB 3O2WL 2ZUQB 3BPCB 4DVRL 2V2XB 4OZIA 4ELMA 4BZ2L 3ZDXF 3JV6B 2RCSH 3QHTC 3S3PA 2VDKH 4H88H 3EOTH 1F3DJ 4JZJC 3JWNC 4LLUA 4ZUVB 1NGPH 2PCPA 1W2KT 4PJ9A 5C0EA 1K3ZA 5KTEL 4O2CA 4MB4A 2NY4C 1MHHB 3T0EA 3HHRB 3L3IA 1KJ2B 3BGMB 4IRJD 1OWRM 2NPLX 4XVTH 3RAJL 1UYWH 1H8SA 1FFRA 2R0ZH 1EDQA 1GAFL 1KFAL 2VLJB 2R2BA 2BVYA 3LIZH 5A2LH 5GZNC 1G6RA 1AD9B 3SE4A 3I6LE 4NCC2 3BFOA 4WHYH 4HKJB 3WSQL 3L3GA 1PLGL 1U58A 3H9SE 3B9KA 3GUTA 4F2MB 5F96H 4AM0A 3PNWA 5E2TL 5SWSB 1LNUB 3HZMB 4X5LA 3PE9A 2DDQL 1MCCA 2VABA 3VDAA 4ZUSA 3EYSL 3L3OB 1S9VA 5ENWB 3P3YA 5HHXL 1PX3A 2APFA 5BW7C 4HWEL 5J3HC 4YAQB 3QDJD 3OWEA 2RQ8A 1R3KB 3D0VA 3EO0B 4C55A 3HC3H 4JPIB 5HVWA 1N59A 4J3OC 5FYJH 3HUJB 1RHHB 2A9ML 3MLTA 3MV9A 1FZJA 2UY6A 4G7YH 4ODVH 4Y16C 2XKNB 5K9OA 1RZIB 5T1KA 5AG9A 4BZ2H 1UZ8A 1MFDL 1KLUB 4HD9A 1FGVH 3QI9C 1VFBB 5EDXA 4TUKL 2YA2A 7FABL 3P73B 2V17L 2PYEB 1P53A 4XXCC 5C08A 1CICB 5CMAB 4C56D 1NFDE 5GS0D 2BVPB 1XF3A 3DX6A 1YNTB 2WQ8A 5EN2A 1AGEA 3TP4A 1MI5B 1BECA 4F7MA 3PGFL 5DJ6A 5I1LB 1DVFD 3N06B 4L3AA 3VFVB 5IR1B 1WLHA 4TUJA 1MFAL 3KJ4C 1ZT7B 3GJEB 5HHVL 3WXVH 1N6UA 2VISA 2IPKB 5JA9A 2AJVH 3L3DA 4L5FH 5CSGA 2NQCA 1S3KH 4P3WA 4S2SB 4JQVA 4K9EC 3X14A 3QUXD 3LMJH 4E9LA 2CLRB 1KIUA 3MX0A 4MJIA 1G9MH 4RAVB 2AEQH 4RWHA 4GS7B 3WIHL 2OK0L 1AHWA 1KJ2L 4ZODA 1FL3B 3SE3C 1DUZB 4XVUD 4HFWA 1RZJL 3ISWA 3MV11 2HMID 4TPRH 4HS3A 2HWZH 1B3JA 1J8HB 3NOIA 5F6HJ 4N1HB 5E6ZA 4O2EA 4S11A 3LHPL 5C3TA 3VGDA 2HFEB 3N0PB 1F13A 2MPAH 3OKEA 4YO0B 1RHFA 2FSEB 4M1CC 5TDNA 4HJGA 5BV7C 2HTKC 3IAGC 3SDDC 3N1PC 2JCCE 1OLZA 4MJ6B 2NX5E 4R3SB 3KHOA 1HYSD 2UWEE 3LDBC 4GKSA 1KYOK 3I9GH 4MA7L 3HPLA 5DFWH 2R4RL 4QXUL 4KTEH 5LGHH 1YUHA 3TVMA 2FATH 1EHNA 4P5MA 4NZTL 4HXBH 5ESAA 3OJMB 2W9LA 1NFIA 2Q6WB 5MENB 1LK3H 5GIRA 1T5XA 1G7PB 2E5EA 2RR3A 4GUPA 3T2NH 2GKIA 2F54A 1CE6A 1DLHB 1FNEA 1GZQB 3PWVB 2IBBA 1QD0A 3MRLA 4LCIH 4O5LL 4L8DB 1AY1L 1F2QA 1S5IH 1YN7B 4OF3A 2I60L 2X6MA 1AC6A 4WFGE 2NY0D 5TF1H 2VLKD 4JHWH 2D4DA 5E4EB 3FQTB 5B39B 4OZHE 3ARED 3RVTC 5KVMC 5FKAA 3TCLB 2OMBA 5BCAA 4L4VD 5T3ZD 2MHAB 4IDJL 1FJ1B 5HHMB 5HHPB 4M7ZC 1JZ3A 3BP6A 3P0GB 3KLSA 5GPRA 4EBQH 1G6RH 3ROOA 5KSBA 2R56L 1U95A 3HI5H 4R26H 4OD1L 3VXUD 4KRPD 4GAYB 4G9DA 1JNHA 2FHFA 2NY1D 3HE7B 5CEYB 5DMIL 4I0PA 4WRLA 2HMIC 3GNMH 5D1QA 5GGSY 3X12B 5MEPA 4KZDL 3JZ7A 4IDLA 1BM3H 4HS8H 2W07A 2EXWD 3IVKA 1LHZA 3EYUL 3FB6B 5FO9B 4I5BB 4ENED 2AGJH 2XZZA 3U6RB 1NSNH 5TE6L 2P8MB 4KI5F 4WHTA 3VXOB 1HHJB 2R23B 2ZKHH 4XNUL 3DSFH 4XAKE 1T5WA 4YUEH 5C0BA 4LQFH 1ZA6A 1OGAA 3QA3B 2BSTA 5D1QD 4R2GD 2UYLA 1BX2A 2E9JA 3H9YA 4ODBD 3UP1A 3KPSE 4H0IA 1S5HB 3KLAA 4QXGL 2C3XA 1AFVL 3VFOA 4UT7H 2A0LC 4M6OH 5TQ2H 3L3HA 3MRDA 1NGQL 4HPOL 1IGYB 3VCLB 5E4IA 1EJ6A 1AHWC 1ZWIA 2VZ1A 2ZG3A 4NN5C 2B0SH 3SN6N 5D5MB 1N7MH 4NQEA 1G7HB 1HXYA 2HJFA 1JHKL 3GMOB 1ZLSL 3L7EB 1XEDA 5B3JE 4P23C 4NPYB 5D1ZA 3ULVE 3GKZA 1V7NH 2Z93B 1AO7A 4XNXL 3HE7D 2R2BB 5LBSL 1JL8A 3VWKD 3PP4H 1KV3A 2FEEL 2DYPB 4NKDB 5DVMA 1AD9A 1Z2KA 3ZE2E 4GRLD 5DEZA 2QQQA 1J86A 5KSVA 4LU5L 3QZWB 1PYWB 1ZS8B 2XRAL 3TN0C 4F2MA 3H6JA 3R0MA 3O4OB 5JW3H 1MHEB 1OAUH 3KPMA 1LNUA 1NCNA 3B2UC 4YFLF 3TT3L 1FYTE 3P77B 