3QEJA

S74e-dck mutant in complex with udp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
242
structure length
234
Chain Sequence
TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVELTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Post-translational phosphorylation of serine 74 of human deoxycytidine kinase favors the enzyme adopting the open conformation making it competent for nucleoside binding and release.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Deoxycytidine kinase
total genus 89
structure length 234
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qejA00
2QP4A 2G83A 2V1UA 2A5FA 4IXMA 1U98A 3BWDD 1E2LA 2WKPA 3H2YA 4A1FA 4ASUA 1MRNA 4Z54A 4TMXA 2MMCA 3QOFA 4Q66C 4BLPA 4PAMA 2I1VB 2KE5A 3G5UA 1T0HB 1HY3A 4DC9A 4M1MA 4KV9A 3GJ3A 4EJSC 4LYFA 3AVXA 2XOKA 1K5DA 4KBFA 1UFQA 4NKRA 3VHLB 2R6GA 2FPKA 4O2RA 3QBTA 4P4UA 4YONB 3ZYCA 1E1RD 1KMQA 3RSOA 1G3QA 3IBGA 1Z6GA 5DE3A 2VHUA 2ZI6A 5KSZA 3NBZC 4FD2A 5DI3A 3K0FA 4YDSA 1G3MA 1RRCA 4OL0A 1Z29A 2P6UA 3OF5A 4HDCA 1XMSA 3QUSA 1DAFA 4ON9A 2H57A 2G6BA 2QBYB 2IA5A 1P9WA 2OFOA 1XDBA 4RSGA 3DKVA 3AP3A 5P21A 4FMBB 2F9LA 5A0FA 1BIFA 1JPJA 1Z0AA 2PMDA 5FPHA 2C03A 2QMEA 5BYKA 2GJKA 1DAKA 1W0JD 1MR3F 4YXWD 3H84A 1VG8A 1KO1A 3X1XA 4GPTA 2GVZC 2NZJA 2KBEA 4MRRA 3VKWA 3PIRA 4AYXA 4C0BA 4MUBA 3AVUA 3K70C 3SN6A 1US8A 5JCZA 2O0KA 4MGKR 1UEJA 2QZ4A 3AF4A 2QMOA 2ZTSA 3SQXA 3K53A 1FQKA 3KKPA 1J99A 1IHUA 4B44A 1FUKA 2GRJA 2WZQA 2A7QA 3SJBA 2JLSA 1R5BA 3VAAA 4TL8A 2FSGA 3U6KA 1UBGA 3ICQB 2PLRA 3WRXC 2CNWA 2J7PA 2W6JD 2GWHA 1VCOA 4A8JC 4BZPA 3A1WA 3WBJA 1JI0A 3QJYA 1TAGA 5EUMA 2QGNA 1AIPA 5HCIA 1N6RA 2EWWA 3ZH9B 1T6NA 2FGJA 4DLWA 2JJ1A 1N6LA 4F38A 1SVLA 2ZM5A 5FBRB 3DKPA 3C5HA 4RD2A 5BN3A 2VHQA 2FEOA 2I3BA 4EPXA 1SHZA 4IKEA 3B7GA 3LFUA 3THXA 4WA7A 2NO9A 3VX4A 3VR3A 2B92A 1IONA 3U3JA 3W5JA 3UXMA 4G0NA 4DLVA 5FOTA 1CR0A 4KXFB 3EW9A 3SYNA 3I61A 3ONWA 2E87A 3ZZTA 4JLJA 3KKNA 1P4SA 2VP0A 121PA 3K0FB 1QVAA 1MH1A 2O8BB 2RH5A 5DSZA 1UDWA 2A9KA 1QHYA 1CU1A 4B47A 4PZZA 3AVYA 3UIEA 4BLTA 1AS0A 2YWHA 2QENA 4A0GA 4DLYA 5FI1B 2ZRPA 1LFDB 2EYUA 5G40A 4HUQB 1GILA 4I99A 4LJ8A 3EA5A 3VMFA 2JJ2D 2JIZA 3TAUA 2EFDB 4DKXA 4LBYA 5BN4A 1CJMA 1UJ2A 3CLVA 3LWNA 3QF4B 2CLSA 3MGCA 1AQUA 4JZKA 2JLWA 2CHQA 1VG9B 4LHVA 1QDEA 4TYWA 3ADKA 3IIMA 1SXJB 1SHKA 1XXHB 4NYMQ 2FOLA 5J4LA 2QPTA 2ZSFA 3PUWA 3LX8A 1EWQA 2BMJA 1W5TA 2W2XA 3D31A 4BRUA 3NTUA 2UKDA 1U2RA 2B21A 2QN6A 2C98A 5CB8A 3DMNA 2ZJ8A 1N0UA 1UDXA 2CE2X 3CX6A 5JRJA 2NMVA 4JYCA 5L3SA 3DO6A 2XB2A 2PLFA 1CJUC 4P31A 3MFYA 3ZZUA 2JLVA 4QM6A 2LCFA 3ADCA 5A4JA 1W48A 5CM9C 2MSCB 3HJNA 1I4TD 2FFHA 2WSSA 5B57C 3AEZA 1II0A 1UAAA 1OXVA 2QUZA 1F60A 1SXJE 3P27A 5CK4A 5AJVB 3MWYW 4NCKA 3CH5A 3TH5A 3V00A 1ZVQA 3B82A 2NPFA 4OI4A 1VDZA 4R71A 621PA 1EESA 3I92A 1XJQA 3WP0A 1HE1C 2CJWB 4CF7A 3AV0B 1C9KA 1ZRHA 2G0NA 2AFHE 2FPMA 4OHYA 1E9CA 5E3HA 3K9NA 4IFEA 3FMOB 4E09A 2YOFA 2ASEA 1KJYA 2IYUA 3GLFB 4JL8A 1IY1A 2A5DA 4OQFA 2LKCA 1OH6A 2PCJA 3RRZA 2DFKB 3T34A 1OW3B 1F2TB 1JJVA 3QEOA 4G5SA 5E7MA 3KQUA 4CGZA 1N6HA 1CR1A 2VBCA 3BERA 4M8NE 3QG1A 2J46A 4TLEA 1OT3A 521PA 4B35A 4DSTA 1OHHA 1PUIA 1YJ5A 3LBIA 5LB4A 2H1LA 5KO2A 2ORIA 5JWHA 3NHAA 5FUXA 1G17A 4GSYA 1P61B 5JJIA 4R7ZA 4URYR 4IHQA 4BWYA 2ZJAA 4CIDA 3W5IA 1S1CA 4N0EA 4OKSA 4M21A 1S1MA 1G21E 5FTMA 5GJVC 4ABYA 4F4JA 1P60A 2HF8A 3K9GA 3PUVA 4YDHB 1W4RA 4OK3A 3U3KA 3QPVA 3OFNA 3MLEA 4RD0A 2ZSDA 4AY2A 4C0JA 2OHFA 3EWAA 3AF0A 1XTQA 2X19A 4OQMA 4B3XA 1COWD 1SKYE 4BUJA 3CPEA 3PR1A 2FEMA 3L43A 3NHBA 1E2QA 2FSFA 4N0DA 1T4GA 3F0TA 2PMKA 1BYUA 3QENA 3TW4A 4FXPA 3U7FB 1FW6A 4GNKA 4F91B 3NXSA 4HB2A 1T9HA 1QHNA 2ZANA 4PO9A 4EJSA 3R20A 2BOVA 4XWKA 1NN0A 1G18A 5EZ6B 3MD0A 4HEJA 2YVUA 2REXB 2V54A 4RKEA 1AZTA 2GCOB 3F8TA 4ZV4A 3ND9A 2FDCA 3GJ4A 3UWOA 2DHRA 2G88A 4WBSA 2YHSA 1NIPA 2YOHA 3PEVA 4QOSA 4CYMA 2HV8A 3U44A 5FR1A 1N3BA 3R8CA 4OJKA 4HATA 1UF9A 1W49A 2QMHA 2PT5A 2WJHA 3A36A 3A1VA 3JZAA 4FMDB 4KVGA 3U7EB 3I73A 4NBSA 3Q5DA 4A36A 3HWSA 1J8MF 3THYA 4PC6A 1KK0A 4IOMA 1U81A 2FSHA 3AVPA 1E2NA 2G1KA 4HLUA 1D8TA 3GEIA 1QVRA 2IXGA 1DAEA 1H65A 2ZAMA 5C46F 4V0OA 4CEIA 2VTKA 2XAUA 2WOJA 3W34A 3B60A 3R8FA 3VTKA 2JLUA 4D0LB 3MAAC 1NVXQ 2PJZA 3RRNA 2QTHA 2ZYWX 1E2KA 4PPNA 3Q3JB 1PLLA 3MG9A 3WXMA 4OHWA 1N6KA 1CKEA 1DG1G 3WHLA 2XSZA 2WJVA 3PFIA 4NH0A 1MO5A 3CR8A 1P2TA 2E9SA 4MRNA 4Z1MA 1SZPA 4UQOA 5K8UA 2GF0A 3TRFA 4KYIB 4RFSA 2X2EA 4TYPA 4QL3A 2J0VA 2IL1A 2ODEA 3ETLA 1A82A 1GNPA 5TV2A 1GG2A 1XZQA 2AL7A 1A2BA 4UNPA 4B43A 3THYB 1QG4A 2ZXUA 4PANA 4X8OA 1RJ9B 4HI0E 1NMYA 1XXHE 2XSZD 3ZIAD 4X8LA 4ZI3A 1WB9A 3AVTA 4XVRA 3N2IA 4M9QA 5TB5A 4G1UC 5B30A 1KDTA 2YOGA 4ARZA 5JCPA 4D81A 1JBKA 2HUPA 3HU1A 4LYHA 3CRMA 4CDGA 1XJ0A 2PZEA 4ZDJA 5KNCA 2F55A 4PAOA 1RRPA 4G5QA 3TMKA 1XEFA 3P32A 2OFXA 3AF1A 1KK2A 2AN9A 1JR3A 3DVLA 3FVQA 1U90A 4A4DA 2V7QD 2CXXA 4Q01A 3CZQA 4KLNA 2PZGA 2ZIAA 1ZNWA 4PHFA 1P7CA 4GBMA 3BK7A 5KNBA 4CEIB 2OEPA 1DBSA 2PJRA 2C96A 2XNDD 1G19A 2A3RA 1IAQA 3TSZA 1CRPA 4DIDA 2GBLC 2WWHA 1UKZA 4XSHA 1QHXA 1TUEA 3K0AB 1W0KA 1UEIA 1XEXA 2VQSA 1X8KA 4M9ZA 1Z28A 1T3LA 