3QEJA

S74e-dck mutant in complex with udp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
242
structure length
234
Chain Sequence
b'TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVELTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Post-translational phosphorylation of serine 74 of human deoxycytidine kinase favors the enzyme adopting the open conformation making it competent for nucleoside binding and release.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 234
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qejA00
2AK2A 3T35A 3DZDA 1R7RA 4LJ7A 4HI0E 5L3SB 3ZLJA 4LZZA 5FOVA 1GKIA 2FOLA 2GJKA 2QG6A 2W0SA 5LB2A 3REFA 3KTAB 3U3JA 4A92A 3PEWA 4B75A 4ZDWA 4OQXA 4TL7A 4URVR 2JJ1A 3U44B 1F2UA 4L9SA 4OHYA 3W5JA 3KKNA 4NYIR 1KK0A 4FCTA 1UM8A 1HUQA 2P3SA 5FPYA 4KV9A 3K53A 4URZR 4AYTA 3ONWA 2ZE8A 4NCIA 4XVUA 2PJZA 2GVDC 3UATA 2HJVA 1T91A 1OW3B 2ZYTX 3ND9A 1XTJA 3B1VA 1P6XA 3DMNA 5E7MA 4N3NA 3EW9A 3M1IA 1Z29A 1PLJA 1ZC4A 1E96A 1KI6A 4OI4A 5H8WA 3K9LA 3IGFA 1GM5A 3BWDD 5JEDA 5SZIA 3U7GA 3EC2A 1CULC 3SHWA 1OV4A 3CO5A 1OHHD 2AWNA 3IPXA 1GIAA 2VHTA 1W49A 1VMAA 4BZXA 5KUTA 1IY2A 5TMPA 1NKTA 4M1TA 1S3GA 2A9KA 3KKQA 3QUSA 3GQBA 2WKRA 2QGZA 2D4HA 2Q3FA 4DCTA 4C0KA 3AVOA 1ZD1A 1T0HB 4G5GA 1I4TD 1E2PA 2CHVA 3QOFA 3NIBA 2PLFA 2V3CC 2A5YB 2XZLA 5BN4A 3CF0A 2IEYA 3IUYA 2FEOA 1KSHA 2XNSA 1GNPA 1IBRA 1W0KD 2OG2A 5DI3A 4C7OB 1S4QA 4QM6A 2XZOA 2ANCA 3DDCA 3IHWA 1KI8A 4LCBA 1W4RA 3I4LA 1Q3TA 1P61B 2C9OA 2QRNA 1E0SA 5B2ZA 2QSZA 1RC8A 3W8RA 4Q4AB 5TVKA 3FE2A 1WDTA 4HUQB 1Z47A 2A5GA 5FUVA 5SZHB 2HCBA 3SJCA 1J2JA 1OIWA 2B7CA 4LGMA 4FMCB 1PLKA 4QJ5A 2IS4A 3EZ7A 1Q21A 2J0SA 2X77A 3THOA 1IQPA 3FTQA 3WMFA 3FKSA 3K9GA 1GITA 4JS0A 3NXSA 3UK6A 3RWOA 4H1VA 4Q9LA 2NPIA 4C30A 1NVXQ 4TQAA 2CL7X 1JI0A 2O0KA 4EQ6B 4XJXA 2JGNA 2WHXA 4EPXA 5FOXA 2QQ0A 1W1WA 2GJ8A 4V0KA 3K0CA 2XZPA 3K0EA 4IEEA 4K8OA 4Q00A 3AVUA 3P4YA 2J0UB 4RD3A 3CBQA 3GFOA 2UZIR 1FMJA 3CH4B 3KB1A 4MA4A 4YXWD 4BFUA 1Q22A 4NP6A 5JECA 3CNOA 1H8HD 4BASA 3PCRB 1R5BA 4FW9A 5E95A 3ZS9A 5A4JA 2XXAB 4B48A 1P4SA 3TQCA 2VF7A 3B60A 3IIJA 3UG6A 4BFVA 3C14C 3TE6A 1GNQA 3N5CA 4DSUA 5J4HA 5F3WB 4PPFA 2OSBA 3BFVA 3FFBA 3RDPA 2HXYA 2ZRHA 1NJGA 4XD7A 2AN9A 4M9QA 4QG7A 1PZNA 2B92A 4BQSA 2F7SA 2R6DA 3I72A 2ZRBA 3AF4A 2KBFA 4Q18A 4D2IA 4TT3A 1GG2A 1NF3A 2QTVB 4HATA 1SVMA 4O2LA 5B64A 2F3TA 2JDID 2GF9A 4TMXA 3KQKA 3U3MA 2X2EA 5FUWA 1GILA 2GAOA 1TQ4A 1I4DD 4AG5A 2QE7A 4D0LB 2C77A 2ZRNA 3NBFA 4DSNA 1TQDA 3AVVA 4UJ5A 2ZITA 5AJWA 3UPUA 1U9IA 4B76A 1VDZA 3UKDA 1HA3A 5CIQA 4PAOA 2OCPA 1YU9A 1Z5ZA 1CR0A 5G3ZA 1XTSA 