4KKBC 4ZUVA 3U0TA 5BZWA 5D7KD 3RIAF 3P30H 1SVZA 1RVFH 4KROC 5EIIB 3VJ6A 2XQBH 1CL7I 4XHJD 3BIAX 5DC0A 1N59B 2VE6B 5TDPA 2YD3A 3FOMB 4MA8L 1MHCB 1OP3K 1T7ZA 4FA8A 2XZQL 4P57A 1JWMB 5CJOH 1IC1A 2I5YH 4XP5H 5GZOD 1J87A 5DQ9A 3MV9E 4EN3A 3PGDA 2FBJH 1AQKH 2EDRA 5IQ7L 1HNFA 1UEMA 5I73C 4BZ1L 2NY7H 5KBNC 4PJFF 1DTUA 2A6KB 3FJTA 4BH8A 1NC2B 2DMCA 2BFVH 2DI9A 4HPOH 1IAIM 4RGMB 5EZJB 5B38G 3RWEB 4BKLA 1N5AA 2O26U 3CVHB 4BSVA 1N0LA 3M17A 1ONQA 4EIZC 2G9HA 5IB2B 1FAIH 3U79A 1HILB 5IT2H 4X98B 3QI9A 2HKFL 5JIPA 1NCWL 1HDMA 5IROC 5EO1A 3FQRA 2AJYL 5DK3A 2OTUA 3CGTA 3H9SA 3NN8A 1MJ8L 2E6JA 1SBSL 5F1SA 3D85A 3RHWF 2DQCL 1WIOA 1DANU 2JIXB 5IFJA 1VACB 1J0IA 3FTGA 3REWA 2OXGA 5DF0A 1NGZB 2R0WL 3M1BB 5C0GA 1T3FB 1SYSB 3TBVB 5DS8A 1A4JA 4FG6D 2VO5A 3OKLA 3KDMB 1JHTA 3ARVA 1HIMH 1QLEH 2NY1B 4KKCC 3U4BL 4O51B 1RZKH 3SE8H 5IFHL 1DE4B 1MLBA 5E1AB 3WDIA 1JCKA 1H3VA 2J1KA 1HHIA 3IDNA 1WJ3A 4F33A 2VR5A 4MAYC 1U3HD 3SDAA 3Q3GB 5F9AC 5LGJA 5FYLE 3KS0H 3VWKC 1ZGLP 2NW3A 5LWYH 1WV7T 4XC3L 4OZGE 4P5TA 3C6LB 3F7YB 5HHQB 5FIEA 2RJMA 1GRWA 2YR3A 6FABH 4JY6B 5I2IA 3V95A 5KZCB 5EOQH 5FUOH 4D9LL 4FN0A 4CU8A 3O8XC 4NO0B 3TVMB 3EFFB 1GXEA 4P5MB 1Q0YH 4OQTH 4RBPH 3MLXH 2ZG1A 4JR9L 2HTLC 3FFCA 2PTTB 3B3IA 3SO5A 1BFVH 2JB5H 3GI9L 4RWYL 4LHJB 4WJ5A 3W81A 3W9EA 5JW5A 2IF7A 1CE6B 4EXKA 5B3JF 4ZOAA 1A6VH 3PQYE 3BWAB 2EDTA 2VXUL 4PGCB 4KKAD 3MLYL 4DGIL 2R2EB 4LLMA 3CSBA 1T03L 4ODHH 4PBXA 3OKEB 5KVDH 1NC4B 2Q86B 1SHMA 4KMQA 4XVJL 1JYXA 1JZ8A 4ZUTB 3T0ED 3L5JA 4WFGD 1KGCD 1O5DT 3HMWL 1RUAL 3SO3B 4KJQC 4RSVA 3ESUF 3HMXA 3HI6L 3P4MA 1UB6B 2OX5A 1JWUA 3EHBD 3MYJB 3IFNH 2V17H 3BGAA 5HI5C 1CS6A 5CEYA 5IHUL 1NANI 1TVHB 1I85A 2ZCHL 4TUOA 5DJDA 3OKOA 3VXUE 1FRGH 4AL8H 4U6YB 4QHKJ 1IGJA 5H94B 2IBZX 2MSPA 5I74B 2CDEB 1RZ7L 1FNLA 3VXUB 1U3JA 5DJYB 1R3JB 4IOFC 4FQIH 1WTLA 1UM6L 2IG2H 4HSQA 2CJUL 3QNXA 4P0DA 5KANG 4R6UA 1G9NC 1P2CA 3VWKB 2LVCA 3MXVH 4TVPH 4M61A 1K8IB 1I4FB 3L5XH 4DGYH 1IBGL 2P8PA 5FGCB 4N9GA 4KK6D 1JZ6A 1IT9H 3MNVB 2JB5L 1ES0B 1FCGA 2WUBL 2AJSL 1LO3L 4I0PB 3S4SA 1N8ZB 3QPQC 4X6DE 3RWDB 1ZLVH 4FMKA 4X4XA 5A2FA 5ADOL 1I1YB 1QFPA 2DTML 1EEYB 3WUWB 2P24A 1G7HA 2VLKE 3ARTA 1A0QL 5IJKA 2J5LC 1HYRC 4NP4L 4G9FD 1HKFA 3ZT5A 1QZ1A 4EIGB 1MIEL 5IMOB 4I0PC 4WEBH 3EYFA 4OZGB 4YDIL 5JXEA 2RHEA 3DURA 4HF5H 5L0QB 3CVIH 3MBEA 4TSAH 1DBKH 4N68A 1U8HB 5D1ZC 4Z7VE 1DEEA 4OGXL 1V7ML 3NCFB 1ADQA 2MQ3A 1JRHL 4IJ3C 1OF2B 3T08A 1UWEH 3VGFA 1DLHA 1OCWL 3WLBB 2W0KA 1B88A 3QEQA 5LCVH 2HT4C 4ZNEE 3MXWH 5FO7B 1ZWIB 2H1PL 4K3JL 2DLIA 1JPGA 2MMXA 2V6HA 3WJLC 1IARB 4Z7UB 3R06A 5FKAB 3HUJF 2MHAA 4DEPB 1G9MC 1UWGL 4TYUA 1XGPA 3MRKA 1KXTB 2ZCLL 1MFBH 1RY7B 5E8OA 1AO7B 3FO1A 3FQUA 3VFMB 5IIEA 1DBBL 1RUQL 4X6BB 4DN4H 4OZFB 1AGBA 3DMMB 2LQRA 3PGDB 1IT9L 3BVNB 3QEQD 4XNQA 1T66C 4NO5A 1ZAGA 4AG4H 1WVZA 3GHEH 1ZA3A 1C7TA 3LDBB 4XNZC 3DO7A 1NGXA 3SE3A 3MGOB 4JN2B 3TWCH 5E2WL 2PUQT 3NTCH 3DUSA 5HVHB 2X89D 2F53E 5MP6H 4L8BB 1HILA 4KKLC 5HGHB 3C5JA 3ZDZF 3ZHKA 1I1AB 2IALB 4G6JL 3ELAT 2NX5D 1L4IA 3FB5B 5I8OH 5DD3L 5D7SL 2HFGH 1GJIA 2OTUB 3FOMA 4K8RD 3BESR 3VFGL 3ZTNH 2ZKHL 1OAYL 4YFEA 1CGVA 3DOSA 2UYLB 3WFHB 4PJHE 2R0LH 2L0DA 