2P6NA 2VHTA 4NYJR 4PR0A 5DGXA 3R9IA 3X1WA 1S9DA 2F1IA 5SZHB 1VKJA 3K09A 1NVWQ 2P0EA 4K81B 4M1OA 3GLGA 3UANA 2P2LA 3W6OA 4D80A 1J2JA 2GETA 3QE0A 1OFHA 2AHOA 1IN5A 1CR2A 1YZQA 3ZD6A 3PV0A 3P26A 3K70B 3GJ6A 4D4KA 2GBLA 4QXAA 1HTWA 1WF3A 2MSDB 2V8OA 1P5ZB 3SI7A 2FMXA 4JSTA 3DHWC 1IJFA 4TYQA 4XSGA 3U3OA 4LYAA 1ODFA 5GADl 2AFIE 5G3YA 1KDOA 2ZUCA 1HQCA 2EU8A 2J7KA 2KSQA 3WMEA 2PCLA 1E9FA 1G4AE 1NG1A 3DM9B 4B2IA 4ZDIA 5HCNA 2GK6A 2KB0A 4OK5A 1OSNA 5F98A 2J0SA 4TWZA 3RS0A 5AJZA 4LOAA 4BFWA 1YHNA 1KKMA 5L3SB 4IW3B 2J87A 2GEUA 1LS1A 5AUPB 1YQTA 3V4FA 1Z3IX 2RGGA 5H8WA 4Q9LA 2BHRA 2OE2A 4JMPA 3ZVRA 3NBXX 4EPTA 3IIJA 1GUAA 3HPRA 3IO5A 4TMTA 2V1XA 2YWEA 3IEUA 2W0SA 3T5GA 1WXQA 3SR0A 1KI6A 3BJIC 2V6IA 3EG5A 1HH4A 4YC7A 1VIAA 1XMIA 1E4VA 4TQAA 4Z8XA 1W7AA 2DYKA 4L16A 3GLFA 1NVVR 2QROA 2ZRIA 4RFSB 1JR6A 1JXOA 3AM1A 2YWGA 2ODNA 1CTQA 3EZ2A 1AZSC 2QY9A 1HURA 2O8CA 4BFVA 2QMUA 4M4SA 2REOA 1WCV1 8OHMA 1F6BA 2F1JA 3KJIA 2I1QA 4URXR 1OXUA 4QJ5A 3GLFE 4DLXA 4BGDA 1N6PA 4FWTA 1IN8A 3VKGA 3B9PA 3SYLA 4PO8A 1IBRA 3KQHA 4JJKA 5KSPA 3MWKA 1QG2A 2PL3A 4ACBA 3KX2A 3BFVA 4RD3A 4DDUA 5TMPA 5HKKD 1ZIOA 2HJGA 5E7JA 3HPQA 1B0UA 4KYUA 1P2VA 3GJ8A 1J7KA 3BFXA 4BFUA 2FX3A 3UMSA 4JLAA 5KPDA 3OEHD 2G9NA 3BH0A 3LD9A 1HUQA 4JT4A 4Q48A 4EPWA 2VH5R 5DN6D 3CM0A 1H8HD 3VQTA 1VPLA 2OBMA 4AG6A 4EAQA 4UXIA 1Z6YA 1Q3TA 2C8VA 2JDIA 1ZC4A 4GL2A 1S96A 1XRJA 1AKYA 4OQLA 4DSOA 3QPWA 3GFPA 1IN4A 3PCRB 3Q7PA 4JYBA 4MGYR 3RHFA 4P0TA 3AVVA 2RKOA 2ZE6A 5JSZA 1Z0JA 1D6JA 2ZRNA 3D8BA 4R2IA 4TQUS 6Q21A 3LX5A 5JEEA 5LBIA 4PAQA 1KSJA 3WMFA 3LLUA 1H8HA 3SS8A 2R2AA 4M9XA 4BECA 1S8FA 2PBRA 2CMKA 1NSFA 1TU4A 5FPYA 2O8BA 3AGQA 3WP1B 2MMGA 2EFHB 1SGWA 3KTAB 1F2UB 4DUGD 4EFMA 3EPLA 1S9HA 2C77A 3LY5A 4PPGA 3GLIB 1U8YA 3SE0A 1ANKA 3CNLA 2YZ2A 2NO1A 3MRSA 2F7SA 3U5ZB 2OBNA 1GVNB 3BH7A 5EE0A 3EPHA 3LVQE 3LW8A 5F3WB 3T5DA 1I4DD 1AA9A 5HZKA 4LCBA 3GLGB 4C3ZA 3ADBA 3KXLA 1LVGA 1NF3A 3AVWA 1CF4A 4AKHA 2HF9A 1RJ9A 1WBDA 4QGGA 2FFBA 3FE2A 2RB4A 1F5NA 2A30A 2QU8A 3RS4A 3SJCA 3DZDA 1HT1E 2VO1A 3B9QA 4V03A 3W3ZB 3RAPR 1Z0KA 2EFGA 3VR2A 3KDSE 2WOOA 4OYHA 1ZUNB 4DEYA 1JB1A 3SHWA 3J81k 2IYVA 3BORA 1VTKA 3AKEA 4QBIA 4PC3A 4TZ6A 3PEYA 1GRNA 3H4MA 3ZQ6A 3PUZA 1XD8A 1NJGA 4QGFA 2VA8A 4D4MA 1OXSC 2NTYC 3UK6A 1AS2A 2BBOA 3DOEA 2ZI4A 3AKYA 1O3YA 3CIOA 1U9IC 4LJ6A 2FU5C 3QF4A 4MKGA 5IDVA 4MA4A 1DAIA 2BMEA 1RC8A 1AK2A 4PHGA 3BD9A 2FGKA 2F1HA 3U2QA 2EVWX 2VLIA 1PZNA 3QKSB 1PVOA 3ZGXA 4NYIQ 2VHJA 1VCIA 4M53A 1ZC3A 4TYNA 3VNVA 3GMTA 5DHFA 2ORVA 1NNEA 3PEUA 2W2TA 1SVMA 2FH5B 4B3DA 2WIAA 4B6EA 2Z0MA 2IXEA 4TTQA 5SZKB 3SOPA 1XTRA 2GXSA 3U4QA 3ZJYA 2ODBA 4MYHA 5EXSA 2R62A 4DJTA 1Q1EA 4N1AA 2R9VA 3MJHA 2QM7A 2F9MA 4HZUA 4O25A 4Q9IA 4ZCIA 1Q0UA 1NMZA 3X1DA 4PX9A 4M2LA 4PHTA 2OUKA 1E4YA 3QBVA 5J4HA 3ZVNA 2AK2A 1E99A 1LF0A 1WBBA 1Z2CA 5M04A 2CCKA 4BEJA 3EZ9A 4AKGA 1OLOA 1QHHA 3RWOA 3VU9B 4D0NA 2ZS7A 2ZI7A 2BEKA 4MYTA 4M22A 3FKSD 3V4RA 2QPAA 2QP9X 1E9DA 5AJWA 1NN3A 2MSEB 1Z22A 4HLUC 1U94A 3PENA 5C18A 2D74A 1P2SA 3CWQA 4F4CA 4DDWA 2ZPTX 5JZVA 1NJFA 2WSSD 2IYZA 2ZRAA 4GZLA 5CIQA 3NKVA 1R4AA 3A1UA 2WMNB 1DAMA 2FE4A 4MYUA 1GKYA 1AM4D 1GFIA 4Q03A 5G3ZA 3CR7A 3BOSA 4JVLA 4LSGA 1E94E 2NGRA 2Q9BA 1U8AA 1ZD8A 4Q18A 1VCNA 4IFBA 4POAA 1FMJA 1A1VA 4CEJB 3BXZA 4V0ME 1BYIA 1KI9A 1NG9A 4C2UA 1W0KD 1BS1A 3CF0A 2DWOA 4ZKEA 5FOSA 3MWLA 3FKQA 4TQ9A 1IOZA 4JBXA 2WWFA 4I4LA 2JIZD 4HLQB 4CEHB 3QI2A 1N5KA 2BMDA 3KXKA 3M4YA 3I5YA 3BB3A 3QKRB 1OHHD 2ORWA 5EXXA 2NZ8A 4GRAA 2Q6TA 1TL7C 2WJYA 4G3XA 4RZ2A 3OAAA 2C04A 1D2EA 4JLOA 2IS2A 4C0AC 1TEXA 4RY2A 3NVAA 3CBQA 4TN1A 2QL6A 2GEDA 1UKYA 3TVDA 3BRWD 4LBVA 4CW7A 1P75A 2BBSA 2P5TB 2BKEA 1ZW6A 2C5LA 2X2FA 3A4LA 4F7WA 5JLJA 5L3RA 5DO9A 1P3JA 3OFND 4YMVA 4B3GA 1OXTA 2GZHA 3C14C 4KAXA 4AD8A 5JMTA 3I5XA 1GTVA 4BRWA 3P4XA 1RPZA 3PEWA 2HYIC 2A5JA 4QKQA 4RD1A 1KJWA 2BBTA 4URVR 1W4CA 3C5CA 1II8A 5JRZA 1PUJA 3T1TA 2ATXA 4QFMA 2OZEA 4NE2A 2XJ9A 4TMZA 1YKSA 2AWOA 5JEDA 3CPHA 1R8SA 1SXJC 2QBYA 1T8UA 3RRMA 5AUNB 1DE0A 2FSIA 3NWJA 1NKSA 2V6JA 2ZRHA 1MO4A 1RVDA 2ZJZA 3SFZA 1NLFA 4B74A 1Q20A 5FOWA 1XPRA 4M0LA 4RZXA 1XPOA 4LJYA 4CZ2A 2CNWD 2J5XA 2W6JA 1MABA 2DB3A 4QHTA 4A2PA 1VHTA 3LBHA 1E9AA 2OCYC 2KBFA 2R6FA 2GXQA 1DS6A 1YZLA 3NEJA 1CIPA 4A8JA 4A82A 2YC2C 3P20A 4LJ5A 3RANA 4DCSA 3A58B 4DDTA 1S4QA 1G8GA 1NLZA 4WIAA 1RIFA 5L8VA 2V9PA 1GNRA 3EXAA 2CHGA 4NCIA 4YMWA 4ESHA 1UKVY 1G16A 4FWIB 3CNOA 2VEDA 3KQLA 2BIFA 3LQQA 3S1AB 4Q7MB 1VHLA 5FTLA 4HSEA 4MYCA 1Q12A 5HE9A 3R7WA 2RAPA 3KQKA 3PITA 5BWMA 1XCGB 5DNYB 5EQTA 4BLRA 1RRFA 2KWIA 1X3SA 1GKIA 2F43B 2H8KA 4Q1BA 1XX6A 2UZIR 1C1YA 1GIAA 1HT2E 5FBQB 1XTSA 3RWMB 2VSOA 4LJAA 5GVRA 1W0JA 2BDTA 3TNFA 2YNMA 4Q5IA 4QGHA 1J8YF 4B6FA 2Q0HA 2WJGA 4JVMA 3GLIA 1BKDR 2G3YA 2BWJA 1NBMD 4KI0A 4LDJA 3I3SR 1R0XA 2OV2A 2ZJ2A 3WYAA 4AKIA 2GXUA 1A4RA 2VSFA 3CRRA 2O8FA 4YMSA 5FL7A 5DLQC 3Q8XB 4KJZA 5CDFE 2ZREA 4MKHA 3VX3A 2O8DA 3LDAA 4LHYA 4OHXA 4PC1A 1UBEA 3QNUA 3WBKA 1U99A 5IT5A 1U0HC 3M0EA 4Q7LA 5L3VA 1E6CA 1JQJC 1W5SA 4DLZA 4KCGA 1E96A 1GWNA 2WAXA 4IXNA 1SKQA 4OJQA 4S35A 3ZQJA 1Z06A 2VRWA 1E2EA 2EFEB 3VHXA 3QKRA 