5JSZA 1H8ED 2CBZA 4R98A 2IXFA 1MO5A 3C4JA 4KVAA 2JATA 3WXMA 3QNUA 1WBDA 2ZRLA 1S1CA 1E4YA 3HP1A 3MJRA 1E1RD 4K46A 3GLIE 2XAUA 1LS6A 3JZMA 2ZRFA 3NEJA 1JPJA 4PAQA 5H1YA 4EUNA 1P2TA 1GAJA 3AUYA 4BEJA 2CDNA 3B82A 3LBNA 4DT1A 4ZDKA 2OCYC 4OJQA 4DVGA 4Q66C 1Z06A 4DB4A 3BFXA 1G5PA 2OBNA 5UKDA 3EX7C 3NDBB 2F43A 2YOHA 4F4CA 3J81k 5DYIA 2DFTA 4E07A 3GLFE 2JLRA 1P2VA 2YWHA 3PUYA 4WAUA 5E4FA 4FN5A 4H1UA 3GJ3A 4FMDB 1XEWX 2NMVA 3LLUA 3R20A 5JMTA 3KJGA 4KLNA 1OKKA 1SKQA 4FCWA 4DDTA 2CK3D 2JLSA 2A5JA 4PQFA 1QDEA 1ZIOA 4JLDA 3T5DA 1YE8A 3SC3A 1Q20A 1KDOA 5FL3A 2AR7A 4B3FX 4WXRA 3WYAA 4IOLA 4P31A 4EDHA 5JJKA 1IXZA 2V1UA 2BDTA 4LJ6A 4LYAA 2LKCA 2NO9A 2VA8A 3TSWA 3VR5A 3LBHA 1D9XA 4Q7LA 3AGQA 1JQJC 3QPWA 4URWR 3VKWA 2GXAA 3ZZTA 5JI3E 1GL9B 1SVKA 4P4SA 2G6BA 4RZ3A 1Z6TA 3IIKA 4Q1DA 3B5JA 1KOFA 1U2RA 3LAWA 1SXJA 3MCAA 4KCGA 4Q9HA 1E79A 3TSZA 4B71A 4AK9A 2O8BB 4CZ2A 4FD2A 1AZSC 4CEJB 2O8EA 2J5XA 2IW3A 4RFSA 2CLSA 4M1OA 3UIEA 3WP1B 2X8AA 4YMWA 5HE9A 2F9MA 2ZQ5A 4US2R 2BMJA 1NIJA 2BEKA 5LBIA 5FBLB 5CYPA 4A6PA 1Q44A 2AL7A 3JVVA 1A1VA 3D7MA 4Q5IA 3QF4B 4IVQA 1Q1EA 1ZP6A 1E6CA 2RHMA 4P32A 2CCGA 2GILA 2OESA 1S2MA 3Q8XB 3SBEA 2YOGA 1UDXA 1Z3IX 5JCPA 4D80A 1XEFA 4UNRA 2QMEA 3MRSA 3NVAA 4BLSA 3SYLA 1KKMA 1R10A 4M9XA 4POAA 1JXMA 3ZD7A 5F98A 2NTYC 1KTVA 1CTQA 1H65A 2HJGA 3DHWC 1ZM4A 2YZ2A 3A58B 5CLQA 2H1LA 1KMHA 2W2XA 4HLDA 4BUJA 1G3MA 2L0XA 2X19A 3HU2A 2KSQA 1EFTA 3ZD6A 1G9XA 2CLCX 3FMFA 2W00A 2ZJYA 4RD0A 4B3BA 1G5RA 3QI2A 4Q47A 4QNRA 4WIAA 2AFIE 2RH5A 2RGCA 3RVBA 2IK8A 3IQWA 4MYCA 4HLUA 4HB2A 1OF1A 3EZFA 5EUMA 1SHKA 3I8SA 1XD2A 4M1WA 4IDPA 4GL2A 2OHFA 1KSGA 1F60A 2XTNA 5A0FA 3NEYA 1CJMA 2JASA 1L8QA 2VP2A 1FUUA 2J59A 2N46A 1W36D 3U3OA 1FX0A 4LYFA 4CDGA 1OH7A 4Q01A 1NG9A 3ZQJA 1BO6A 4MYTA 3W90A 2K5UA 5DYGA 3ZVRA 2ZVQX 3RS0A 1Q12A 4HSEA 2JLWA 2A5FA 3BC1A 1N0UA 4ZCIA 2H17A 3EIHA 3P27A 1DBSA 1SKYB 1D2EA 2J7KA 5M04A 4JJKA 3H84A 3T1TA 2OAP1 3LLMA 4LJ8A 3U7EB 1PJRA 2XJ4A 2V7QD 3WHKA 1VYUA 2G1KA 5FI0B 2FGKA 2FZ4A 4GSYA 3QG5A 2VIIA 2FV8A 3ECCA 4IDOA 5FPSA 1YJ5A 2MSEB 2XNDD 4AY2A 1DAGA 1KDRA 4P4UA 4L8GA 2WBLC 4WBSA 1RJ9A 4KO8A 3B7GA 4Q1EA 1KI4A 2I1VB 1OHHA 4QOSA 1MT0A 3RANA 2IUSA 5EXPA 1HE8B 2IYWA 3I73A 4P33A 5FR1A 5GVSA 1QHNA 3X1ZA 1A2BA 3L0PA 1G6OA 2NO6A 3PFIA 3CRMA 2RGGA 4UXHA 1AN0A 2O0JA 4L9WA 3RNLA 3VKHA 5EP1A 8OHMA 1EWRA 3ZQ6A 1DAFA 3CB4A 4PHHA 2C03A 3CWZA 4V02A 2IS1A 1SVOA 5DN6D 2G3YA 2GCNA 1HYQA 1W0KA 2GEDA 4OHXA 2G83A 5CB6A 1W47A 2AXPA 2KB0A 2O8DB 1U90A 3DOEA 1G16A 5IHPA 1JEDA 4TL9A 4OK5A 221PA 5HCIA 4FIDA 4LBVA 3D31A 4TYPA 3U3RA 4LBWA 5J4LA 2W6JD 1CEEA 3RSOA 4NMMA 