5GSVA 1EA9C 1T1XA 1NGWA 3DVNB 3AUVA 2J8UB 3QIBC 3O2VL 1ITCA 4FQ1H 1EHAA 2FHCA 3TBVA 1IC7H 4AQ1B 4F15B 2YD4A 1P6AB 5C0NC 5DJXB 5ICXA 4HIJA 1JPFB 2BC4A 1IGIH 2Y23A 3OZ9L 3RKPA 5E24E 3QEHA 1BF2A 5A1AA 5F8RC 1JI2A 3M17B 2ADJA 1OGTA 3X17A 1F3JA 3MLUL 1KBGH 3GMMA 1AXTH 1PQZA 4P4KB 4JRYB 4OCYL 4G8GB 2JJSA 4NYLA 2Z0BA 4NQCB 5CGYD 2JK5B 2MWCA 5ILTL 4XX1G 2B1HL 3VXRD 5KAQG 1MAMH 5KVGL 2F8VA 3QZWA 3MRIB 3C6LA 3WD5L 4KI5E 3RUGE 4LASH 1NUNB 4Y2DB 2DQIH 2JIXA 3P11L 4LVOC 5IEHA 4DGVL 4HPYH 2EXYD 4Z76B 1A7PL 1H3WM 3G5XB 4AYFA 4ZNCD 4FNLH 5CZVL 2HFFA 2AS5M 2VC2H 3RZCA 4LCYB 4AZ8A 3MV8E 3KWWA 1RJCA 2FX8H 2CO6B 4WV1C 3W9EB 4EUPB 4Z5RA 2DIBA 3ME0A 5IB3A 4L9LA 5JQ6H 5SV3A 5C09B 1YQVL 3ZSSA 3K2MC 3TBTA 1TZGH 5IHBA 4OF8A 4ZUTA 2XQYG 5T5NG 3VG9B 2V9RA 1KIRA 2YD5A 1RU9H 2V9QA 2BSSA 3OXRB 1ORQA 4LLDB 3EJZC 4Q6IA 5J1AB 1IQWH 1U6AH 4MDJA 5DUPH 1U3HC 3JWOL 4WI8A 3TIEA 2OJEA 3TIDA 4JREC 3AM8C 3OB0K 2W60A 1T1WA 4FQCH 3EYOA 1VGEH 3HPJA 1NMAH 1D5XB 4MNQD 2DQDH 3QIWD 2ARJA 3OF6A 3O6FC 5T1LD 4AENB 4AH2A 4KROB 4ODXB 1UGNA 3CC5B 3TO4D 1GC1H 4G6KH 3V4VL 1DQDL 2R4SL 5FGBA 4FQJH 3I75A 4LSVH 2EE9A 4PR5A 3IRPX 4IRSD 1LQSR 4U7SA 3BN9D 3L6FA 5MI0B 1K8IA 3HN3A 2VR4A 1YY8A 2E7CA 3SCMD 4MNQA 2PR4L 4QTHB 2W59A 2DM7A 2JF1A 4HCRA 3O3DA 1LO4H 1WAAF 5D2NC 3RA7L 2G5BA 5HVHC 35C8L 1I7ZA 3N9GL 4QWWD 2OR9L 3BX7C 4UT9L 4NNYB 5E9DE 1X4YA 5GJTL 3UC0H 3ZKSD 2V5RA 3HR5B 4QO1A 4JFPB 4LRIC 2X7LB 2XICA 2VJXA 2NW3B 4X7SH 1TZGL 2D7PA 5F7UA 1J0KA 1EGJL 3IF1B 5BW7A 2HRPH 4Z8FH 3HUJA 4G6AC 3F58H 2VL5A 1XF5B 5T3ZH 5TQ0L 4QTIH 2X1WL 3U7YH 1YYLH 4DKFL 1G6VK 1H9VA 1CD1B 3NFPB 3VFPB 4L4TA 2P8PB 2YWYA 2E3VA 2FNBA 4GG6B 3AS1A 1J1PH 3BZDA 2DQUL 5GJSL 1J8KA 1KTRL 1EV2E 2DQDL 1TETH 4OLYL 2NY0C 4HJ0D 4X6CE 1EVTC 5LQBL 1UQSB 4NQED 1MJUH 4JHAL 3QQ3A 5F97E 1A14H 4HMDA 2P5WB 3BH8B 3IGAA 1A3LL 3LQAC 3GBNL 1QSFA 1MOEA 4WV1A 1V3KA 1U93A 4RFEB 4FMFA 3GSOA 3IJSB 2WM0A 1TPXC 4HKJA 4L8CB 3AS2A 1OSPH 3VFMA 3C5SB 2DL9A 2GSIB 3MRBA 3K8KA 3WKML 1FL5A 2HRLA 4H8WL 1L0XA 1P7HL 4FFYL 4PRPE 4MJIB 1RUKL 5GGQL 4ZUSB 5LXGL 4BSWA 4GAJL 4N0FB 3GIZL 1IGJB 5H94A 4LSPL 4YAQA 4Y4KD 1KEGL 3DUSB 5J56B 2WINB 3O6LH 3CFIC 1F6AA 4JQIL 1AR1D 1MCRA 5C1MB 4ACPA 4UTBH 5BVJA 2AEWA 4QEGA 4GH7B 4LLAA 1YEKL 4WU7B 4NJ9H 2ARWA 3BP4B 4NQCD 3ULUH 1QSEE 3VWKA 1T21B 1MUJB 3SDXB 4L4VB 4UIKL 2NXZB 1RJLB 4UT6H 3LS4H 1JHLH 4UNTA 4NCC1 2Z8VC 4GRLA 1RMFL 3DV6A 2WAHA 1KB5L 1IILE 2A2QT 1DSFL 1WITA 2FX7H 4DOHE 3H42L 1RFDH 2QSVA 1E4JA 3QXVA 3O8XA 3MRRA 1FFNB 1V8HA 3SDDA 3VWJC 1WBXA 5DRZB 3B5GA 4WNQB 1EUTA 3TYGL 4Z0BL 4D9QE 3WJLA 2CXKA 3WN5B 4EDXA 1E4XL 3GI8H 1ZHBB 1WT5A 3LAFA 3F8UB 4XI5D 1WC7B 1Z3GL 4HUMB 5C07A 5IJVB 5TE4H 4PGBB 4YK4C 1RZGA 4W81A 2IALA 1T6VN 5BVPH 4DW2H 5SWSE 1FVEB 4DKEH 4MNGB 1A7OH 4O9HL 5J06A 3EYFB 3D85D 5JHDD 2XWBA 3S97C 4Z9KB 2O61A 3QDGE 1DQML 2DQJL 2J8UA 2Y9RT 4MCYA 3GIZH 3WMSA 2JJVA 5EA0H 3MODL 4E0RB 1MCEA 3SKMB 4PLKD 1FO0A 2F5AH 1JGLL 1YY9D 1MLCA 4LHUD 4O2EB 4RGOL 2QADC 5KVFL 1UM5H 4M5YH 3VA6A 3CZFB 2WBKA 4XNMA 2YD9A 4OLWH 2VB5A 2ZOKB 1JUFB 1INDL 1KN2L 3QHZL 2M1KA 1JNNH 1QBML 4P9MH 2WWMD 4DN3L 5CGYC 1FVCB 5H2BB 2I07B 1T7VA 4NKMA 4WHTB 3VXOA 