3ZS8A 5D3MA 1EX6A 2IHBA 1KK1A 1TQDA 2RHDA 2OG2A 1E2HA 4Z51A 1Y3AA 1YR9A 3LBNA 4WVFA 1IXZA 3GEHA 4BLSA 4IOJA 4HAVA 2Z5FA 3SFVA 3U3RA 3Q85A 1ZM3A 4Q00A 1P9RA 2WICA 3AQ4A 3AH8A 2W6IA 3C16C 3IHWA 1GRQA 4ITRC 4Z1MD 4FN5A 3QKTA 1ZAKA 3EA0A 4XOIA 4LUCA 4Q21A 2GZDA 2C9OA 3B78A 4Q9HA 1M34E 3LO5A 2BC9A 1T3SA 4TLCA 1X86B 5DIFA 1E1QA 1JJ7A 1YR6A 1NMXA 3UWKA 1RE0A 2YV5A 4FCVA 4V02A 4WZBE 3TBKA 1CBUA 1TQ6A 4LBWA 4QRHA 4DT1B 3PXGA 4KFTA 2JJ2A 1W2GA 3EC1A 2D2EA 2GZAA 3FPAA 3LXXA 1FX0B 2AWNA 4LHZA 3UG6A 1E9RA 5LB2A 1X8LA 4DLRA 2O8FB 4DZZA 3U7GA 3B1ZA 1AS3A 3AF2A 3BH6A 1Z6TA 2ZUDA 4JIMA 5CIWA 5JWRA 1QHHB 4EJSB 2ONKA 4BFZA 2NOAA 4JSYA 821PA 5KHOC 5KUTA 2YJTD 2B7BA 5FR2A 5FPTA 2ZU6A 2JLZA 1KIMA 5AR1A 2I4IA 4NDZA 1XZPA 3P1JA 4B32A 3W6PA 2BCJQ 4HAZA 4NCJA 2HEIA 2V7QA 3GFTA 4DBLC 4BQSA 4KBGA 4MITA 3A4MA 2GF9A 2ZVQX 2QPOA 3ICEA 5B64A 3W8NA 4B76A 4CT4B 3JZMA 1KSFX 1KI4A 4LPSA 1JECA 4ZO4A 3RVBA 1IQPA 4YXWA 1ZNYA 2RGNC 1G4UR 3R7WB 2WIBA 1N6IA 5FTJA 4W5WA 3CB4A 4BASA 1GM5A 2W00A 3FFBA 1G7CA 4YMUA 1TADA 1G8FA 4C9BA 1Y63A 2BM1A 4JS0A 1Z83A 3FYHA 4LJ4A 2YWFA 3ECCA 3OIWA 1OF1A 5FBLB 4B3FX 4CVNA 3GLHA 1ESNA 2LKDA 2ZRGA 1TUIA 1TQ2A 2IHYA 1LTQA 1DADA 2BMFA 4NCNA 5FI0B 4P4TA 4TT3D 5AJYA 3SU8A 4JLKA 1PJRA 1ZNXA 4LC1A 2REBA 1LW7A 2JGNA 4GFDA 2HCBA 2FWRA 3NDPA 5KDDA 2FNAA 1R2QA 2ZEJA 3KJHA 1SKYB 1YZNA 4M1KA 2IX3A 3X1YA 4NL4H 1LB1B 1Z07A 2J9RA 3EX7C 3CF6R 1IM2A 1DO2A 2QRNA 4HDQB 5E7IA 4KVAA 2Q21A 3FDIA 3QVUA 1C4OA 2FF7A 4MKIA 1E2DA 3U60B 3RLFA 4MGZR 3FTQA 1EFUA 5ANRB 2D7CA 3NIBA 5DN6A 1R8QA 1ZCAA 2HLDA 3TR5A 1E69A 4KODA 2WMOB 2C78A 3DZ8A 1IY0A 2HXYA 1ZM9A 3C4JA 4DDVA 2D3WA 1KAGA 3Q7QA 5HE8A 1SVOA 4TMVA 4UNNA 1M2OB 1Z0IA 2ZAOA 4PC2A 2OILA 4V0LA 1GP2A 1QZXA 1W36D 2FG5A 4ILEA 4Q1FA 4DCVA 3GFOA 4D0GA 3SZRA 1NSTA 1TEVA 4LV8B 3KB2A 5JS8A 3EZFA 2A5GA 3TQCA 5EP2A 1OFTA 1OPXA 1Q22A 4Q9JA 3RSLA 4PQFA 4NYMR 3H1TA 3C41J 3K0EA 5G41A 5EZ5A 1IXRC 4KSBA 1AN0A 1G8YA 4I1VA 2GAAA 5IF9A 4RCYA 1XBTA 2OBLA 2RGDA 3HDTA 3ZVMA 5FTNA 2J0UA 2WWIA 4PQYA 3W9YA 1N2CE 1OYWA 4BFXA 3T35A 4NCHA 5AJXA 3OIYA 1KZGB 4LZZA 1BO6A 1NP6A 4TL9A 2B8TA 4IDOA 5JJLA 2N1BA 2GHIA 4ZDWA 2Y8EA 4JLVA 4I1SA 3KUDA 3GJ5A 1HYQA 3I72A 1G6OA 4UNQA 1XJCA 3LV8A 5B58C 3IEVA 4JLPA 2XX3A 5JFGA 1L4UA 2ZRKA 4IVRA 2C9CA 5J5CA 2ZYTX 4GI7A 4MRVA 4KLZA 1RFLA 3M1IA 1WE2A 1R0YA 1QF9A 1KZ7B 1P62B 4L15A 3CRVA 4U00A 2B8WA 4XVQA 3L8ZA 2JAQA 4BLOA 1BOFA 4LYJA 4C7OA 1MKYA 4OQNA 5J40A 3KKQA 1X1RA 3WYGA 3X2SA 4DT1A 3ZLJA 2ZSEA 5A5GA 1VYUA 2ZI5A 3L8YA 4JBYA 4D25A 4PSKA 4FMCB 2WPDD 2ANCA 3QY0A 4JBWA 4P4SA 1VYVA 2QI9C 1R0WA 4B34A 1VMAA 2GCOA 1DG3A 4LBZA 1ZCBA 3SBEA 4ZI2A 3W6NA 2ATVA 3AP2A 4DB2A 5CYPA 2HLDD 2P65A 1ZP6A 1ZYUA 2IC5A 2ZUBA 5UKDA 3RRYA 1VYTA 1R7RA 2AKAB 4NMMA 5C1BA 1UBFA 421PA 3IHLA 2QAGB 4DUGA 4HB3A 3QXCA 5AUQA 2BKUA 4BZQA 4JT2A 1QHSA 4UXJA 1RW4A 2YC4C 3A1TA 5E95A 1JALA 1NBMA 3CW2A 3LW7A 3WNDA 4C7OB 3K70D 3KXIA 4FCWA 3TVTA 1R10A 1ZD1A 2XZPA 5KOYA 3BC1A 4EIWA 1D2NA 3TK1A 4PFSA 3ASYA 5FOVA 4BFSA 5IRCD 4L9WA 2ZRBA 2IT1A 4Y0VA 2H16A 1QBKC 5FFMA 5BQ5A 2G0TA 1JXMA 3EZ7A 5BN5A 4M1WA 5JI3E 2OXCA 2W2VA 1UADA 3GJXC 3ZDQA 3FMIA 1D9XA 3HU2A 5JS7A 1JAIA 5DISB 3HP1A 2ZRDA 4MRPA 3ASZA 1EFHA 1CLUA 4IDQA 2GCNA 5K8TA 4B73A 2J41A 4QNRA 4DWJA 5LDDC 3OZXA 4IEEA 4B2LA 2HDNB 3GJ0A 1ZUIA 1KDPA 1OKKD 1G20E 1IN7A 3RC3A 1G8PA 5FBWB 1CS4C 2WWWA 2XTZA 3O8RA 1TTTA 5LD2C 1Q3HA 1ZMXA 3LVRE 2W6ID 3OHMA 1SQ5A 1UM8A 3DDCA 4FW9A 2FA9A 2QQEA 3E1SA 5TARA 3TIFA 1FNMA 2GJ8A 4I1OA 2WKRA 3BB4A 4JL6A 4JLNA 1N5IA 5E4FA 2QA5A 1G3UA 4YMTA 1GNQA 3T06B 5IK2D 3K09C 4B3CA 2UZ3A 1XB2A 2PEZA 3IO3A 1XTIA 1E9SA 3EIEA 2V55B 1P9NA 5HTKA 1XD2A 4OBEA 4U7DA 1II8B 3TQFA 2ZR9A 1GZSA 1F2UA 5SZIA 3GCGA 1K8RA 1M6NA 2BJWA 2OFWA 3TJZA 1AJEA 3IGFA 1PV4A 2WJJA 1H8ED 1XCPA 4KITB 1E98A 2D2FA 3KJGA 3QXXA 2XZOA 1OH7A 1MT0A 1EWRA 5GVSA 4A2QA 2PZFA 4MDFA 1KI8A 1F2TA 4CRWB 1O87A 3RNLA 1CJTC 1Z0FA 4O3MA 4LJ9A 5FTKA 2ZU0C 1MO3A 3FGNA 4MH0R 1ZD9A 2IBMA 2ZSBA 2VF7A 2X8AA 5KSOA 1L8QA 1SULA 1XU4A 2IYYA 3A6PC 721PA 2RGAA 1YZKA 4TMWA 2EWVA 4LHXA 1TPZA 4XTRA 4GT1A 1M8PA 1LS6A 1EFRA 2F3RA 4DHEA 5BW8A 2FFQA 1NN5A 3L0IB 2O8CB 2XEXA 4C0QC 3OIUA 4YQFA 5FOXA 2IYRA 5GJCA 4PXAA 1W46A 1E79A 4DB4A 3B1VA 4JVSB 2P6RA 5LPNA 1OFIA 1LV7A 1QRAA 5KPJA 4A0RA 4K46A 3KTAA 2Q9CA 5AWFC 2H7VA 5BYJA 4LI0A 2B7CA 4DVGA 2GILA 1KY3A 4PHHA 3THXB 2OESA 4IRUB 2ZETA 5FUYA 2ZROA 3HYTA 1G5RA 2QAGC 4XH9B 4AK9A 1ETUA 5EE5B 1E3MA 1W47A 3Q9LA 1JQLB 4ASUD 1X6VA 3EIHA 1WMSA 5JSZB 1ZINA 4XTCS 3L2OB 4QHYA 3ZS9A 1W1WA 1G5TA 4JL5A 3U44B 1ZIPA 3BIFA 1M1YE 3QEJA 1KI6B 4Q47A 1QHGA 3WY9A 5KDOA 4HB4A 2IEZA 2GEVA 1Z63A 1WA5A 1TF5A 2NQ2C 4US2R 2HJVA 1ZU5A 4HUQA 2ZR7A 1TX4B 4MQBA 4P33A 1KY2A 4BPBA 4F4IA 2IF2A 3QQ5A 4HUTA 4I81A 5EP3A 2HT6A 4X8MA 4QBHA 5KYKA 2OCAA 3TUZC 4EFNA 4EPYA 5FH9A 4RJLA 4QBGB 1CJKC 3CONA 2P67A 3NBFA 4AKEA 2F6RA 4BE7B 1OXXK 3K8YA 3VNUA 2CVFA 2PT7A 1U0LA 3U3MA 3K0CC 3L0PA 4W7SA 5EE3A 2VIIA 2JLQA 3QF7A 2IWHA 2LWIA 1Z6XA 4A6XA 1FUUA 2CLDX 1ZM4A 3AB3A 4E07A 4AYTA 2QGZA 5CYOA 3FWYA 4WZ6A 4O0MA 3T15A 5EUQB 4W5HA 1A7JA 1YR8A 2ZI9A 1XPUA 1W44A 4B2PA 5FOUA 1G3IA 