2FN4A 3X1DA 1XMVA 1UKYA 3GFTA 1IN5A 2FFQA 2OBMA 1DO2A 2KJQA 2QAGA 4JT2A 2PT7A 821PA 1G291 2GEUA 2W0MA 4Q03A 1MRNA 2WSSD 4KXFB 2N1BA 4M21A 1PUIA 3FWYA 4PZYA 5FOWA 2IYVA 2G1JA 3WRYC 3IPYA 3AH8A 1DAEA 4W7SA 3EPHA 5KSZA 4QHYA 4LBYA 2OFXA 4WZ6A 3EXAA 4KAXA 4YXWA 1QHHB 2FE4A 2IYUA 1L4YA 1Z0FA 3E5HA 4HB3A 3QPUA 6Q21A 2LWIA 1H8HA 4F92B 1OXUA 2J0VA 4ITRC 1KI7A 3CPJB 4PSKA 3THYB 3CPHA 1VYTA 4OHVA 1ANKA 3QXSA 1TTTA 1K5GA 1KI2A 2CNWD 1Q0UA 5L3VA 3OESA 1AIPA 3TW8B 3HR7A 3K1JA 5CJ2A 4PPNA 1RW4A 4TLBA 1RRFA 4JVMA 2GKSA 4U02A 1VG9B 4LV5B 3ZJYA 2OV2A 4E03A 1FW6A 1ZCAA 4R71A 1N6RA 4G0NA 3GLGA 1VG8A 4PAMA 3X1XA 1R6BX 3A1TA 4F4IA 2WWWA 1Z63A 1GZSA 3AP2A 2EFHB 1VYVA 2JDIA 1F5NA 1NBMD 4KSBA 2CJWB 2QEQA 2ZE6A 1XXHB 2H16A 2IT1A 3PJRA 1IXRC 4N1AA 1JR3A 2BBWA 5BW8A 1RVDA 2PJRA 1GOTA 3D3QA 5LD2C 2O8FB 3R7WB 2GCPA 1AGPA 1JAIA 1IJEA 3P20A 5DI9A 4PX9A 4AWXA 4D82A 4R7ZA 5B30A 4GMDA 1JECA 1N0VC 1Y63A 4DC9A 2R2AA 4V0NA 4ZV4A 2ZPTX 4CIDA 4QGAA 1H8EA 4TMVA 2GBLC 3VR2A 4Z1MD 2GZHA 3K0AB 4RKFA 3AM1A 3GLHB 2HXSA 3W6NA 1R2QA 1E1RA 5FTLA 2B8TA 2A3RA 3EIEA 1TF2A 3SNHA 2EFEB 1KK3A 1WMSA 5KSOA 3AEZA 3AKDA 1T0JB 4Q4JA 4V0OA 1GL6A 4PC6A 4KHZA 3W9YA 5LD2B 4MUAA 2IS6A 1U8YA 2G9NA 5CB8A 4M1YA 2IHBA 3KL4A 2G0NA 3PXGA 4ZCLA 3AVXA 3X1YA 3E2IA 1SVIA 2E87A 2BBOA 4JKYA 1D9ZA 4OK6A 2A78A 4C0BA 2QP9X 4JSTA 4JLVA 3G0HA 2PT5A 2CK3A 2VSFA 2W2VA 2YINC 3LVQE 2FSFA 4FMCF 1CJUC 4AYXA 5EE3A 5L3QB 1EK0A 5FPKA 3QIAA 1ZM3A 4FI3C 1E9RA 4ASUD 4D25A 3CW2A 1ZCBA 2R44A 1VHLA 4M2LA 5L3SA 1XRJA 2RGNC 4URXR 1T5LA 4V0LA 2ODNA 1N6HA 1N3BA 3SJBA 4RVCA 4F91B 5FBQB 2BOVA 1ZC3A 1Q57A 2OFOA 2WICA 4W5WA 2XSZD 4XSGA 4C2TA 1NP6A 1HEIA 3DO6A 1E0JA 1T3SA 5EE5B 2WM9B 4AKIA 1E9BA 4KYIB 5L8VA 3BK7A 4BFYA 3FYHA 4MH0R 5EP4A 3ZS8A 2Q9BA 3IILA 1NNEA 4TYWA 1KZGB 2QMHA 2VRWA 5CK4A 4RZUA 3U6BA 4C9BA 4Q1FA 5KDDA 1E1QD 5IT5A 3TR5A 5LB4A 1BYUA 1FP6A 1F48A 2DFNA 4YDSA 3RC3A 1US8A 4GP7A 3C5HA 1A2KC 5SZKB 5E3HA 1EX6A 2DWQA 4AYWA 4BLQA 3CRW1 1PUJA 1YR7A 1DAKA 2WZQA 3G82C 3QBTA 4I1VA 4ARZB 4RD2A 5TB5A 1UF9A 1E9SA 3L82B 2MMGA 2W2TA 4MDFA 1ZD9A 2YWFA 1COWD 2CL0X 3RRMA 4QL3A 1XTQA 3SFVA 2FDCA 2YOFA 1YR8A 4ZIRA 3PUWA 2VEDA 4DIDA 3S1AB 1N5LA 3CZPA 1OB2A 3U2QA 2ZEJA 5D3MA 1W4AA 1D5CA 1II9A 2D2FA 4L5BA 1MABB 3B9PA 4S2EA 4A1FA 1G3RA 1E2HA 5F9HA 2O8CB 3D8BA 3IO5A 1P75A 3A6PC 3WYGA 4HAZA 2ANBA 1G18A 1U8ZA 2FZLA 1M1YE 1UBEA 4WA7A 2PMKA 4HB4A 5FTMA 4I81A 4OYHA 4IHQA 2QY9A 2HT6A 3AF0A 1C4OA 4OQMA 1A7JA 3JVUA 3CWQA 4IOJA 1Z6AA 4NCNA 2PCLA 3BFKA 3AQ4A 4IOKA 2QL6A 3NBYC 3QENA 5KPDA 5JLJA 4JVNA 2YHSA 3C5CA 4I1OA 4TWZA 1L2TA 1CLUA 5TARA 2J0UA 1YZUA 2B6HA 