5DR5L 3WFDH 3ZKND 4U1JA 4MD4A 5HYJD 5I6XC 4LHUA 3QCUH 3MO1B 1EFQA 4FFZH 1TFHA 5D8JH 1INEL 2A9NL 4Y2DA 1MRFH 4P2RE 1AQDB 3T4YA 4WWID 2BXZA 4XC1H 4YDKL 1I1AA 3MUZ1 1NGYA 4PJIF 5HHOA 2A6DB 4X7TA 4LPXA 4HUXA 5F1OB 3FB8B 4DKEL 4ZDHA 4LLYA 4RNRA 4LVHC 3IFPA 1E0OB 3OKYA 1U3HA 1T2JA 3SDAD 1C5DA 1QFWL 2HJFB 3QRFM 2EICA 5D96B 3QR2A 3LRHA 4LK4A 5IVZB 4U31A 4JFEA 2DQJH 2NY2B 3O41B 5IW1A 1T83C 5D2LF 1ACYH 3ZSTA 4JN1L 2ESVA 1L9NA 2PXYB 5IBTL 4HWBL 3SGKA 1D6EB 2CIKB 3W5MA 4KZEH 2YPVH 5C0RH 3LKRA 2F19L 1T0PB 2G5BB 4O00A 1NAMB 2GITA 3IDXH 1F5WA 1CGWA 5C2BH 5EOCL 3CJJA 3AB0C 4NYLB 4F7TA 5DJ2B 3BMVA 1CFTB 3CFEB 4XMKL 5I1AB 1YEJL 5CJ5A 1XGUB 5FECB 3T3MF 3CFCL 2CH8A 4OI8A 3SPVA 1ZA6B 3QA3A 4XPTH 3HE6B 5D2NA 3JXAA 5DK0B 1H3GA 3BUYB 5FYKL 4MWFB 3LEYL 4ODXA 4WFFE 4GKZB 3V0VA 3IETB 1XZ0B 1BBDH 1B4RA 3SOBH 3RWFB 4QYOA 3CH1B 3CUPB 4DGVH 3LVEA 3HZYB 1I9RH 3BPOB 5DUBB 1I7UB 2IADB 2DQFA 2NXYB 4H8WC 4BH8B 3ILPA 4I3RH 2ZUQC 2FHBA 4KTDH 3KPOB 4X4ME 4ETYA 4S1DC 4Z7VB 5GGVL 5FGCE 4JG0L 1U92B 3MPCA 4KKCD 3UJIL 5BRZB 4M9OA 1QEWB 4PRAA 2P5WA 3FAXA 4EI5C 3GSXB 3IFOB 3RPIA 4K7PL 2COQA 4OKDA 1QSFB 4JY5L 1IAOA 1R0AL 1YJDC 3KS0J 3ZKNC 3QO0B 4U1SA 4E5XA 3TJHD 1CCZA 3IDYC 3KGRA 2PETA 3TNMA 3AGVA 1DQJA 1JPSH 1LO0H 5IVXF 3WDJA 4NT6B 5FA3B 5EORH 4DCQA 4KKLD 5JOFA 2WBJB 3V6ZA 4JB9H 1CDBA 4WW2F 3TIDB 5A40E 4HC1H 2W60B 1MIML 4WW1B 5D7IF 3BRFA 4PLOB 1VA9A 4IOIA 3B6SA 4PRID 2ICEA 1YDPB 1K2DB 2J12B 3UTPD 5FXCH 4MQXD 2R69H 4FQPA 4OD3H 1J88A 4XPTL 3C5ZD 4LPWA 3BE1H 3SGDH 3UTTB 3MV9D 1EHXA 1CU4H 4H88L 2Y25A 5IEKA 2HLAB 5CIPB 1WZKA 1W0YT 3LSOB 5DD1H 1HKLL 1AXIB 1FFQA 5BS0B 4XWGL 1ETZA 5JHDB 3ALXA 3V7MA 4PRDA 2A6KA 2FO1A 5IB1B 3EO1B 4MD5A 1MVUB 1I3VA 1Q0XH 1S9XA 1WF5A 4QKXB 1YEIL 1S7XA 4OFDA 4F3FA 2C3GA 1RUMH 1ZHBA 4N0YH 2GEEA 3GSUB 1C08B 5DRNA 2IJ0C 1IAIH 2YD8A 3LEXA 2BOBB 2GK2A 4Y5YB 1S7UA 4J1UA 2EC9T 4KKBD 4P3DB 3X13B 4JPKH 2YD1A 4NM4H 2IQ9L 4HS6A 1S9YB 2Q3ZA 5ENWA 2FB4L 5D71H 1WT5C 3QUZD 4WI4A 4HG4J 1HXMB 5I17B 5KAQF 4RQQA 1J5OH 3S37L 1DCLA 3MRNA 4PRIB 1B0RB 5ESQA 4JFZL 4HGKC 3VFWA 3L7FA 3RI5F 5LKNA 3VA2C 1BD2A 2VDRH 2ZUVA 3AXLA 3WHXA 3MV9B 3MLTB 1FHGA 2CLZA 1UQSA 2YUVA 2J4WH 1KOAA 3NZHH 4LL9A 5MEOA 1UZ8B 5C0DA 1X6NA 1BFSA 4EOWL 5JR1H 1Z9SA 3WE6B 1PKQE 3U0WH 3DJ9A 4JQXA 3T0AA 2QADB 5ABDE 4WI7A 5C07B 4DFIA 3N85L 2ZUWA 2IMNA 3UO1H 3RUGA 1DFBH 1J9CT 2M8XA 4JRXB 4MCZA 1OT2A 2OQJA 2XA8H 4LNRA 3HRPA 2IMMA 3IT8D 2RAMA 2OTWA 5FGBC 4OV5A 2BVPA 4HJJH 4M7JH 4LCWA 1UEYA 4K3DH 3RNKB 4U1HB 1TENA 2BSED 4PJIE 2O61B 4LHUB 1E6JH 2BSRA 4KGJA 1CIUA 5F6HI 2F15A 4HIIB 3FFCB 3U46A 4DQOL 1FH5L 3PWJB 4NCDA 1CZ8L 2V2WA 2AW2A 4OCWL 3C09C 1UM4H 1XGRB 3OKKA 4N1EA 3WUZA 5CKAA 3L3KA 2CXGA 1R24B 1S7SA 3ABZA 3RWDA 3DRQA 2NXYD 1JNJA 4XNMB 1QO3A 3TYFA 4XNYL 2H32B 3WN5C 3BZ4A 3ARFD 4HKXB 4N8CL 1QVOB 3BMWA 1C16B 5DJZA 1YMME 3RBSA 3G9VA 3QO1B 4ZFOL 1A1NB 2X4QA 4UIKH 4CU7A 2GTWB 4OQ1A 2OL3A 1N3NB 5HPMA 1UXWB 1U9KA 1A6ZB 3QCVH 3TH2T 1TVHA 2FZ3A 1GZPB 4PRNA 5JZ7C 3LQZB 2GI7A 2X2YA 3HR6A 25C8L 3TZVD 1WISA 1QA9B 3RWHA 5DMJB 5J8OA 3V5KA 3H7LA 1J0YA 1U8KB 3GMQB 5JNYA 1TQBC 1DQQA 1NGYB 3PABA 3RDTB 5I8EB 4UMGA 4JFDE 2B2XH 4KHTH 4TSBH 