3A1SA 1L4YA 2O5VA 3FHCB 2IYSA 3I8SA 4HZUB 4LK2A 3FOZA 2VL7A 3G82C 2BVNA 1XD9A 1EX7A 3I1FA 4PQRA 4LWZA 2IS1A 3SEAA 2CL6X 3MJRA 1N25A 4M1SA 4LY6A 3L0SA 4KSCA 4BLQA 4DRZA 2W83A 4D4JA 4QHSA 1XEXB 3SHFA 4ACAA 1T91A 4UNSA 4Q4HA 5EP1A 4IVQA 1ZJ6A 1TF2A 2X77A 4H9GA 4L9SA 4NP6A 5F9HA 3V9PA 2KJQA 3NC0C 1EK0A 2CE7A 4EQ6A 5AK0A 3VR6A 3KFVA 5GJWC 4U02A 3GLGE 1AGRA 3K1JA 3LAWA 3QKUA 4L5BA 5ELXA 1NY5A 1E0AA 1VECA 3FHTA 3A4NA 2H5EA 2CL7X 1UKEA 2IXFA 3LRPA 1YZUA 4KO8A 2AXNA 3CZPA 1Z0DA 2P3SA 2EFCB 3DM5A 3WNBA 1E2JA 4GZMA 3PQCA 3IDQA 3QIAA 1G7RA 2FPLA 4E22A 2WTUA 3ZVLA 2RMKA 1COWA 2PX3A 3IBYA 4G5GA 4JLMA 2Z83A 4AURA 2RGBA 4MDEA 5DYGA 3FMFA 4KHZA 1ZM7A 3SNHA 3U4QB 2R65A 1G3RA 2XTMA 3OESA 3LA6A 5TDHA 1CR4A 3IPYA 5L3QB 3R9WA 2DFTA 4LV6A 3VR5A 5JI2E 4LGMA 2ZRCA 2GNOA 2VP6A 1U8ZA 4B33A 1G1MA 3O8CA 1IY2A 1MRSA 1KNQA 4XWOA 2C9YA 2YINC 3PUYA 4CEHA 1S3SA 2X1VA 2ZE5A 1XCMA 4MGIR 4C0SA 3QXSA 1CRQA 2F3TA 1FZQA 2JCSA 3L0OA 1S0UA 3TAHA 1HE8B 1E2IA 1II9A 1XTKA 4W9MC 5CJPA 4Y0AA 3OE7D 2J7PD 3TKLA 1EG7A 4XD7D 3FFAA 1FP7A 4DIEA 2BV3A 2WKQA 3IIKA 3VKHA 4L8GA 2CHVA 3C15C 1U0JA 2JJ1D 1Q1QA 2D4HA 1KAOA 3RS3A 1JEEA 3NBYC 4OI1A 4PSVA 4LHWA 1FTNA 2DFLA 2RHMA 4TLBA 1Q21A 2BM0A 3WHKA 3DL0A 1NL3A 1SVWA 2O52A 1OYYA 1GOTA 1YZGA 4ZIRA 4X8HA 1SVSA 3TR0A 1A2KC 4ZCMA 1ZBDA 1KKLA 3OE7A 1E0JA 2IW3A 1G64A 4EPVA 1N0WA 3MWJA 4TLAA 4JJZA 1M7GA 1NRJB 1XMVA 1E2GA 3GD7A 4TSFD 3B1YA 4QJ4A 3F3YA 3WNCA 1KHTA 2QRZA 1Z2AA 1Z47A 4LJ7A 1OH8A 4TL7A 3F5FA 2AKYA 2F1RA 3AGPA 3HYRA 1JAHA 1SVKA 4L4UA 1YRBA 2O0HA 2ZRLA 1G8HA 1JNYA 1WDTA 3OAAD 1NVUQ 1GL9B 3W8RA 3B5JA 4IOKA 2JLRA 3T1VA 2DWPA 1FNNA 3E5HA 4QBFA 1KO5A 3NH9A 4GOKA 2W0MA 4J0QA 4TYYA 2J59A 1OB5A 4TSFA 1OIVA 1E9BA 1Q1ZA 2O8DB 1AGPA 4RD6A 4US1R 4NYIR 2IYXA 4C2TA 1NI3A 4PZLA 1P2UA 4ZIRB 5C4MA 2N46A 4Q7JB 1FX0A 3EPJA 1DAGA 2ZJBA 2VSXA 2GAOA 3U6BA 2ZRMA 3THOA 5CM8B 1KI7A 4Q9KA 2FN4A 2VHCA 3OEED 4WXRA 4QM7A 1FP6A 4NONA 1N5LA 3CUEF 1G5PA 2WAYA 4HLCA 2QEQA 3HU3A 4EDHA 1HV8A 3IUYA 2WBLC 1P73A 5FUWA 5H70A 5FL3A 3RYTC 3WRYC 4DLTA 2QSZA 4M9SA 4EFLA 1T3HA 4IDHA 4BFTA 3UPUA 4EKDA 4GP6A 1KTVA 4OHVA 5K8LA 2IYTA 3EPKA 3GJ7A 1KGDA 3KKOA 2IUUA 3X1ZA 2CK3D 4WXPA 2J45A 4OQXA 4PSAA 2NIPA 4MRSA 4TT3A 2XNSA 3PG5A 2JA1A 1GL6A 1RYFA 2C2HA 1T0JB 1TQ4A 5KNDA 4WW0A 3T12A 3JVUA 5TY0A 1KI2A 5JHGB 4YLGA 4GOJA 3TUIC 2AX4A 1N6OA 3ADDA 2QQ0A 3FKSA 2D7DA 4Q7KA 2NO6A 1PLJA 5EXTA 1GSIA 5D3MB 1E2PA 3BE4A 1ONBA 2HCJB 1AQYA 3EWSA 4RFVA 2OM2A 1KMHB 1XFAA 1EGAA 3Q5EA 4LV5B 2ZR0A 3QPUA 3VR1A 5TXGA 221PA 5EXPA 1TF7A 2Q9AA 2WM9B 1KO8A 4OHZA 1W4BA 1OV4A 3B1XA 3RABA 3S1AA 1KI1A 2ZI3A 2ZRFA 4DXAA 2DFNA 3TLXA 2OLJA 2W58A 3IQXA 4P3YA 2RCNA 4IDPA 3BAFA 2G1JA 5F2EA 3I4LA 3SDZA 4EQ6B 3MUFA 1I2MA 2BJVA 4G5OA 2IK8A 1G6HA 2A2ZA 4G01B 4QG7A 2G77B 3AUYA 2AXPA 4BZXA 4EUNA 2Q3MA 5CK5A 3MCAA 4Q19A 2JEOA 1OIXA 5FPKA 1GAJA 5FL7D 5EE1A 4ARZB 3CX8A 1UPTA 5CLQA 1NY6A 5GJBA 2ZYVX 3KQNA 3KZ1E 2J0UB 1K6MA 1I2DA 1XP8A 2CL0X 3VFDA 1CULC 4D6PA 2QE7A 4XIGS 4AWXA 4TZ0A 4MKFA 2PH1A 4WAUA 2QORA 3CH4B 3CRQA 5DYIA 1YU9A 1RYHA 3GPLA 3W3AA 4A9AA 2RGXA 3AKCA 3QXJA 4P4SB 2GTPA 3NDBB 1CXZA 4HAUA 2YYZA 4ZCLA 1J90A 2RGCA 3NH6A 4Q1AA 3U7HB 1DELA 3T1QA 2ZRJA 2QG6A 1XD2B 3HR7A 2Z4RA 2CLCX 2PX0A 3REGA 4FMCF 5G53C 4LRWA 4IDNA 3CKLA 2EQBA 1Q44A 1D9ZA 2O0JA 4HYYA 2QE7D 3C7KA 3EC2A 3A8TA 1DEKA 1DO0A 2WHXA 3FMPB 4NPHA 1IJEA 4RVCA 4U5XA 3RS7A 1RZ3A 5CDFA 3UMFA 3UMRA 3A37A 1KK3A 3IKJA 4QGAA 2ODWA 4Q4HB 4H1VA 3B6EA 3B1WA 3TGPA 1G7TA 3D7MA 2OT3B 1W4AA 2BCGY 1M7HA 4FMDF 4DSNA 1OKKA 5F9FA 4PC7A 4II7A 3CF2A 1F3OA 2AD5A 2ERYA 2R6CA 2ZSAA 3AP1A 1OB2A 2J3EA 3PJRA 2XITA 2QM8A 2WV9A 2OCPA 1FMLA 2WJIA 4ZDKA 4HAWA 5HR5A 1P72A 1NLYA 4HAXA 4C30A 2XXAB 3O8DA 3CO5A 2UVQA 1YRAA 3TSWA 1BMFD 3O47A 3DMDA 1E0SA 4XJXA 3KFXA 2FZ4A 3LXRA 3H86A 1HQYE 4A0HA 2ZJOA 4GP7A 2EW1A 4AG5A 5IK2A 2WVJA 4ZPXA 3N2EA 2GJSA 5KTYA 4F92B 1L7VC 2AK3A 5CITA 1XWIA 3AF3A 3K9LA 1TU3A 1A5TA 1J70A 1FQJA 2L0XA 1US8B 2ZJ5A 1V5WA 2FJUA 3NEYA 4RZUA 1VCMA 1R5NA 1OE0A 2CEAA 1R5OA 1FTSA 1U9IA 3EARA 4M1YA 1MO6A 4JVNA 2QAGA 1JR3D 1OIWA 2XB4A 4GDFA 1DOAA 1NIJA 2IEYA 1FFHA 1L2TA 2DPXA 1OH5A 1QHIA 3KJEA 4CEJA 1W2HA 1D2MA 1K5GA 1KNXA 2RGNA 3T1OA 1E2MA 2R44A 3SJZA 1JPNA 1YZTA 3NG1A 4TL6A 4C0KA 1GKUB 1GITA 4WZAE 5J4VA 5DI3B 3RDPA 2GXAA 2CCGA 2XNDA 2ZE8A 3D6TB 5JHHB 1JR3E 4DSUA 1YR7A 1EFRD 2V3CC 4DCNA 4BFYA 2VP5A 4C0LA 5B2ZA 4GOXA 4UNRA 3WYFA 4B75A 2NO7A 1MV5A 3AKDA 2JATA 2RGEA 2J1LA 2JJ8A 2IYLD 4DCUA 1CJVC 1JEDA 3GLHB 1N5JA 3TE6A 1FL9A 4N3NA 4D26A 2ZJYA 5KDLA 4PO1A 1UBCA 2QSYA 2XOKD 4DLUA 1ELOA 4NTZA 5FBVB 4CT5A 3VU9A 1VG0B 3I32A 2YKGA 1E1RA 1S2MA 5DI9A 3I8XA 1NKTA 5D3QA 5L3QA 4W5JA 2XZLA 3EAQA 3EZ6A 1XMJA 1XNJA 4BEBA 4NZYA 4NU0A 4QNMA 3MSXA 1KSGA 5CJ2A 5HKKA 2GESA 1BMFA 2QTFA 1Z6AA 4PPFA 4QC2A 2F43A 2WPDA 1HA3A 3BBPA 2DCUA 2P5SA 3UATA 3O8BA 5TVKA 3FHOA 4UXHA 2ZQ5A 1E1QD 5HZHA 3GLIE 5JWOA 2ANBA 3BFKA 3LH5A 1R6BX 2WSMA 4TMKA 4A8JB 3I62A 1PLKA 2IS4A 1Z5ZA 3QXHA 4JKIA 4V0NA 3RS2A 5IHPA 4FI3C 4Q4JA 2CCJA 3VR4A 5LD2B 1IXSB 3TSOA 3UKDA 4IEIA 2NPIA 5JJKA 3B2EA 3PVSA 4FINA 4E5UA 3T61A 3LQRA 2D06A 4F93B 2JLYA 2H18A 