2NZ8A 4NCKA 2IF2A 1KGDA 4JJZA 2ZYWX 1Z08A 3W6OA 2IUUA 3DEFA 3RS4A 3W3ZB 4EJSC 3GJXC 5CK5A 1JJVA 4NYJR 4C0JA 1RYHA 5FBWB 2C9YA 1K6MA 1BYIA 4DLWA 3EZ2A 4OI2A 3FMPB 5AJVB 2OFWA 1JBKA 2QM8A 5J4VA 2V7QA 1P9RA 5DISB 4ERNA 1TUEA 1VG0B 3EWAA 3F5FA 2ZJAA 2AKYA 2WPDD 2NO1A 3M4YA 4TLDA 4Q4HB 3H0KA 2XNDA 2R6CA 3AKCA 5A5GA 4R9UC 2ZI3A 4GDFA 1JEEA 2Z6VA 3V9PA 1G8PA 3BERA 4QXAA 5FOUA 5DNYB 3I32A 2XGJA 4TTRA 2GCOB 3IBYA 2D74A 4B43A 4HZUA 4I1SA 4EJSB 1N6OA 5JJLA 3CF6R 2ERXA 4DLSA 1NN0A 4BRUA 2D2EA 4M1KA 1ZM2A 5P21A 2HYDA 2YC4C 5GADl 1OE0A 2X1VA 4PHFA 1ODFA 3GLGE 3P26A 1VCNA 2NOAA 5DN6A 4KI0A 1TPZA 1J8YF 2Z43A 3BB1A 3CPEA 2IBMA 3MWYW 3TH5A 4AKEA 4B32A 1DADA 5EE0A 2JLUA 2WKQA 4A6XA 3DZ8A 3QXJA 2ZXUA 5EXTA 4IW3B 1G1MA 4RD4A 1OSNA 1JR3E 3ADDA 3OF5A 4HYYA 4RD1A 3CNNA 2F9LA 1ZMXA 5GJCA 3IKJA 1KDPA 3KUDA 2W6JA 3ADKA 1LV7A 2W6ID 3THWA 4E5UA 2O0HA 2GJSA 1QG4A 2IA5A 2P6NA 2ZTSA 2QBYB 5AUPB 2WWHA 4BFTA 3LO5A 1II8A 1SULA 2C8VA 4Q4LA 3RYTC 3SOPA 2WSSA 4NCHA 5G3YA 2HDNB 2AD5A 4I4LA 4PFSA 2ASEA 2OEPA 3AKEA 2IYZA 2QORA 4CEIA 4URYR 3GLIB 4A0HA 1UKVY 2QTFA 4EFNA 3W8NA 5CITA 1KDTA 1MRSA 3JZAA 4XVQA 2C98A 1X3SA 1Q1ZA 1TF5A 1Z07A 5EP3A 2CNWA 4J0QA 4NZYA 2D3WA 3N2IA 2I3BA 3EC1A 2OCBA 3GLFB 1OFIA 4V03A 4C4PA 1ETUA 4ZDIA 1NLZA 1VHTA 1NL3A 2VYFA 2IYYA 1IM2A 3FDIA 4LJ5A 4BE7B 2WOJA 3AF1A 2EFCB 3RWMB 2JJ2D 1YKSA 4JLAA 4AURA 1X8KA 4C0SA 2HT1A 2O8BA 4KYUA 1OXTA 1XTKA 3Q3JB 4MRRA 3K0SA 1HQYE 1OYYA 4MGIR 5K8UA 1NBMA 5EE9A 5AWFC 1FP7A 4LV8B 2VSXA 4JLNA 4QFMA 4B34A 5K8IA 1XCMA 1UFQA 2ZJOA 4U7DA 3MWKA 3SU8A 4OQFA 4XTCS 4MRVA 2V8OA 1E0KA 4GZMA 1E2GA 4PC7A 1JAHA 4TL6A 4B3CA 4LV6A 2ZI7A 1N6IA 2V55B 4X8OA 1Z8FA 3CKLA 3GEIA 1PLLA 4PTLA 3O8RA 4ABYA 3AP1A 3LD9A 4G1UC 4DJTA 2A2ZA 4QBHA 2JIZD 1EGAA 2NPFA 2ECKA 2QPOA 1P60A 3EA5A 1RE0A 5FBVB 4LJ9A 2FSIA 4Z1MA 5HTKA 4UNSA 4XSHA 4B6EA 2XXAA 4LPKA 2FMXA 3EG5A 2VTKA 4BFZA 1BS1A 2ZUDA 1KI3A 1I2MA 1G64A 3OFND 4DSOA 1G8FA 2EQBA 2XEXA 3OZXA 1EFUA 1Z0AA 3UWKA 5FH9A 1U0HC 4PSVA 1FL9A 1AS3A 4DZZA 1OJLA 2GNOA 1F2UB 4DIEA 1T4GA 4XH9B 3BJIC 2RKOA 2EVWX 3OEHD 1XD8A 1X8LA 1NY6A 3MGCA 3SZRA 3L0SA 5F2EA 4DLTA 4TLAA 4NPHA 2PX0A 3HPQA 5GJVC 4DEYA 2ZJ2A 3NH9A 2F3RA 4ASUA 2QUZA 2Z4RA 2Q3HA 3KXKA 1J70A 1IAQA 1O3YA 1E3MA 2REOA 1NSTA 1W48A 2J87A 4LDJA 3K0FB 2N42A 4OK3A 3AVYA 1R0YA 2GTPA 5BXQC 1P3JA 1YR9A 1R5NA 2CXXA 1JQLB 1AQYA 3TVDA 4D81A 2VBCA 2A5DA 4MRSA 1XF9A 1VCMA 3SBDA 2E9SA 2R6AA 2XSZA 5KYKA 1W5TA 2DCUA 5FL7D 1DAMA 4WW0A 3MSXA 3RS3A 2IC5A 3KQLA 1B23P 721PA 3RC8A 5FFMA 3X2SA 1XEWY 5EE1A 3UWOA 4D0GA 4EFLA 4DRZA 4Q1AA 3K0CC 2GWHA 1E1QA 2BC9A 4RSGA 4Z51A 4ZPXA 5DI3B 