3QDME 3BEVA 1NFIB 2Q6WA 4YWGH 1CFSB 4L3CB 5LAXB 3ROLB 4NNXB 3RU8L 3BUYA 3UTTD 1N5YL 3IJYB 2VQ1A 3T09A 4LEOB 5E5UB 2OTPA 4Z78A 2ITCB 1FNGA 2QQNH 3PHQA 3ARZA 2J3SA 1HQRA 3ZDXE 1QFUH 3TGXA 4KK9D 3S4SB 4LIQH 4ZS7L 4LCCB 1ZA3B 4ZPVA 1GGTA 5L88H 3T65A 5HHME 3HC4H 5I66A 4JN2A 1J05B 4JFYA 5DJAA 4ZD3L 4Z7VA 1NFDF 5F6IB 4JG1L 4LSQH 2D9CA 4GXVH 4BFBD 4EBQL 3CSYB 3KYKH 5FHBH 3BKJL 4OD1H 5A43C 3O6FD 3HE7A 1XGUA 5FECA 2VR9A 1E27A 4WUKH 4JQXC 4RX4A 5ETUA 4BUHA 4TULL 4KH2A 1R3KA 3D0VB 5IMOA 4M5ZL 1KCRH 5GRUL 4YDLC 3QB7C 2FLBT 2R2HB 3BKMH 2VWEC 1CGSL 4OZIB 5SWZE 5K93A 1HH6A 1QTYT 3ARGC 4RCAA 3HZYA 4KU1A 4X6DA 4YUEL 1RIHL 2AABH 1EZVX 5ELIA 1Z0NA 3QIBA 3O0RL 4J4PD 4F9PC 4BFEA 1YDPA 1HHKB 1M7IB 1N4XH 5CMAA 1E28B 3HAEH 4XBGA 5I15L 3PL6A 2EO1A 1TQBB 2ID5A 2R2CA 3OKMA 3FT4A 4PLJC 5C86A 1KIPA 5JHLL 2KH2B 5FDWA 2NY6D 5CJBA 2HLAA 3SDCA 2VH5L 3FKUS 1YEHL 2XKSA 4Z7WE 1IAOB 1F97A 2Y6SC 1QYGL 3B2VL 5JIIA 4HIXH 4YE4L 2DOCA 3TNMB 1D6EA 1ZK9A 2CGRH 1FN4B 4LIQL 4YHYC 3SKOA 4ZFFB 1MEXH 1IAKA 1BVKA 3F6IA 3ZKXC 2LU7A 4XBPA 2PW2B 4JY4A 1AI1L 3C8HA 3DRTB 3REVA 4HAGA 1XGYL 3LEXB 2G60H 4YHOH 1OSZA 1KJMA 3HNVL 1PBYA 5CGTA 5EPMB 2PO6C 4BQBA 1QHOA 5DMYA 1OAUL 5GRUH 2AJXH 3IETA 3WIIH 5E8EB 3UCRA 2ILLA 1KB5A 2FSEA 3P30L 3SKJH 4D8PB 3TBTB 1T7XA 1C5BL 4MJ4A 5F3BA 3TPKA 1UACH 4ODWA 4XP1H 4Y4FD 3SDDD 3L7FB 4GG6E 4W4OA 2ORBH 1ORQB 2ZG2A 4LLDA 2BC4B 5DVKA 5JXAH 1M71B 1V3JA 4WI6A 5ALBL 3GEWB 5E99H 1S7XB 1XCTB 1XGTA 2G75A 4F3FB 4JM2A 2HH0H 2QTEA 4Q6IC 2WP3O 1IC5H 2PF6A 2VLLA 2VTFA 2CPCA 3FHAA 3IRZA 3C6SA 3B9KD 5DWUL 4BKLB 4TSCL 3BHBA 2A77H 1QYGH 1OAQH 4P5TD 3BH9B 1PSKL 3HC0B 4DJMA 3L3DB 1OPGH 3IAQA 3OTTA 5JDJA 1P4LA 2EIDA 3QRGL 3DGGA 3D3VB 1HXMA 5I17A 3QPXL 4KTYA 4X98A 1JPSL 1LO0L 4YGVA 1I3UA 1MCSA 1MNUH 1AKJD 1EFXB 3A6CL 1IZKA 1B0RA 3MR9B 5E94A 2HKFH 1ZLUK 1XIWA 1EVUA 2J2ZA 2ICEB 2VDPH 1VKXA 3PWJA 4HFWB 5INDA 1BQHB 4JRXD 1IMHC 1EZVY 2I9TB 5F1KC 5HYJB 5F93C 2V2TB 3MJGX 4RRPG 5IFJB 3TC9A 3C8DA 5D93B 4KWUA 1GC1C 5FF6B 2DJ4A 3V0WH 3DI2B 3TYFB 1E6OH 4F9PA 1V05A 1EEQA 4YIQB 4JFPA 1JNLH 3QDMA 4UIMB 2QHRL 2EDWA 1FCCA 1ZTXH 3MOQA 4Y5VB 4JFDA 4Y5YC 1J11A 4HV8A 1ZLWH 4Y1AA 5F1IB 2IEPA 1HHIB 5CWSB 1T5WB 5F7NC 2B1AL 1BJ1J 5IW3A 3TF7C 3FRUB 3MJ7B 1NGPL 3NFPA 5ESVB 5GS3A 5GGUA 3GRWL 2Z31D 4ORGB 1OAKH 5CLTA 5IB5A 4ODSH 3ES6B 3EAKA 4OD2B 2DWDA 1QR4A 3D5OF 1I1RA 3PQYD 4HCRH 2BNQB 4OCXL 2EZ0C 2BY3A 5HGAA 4YX2L 1HYSC 4NNPH 4S1QL 3CLEL 2OL3H 5E8DH 3IGAB 3FQTA 3B9DA 1P4BH 3B3IB 3KYMA 4ZTPL 2C3VB 4DVBA 4PRIA 5IBUG 2EYRA 5IOPB 1EJOH 3MV8B 2H9GB 4AJ0A 3KPNB 4K3HA 1S5IL 4GKNB 5JUEH 3KPPA 4PG2C 4LLMB 3BXNA 4J6RH 1GGBH 3P0YH 3MOBL 1LP9A 1I8KB 3MV7D 2C3WA 3DXAB 2VLMD 4XVJH 2NZ9D 4XP9H 1LDPH 1SY6H 3NZHL 1ZSDB 3ZO0A 2XWTA 4XCFH 3MNZA 2WBWB 1CFQB 1SM3H 2OQJB 5HHMD 3GRWA 3PABB 5FAAA 4HLZH 4WGVB 3QNZA 5A2JH 3L1OL 2QQKL 5GGTH 3G04A 1EO8H 3EYVA 4PJXA 5CD3B 1QQDB 4UINL 3MJ9A 2JCCF 4HT1L 5GRJL 5KS9B 4HLZG 4Z7NF 5DDHA 3TPUA 4V1DB 3BP4A 4KDTC 4M7JL 1NKOA 3H2WA 2ED7A 3QEGL 5TE6H 1PG7L 3QISA 4N0UB 1MRCH 1PD6A 3QUZA 1CLOL 3VU2A 5GRVL 3ZL4H 4NQEE 3NBNA 3RZCC 3CK0H 2J5LB 5C6WH 3VFOB 5CFHA 2CJUH 3QFDB 1JIBA 1W72A 3UJTH 3OKNA 