2GJ9A 2E1RA 2O8EB 1DTSA 2ZS9A 3B8HA 3ZIAA 1F48A 4OI2A 2GVDC 2A78A 3KKMA 4ESVA 1GDDA 3TW8B 3P4YA 3QSYA 1E0KA 5C4GB 2VYFA 1DAHA 2QT0A 3CNNA 2VP4A 2ECKA 4TLDA 4FCTA 3L82B 2CK3A 2BBWA 4R2HA 2OO7A 3EIQA 1NN1A 2TMKA 1DARA 1XXHA 3K0SA 4Q02A 1WRBA 5KSYA 4PPQA 3SC3A 5KU1A 1G9XA 4GMDA 2IYWA 2GDJA 5C2JB 5J4KA 4OK6A 4PZYA 1G7SA 1XF9A 2ERXA 3G0HA 3KUCA 4JLBA 4XWAA 4AYWA 3R9XA 4A15A 3RS5A 1G41A 4A6PA 1KDRA 2IUTA 3CPJB 2R6AA 2OLKA 1YVDA 5J4YA 1T8TA 2IS6A 3K0CA 2Z6VA 1T5IA 3OEHA 1S3GA 2WWXA 2J0QA 2FZLA 2WWYA 3H0KA 2CBZA 4H1UA 2Z43A 1OFUX 1M7BA 1NBME 2H17A 1KO4A 4NYJQ 4B3BA 1ZUHA 4HLDA 1X1SA 3RC8A 5JECA 1RKBA 1GL7A 3SJAA 4D2IA 3PUXA 1X8JA 1ESMA 4Q1DA 3DOFA 3UG7A 5EJEA 2XGJA 5EP4A 1KOFA 2ZITA 3Q72A 2IUSA 4GMXA 3QVVA 3KB1A 1EFTA 2VF8A 4KFSA 5HPYB 1P6XA 4HZIA 2DBYA 3AVQA 4HB0A 2WWGA 4O2LA 4Q4AA 1EXMA 1Z8FA 4KFRA 4V0KA 4HDOB 2H92A 5DH9A 2ONJA 3AVOA 4AIIA 3U61B 1XTJA 4EPRA 1SVIA 1GRRA 2C99A 3OIVA 2HYDA 2D62A 4D82A 3IILA 4TTRA 2Q3HA 4D4LA 1BH2A 2OAQ1 3N70A 4HAYA 4JKYA 4LX0A 2DR3A 2R6DA 5H1YA 1WP9A 3NC1C 3D3QA 3B85A 4RCZA 1W36B 4I1UA 1Z08A 1SXJA 1DPFA 1LF5A 2XTNA 3LLMA 1FOEB 4LC0A 4A92A 2JLXA 4OI0A 3QG5A 1KI3A 2VP9A 2JASA 4V0MA 4E03A 4ERNA 1ZU4A 3SYKA 2QTVB 3ZD7A 1EFCA 1E9EA 3SBDA 2GKSA 1KMHA 2IYQA 4P32A 1VG1A 3AUXA 4UKDA 3FB4A 3LNCA 2Z4SA 2DWQA 4A2WA 3DEFA 4RKFA 1MOZA 1G291 2FFAA 5K8IA 1D5CA 2FV8A 3M6AA 1KSHA 2R8RA 1W36C 2XXAA 3K0AA 3KL4A 5CLLA 2NO0A 3TUJC 1CEEA 1E32A 2OAP1 1NVVQ 5AUOB 1I4LD 3IQWA 1TMKA 2HT1A 5EE9A 2EYQA 2OCBA 4DEXA 1KYIA 2N42A 4RD4A 4B48A 2GCPA 1E79D 3BGWA 4LPKA 2PEYA 2NG1A 3K9HA 1IN6A 2ZVPX 5SZJA 4Z8YA 3THWB 2Q3FA 5BXQC 4A0FA 4Q1CA 1R0ZA 4XVUA 3W90A 3GQBA 1AKEA 2OSBA 1VIYA 2QP3A 5FPSA 3ND8A 5DHAA 4URZR 2IF0A 3IPXA 2O8EA 4MUAA 2SHKA 1TNDA 2CDNA 1E2FA 3WMGA 1OJLA 4Q4AB 5JBQA 1WQ1R 3QKSA 5CB6A 4ZKDA 2VP2A 4IVPA 1N0VC 2GK7A 1RRGA 1H8EA 2AD1A 3ZZ0A 5J47A 3SQWA 1Q57A 2DY1A 1KO7A 3EASA 3N5CA 4C0HA 2QAJA 4G5RA 4IOLA 4Q1EA 2C95A 1DVRA 3B13B 2ZE7A 2GJAA 5FUVA 2HXSA 4M1TA 2ZYUX 1ZNZA 3C8UA 4IJMA 2B6HA 3GP8A 2XJ4A 1ZM2A 4PTLA 2GA8A 4RZ3A 4DCTA 4S2EA 3BS4A 4FIDA 2IWRA 2CJWA 1YE8A 4C4PA 1M74A 3BB1A 4XD7A 4AC9A 1KJZA 3OEEA 4UJ3A 3CX7A 4TTPA 4UJ5A 2VPPA 4Q4JB 2JDID 2K5UA 1LY1A 2A5YB 2QNRA 3JVVA 3GEEA 4R9UC 2BEJA 4DLSA 4QJ3A 2KI5A 3CWZA 4B71A 1HEIA 1SXJD 4WOPA 1LNZA 1N6NA 3HR8A 5H68A 3E70C 4K8OA 1XEWX 4NHOA 1MABB 4Q4LA 3REFA 3MMPA 1B23P 1XEWY 1Q1BA 4KFUA 2CVHA 2QT1A 4AI6A 1T5LA 4URWR 4KU4A 3GLHE 2OXRA 3THWA 1CP2A 3CRW1 3DPUA 1FPMA 3E2IA 4URUR 2ZS8A 4JLDA 4R98A 4US0R 2AR7A 2V4ZA 1V43A
chains in the Genus database with same CATH superfamily
2A5FA 1M5TA 1U98A 4TSKA 2A1UB 3IEKA 4G0UA 1PR6A 4RDHA 4QSMA 1H1DA 2JCGA 5DWDA 4GDMA 4A1FA 1Q0QA 1TU0A 4OH1A 2K7ZA 1JTEA 2HNKA 2ZBVA 4RVSA 5JCOA 4TMXA 3QOFA 3JTEA 3G5UA 1FQOA 1T0HB 4MZDA 4RS4A 4UMFA 4ZOLA 2VNAA 3DR5A 4B6QA 4KV9A 3GJ3A 2ZYIA 3ZHXA 2XBLA 1Y1LA 2XOKA 3R3WA 2E18A 4E6EA 1Y7TA 1ZD2P 3B1FA 3OQ1A 1V7CA 4NKRA 2FPKA 3JQPA 1T2NA 3KUKA 4O2RA 5ELMA 1O6ZA 4P4UA 3VOBA 3ZYCA 1OVGA 1V4VA 3C5EA 5DM60 1G3QA 3E53A 4WPGA 6CHYA 3EG9A 2I9PA 1JFFA 4D3SA 2ZI6A 3W2TA 4LGVA 5I3ZA 4OL0A 1H85A 4KUGA 1RAFA 5G1NA 4HDCA 4UD6A 1XMSA 1EQUA 5FD8A 1XALA 4RSGA 1OX4B 2XXBA 5B6IA 3AP3A 2PKRA 2HH9A 5P21A 3VXKA 1XAHA 3BIWA 4ARIA 3U4AA 5JZSA 2VDKB 3W4JA 1Z0AA 1YJQA 4GOND 2C03A 3D3JA 1JB9A 2F00A 2C9MA 1KYXA 4FKZA 4CI9A 5H81A 4YXWD 3VM6A 1XDDA 1VG8A 4BS9A 3X1XA 4GPTA 1R4NA 1THMA 1RABA 1OU0A 1X1BA 2AFHA 3OC0A 3PIRA 4H59A 1L5WA 2YZ7A 4MUBA 2BGJA 1KE2A 3SN6A 3L4BA 5JCZA 1HLFA 1XZAA 4LHSA 6AT1A 3ZX4A 5E4JA 3AF4A 3SJUA 2GUWA 3DE5X 1NI4A 3GLSA 4FSDA 2ZTSA 1G42A 4CN9A 4CTNA 2EBFX 1FQKA 5EQJB 1J99A 4L6IA 1IHUA 1UBUS 4LI3X 2GRJA 3RR2A 4DWVA 4YT8A 1R5BA 4NBRA 4Y2HA 5AKLA 3W8FA 5C8DA 3L4JA 2FSGA 3K6SA 1ZOLA 4MB2A 4BZPA 4MPRA 1VCOA 1E5LA 1ZGJA 4LCEA 1MPXA 3GVXA 2GN6A 4ARCA 2EWWA 3K4PA 4K7JA 4F04A 2QR3A 1T6NA 4DR2B 2QVXX 1NU8A 2QTAA 1PNQA 4JQOA 3FAZA 4ZO7A 3VVCA 2J9GA 4FE7A 3DKPA 4II3A 3DFUA 3GLRA 3HDJA 1M2WA 3CLTD 2PZBA 2VHQA 3LKBA 2FEOA 5BN3A 3MJTA 1PKEA 2FRVA 2DC1A 4J0EA 4P3NA 4YCCA 3PFKA 2NXWA 2NO9A 5LYYA 3FTDA 2AFHB 4J0HA 2WF9A 2XDYA 2B92A 3U3JA 3UMCA 1AB5A 3IDZA 3MTBA 3HCFA 2M6LA 2OA0A 4NG5A 4NY1A 1P9LA 4JB8A 4DLVA 4JJ6A 4FZ3A 2XWPA 4G0VA 5LA6F 1BG6A 3CLHA 3SYNA 1CRWG 1JAYA 2OGWA 1Y42X 2FEWB 2I55A 3VZSA 3ZZTA 1QTNA 3T1YB 3A7DA 1DQPA 3KKNA 1P4SA 4IPTA 1C0KA 3D4PA 4OP1A 4TT8A 4K05A 3E7PA 5JAQA 1UXHA 2AGVA 5KTYA 3ABSB 5DSZA 3KOOA 4QUGA 1EXNA 5A4MS 1CU1A 3B5EA 3C45A 1GZ6A 2OGTA 4TV8F 5EHGA 1I2BA 3WWOA 2LXNA 3B9BA 3EEYA 3AVYA 1W1IA 5DCWA 3BPSA 3UIEA 4BPRA 3A9UA 4IJWA 1WDMA 1ND5A 3BKXA 3HY6A 4KIFA 4DLYA 1WAMA 2QR5A 3MRVA 3VDQA 1LFDB 2EYUA 2P4SA 2VI5A 4HUQB 1IC6A 2R00C 1RLOA 2VAMA 3EG9B 3GB9A 1C8LA 5BV0A 5KOIA 2P9JA 3ACDA 3EA5A 4MVJD 4DAEA 2FAXA 2JJ2D 2X8BA 4NZNA 4LFBB 4NVRA 1SBIA 3H4IA 3NU1A 1EXDA 3JQAA 4GPIB 4FC6A 5ALKA 1A8UA 2VKTA 1E3JA 1XQVA 3MGCA 4JZKA 4F9FA 2CHQA 3C87A 4L5AA 5G02A 1EB8A 3LQ1A 1NE2A 1VG9B 4L7VA 1QDEA 4LHVA 4RTMA 1ZH0A 2B3DA 2HWKA 2J31A 4I08A 5J4LA 1N1MA 3W05A 4LF4B 1EWQA 1RPAA 3GFGA 4ZD6A 3FTEA 3I4CA 2P9BA 3D31A 1QV9A 3R4CA 3NTUA 2UKDA 