2FPKA 5KNCA 3FHTA 1SZPA 1G17A 3L0IB 3PEUA 2DWPA 3OIUA 2QGNA 4NYIQ 4EAQA 1XJQA 1K5DA 2GK7A 1AS2A 3NKVA 1AA9A 3QY0A 3RRZA 3RS5A 2LKDA 1M34E 2WJHA 3CR7A 1LNZA 3QKRA 4JVLA 4OJKA 2XJ9A 3AUXA 4MQBA 5JS8A 3LDAA 3DKVA 3WP0A 3F8TA 1COWA 2RB4A 4JL6A 4MRPA 4PZZA 3SHFA 4JVSB 2W83A 2MSDB 3CONA 2UVQA 1E32A 2QT0A 2VSOA 3QEJA 5DIFA 1DELA 3CX6A 3GEEA 5AK0A 1KZ7B 1R0ZA 2ZRCA 1G8GA 2ZM5A 3KQUA 4A4DA 3A37A 1X86B 4JBXA 2JCSA 5H70A 3TNFA 2QA5A 3MMPA 1XD9A 2HEIA 1CR2A 1JXOA 5JWOA 2O8DA 2JLXA 4GMXA 3R8FA 5FTNA 4TZ6A 3KJEA 1YRAA 4PC1A 5AJXA 5TXGA 3IEVA 4ZI2A 1TL7C 2ZI9A 2GJ9A 1ZYUA 1LVGA 1U9IC 2WAXA 2GXQA 1XNJA 2GAAA 3C7KA 2OAQ1 3PG5A 4A8JC 2AHOA 2ZAOA 4NL4H 2MMCA 3AVTA 1SVSA 5IK2D 5JHGB 1KK1A 4TMKA 3T5GA 2KWIA 4N0EA 3VMFA 2QI9C 3KX2A 2QPTA 4ZI3A 1DG3A 5GVRA 4CF7A 2R6FA 4I99A 5JCZA 2H57A 2QQEA 3KUCA 1NVVR 2ZSFA 2J3EA 4HB0A 4FWTA 2BKUA 1Y3AA 3WMGA 3PEVA 4ZDJA 2GEVA 4YLGA 1FNMA 3KDSE 4NBSA 3TBKA 4B47A 1WE2A 4YQFA 2YKGA 4YMVA 2WOOA 1CJTC 3WNBA 3SJZA 3THYA 2AK3A 3I61A 1HTWA 4PANA 4A8JB 4B73A 4C3ZA 4MUBA 4CW7A 4D26A 3SFZA 4O3MA 2WWYA 1Z2AA 1YZKA 3TAHA 1F3OA 1LFDB 1S0UA 3AGPA 2WPDA 1J7KA 2IYQA 3NHBA 4NTZA 3AF3A 4TQUS 1ZUHA 3LQQA 2Q9AA 1QHGA 3HJNA 1AGRA 1GKYA 3SQWA 1XPUA 2X2FA 3TIFA 3K70C 2WWGA 3PUZA 1P7CA 1N2CE 2V4ZA 1T5IA 1UBGA 4LPSA 1DTSA 2F1IA 2P67A 2JJ8A 4GPTA 4B44A 1FUKA 2F1HA 1VG1A 3PEYA 1IN6A 3BAFA 5FPTA 2OILA 1VTKA 2Z0MA 4DCNA 1HT1E 2NO0A 2CVHA 1VPLA 2ZR0A 4DLYA 3I1FA 1G3UA 2J9RA 4Q1BA 5DE3A 2PLRA 3EA0A 1NBME 2DFLA 2WMOB 1IJFA 1YZQA 3K0AA 3QVVA 4MKIA 1ZUIA 2ZRDA 2DFKB 1OLOA 2BVNA 1MO3A 4Q48A 4M1MA 1MOZA 3CR8A 4IVRA 3ZIAD 4EFMA 1OIVA 1F2TA 3K70B 2FH5B 3VFDA 1RRCA 1XX6A 2W6IA 3MWJA 3TQFA 1G3IA 4QC2A 1KAOA 1CIPA 1HURA 1S3SA 1BMFD 4Z8XA 1JB1A 3LVRE 4QBIA 2ORIA 3GD7A 1EFRD 4YC7A 4IDQA 4D4LA 2LCFA 2VHUA 1E2DA 3RHFA 3THXA 1OH6A 2O8EB 4RFSB 2FWRA 3LV8A 5IDVA 2CEAA 4HAVA 1FTNA 3EIQA 4PSAA 2ZS9A 5KPJA 3QKSA 2FNAA 3B9QA 5G40A 1GP2A 2Q0HA 4TSFD 5B58C 1E4VA 4OBEA 4Q9JA 5AUQA 4D4JA 4CEHA 4P4TA 1IN7A 3ASYA 1KO1A 1TU4A 3GJ5A 5BQ5A 2IX3A 2RGXA 4OKSA 4RCYA 4II7A 1XWIA 4TTPA 3VNVA 5CLLA 2QP3A 4JYCA 1WF3A 2B7BA 1GVNB 3L0OA 2ZE5A 3ICEA 5J5CA 4JMPA 1G3QA 1EESA 5G41A 3UMFA 1KO7A 3U4QA 4JT4A 2GK6A 4HLUC 3A8TA 4LC0A 521PA 3FOZA 1XJCA 4IFEA 2ONKA 2JJ2A 2VH5R 3OAAD 3NG1A 4A2QA 1ZD8A 3QF7A 1E2QA 4AG6A 2ATXA 3ZZ0A 1WB9A 3LXRA 3OEED 3Q9LA 4M22A 4YMTA 4HLCA 1OIXA 1ZBDA 2FFBA 1DPFA 3RLFA 4DWJA 4CT5A 1KMHB 2PEZA 4TQ9A 1IY1A 3DL0A 5FTKA 3SI7A 3NBXX 2WJVA 4G5QA 4PC2A 2HF9A 3PIRA 4PC3A 3KQHA 3VR6A 4U5XA 1ZM7A 2C78A 1J90A 4JLOA 4B3XA 1DS6A 4B2LA 5J47A 4TYNA 3O8CA 1HQCA 2OLJA 3MJHA 3V4FA 3U60B 