3KXFD 5DK2B 5H37H 4HH8A 3GZKA 5HGDA 2AK1L 3RWEA 3ULVL 3EKCA 5E2TH 4M8VA 2X1QA 1X7QA 5HHVH 2GK0B 4PGBA 3B83A 4WI3A 3JV5A 4N5UA 4L8CA 4LCUB 4I4WA 5D2NE 4ALAH 2ZJSL 5FYKU 3SGEH 1JGVH 4OT1H 5ALCH 3QUYB 2XTJB 4NQDD 3BP5B 3UZQA 1KT2B 2N1KA 4JPVL 4WTZA 1FVDB 2A38A 1PYWA 2B4CL 3D85B 3WUWG 6CGTA 5EUOA 4P46D 2Y5TA 4ODVL 3TBSA 2E7LC 3U9PL 4M7LL 2VLJE 4Y19A 1DQQB 2HAZA 5I1GL 4G6FD 3U0TB 4NZUL 4JY4B 1I3RA 1T0NA 3QIBB 1LEGA 1LEKA 3L1OH 4R7NB 5DQJB 5EIIA 5BVJB 2UZYB 4HT1H 3ROLA 1UJ3B 2OM5A 4ZSOA 2X4NB 1T21A 3CXDL 1CQKA 1A7RH 1YMMB 5C70A 3WCYA 1NAKL 3B5TA 4DK6A 2ITDA 3EO9H 3L3JB 1JWMA 3MA9L 3PGFH 1ROWA 2J6EH 1A5FH 1T22A 4NRYA 2WIMA 5SWZD 2D03L 4ZUUA 1CR9L 4RISL 5DRZA 5SX4I 3WXWL 1HSBB 1AE6H 4LCCA 1IZJA 2CIIA 3UPAA 1PY4A 1A1OB 5TDOB 5I1KL 3AMKA 3Q5YA 4QHNA 4AEHL 3I3EA 3FT3B 4UQ3B 3X3FH 1MWAL 4L3EB 4OLXH 2Q8AH 4Q2ZA 3PGCB 5FK9A 4WU5B 1J1XL 2UWEA 3QDHA 2KPNA 3OMZA 4HUUB 1U3HB 5CHNA 1TZIB 2FIKA 3E8UL 3LHPH 2EDLA 2EE3A 1S9WB 4FTVD 4X99A 3DTXA 1FZOB 5BV7B 1DEDA 2X4RB 3HS0B 1N64H 3TVMD 4CN6A 3PWLA 2NLJB 3D0LA 5GSVB 1QHPA 4EDWL 3NFSL 3HRZB 1LILA 4N0CC 5F21B 4XP4L 1N6VA 5EU3B 3GSRA 1HOCA 3FO0L 1FORL 3UTTE 3VRJB 5KANI 1BVLA 3H9HA 3O4LE 3QQ9C 4FP8H 5EU6D 1D5ZB 3F7PC 5H2BA 1ADQL 3K0WA 3RGVB 1GGUA 1RPQA 5JW4N 4FZEL 4QHKI 5J6GB 1JK8B 1P7KA 3U4BH 1X6LA 4HIEA 1FN4A 3FZUD 3D69A 1G7LA 1T4KB 1AE6L 4AIZB 2V2XA 4HV8B 2VZVA 1XZ0A 5CUSH 5C07E 4HDIA 4U3XA 4NQCA 4HIHA 4B41A 4MA3A 5T3XE 2C7UA 2HVKA 3AAZB 3D87B 4QYOB 4HAFA 4M61B 4XZUB 3W9DA 3KAAA 5CEXA 1SJEA 5F7KC 4MAUH 3VXPA 2I25N 4LASL 3AB0B 1OLLA 2R0KH 3BGMA 5IEHB 4P48A 3H9ZA 1NCAH 2EDQA 4HPYL 1JI1A 5FYKD 3TO4A 2OLDA 1O7VA 5KSAC 4PJBB 4HK3J 4YBLB 4Z0XA 3WUWA 3TA3C 1RIUL 3RX7A 1EAPB 1PZUB 3S36L 3PQYB 1BQHG 4WUUD 4EUPA 1OGAD 3I6KA 3WNLA 2DQTL 5C92A 5JIHA 1DQJB 2Y36L 1DUYB 5JQ6L 4OI9A 4QHMB 1XF1A 3WEXA 3MRQB 1A1MB 3S6CA 3HZMA 3WFBH 1R3IL 3BKYL 2CDFB 3HMWH 5ESVA 3GGWA 5HI3D 4OCSL 2NZ9C 5DEGB 1EO7A 4Y4HD 1WZLA 3CMOL 4NGHH 4H1LA 4JFHD 4FQXB 4JZNB 5BZDA 2KUTA 3IXTA 3FN3A 1ORSA 3BPNB 1YJDH 3S36X 3RWCA 4HUVA 3UX9B 3ARBC 4U1LA 3O4LA 4P9HH 5TQ2L 1JPST 1A21A 3UTTA 4IS6A 5F70A 1UADC 1T1WB 4ODTH 4M4PA 4XVTL 3MR9A 3NCYP 1ZT4A 4NOFA 1K4DA 3VFNB 3NAAH 1MFCH 2EIBA 1NFDB 1ETZB 1T2QL 1GPOH 4PY8J 3GO1L 5EUKB 4AH2B 3I2CL 5ADPH 2DQFB 1LD9A 5C3LD 3GKWH 4F15C 5IB1A 5HYJA 1CICA 1UFUA 3RTQC 1G9NL 1S9XB 4ZAKD 4NDMA 1H3XA 5IT2L 2VAAB 1XF3B 4K7PY 3K2UL 1A6TA 1AJ7H 1IKNC 3GSXA 4F7MB 2P24B 5B8CA 3MREB 4X4YB 4QTHA 1X7QB 2V7HA 1CTNA 5IROA 4J1UB 5BOPA 2VISB 1JNLL 4C56E 4XMLH 3N9GH 1UKSA 3N1GC 3NMEA 2C1OA 1SJXA 3UC0L 3ARDD 4QHUA 2HJLA 4F8TA 4JO1H 2HTKD 4XPBL 4J3UA 3NPZB 2HWZL 1W72H 4WW1A 1R3HB 5C9JA 4N0UA 1EX0A 1H8NA 4ZXBD 5HJ3A 3PJSA 3U7AA 3BPOC 4NGHL 1FNSH 3C2AL 2E27H 3VMPA 1QSZA 3D18B 3O6KL 5AG8A 1F02I 1JF6A 3WNOA 1EXUA 5BJTB 1KTLB 1W72B 3CVIL 4TSAL 1HINL 1KEML 3L5IA 1I8IB 4IRSB 5IEKB 5F7DA 3LEVH 1NBZA 5K9JH 3MLVL 4XBEH 3V5HA 1F3JB 5LWYL 2NY3C 3G6AA 3HTLX 2VKXA 2N7AA 2XIDA 1TETL 1XH3B 3S9DB 3FQUB 1KG0A 5K59F 2HP4A 4P5TC 4PB9L 3GO1H 1B6UA 5ID1A 1A14L 4Q0XH 3GKWL 4NQVB 5DUML 3BIKA 1Y0LB 5CP3A 2VLRA 2ZCLH 2IAMC 1A1OA 3T0VA 3JWOC 2JJTC 3HG1A 2JKXA 4QHNB 4PJIB 