1M0SA 3K0HA 2B21A 3FRHA 4G81A 2PANA 2NU6B 3DMNA 4R7GA 1IIRA 4WEOA 2CE2X 5TF0A 3CX6A 5JRJA 4OQEA 2JCVA 3H9CA 1VMKA 1MUUA 4IS2A 1BGXT 2VNIA 4IHJB 5TPWA 1XMXA 2PLFA 1N1GA 1CJUC 3GNLA 4R8VA 1Z6PA 3C2QA 3ZZUA 5HKBA 3LC0A 1HDEA 4E2YA 3BQNB 4JWKA 1L5HA 4UM9B 2XKAA 4CR6A 1PYOA 1ETHA 1O5TA 5I9SA 5BNIA 1LDBA 1P2GA 2VNKA 4LNUA 1IVNA 1K97A 1M72A 2HCRA 2QUZA 4AQDA 1XZFA 3P27A 3UENA 3V00A 5K45A 5GV8A 2X5NA 1EK6A 3N3AC 3JSXA 3ZLTA 2CJWB 5C8YB 1N2OA 3AV0B 3GRAA 1C9KA 3QE3A 4MHTA 2FSUA 4IIJB 3PYMA 4Y7CA 4MWTA 5K2MA 5HIKA 4DNQA 4ESEA 3FMOB 1WS6A 2Q8PA 3ZD9A 3I53A 3MB8A 3ZHRA 4CGYA 2IYUA 3IJPA 4HGYA 5JMOA 4IS3A 3UN1A 3PC4A 1LBEA 4JL8A 1A77A 4LK3A 4QPDA 4MUGA 3VPXA 4HDRA 1GG9A 1K7EB 4INJA 5E1MA 2X0EA 2PCJA 3QTTA 4CM7A 2DFKB 4D56A 5J2TA 2H52A 1XZGA 1JJVA 5E7MA 5I8PA 5KMGB 1FDVA 2VJNA 4R84A 2XUAA 1ZMOA 1CR1A 1PBTA 2ACKA 4M8NE 1MAHA 2GYUA 2HRBA 4O59O 521PA 1U3VA 1UBOS 3NPMA 2JI6A 2KW5A 3LBIA 1PK8A 3QLTA 4Z9YA 3QOXA 3VZPA 1PSDA 1I1QB 1LZLA 3WL5A 4CKEA 1OU4A 3EZGA 5D3KA 3P9PA 1P61B 4GSYA 5DXFA 4RLQA 2QIPA 2EL7A 4BWYA 1MGPA 5CHYA 1CNFA 4EOGA 1S1MA 2HI0A 1P60A 3PUVA 4YDHB 4MQFA 3RC7A 1GZVA 3D5QA 2PUGA 2RHTA 3RS8A 3EWAA 3AF0A 1PL7A 2FE1A 2WU1A 4OQMA 4B3XA 4BJ5A 1YZYA 2FEMA 3IYLW 3H0EA 3L43A 4B6OA 4B7AA 2ZFUA 1HETA 2PMKA 1E1LA 3GFFA 3KR9A 2B1RA 5DNEA 3U4HA 1S3IA 3UOWA 1UBJS 1RTKA 3ZXXA 1QP0A 2ZG6A 3F96A 2J9ZB 4IUBS 3RWBA 1Q7CA 3PQEA 2XE8A 3SZOA 3X0DA 1G18A 4HZGA 3MD0A 4PAWA 4M36A 5CT4A 4ZAGA 5K2OA 1AZTA 1IQ0A 2PGJA 3F8TA 3H04A 4RA6A 2OGUA 4BMPB 2FDCA 1IUPA 5IBCA 2DSNA 1GGEA 2DHRA 2G88A 4IJ6A 2YHSA 1OI2A 1XIVA 2YOHA 3C24A 2H3EA 3PEVA 1N8SA 3DPIA 3OUTA 4D8YA 5C7OO 5K0SA 3OO1A 1N3BA 4HATA 4YJFA 2DQSA 3V8QA 3G2KA 4UU0A 2IEBA 5BSKA 2V5VA 1B2LA 3JZAA 4W5QA 5IBRA 4LKRA 5FJJA 3Q5DA 4C22A 1WF6A 1YJAA 2GEJA 3HWSA 4JC4A 4KQXA 4P83A 1W75A 2DR2A 3OT1A 4IOMA 4MWCA 2FSHA 3AVPA 1EJ2A 2G1KA 2ZOSA 1D8TA 1W5EA 3OWHA 2C58A 1FU8A 5EINA 4RMNA 2IZZA 4AX4A 1C1DA 4LWPA 4OGKA 2Z08A 3D0QA 5ALTA 1KDYA 3VZCA 2YMQA 1HSZA 4NG4A 2WOJA 3W34A 5LWQA 3OP1A 13PKA 1USVA 2FW9A 5F1OA 3VR4H 2Z6AA 4D0LB 4OX9Y 5LM3A 2FKNA 2QTHA 3IBSA 1NZFA 4UVHA 3T3NA 4RMIA 3OX2A 2W6QA 4S24A 5K0FA 3N8DA 1OMOA 1BS9A 1CDOA 2DF8A 3MG9A 4YJGB 1VPTA 3O8QA 3WO0A 1JG4A 4B8WA 3UJCA 4KR2A 3O4VA 1DG1G 1SOAA 4IIVA 2H2IA 4DIUA 4B0OA 3A1NA 4Q3LA 2QN9A 1BX1A 1O96B 1Y3DE 3D54D 4M0FA 4MRNA 1RQGA 1TUGA 5JXJA 3ZU6A 2UZ1A 1N8NA 4HEHA 4FR0A 4N4AA 2X2EA 4ND6A 3V1YA 3UMMA 1O9HA 1A1SA 2BZSA 2IL1A 3CRNA 3DL4A 3ETLA 3K05A 3BWBA 3PXEA 3RAGA 4PQGA 4CFZA 1XZQA 2AB0A 3H18A 1A2BA 4X6XA 1WMBA 2QVGA 1B0AA 1OTXA 2HSEA 2V4MA 3G2PA 4H6VA 4PANA 2ZXUA 3AUJB 2IYFA 1DIHA 1Y3FE 4FS8A 4JIGA 2DFVA 4JGBA 5DLPA 4AUMA 2X8JA 1QQ7A 3WFIA 2DT5A 3SS7X 2FOXA 2GQ0A 2PKEA 2XCLA 4HX5A 4JYPA 5CA0A 1ZQ9A 3QHAA 3RNOA 2AEJA 4XGKA 2ZCVA 1Q2XA 4XM0A 1R9MA 2YOGA 4ARZA 3VC2A 4D81A 1ESZA 5B6PA 5JCPA 4LYHA 2CWWA 3OJFA 4QU9A 2RBEA 3FWNA 1O8BA 4QRIA 3KKLA 4HNAB 4G5QA 1ODTC 2BKXA 3EE6A 4LW8A 2H2DA 3D1JA 5AVXA 3AF1A 2YXLA 5EA2A 2AN9A 1QH8B 3E7XA 1IRXA 4BU1A 5EZYA 3K9BA 4A4DA 2BHSA 2JGFA 1JA1A 3GU3A 4D9EA 1OX4A 5ESRA 4TVSA 3MT0A 3BTSA 5BUQA 1XU7A 3F98A 1MB2A 3HKCA 4PHFA 5MFPA 1O9GA 3KT0A 4O2BA 3ONEA 3QUAA 4YVFA 2Y1WA 3BK7A 3TX2A 3HWWA 1SCAA 5IVDA 1WXDA 2FPIA 2KYRA 4LDZA 1DBSA 1EBBA 3KOUA 4BE4A 4CCSA 4O2BB 4QXOA 4C5BA 5I01A 5LYJF 2OD9A 1Z2NX 2F4NA 1JW9B 1X7ZB 3MMNA 1CRPA 2CZCA 3UMVA 4NICA 4F6CA 2QL7A 3L6OO 2GBLC 4BXOA 1M2HA 4XOUA 4X6UA 2YHUA 3ILSA 3K0AB 4QOFA 1XEXA 1UEIA 4M9ZA 2VQSA 3DXXA 1YBFA 3T5MA 5DGXA 2O3SA 2A7XA 3DDUA 4BHTA 1S9DA 1T2EA 4BDSA 1JKMA 2HN9A 3UANA 4D80A 2WE8A 1J2JA 2GETA 1CE8A 3CG0A 3IBFA 3OU7A 1YDMA 2WPNA 3QE0A 4J9VA 5I5GA 2F8SA 2GD0A 1YS7A 3F2IA 3GJSA 4GP9A 3S2YA 3UJPA 3O8LA 3O8OB 5JXHA 3ZD6A 2HNAA 4OFWA 2JEZA 3BTOA 4LE1A 4ALIA 2YQ4A 1HTWA 3KM0A 3WIVA 4R54A 1DJMA 2CHFA 1ES9A 3WLSA 3NP7A 2NU9B 1IJFA 3W2GA 1T8RA 3P9KA 4Z6KA 3H8WA 4TYQA 3N2ZB 3U3OA 4BV3A 1YB7A 2AFIE 3RG2A 4Z7OB 4R1SA 2EU8A 1CY1A 1UBMS 2OY0A 1ZUD1 3TBHA 4H08A 1G4AE 3ZN2A 3O4HA 5HCNA 1I0IA 2VT2A 4PF1A 2YXBA 1A71A 1V16B 4P3PA 2R8BA 5F98A 1AUQA 3H11B 1NKVA 3PEFA 1BXRA 2W6NA 4KGDA 5IVHA 4FJ2A 2Z2YA 3STWA 3SICE 4DNXA 2AR9A 4PLPA 5L3SB 5ALRA 1TQ8A 2Q3DA 4IO1A 2JCXA 2G4LA 2P77A 3M9XA 1YF3A 1E6LA 1JIIA 1P3Y1 1PV1A 1EVQA 1LS1A 2GEUA 1WZIA 2JD2A 5AUPB 2OCGA 1H3NA 3A6FA 4R2KA 5LXTF 3AHEA 2W2PA 3MWDB 4JMPA 3QVSA 5IKOA 3P2KA 2BELA 2QTNA 5A71A 3LUHA 3IIJA 4TMTA 4JB2A 4D99A 4EG6A 3NAMA 2YWEA 4DJDC 2W90A 2FTKE 1JBQA 1S3FA 3RUEA 1O95D 2WFMA 4PIVA 2ACVA 2PS3A 2PKCA 1NI5A 3EGDA 1LK7A 3EG5A 1HH4A 4DNPA 1DIRA 1E4VA 1IULA 1QGYA 3GNQA 3KSAC 1CPYA 3AOEC 3PFNA 4L16A 2QROA 1U1GA 4HNGA 1B14A 4Z86A 1JXOA 3GLFA 4C7XA 3AM1A 4QG3A 4XB6B 3X2EA 3DVQX 1ZRMA 4WRRA 5JNLA 3Q7RA 4MA5A 3TTUA 3KPUA 4OHKA 3PDJA 2ZTUA 8OHMA 1F6BA 2F1JA 2WHYA 4R3UC 4YCLA 4IDCA 2VK2A 4CG1A 2JBWA 4DLXA 4Q1VA 1ESDA 1L3BA 5JVDA 1GTMA 5IZ4A 3FWZA 1IN8A 4DMRA 4IIGA 3CNBA 4X64B 4H17A 1KRHA 2A9FA 4B31A 4DC0A 2BFNA 4JJKA 4GOLD 4W8GA 2B4KA 5CXSA 3BFVA 3AFNA 4RD3A 1A4IA 1PWYE 5DBIA 4BUCA 4NIMA 4DCJA 4DDUA 1O6GA 2GD6A 1I30A 1JQAA 5DF1A 5BOSA 4YFVA 3HA2A 1ZIOA 5DEIA 2HJGA 5E7JA 