4NYMR 2OXRA 2UKDA 3GMTA 4G5RA 2JIZA 1RIFA 4ARZA 1HE1C 1YRBA 1KAGA 1R0WA 5GJWC 3NDPA 1CBUA 1XD2B 3QJYA 3TW4A 4JSYA 4A82A 3SQXA 1I2DA 1RPZA 2D7DA 1II0A 3BORA 4DLRA 1AM4D 1KJYA 2QPAA 3OFNA 4W5JA 3TR0A 1XBTA 2ZIAA 4D6PA 3QG1A 1E9FA 2JLYA 3GEHA 4PZLA 4RJLA 5TV2A 5JFGA 3K09A 4MKFA 1MKYA 4R2IA 2WTUA 2FU5C 1SXJE 3REGA 5FI1B 1MABA 1WCV1 2MSCB 2YC2C 1EWQA 2P6UA 3OEHA 4NDZA 1M7BA 2ZYUX 3LY5A 2O8CA 1N25A 4QJ4A 2C2HA 2VHJA 1W2HA 2RMKA 1VIYA 3QBVA 1SVLA 4OQLA 1W0JD 4X8MA 3K8YA 4KITB 1PVOA 3L2OB 2CCKA 2IEZA 4LHXA 5C2JB 5KO2A 3FMOB 4HLQB 1P2SA 4Q02A 3HYRA 4NH0A 3TMKA 3P4XA 1FQKA 4X8LA 1NN5A 4IOMA 4UJ3A 1N5IA 1JR6A 1TAGA 3HR8A 1D2MA 3LNCA 4KLZA 1RJ9B 2WAYA 1NIPA 4QM7A 3CX7A 5ELXA 1YR6A 2PH1A 4JZKA 4B3GA 3W34A 2ODBA 4YDHB 5B57C 4XOIA 5AR1A 5IRCD 3ND8A 5D3QA 5FL7A 2R8RA 1A4RA 1DE0A 2ZE7A 2H5EA 3IO3A 4O25A 3A4NA 3W3AA 2O52A 4C0AC 5KSPA 1E69A 2QAGC 1QVAA 2Q3MA 5HZKA 1T6NA 5KOYA 4Q7MB 2GHIA 1E2FA 2RGEA 4K81B 4B35A 1NKSA 1IXSB 2QNRA 4NCJA 2FFHA 2FJUA 2HV8A 3B13B 3KTAA 2XB2A 4QBFA 2A30A 1S9HA 1FPMA 2QENA 1SQ5A 2PBRA 3HU1A 4TMTA 1FNNA 5EJEA 3U44A 2J45A 3ZZUA 3HYTA 2R6GA 1QHXA 4R2HA 1P72A 1U81A 4NONA 5EXXA 4ACAA 4BRWA 1G6HA 3H2YA 4PHTA 1L4UA 4M0LA 2VP9A 1GSIA 1X6VA 4L16A 3KFXA 3PQCA 2QAGB 1WP9A 2EW1A 2Z4SA 1E98A 3MG9A 3A1SA 2QROA 2WJJA 1TEVA 4QGGA 2GZAA 2NG1A 3CUEF 2BJVA 4HEJA 4M9ZA 1IOZA 3WRXC 2WMNB 3M6AA 3PVSA 1OKKD 3EASA 3VU9B 3B1YA 2BMEA 1B0UA 1W4BA 3L8ZA 2Q21A 4LHZA 5FR2A 1P5ZB 1UBCA 4KJZA 3VX4A 1U99A 4Z54A 5ANRB 1FTSA 4C0QC 1Q1BA 4LSGA 2ZETA 5E7JA 1XEXB 3KKOA 1W4CA 3WBKA 4GNKA 4ESVA 3HDTA 5CM8B 3OE7D 1QHIA 3TJZA 5FBRB 2VPPA 3GFPA 4UNNA 4EPWA 4MDEA 5IK2A 1ESMA 1R5OA 2ODWA 4XWAA 3ZVLA 4US0R 4CRWB 3GLGB 2BBTA 2ONJA 2WIAA 1AZTA 1U94A 4C7OA 3BH7A 1RRPA 3AVQA 4JLJA 4LHVA 5HKKD 1IY0A 2BM1A 1HT2E 1EG7A 3SE0A 4Q4AA 4DLXA 4GP6A 4HUQA 3AVWA 3QSYA 1ZNXA 2OE2A 1AQUA 2BCGY 1KY3A 3GLIA 4MYUA 1Z6XA 3L8YA 2JLZA 4RZXA 3G5UA 2ZR9A 3GPLA 2O5VA 2PX3A 3B2EA 4LC1A 4MKGA 4QGFA 3R8CA 2B8WA 2Z5FA 3H1TA 3KKPA 4V0MA 1ZVQA 4LJAA 4EQ6A 3CH5A 3W5IA 1XCPA 4FMDF 5JHHB 3HU3A 2EYQA 3SN6A 2ZRGA 3UG7A 4BLPA 1UEJA 4D4MA 5KTYA 3LQRA 4S35A 1KI1A 4LUCA 1IN8A 3CRQA 2DHRA 1K8RA 1UKZA 2FPLA 1DO0A 4Q4JB 4HAYA 2DB3A 1G5TA 2BM0A 2VHQA 3IBGA 1X8JA 1M74A 3CLVA 4H9GA 1DG1G 1EXMA 2YYZA 2JAQA 3QQ5A 4RZ2A 4BLTA 4DB2A 2CLDX 2H8KA 1ONBA 1OYWA 4A15A 1T8TA 1ZJ6A 1HY3A 2QZ4A 1KK2A 4W5HA 3FHOA 1WRBA 2YNMA 3TUZC 3WNCA 3B85A 3PV0A 1AJEA 2P2LA 2H18A 4UXIA 4IVPA 4MGKR 2Z83A 5TDHA 5HR5A 2AD1A 4KFTA 1LB1B 1AKYA 3M0EA 4JLMA 1NVWQ 1E94E 2JA1A 5C18A 2J46A 2VP4A 3DVLA 1Z0KA 4OHWA 3W6PA 4D4KA 4IJMA 3ZIAA 2SHKA 1KSFX 1G4UR 