1RUPL 4XH2B 1RUQH 1F90H 4F9LA 4MA1B 2V2WB 4ZMAT 3QNYB 1F3RB 4XWOC 2OK0H 2HFFB 4FQ2H 2VXUH 2YS4A 4RRPA 4OM0H 3PL6D 2Q8BH 2LTQB 4ZTOL 4PV9B 4PJEB 2I9LB 4N0FA 4ZO8A 4IIQA 1JJUA 4Q9RL 3U7WL 4KHXL 3Q6FB 4CNIA 1CXLA 2XZAL 3QDGD 4JCMA 4PUBH 4RMUA 3C60C 5D72H 2E7LA 4PJ9C 1NGWB 3PP3K 2YRZA 3DYMA 1M6OB 1MCOH 2DBJA 4HZLA 3S4SG 4KZDH 2EH7L 2CIIB 1MUJA 3MOAL 3LKOB 4MX7A 1WZ1H 4FQLH 4CVZB 5DVLA 4OGZA 3T3ME 4CAGA 4M93C 1PZ5A 3BZEA 4JM4L 3IDMB 3MV7A 2DYPD 4A6YB 3GMMB 3RY4A 3MLVH 4GFTB 4H1LH 4Y4HB 4PYHA 1T89C 4PJXE 2BDNH 5F44A 4ZO6A 3RWJB 5B38A 1D5BB 5J11B 4TVPE 1IKNA 4ONHB 3QQ9D 5DO2C 4ONGH 1IEHA 4HWZA 5IVNA 3UXFA 4NNXA 4KV5F 1A6VL 1RZGB 3U82B 2APXA 5E9DA 4LEOA 2Y5TB 2J88L 4PLKC 1RZFH 5L2KB 1F3DH 1IL1A 1P5UA 5GS1B 5GISH 4XB8A 3PHQB 1B9ZA 5HGGS 4KFZC 2XXMB 4M7LH 4LVHB 4OLZL 3B9VA 1LK2B 1WIPA 3HC3L 4UU9A 5TF0A 4GKOA 4Q7DA 3P11H 3QXDA 4PRIE 4MNHB 4NWUL 4MCYB 3OKDA 4U1KA 3U36A 5MI0C 4YDJB 4OCMC 4L9LB 3LPWA 3U1SL 3SY0B 1GOGA 4XGZB 3L3JA 1A7QH 3H3PL 5EZIL 3V79C 3MUHL 4I48A 4I18A 3GM0A 2GTWA 2X10A 3AROA 4KRMB 3EO9L 4JM2F 5JW3L 4NC1E 1S78D 1WGOA 2FGZA 4P3CL 5E2UL 4QOKD 5JXEC 1GZPA 4PRNB 2Q7YB 3V52L 3ILQC 5IESL 2F53A 4JO4L 5DA4A 5GS0C 2NMSA 4LSSL 4EI6A 1JYNA 4KJQD 5EO0A 3MRQA 1PX4A 2HVKB 1CVSC 5E8PB 5A3ID 1MJJA 3RL2B 2EDJA 3S96A 4Y1AE 2VXSH 3CFDB 2YK1H 2WBJC 4MD4B 1G7QB 1W0WB 5AAMA 1C5CH 4HHAB 2H3NA 5TH2B 3K1KC 3PP3H 4YBLC 3IDJB 2IAND 4JREB 1D9KC 5CJOL 3UBXI 3H0TB 1CFSA 1S9KC 1J1XH 4Y19D 3O4LB 5AWNH 1M7DA 4I3SL 1R5IB 2XPGB 3O2DH 5EBMA 4K71B 3IKCB 4OAWA 1P7QB 3PWPB 3BSZH 5C0EB 1K4DB 4LLYB 3V8OA 1ACZA 1UCTA 5HYEA 1P5VA 2ZUUA 4LBEA 4LDEB 5C0FA 5E2WH 5D96C 4NN6C 1E4WL 2DN7A 4NWUH 1QRNB 1BVLB 3H9HB 3CSYA 3ZHLA 3WFCL 4XBPB 4HQQH 1LEIB 1IEBB 5D6CA 4HW6A 3RGHA 5EZIH 1DVFA 2NW2B 3DVGB 4XRCB 5B8CB 3QEUA 3MJ9L 3ZTNL 2BVOB 35C8H 2B5IC 4HLJA 2CD0A 4HXAH 2YKLL 5KZCD 4POZC 3RTQA 3QCTL 3L95B 2VABB 4I9WE 4K2UH 1MCPL 1BZ9A 2R4RH 5EWIH 4F7TB 5J0BA 4MA8H 4QRQB 2DD8H 5FYJD 4XP6L 5L8LB 3UAJD 4LLQA 1I9IL 1CD1A 3V8CA 5JDSA 1EGJH 3V9FA 2VXSL 4GG6A 5EZLB 3NACH 5DS8B 1LD9B 2DKMA 3BD5A 4K71C 4D94A 4P2CG 4CDHA 3C8KA 1BBDL 5GS2D 3RVXD 4DKFH 4O51A 2LAGB 3WN5A 4EDXB 1T80A 1NMCC 4GW1B 3T0EC 4NN5B 4IRSA 3QSKB 2F74B 4M43L 3ARDB 4QRPA 3VXNB 5DUBA 3MLWL 2V7HB 3TM6A 4FQQA 3T2PA 1I8LC 4WO4C 1LMKA 2CMRL 2OR7A 3T2OA 4GAGH 4HWNA 4LARH 4MNGA 3UJIH 3ZDYE 1BREA 2HFGL 3RPIB 5I16A 1FPTH 1EUUA 4LKCA 4F8QA 2H2PC 1TCRB 2VKWA 43C9A 1YEGL 4HULB 8CGTA 4JANA 3EZJB 1AIFB 2FX8L 2XTJE 3SO3C 4OCSH 4MQ7A 2OP4L 3BT2L 5BV7L 1S8DA 1FIGH 5EIVA 2YN5A 5F7DB 2F9BT 1CFBA 4I0KA 2JJTA 3H3KA 1NEZG 15C8L 5EWIL 3OR7B 2VDKL 2Z9TA 2ZOKA 4OIIL 3SJVE 1ZVSB 3BI9X 3PIQB 5CP3H 3MLUH 1FDLH 4NQDA 1D5IH 4UUJB 2NTFB 3FRPA 4HS3B 1JV5A 4PRPD 4RX4D 4LFHD 4MSWB 1IQWL 2YOCA 1NGQH 3QUMH 3RVUD 3WNMA 3AY4C 3EJZD 2P5EA 4PJHB 4MAYB 3UJJH 2Y5EA 5J12B 2DMKA 1G9EA 4U6YA 5L8JB 4RZCA 3QIUD 5JORA 4JFXB 3ES6A 1A7PH 2X4OB 4LPVA 4TQEL 1YECL 4MB5A 2JB6A 3OAYK 4X7TB 5DEFB 4JJHA 1GGIH 3L3OA 4AY0A 2HA1A 4QHUB 5FV1L 4XTRD 5C0BD 4MLIA 4R96B 3T8XA 1DUZA 3MLYH 4DGIH 1S7WA 2FH8A 3W5NA 3CCHA 5I0DA 4U1IB 3TT3H 4F9LC 5BVPL 3UTZA 3PWVA 2GUOA 1XF2B 4NUJA 3JSSA 3NGBC 