4EG4A 4DE5A 1EEHA 1YS1X 3VSDA 2ADOA 1UQTA 2J0EA 3OTIA 2B1IA 5KPDA 4AVYA 1WDLA 3TW0A 4LZJA 2PSJA 2G9NA 3U5TA 2IBSA 3OM8A 4MAFA 1ZQ1A 3MLBA 1HUQA 4JT4A 3FETA 1O54A 4NEGA 1T5OA 5A7FA 1YQDA 1JH8A 3CM0A 4O02B 2ZYGA 4WOCA 3P0EA 5TF4A 4BLVA 2R97A 3H8VA 4GWGA 1Z6YA 1OZFA 3BHJA 1JXAA 1U2DC 2HA7A 2JDIA 3GELA 3EF1A 2PQMA 5EEGA 1XRJA 2EW8A 3QLEA 3OX3A 5AW9A 1AKYA 4DSOA 5LU8A 3QPWA 3GFPA 3ZI4A 3QLUA 4MGHA 5AP9A 4JYBA 3Q7PA 4MGYR 2EGHA 3RHFA 2O2GA 1TEZA 1JSZA 2RKOA 4JENA 5JSZA 3GPCA 1Z0JA 1D6JA 3D8BA 6Q21A 1FC0A 3CCBA 3ZG6A 2YJ4A 5IJWA 5T6BA 2CLFB 4MZXA 3WJ7A 1KZYC 2B9EA 4FFDA 5JALA 4S05A 2W48A 2WJ6A 3SS8A 4M9XA 5AM2A 1GSHA 3HB0A 1XCBA 2HJRA 3T9AA 1TU4A 2O8BA 3KZOA 4DMKA 3PGVA 1I9CA 3WP1B 4O4HF 2X7HA 3I28A 4UARA 4G1BA 3KTAB 1TKBA 2POCA 1E9VA 4HYTA 1P0MA 4DUGD 3H8SA 2OQIA 1KZ6A 1SK9A 3SE0A 5IXSA 3D4LA 3HB5X 4BQQA 2YZ2A 3MT9A 4H35A 4YK7A 3ZVKA 4R0VA 3NPAA 4PYNA 2AE1A 4GQBA 5LA6B 3BCRA 2EFYA 3I1JA 2XLCA 3PHIA 3L4EA 3ZY6A 2WJAA 3L7KA 1MB9A 2PXCA 4KXNA 5TMDA 5B4VA 5ISMA 5C5IA 1KAEA 3V6LA 1YE3A 4LAFA 4C3ZA 2Z57A 1A88A 3LGXA 1NXSA 4CMEA 1HYGA 2XTAA 4KQ6A 1J9ZA 4QGGA 5E9JA 3VC1A 1K68A 5LCXA 1F5NA 3UJAA 3T7AA 1T4DA 1Z5PA 2CUZA 4UTXA 1XZEA 2FEKA 3KDSE 1CE8B 2WOOA 3Q8KA 1JB1A 3SHWA 1EQ2A 2HA0A 3LHKA 1VTKA 2X8LA 1VSTA 4HGZA 5DX1A 3UW3A 4PC3A 5EWMA 4NBUA 2BP7A 2UV8A 1RXCA 1JIVA 2HSDA 3H4MA 3HEAA 4I4NA 4Y2GA 1XD8A 5ALFA 3TMAA 5BV8A 5SYAA 2NTYC 1PNRA 2RCYA 1AS2A 3UK6A 1SC3A 1T1IA 4PG4A 3DOEA 1O3YA 5JCXA 4RLSA 2FMKA 1DCMA 1I13A 3D7LA 4L2IA 5AXCA 5IDVA 1SNYA 4OA5A 4Q24A 3MUNA 3LF2A 3SHTA 5KYUB 2JGDB 3N1UA 2EC5A 3QKSB 5CNIA 3N86A 1P2BA 3DEKA 1KF0A 3LS2A 4FDLA 1G20A 2YJNA 4DYDA 3CLUC 2BR3A 3AI2A 4TYNA 4LJRA 2IBTA 2PIDA 2CYBA 4A1OA 2QUKA 1X8XA 2DX7A 4TTQA 1XTRA 4IYRA 3PYXA 5FLKA 3DWGA 4QQFA 4V3BA 3OQMA 3AESB 2R62A 4RHYA 3RTAA 2QV7A 3IS3A 2GPWA 3MJHA 3OWXA 3H5VA 4TXNA 4YPOA 4CETA 2FLKA 5COQA 1NMZA 3R76A 3X1DA 4M2LA 4GECA 4LTDA 2P9ZA 5U4XA 2OUKA 1EKXA 1XF1A 3HI6A 3CZ9A 4EX7A 4D57A 4FDUA 5EKTA 5DVZA 4E30A 2JH9A 5M04A 2FJ0A 3K9FC 2AYXA 4BEJA 3EZ9A 1WPQA 4ZVVA 1JLLA 5CA0B 2GHRA 4XYGA 3VU9B 3BMOA 3HWX1 2C1EA 4J4HA 1TMGE 2JFQA 5K3OA 5E0KB 3GOQA 4DG8A 3ICOA 4QOEA 2QPAA 4KWEA 5ICCA 2C07A 4R68A 1F5SA 3FPKA 3N75A 3ICVA 2PSFA 1NN3A 1U2QA 2I2WA 3B3JA 3SM3A 1BN6A 1M2KA 2V6GA 4HLUC 3SF0A 5ES3A 4J7CA 2I91A 2D74A 3F49S 4PR3A 2PGDA 5AQEA 4F4CA 2ZPTX 3VZBA 1DHRA 1IMOA 2ZRAA 3FVVA 4U7HA 1R4AA 4KRGA 1MVNA 4UBMA 3T7DA 3K96A 2H1CA 2ODTX 1EDOA 1GKYA 2CMHA 3H83A 1X13A 3UCFA 2ONYA 3L7BA 5CYGA 1KZ1A 3MMXA 2P9YA 4U9HS 1B00A 3BOSA 1M66A 1T5TA 1V8BA 1E94E 4JLWA 4P86A 1E92A 3U39A 1PIWA 4ZVQA 4ZGWA 1ATZA 1ZD8A 4IFBA 4Q18A 4C6HA 1A1VA 4CEJB 5ICEA 2R1VB 3BXZA 1EK5A 1QKKA 1JIQA 1YB6A 3NTQA 4R16A 4Y3UA 1YZVA 4TXJA 1W0KD 2XCSB 4C2UA 2H4ZA 2BFFA 4YJDA 4ZKEA 5BT8A 3OWOA 3DL7A 2OORA 2XRFA 3OE4A 4HL6A 3GBSA 1VSUA 1TE2A 4KTVE 3HN6A 4QTZA 3VNRA 3PS9A 1ZK3A 2WWFA 4BMOB 5ADUS 4HLQB 3GZNA 4CLOB 5HNKA 4CEHB 1N5KA 2BMDA 2WM3A 3WE7A 2ZBQA 1FFEA 1GGNA 1ZX1A 1SG0A 2Q9UA 1PFUA 1NQXA 2Q46A 3EIUA 3OG9A 3QKRB 4JOBA 1A4XA 1RKQA 5EXXA 5HIMA 3Q40A 1OY1A 2C9ZA 1DQYA 1L5QA 4QYIB 4WFQA 3OCYA 3OAAA 4XFJA 3RJTA 3WRVA 1WV0A 3WQSB 1QRUA 1SC1A 2IS2A 1GQ2A 4LCJA 4TVOA 4RZSA 3GHHA 3WWDA 4LBVA 5ADVA 2I7XA 1P75A 1DC8A 1K5PA 1Y1RA 1FRVA 4ZMRA 2AZTA 3UOAB 2VT3A 4LZLA 3PX2A 5HX7A 1FFCA 4IQGA 4OUDA 1J2YA 2Q29A 3E0XA 3QU5A 4P6VF 5EFZA 4BNXA 1QYRA 5EWLA 1QYIA 1T1JA 3ZHUA 3CVVA 5TMBA 5BMVA 1NF9A 1N2CA 4IL5A 2QG4A 2UZ4A 1KJWA 1V16A 1IXYA 2BBTA 1N7JA 2NAFA 3L1UA 1HWYA 3LQYA 3TSYA 5LQDA 3N5KA 1II8A 1PUJA 2A1UA 2OZEA 1QO7A 5IAJA 1U63A 1J8DA 3G7UA 4CQLA 1R8SA 1D1QA 1KH2A 1F06A 1UIRA 4NC9A 3IH5A 2EHDA 5JAZA 2J3HA 3M82A 4N5MA 2HMUA 1NKSA 2ONZA 2V6JA 2AN3A 1MO4A 2Q1TA 3PHCA 4J16A 3WWZA 4BP9A 4WKGA 4ZREA 2QUJA 4P98A 4WTOA 3DE4X 4FOTA 1BHQ1 3ESRA 2PMFA 4E51A 1XPRA 4JI7B 2O3TA 1D4AA 1A9XB 3L7IA 1TVEA 5ALLA 1DJOA 1XPOA 4LJYA 2VF2A 2C97A 1Y6ZA 4UE3S 4WY2A 4CKBA 1VMIA 2F3PA 2C8LA 1MTOA 4A2PA 1IZ9A 3LKDA 1W73A 2EX4A 2C3YA 2KBFA 1A5BB 1TO6A 3FG9A 4M99A 4FB5A 4YCMA 1E1KA 1T0IA 5BO5A 3P9NA 1YU6A 1DS6A 2TMGA 1BWQA 2D1RA 4CQJA 1QONA 4ADSG 3RANA 4NR0A 1S4QA 4B3RB 3MJSA 1RIFA 5TQJA 3UGKA 5K0EA 1JILA 3HGQA 4ESHA 1ZIDA 3KQLA 3ZZ1A 4R2MA 2BIFA 3AQIA 1RI4A 3I05A 3LVFO 4K9QA 4C0WA 3S1AB 3O4RA 3H9GA 1VHLA 4KK3A 1G8SA 5FTLA 4HSEA 3R7WA 3CVUA 4GX1A 2P91A 1WXFA 5AO9A 3EIOA 3JWIA 3RD5A 5DTIA 3SSNA 4C76A 4UQLA 1W8IA 1Q83A 1UJ5A 4R05A 5A5DA 2F43B 2CV2A 1NBHA 2UZIR 1C1YA 1DFHA 1GIAA 1ESCA 3BXHA 2J4CA 1XTSA 3AJ9A 3JSAA 2VSOA 1DV2A 4AJ2A 3GGPA 4LJAA 4JP5A 1XNGA 4Q5IA 2IHZA 2OPBA 4QGHA 1J8YF 4U4AA 3DVAA 3QLJA 5FADA 2G5TA 3ZHZA 3WC4A 1SKBA 3G9XA 3EDQA 1K8QA 1VIDA 4KI0A 4HRAA 3KWLA 2B0JA 4HWOA 4QICA 5DYTA 1H2WA 2OV2A 2ZJ2A 3DAGA 4L3WA 4ZEVA 1G55A 2GXUA 3NEPX 5AVOA 1SVNA 2VJMA 2ZSKA 1V1JA 4CTMA 3D81A 4Y2QA 1PR9A 2WG1A 4M0PA 1O95C 2AKEA 4PTYA 1YJBA 5ALGA 5M5BA 3O75A 5C8YF 4G4SP 5IT5A 4BNIA 1ZVVA 1NGSA 3R5JA 4IXNA 4BQNA 1Q0SA 1OT5A 3DTVD 1P0PA 3FNRA 3LI2A 3T5BA 2M1ZA 2GK3A 2XD9A 5JNTA 1ISMA 1Z63A 1U28C 2DJ5A 2I4TA 3E5NA 3GPDG 4IMPA 3DE2X 3CUKA 4DM4A 4H4DA 1SXIA 1W6RA 2HK7A 4GKKB 1EX6A 