5DLQC 3QKUA 5CDFA 3T06B 2A7QA 2XTMA 1ZINA 4XTRA 4F4JA 4LHYA 3LRPA 3R9WA 4EPRA 2QMUA 1BMFA 1QVRA 1KI9A 3LA6A 1ZAKA 2AWOA 1EFRA 1U98A 1XMSA 1GWNA 1P2UA 2GA8A 2WV9A 3UANA 4FMBB 1T3LA 1OH5A 2FF7A 2XX3A 3FB4A 4OQNA 3V00A 3PUVA 2J7PD 1V43A 2C5LA 3GJ7A 2PL3A 2IWRA 5AJYA 4CVNA 2QSYA 3MUFA 2FPMA 4TSFA 1US8B 2GZDA 3KJIA 1D6JA 1S9DA 5FTJA 1ZM9A 3K0FA 4AKGA 2REBA 1W5SA 2IHYA 4BZPA 2V6IA 4Q7JB 3T1OA 1VECA 3AKYA 1LF0A 3HPRA 3TLXA 4P3YA 3A1UA 4LI0A 4N0DA 4GFDA 1LF5A 2VQSA 2ZI4A 4JKIA 2EYUA 3Q5EA 1CU1A 2FGJA 3OAAA 3NC0C 4ZIRB 3L43A 1YZLA 4JBYA 3RSLA 3B1WA 4GI7A 5EZ5A 1U0JA 4TN1A 4OI0A 2DPXA 3OEEA 4DSTA 1F6BA 4KBFA 5D3MB 2RAPA 1NJFA 1EX7A 1W36C 4BFWA 1LS1A 4EPVA 1UKEA 5SZJA 2ZSEA 4DXAA 1V5WA 3IHLA 1OFHA 3AVPA 3VR4A 3CX8A 1XFAA 2NIPA 4Q9KA 2C95A 4XVRA 2ZU6A 1Z0JA 3E70C 5KHOC 4QRHA 4IFBA 4UNPA 3PENA 5C4GB 3RS2A 2B21A 4CEJA 1D8TA 1TF7A 4DUGD 2ZVPX 5CYOA 1Z22A 3GJ8A 1FFHA 1UBFA 2HLDD 3BGWA 3EPJA 3LFUA 5KDOA 4GZLA 4MGYR 4TZ0A 1MO4A 1VIAA 3BB3A 4LBZA 1ZNZA 2QN6A 4WZAE 1W36B 2R62A 5JWHA 2WWFA 3N70A 1YQTA 1CF4A 1XZQA 1SHZA 2J1LA 5C4MA 2NGRA 2AFHE 1RYFA 3CRVA 1RFLA 2V6JA 1BOFA 1ZNYA 3QF4A 2ERYA 1S1MA 2OT3B 3KXIA 4NKRA 1E2NA 1FZQA 1J8MF 3T1VA 1C1YA 4O2RA 4DKXA 4ILEA 1UAAA 3I5YA 1KJWA 1L7VC 1AKEA 4DLZA 3HWSA 5DHFA 1UEIA 4JL8A 5TY0A 1EFHA 3FGNA 1D2NA 1W0JA 5BN3A 1ZRHA 5EQTA 1S8FA 3IDQA 1ZU4A 4FCVA 2V54A 3RRYA 3MFYA 4HDOB 2OUKA 2CCJA 1N6PA 1YHNA 4L4UA 1CRPA 4DBLC 1AS0A 3IIMA 4ZKDA 4HZUB 4KVGA 4DDVA 1YZNA 2DR3A 3FFAA 3TKLA 3UXMA 3BS4A 1RRGA 1NG1A 1JR3D 4M4SA 1NMZA 2EWVA 3LW7A 2IXEA 2YV5A 4PPQA 4EKDA 1KO4A 1NI3A 2RGBA 2J41A 1N5JA 3P32A 1KI6B 2P0EA 3D6TB 2WWIA 3KZ1E 4AD8A 4A8JA 2BBSA 3PITA 2E1RA 1GFIA 1NRJB 4G3XA 1R8SA 4QHSA 5LDDC 3U5ZB 3B1XA 1TQ6A 1NMXA 3WNDA 2QMOA 3MWLA 3IQXA 4QBGB 1QG2A 1E2IA 4P0TA 1OXVA 4NYJQ 4TLCA 5C46F 1G41A 3VHXA 3WMEA 3U6KA 2BHRA 4HAWA 1G20E 2ZU0C 3BH0A 5G53C 4Q9IA 4V0ME 1GTVA 3THWB 1G7CA 1DARA 1CJKC 5EUQB 2HYIC 2BIFA 3BD9A 1XPRA 2P65A 4RCZA 2IUTA 5AUOB 5BYKA 1YZTA 4XWKA 2Y8EA 1II8B 4PO9A 4AC9A 4C0LA 2ZRMA 3I8XA 4TTQA 5LPNA 4NE2A 4E22A 2G77B 1BH2A 1NLFA 2IYSA 4LYHA 2ORVA 1E2MA 4BLOA 2CVFA 3I3SR 1OT3A 2YVUA 4HDQB 1E2LA 5JJIA 5C1BA 2AXNA 2F55A 4CEIB 2IWHA 4MITA 4WZBE 4UQOA 1TU3A 2OBLA 2ZJ5A 4DHEA 3BE4A 1MO6A 2YJTD 1NLYA 3FHCB 2KBEA 4UKDA 1ZU5A 2PZFA 4IEIA 3GCGA 3NWJA 3VNUA 2VP6A 3SYNA 2BKEA 2WWXA 1KHTA 1BKDR 2F1JA 3OHMA 5KNDA 3OE7A 2GRJA 2REXB 1KY2A 2ZSDA 4UNQA 3TGPA 3U61B 1OFTA 1NMYA 3ZGXA 1GL7A 3QPVA 1XPOA 3QXXA 2PEYA 5J4KA 4TMWA 1P9WA 4YMUA 5HKKA 3T34A 2GVZC 3CF2A 4LX0A 4A2PA 1QHSA 4CYMA 3ZVMA 4PO1A 5CDFE 1N6KA 3LX5A 2IYXA 4BPBA 1VKJA 4IDHA 