1FYTD 1KTLA 1NFKA 1NL0H 5JPMB 2BX5A 4GMSH 2W38A 4P9HC 4RQQB 3RBGA 3VG0H 1A0QH 4B50A 2CUHA 3ARFC 5FYJE 2DWEA 2FWOA 2WUCH 4XCCH 4N0RA 1N0XH 3SDYH 2VZUA 5FKPA 5DJ2A 3DSNA 1KJ3L 3QNZB 4S1SL 3EOBA 3JTSA 3QG6A 4MA1C 3T1FB 4RMQA 2I27N 3ULUF 4ZUWB 5FCUL 4CW1A 4P4KD 4X9BA 1FBIH 5IV2B 1OD9A 4G8GE 4IMLB 4JO2H 4K8RC 4MWFA 4HEME 4QCIA 2F54B 1RULH 4MCZB 4A6YH 5E08H 2GTZA 3MLPA 1YA5A 2GQHA 3V5DA 3MRGB 2G2RB 3GSVA 3LRSA 2O5YL 3CFJA 3W0WB 2R9HD 4X0KB 4J7RA 1F4WL 4G6FB 4Z7UF 5F9JB 5D8JL 4L5FL 4U0QB 5JPNA 2H3NB 4LRNH 5TH2A 1EERB 1PEWA 2W9DL 1II4E 4Z7WF 1NAML 4LVNB 1BZ7A 4ZDHB 4C57C 2DJUA 5FHAH 3TNNA 2R15A 5IF0A 5F89B 3T3PE 4G8IA 4RMSA 4R7DB 1T66D 2H6PA 2ZSVB 2PO6D 3SDXE 4MD0A 1L7IL 4OI7A 4ORZC 2VN7A 2HN7B 3K1DA 4LCUA 3RZWA 4POUB 3HMXL 4HUNB 4F57H 4YO0A 3OX8B 5LXGH 2DF3A 1FVDA 1QLEL 4D3CL 1VFUA 3GMOA 3QUYD 4N8CH 3B43A 2NY4D 4KJYA 1UH4A 4M8QA 2XWTB 1WZ1L 3F5WB 4N1CA 1YQ2A 3D6GA 3SQOH 2OSLA 1LEIA 3VH8B 2NX5B 1OW0C 3QH3B 2R0LL 5KSVB 4R7NA 5BS0E 2DQUH 1V3LA 2AK4E 2XI9A 4OF6A 1TZHB 1UJ3A 4ZSOB 2UWEF 3MXWL 4UBDD 3V5KB 1MJUL 4PP2B 1IGML 1CYGA 1ZHLB 2YSSA 3CDGA 1T1XB 1LK3L 3DV4A 4BK4A 4D9LH 5F9DC 1BIHA 4A6YL 4AK1A 1DVFC 4QNPE 4QRRE 4WHCA 4JR9H 4I77L 5DD6B 1OTSC 4I9WD 4QGTA 3BEVB 2P44B 3TYGH 2VAJA 1HSBA 1LK2A 2D9QB 5FYKH 3GI8L 2D0HA 4OCYH 4Y1AD 2W9EH 4KPHL 1IFHH 3UTSE 2X4UA 2ZNWA 4LCCC 3A67L 5E0QA 4AEFA 1G0YR 1Q8MA 4LLWA 1J7VR 2DLFH 2ENSA 1JNHB 1WK0A 3OR6B 2H2SD 3EGSB 5I1EL 4R26L 4Y5YA 1KPUB 4MZ3A 2UWEB 5DI8B 3BUTA 5T3XL 3HI6H 3VFSA 1EGJA 1H8OA 5A2KH 5DD3H 4FNLL 5JTWA 3BJ91 1OARL 3IU3A 2CDGB 4PJ7F 3GMRB 1M05A 4PJCF 3TBSB 4IOFD 2H8PA 4Y4KC 4PS4H 5IG7B 5KW9H 1F58H 3IFLH 2W91A 1OWWA 3I6GB 4YPGA 1DQLL 3ZMRA 3SGDI 4K7PX 4Y7MA 3IDJA 3RIFF 3BN3B 5J12C 5D4QA 3VD7A 5KSBE 4P4KC 5ACLA 3K4AA 3D39E 1VPOL 2XWJB 3WS3A 1U0QA 3MSPA 1KPRA 4ZFGH 1PG7W 5T1MB 4PFEA 3U0PA 1D9KB 4UB0L 5DJ8A 4GBXD 3VFRA 1A4JB 4K3EH 3EJYC 2FR4A 1ZVSA 1HHKA 1M7IA 4M6OL 1MPAL 4LSUL 5E6YA 1OTSD 3FT4B 2VLRD 1O0VA 2WUBH 4JCLA 2B0SL 5GGVY 5I30H 1AD0A 4HX1B 3IDUA 1WCBA 1DE4A 1MLBB 1KULA 1JFQL 2KQMA 4NBXB 3TV3L 1INQA 1WBYA 5BXFB 4UOJA 4N8VB 1BQUA 3FO9A 2GCYA 3V6OA 1CL7H 3QUXC 4BFIB 3VH8G 4CBPA 1IVLA 3T77B 1YNKL 1OHQA 4IRJA 4IRZH 3RDTD 1CF8L 3OKKB 3S35L 1BVKB 1WFTA 3ZYJA 1OTUC 4BK5A 1TZIA 2JCCA 2JB6B 3G6DH 5H35B 1BQSA 4PGDA 4XVSH 3MRJA 2NXYC 1T0MA 1U8JA 1IC4H 1QLFA 2D7TH 4KMTL 5D7IB 4O2FA 4OGXH 1CLCA 3QJFB 2B8OT 3VFWB 4G6MH 1KENH 4DTGH 3TJEH 1MHCA 4B0MM 4DN3H 1OVZA 2EDDA 3TA3A 4P5KB 3U4EA 1HHHB 1I9JH 5DR5H 1BAFH 2CLZB 3SJVB 3ALPA 5TPWL 2W0FA 4NO2B 1I7ZB 5L2KE 3SCMC 5BMFH 1C5BH 5DC9B 4G80A 2Y07H 2JIXD 5DRXA 1F4HA 2VDRL 1OGAE 1NBYB 4FQXA 1BGXL 2X7LA 4LMQI 4R0LA 1QPXA 3K7UA 3CVHL 5F7EH 1JWUB 4DN4L 4K9EH 4EVNB 2XYCA 4G3YL 4JM2B 1BJ1H 4AG4L 4HDIB 4IS6B 4LCWB 5E9DD 2VLLB 5I30L 2Q3AA 3QI9B 4JFED 3V4UH 3CDCA 1ZEAH 3BHBB 3V7AE 1CBVL 4ZFZA 2ESVE 1P4LB 4MHHG 3MLRH 3VW3H 3QRGH 1IQDA 4FS0A 1XGRA 4J3VA 2XTLA 1JN6A 1NCCH 3OPZH 1AGFA 3DX9A 4OLVL 2O5XL 3HAEB 4D0DB 4Y8DC 3K8MA 4JFYB 1UB6A 5F89A 5SWZB 5INDB 3WKMH 4UUJA 4HK0B 1A7BA 4JJ5A 5F96L 4MD0B 3VXSD 4XB7A 1A7NH 2PW1B 1KC5H 5HPMB 2JELL 1BAFL 3SDAB 3OX8A 2CDEA 1L7TL 2BNRA 2ADGB