3C7TA 1KK1A 3WG9A 4H3HB 5AVVA 1PP4A 5DM70 2F9FA 1E2HA 4EUFA 4Z51A 1Y3AA 1JEYA 3LBNA 3CGGA 2QVBA 4ZTBA 4WVFA 1IXZA 1C0PA 1NQAO 3GEHA 1Z7GA 4XI9A 3ZYZA 4AMGA 1Q6ZA 1LW6E 2F1OA 3ZQKA 4Q00A 2D7JA 2XXJA 2ODAA 1Q1AA 3AH8A 4MI1A 3A9CA 4BQEA 4CQMB 1GRQA 5EWMB 3T5TA 4S1PA 2OTCA 2OFPA 3RT1A 2QD2A 4WQMA 3R0XA 2JK1A 1KFBB 4OQQA 1Q7BA 1UL1X 3S2FA 3I9NA 1T0BA 4RF4A 4LNAA 1M1YB 4R3WA 3E5MA 3LDHA 4MRMA 2BZ1A 2R4UA 4X00A 1Y6QA 1OWPA 4UCWA 1C80A 3EDYA 1T3SA 4FC7A 5DIFA 2EFJA 1VLJA 1M8JA 2XMGA 1NP7A 3NORA 3PIIA 5DNDA 1QTRA 4FCVA 4V02A 4WZBE 5FEMA 2ONCA 2GFHA 2JJ2A 1SXPA 2Y4NA 4FN4A 3VPSA 4C1NA 4Y6OA 1FX0B 1DQZA 2AWNA 1ZL0A 1XRQA 2LIPA 1E9RA 2V5UA 1X8LA 3JRNA 3UG6A 4DLRA 1I32A 2EZ9A 3VOSA 4UCFA 1T0PA 5JV5A 2AVDA 1VI2A 1IEVA 2WWTA 4IDAA 4BGUA 4F21A 2XWQA 5E3JA 3JTMA 2Q6KA 4XUGB 3P52A 3U3DA 3X43A 3D2BA 4IDBA 1NNI1 1ZD3A 2O1WA 1N3IA 5FPTA 2ZU6A 2JLZA 4DGQA 1V3TA 3E2MA 1T2FA 1DUVG 1I9GA 1NR5A 3DT8A 3W2IA 4B32A 2PUWA 3W6PA 2WB2A 4G67A 1Y4AE 3AR9A 3EB9A 4PGMA 4KBGA 1SPXA 1HEUA 1RWNA 2A58A 2JI9A 4U7TB 4NEHB 2EWMA 3LT1A 4MITA 5FLXA 2AJTA 2E4YA 4TKLA 1KBZA 1VP9A 1Y5RA 2QPOA 3FMVA 5CLJA 3U7FB 4EEZA 1GLGA 2P35A 3AEXA 2OSVA 4I9FA 3JZMA 4WFJA 1X0VA 4FNMA 1Z17A 5JS2A 3Q0IA 5FFNA 2CNOA 2WIBA 4O4JB 3X44A 1N6IA 4U2GA 2XBMA 2GM9A 1CLEA 4MIEA 4R81A 3R7SA 1KEEB 1DQSA 3VPDA 3ZDFA 4BKPA 3OPMA 5LU9A 3AHFA 1RMYA 3AX6A 2D5BA 4ZANA 4ZQEA 5LBTA 2B25A 4XLZA 3H6KA 4EM6A 2LPMA 3L1JA 4MQ5A 3GVHA 3QFRA 3FI0A 2BM1A 2DPGA 4L02A 4O2AF 5DBOA 4LJ4A 1ZIYA 2BD0A 5KKCA 5AVKA 1V0JA 5JD3A 2WYWA 2PX2A 1EM6A 2D59A 2IUYA 3JCZA 3U9SA 4BVFA 1OOEA 2VNSA 5JARA 2N9UA 4MB6A 5HXAA 2A84A 2J6HA 2HSGA 3JVIA 5TSDA 3PP8A 1MDBA 2IHYA 1LTQA 3E8XA 1P2FA 4MR7A 3RJ5A 3KLOA 4YRMA 1SIOA 2WJ4A 1AKTA 4MIOA 3SU8A 1N8TA 2IQIA 1ZNXA 3GR6A 4JLKA 4UBIA 3DBIA 4GFDA 4OBXA 4UBKA 4F2DA 5K03A 3FCCA 2FWRA 3LT5A 4CIYA 1NNSA 2MSWA 1FJXA 1R2QA 4P5EA 1YZNA 2QUAA 4HMOA 2WYIA 3X1KA 4GM1A 4FILA 1TT5B 3GAMA 4M0MA 5C7IO 2WQ7A 3QEKA 1J8FA 3WZMA 3FR8A 1LB1B 2FMIA 3EX7C 2IU0A 1IM2A 1F1JA 1NOKA 2E82A 2EHJA 2PX6A 4GXQA 4HDQB 5E7IA 5CFNA 3TL3A 2JAUA 2Q21A 1ORDA 3HKCB 5FUQA 1PYGA 1Y4ZA 1VKOA 3QV2A 5A1JA 1CYEA 1Q1NA 3LC7O 4MKIA 3ZIUA 5HUHA 3I2KA 3M6FA 1WMAA 2VQEB 1K8ZB 3ZDBA 4GRIA 4FD3A 4RX1A 1T5BA 2FP4A 2P0AA 5F51A 1OUMA 4E31A 5I7RA 5KQLA 3NIBA 2CN1A 1CRLA 2XBUA 4DDMA 3AW9A 3WKCA 4I8DA 2PHZA 3UB3A 2QRVA 4F97A 3SK0A 2OZLA 1PJTA 5I47A 2NV6A 3N9IA 4EYGA 2VSQA 5E1BA 5CT8A 3OUUA 1A69A 1KAGA 3KRTA 4RVGA 4RXTA 2ZB2A 4TMVA 1JZSA 1M2OB 1Z0IA 3L06A 4PC2A 1TD9A 1GARA 1BWRA 1ORIA 4J3JA 3TPCA 4UM9D 3FPCA 1QZXA 5FP0A 4RK1A 4MPDA 2X14A 4FGLA 2QJWA 1KYVA 5T6MA 4DCVA 1U7ZA 2PYZA 3R9KA 5C53B 3SZRA 3ER6A 4NU5A 4LV8B 4P54A 1VFNA 4D9IA 2RH4A 1B6RA 1C9YA 1JLSA 1N2HA 1JHOA 1FMTA 1OPXA 1TJNA 2M9MA 2I8CA 3IVXA 4MA0A 3RSLA 1L5RA 4ID3A 4PQFA 3OQPA 5MGBA 1YMVA 2X0NA 1TA4A 3ONVA 3FDJA 4NAVA 7MHTA 2XOEA 4Y18A 5EZ5A 4RQTA 5LWHA 4KSBA 2CXHA 1ORWA 3DOHA 3PU6A 3OT4A 2FWBA 4UEWA 2GAAA 5KYYA 3NB0A 5A05A 5FTNA 5JZ9A 4TVBA 2J0UA 3ECAA 3RIMA 3RIXA 1UMDB 5KJ6A 4G97A 3OIYA 1KZGB 1NP6A 4IDOA 4PICA 1UDRA 5J1SB 4P92A 1RXUA 1UKCA 1C1HA 3DMRA 4ZYWA 3J80A 2Y8EA 4JLVA 1QK4A 3R40A 1SU6A 3KUDA 3GJ5A 5CVDA 2C9BA 3NHZA 3I72A 1G6OA 3M4XA 3JAMA 4OJTA 3LV8A 3O94A 3RVLA 2XA9A 3DH0A 1L5GB 2PK3A 4CMBA 1WQ4A 4PU0A 1KFEB 2H65A 1RFLA 3CLTC 1WE2A 4KLZA 4A91A 3EGXB 3BILA 3PSHA 5IJ0B 4PYIA 4L15A 5AM3A 2PBZA 1YTLA 5E2AA 3VZDA 4B9AA 2B8WA 2WZBA 4Z4EA 2PA3A 3X1MA 1BOFA 1MKYA 1K2VN 4OQNA 5ARCA 1SBQA 2AJDA 3ELDA 3OA2A 4BVHA 3K35A 1B3RA 1X1RA 5LKAA 3L02A 3ZLJA 4CM6A 2HFKA 1AKMA 3TZKA 4JBYA 2ON6A 2H4HA 3C98A 3EXHC 4RM2A 4F84A 4RSRA 1W85A 2HM7A 3KV3O 1VYVA 2RDMA 2P11A 4JXXA 4YCBA 4H6PA 1DG3A 3U9LA 4DAOA 5LXTB 1G4HA 2QD3A 1BS2A 4REMA 1KOLA 5EIXA 3D6JA 2Y1CA 4ZI2A 5HRAA 3W6NA 4CMGA 1KU0A 3EFBA 2H51A 2Z6UA 2ATVA 4BP1A 1NYQA 5C1PA 4KACA 4G84A 5UKDA 4D0RA 4ZHQA 2VNHA 2VK4A 5C1BA 3LPDA 4YAFA 1T29A 3OJ0A 2FSSA 4G85A 1JDJA 4DUGA 2QAGB 3QEMA 4ZWNA 1VLZA 3HXLA 3DA8A 4HB3A 5HFNA 3QXCA 3UOGA 1EUYA 3EGXA 3NM4A 1DG9A 3OLQA 3PE6A 1U5BB 2C2WA 2Z98A 4MQMA 2H4FA 4PRLA 1DX4A 1V8ZA 1ZITA 1ZW1A 3AB7A 4OMDA 1RW4A 2HO5A 4ZC8A 1P18A 1NBMA 5IFKA 4D02A 3RVJA 4C7OB 3BL5A 1F0NA 3E22A 1U6IA 2GASA 1VL8A 4R1QA 5I9IA 3GWGA 3RU7A 5BQXA 3AFGA 1NT4A 5KOYA 2I2BA 3GQVA 3TK1A 1YZFA 3TLMA 1KWKA 1GKKA 5IRCD 1DCTA 1AZWA 4MCJA 2IU3A 3OLVA 1MJNA 2I22A 2IT1A 4Y0VA 1LNSA 2C5AA 2H16A 3FUCA 3Q2IA 3UVEA 2IEGA 1VE3A 5BQ5A 4LF8B 4BCDA 1Y3IA 1TVKB 2WG2A 4AAYA 5KMGA 5KC8A 5HWSA 2W2VA 1ECPA 3OJLA 1QAMA 3GJXC 3ZDQA 3FMIA 1D9XA 3HU2A 4FYHA 4HX2A 1WETA 2OHJA 2XYRA 1JAIA 1E7YA 1HT0A 5HJ2A 3HP1A 1PR1A 5JNVA 1K8YB 3ASZA 3A3YA 2DUUA 4WLEA 4QGSA 5CFQA 3TZBA 2J41A 4KWTA 4QNRA 3GVCA 3A3NA 3F3MA 3OZXA 4BYMA 3GO4A 4A0QA 1YR1A 3GJ0A 2NVUA 2P6PA 3TTSA 5IM4A 4MQEA 1NRIA 2HX1A 2ZBFA 1QAOA 2X4IA 1CUJA 4JUDX 1IN7A 2XQVA 1YS6A 1CS4C 1KL7A 2NUTB 3G2LA 2XTZA 2BT4A 3F4LA 6REQB 2O8BB 5JROA 2DFDA 1NQUA 3O3OB 5BWLA 1VLMA 1ZMXA 4HN9A 3LVRE 4L0QA 2VBGA 1XV5A 2HA3A 4FSXA 4O5AA 5G1OA 1EA5A 3E9NA 4O4JA 3QVJA 1SCUA 2PZKA 1TTPB 2XA1A 1TVMA 1UM8A 1J0DA 2DBVO 3FCSB 2QLBA 1FNMA 3JZFA 3NUGA 1T24A 3HJCA