4QJ3A 4B2PA 4Q7KA 4BEBA 3BBPA 4JLKA 3OIWA 2VL7A 1G8HA 2NZJA 5E7IA 1R0XA 2IYRA 1FMLA 1LTQA 4RFVA 4NU0A 4KFUA 4A0RA 1W46A 4IDNA 3QEOA 1WQ1R 3EZ9A 1I4LD 4DDUA 2ZS8A 1M2OB 3VR3A 3ADBA 5K8TA 4HDCA 4CT4B 4DLUA 3ZVNA 1OXXK 1QHHA 1KNQA 2CMKA 2I4IA 1RZ3A 3TRFA 4RD6A 3I62A 4AKHA 1GRQA 4Q1CA 1LY1A 4MGZR 2WKPA 2FFAA 1N0WA 1QHYA 3T61A 3Q7PA 2FSGA 3T1QA 2VLIA 2FEMA 5JSZB 1XJ0A 1DAHA 1Z28A 3PUXA 5JI2E 4A9AA 3QE0A 4QNMA 1QRAA 2NO7A 121PA 1XCGB 4M9SA 2XITA 4M1SA 2VF8A 2IXGA 1IONA 2YWGA 4DT1B 5JEEA 1UJ2A 1ZIPA 1JPNA 2GESA 3E1SA 2CE7A 4DLVA 5JRZA 5CM9C 1OPXA 4LJ4A 4LRWA 3VAAA 4XWOA 4ESHA 2CJWA 3T15A 2F43B 2PZGA 1XXHA 2XOKD 3A1VA 1E9DA 1YZGA 1VCIA 4EIWA 1G4AE 2O8FA 2P5TB 2XTZA 2YWEA 1Z2CA 4Q21A 3CNLA 3R7WA 4B3DA 1EFCA 4GT1A 1TQ2A 2RGAA 2H92A 5HE8A 1W7AA 1RKBA 1W2GA 1SXJC 4G01B 5AJZA 4ZKEA 4DCUA 1SVWA 3BB4A 1U8AA 2R65A 1T3HA 4IRUB 1GRRA 2ZJBA 4CGZA 2IYLD 2OLKA 3IEUA 4PPGA 4FWIB 1G7RA 3BH6A 3GLHA 4UXJA 4OI1A 3TAUA 3EPLA 2EFDB 2J7PA 2V1XA 2ZRPA 3NTUA 3OIVA 2CHGA 5HCNA 3F3YA 4KODA 2DY1A 3A1WA 1MV5A 4ON9A 4KBGA 1TEXA 1G21E 1MH1A 3NC1C 4TYQA 5EP2A 3SDZA 1WBBA 2CE2X 3O8DA 2ZYVX 3ZYCA 2JJ1D 2PMDA 3CZQA 5KU1A 1X1SA 4P4SB 3V4RA 2ZJZA 2KE5A 4Q19A 4A0FA 1AK2A 2Q6TA 5FOSA 2EU8A 4M53A 1CRQA 4MRNA 1OB5A 1SXJB 1CP2A 3QKRB 2GDJA 1CS4C 2BCJQ 2WJIA 2D06A 2GBLA 3EARA 3CRRA 5L3QA 2PCJA 1QF9A 3NBZC 3VQTA 2WJGA 4GOXA 5DHAA 4Y0AA 3RABA 2P6RA 2IS2A 2BWJA 2ATVA 4A36A 3EZ6A 3T12A 1PV4A 2C04A 1E2EA 2ZRIA 2DBYA 4XIGS 3U7HB 3KFVA 3B8HA 1Z0IA 5F9FA 1CXZA 4QKQA 1DAIA 1DEKA 3SEAA 5DO9A 1ELOA 4GBMA 4I1UA 1ZW6A 2ZAMA 3DM5A 4HAXA 2WJYA 4PR0A 4X8HA 1KKLA 1Q1QA 4PXAA 4BWYA 2ZREA 4LYJA 5L3RA 3TK1A 2QRZA 2ZANA 1G19A 2AKAB 4GRAA 3C8UA 3BIFA 3AV0B 2BMFA 4DUGA 2EWWA 2IYTA 2ZR7A 2OO7A 4B74A 2HLDA 1ZUNB 4JLPA 4YMSA 2F1RA 1M7GA 4NHOA 3SS8A 3VR1A 1M6NA 4F93B 3NHAA 2RGNA 4LHWA 2QM7A 3PR1A 3BRWD 3VKGA 1G7SA 3O8BA 2RHDA 3VU9A 1NVUQ 3U7FB 2QTHA 5CIWA 1G8YA 3K9NA 1SKYE 3DMDA 3FVQA 2ZUCA 5K8LA 2WIBA 3BXZA 4D0NA 4US1R 3FKSD 2Q9CA 4QHTA 4OHZA 3TUJC 1C9KA 1GKUB 1XEXA 2HF8A 2WVJA 4B6FA 3ICQB 3EWSA 5GJBA 2G88A 5KDLA 1P73A 2HUPA 2ZUBA 3Q5DA 4RKEA 3GJ4A 1NSFA 1U0LA 1OXSC 4JYBA 4O0MA 2XB4A 1T9HA 3S1AA 3WYFA 5JBQA 1Q3HA 1FX0B 2ZRKA 3FKQA 4BFSA 3QVUA 3H86A 1TMKA 3TVTA 3ETLA 1E0AA 3ZH9B 2HCJB 3I92A 4Z8YA 3DM9B 3ZDQA 2V9PA 4AI6A 1FQJA 1DVRA 3QXCA 3B6EA 4A2WA 5BYJA 4QGHA 4GOKA 3SJAA 1XMJA 1XP8A 3EPKA 4YONB 1E9AA 4B33A 1GUAA 1X1RA 1JNYA 1UPTA 3BOSA 4G5OA 2D62A 3LW8A 2ZRAA 1J99A 2BJWA 4PQRA 1KNXA 4XD7D 2J0QA 3F0TA 4LOAA 3KKMA 4JBWA 4DCVA 4LK2A 2JLQA 1Z6GA 1YVDA 4MYHA 1HH4A 2FX3A 1OFUX 4E09A 5FUYA 1NVVQ 1P62B 1E9CA 4TT3D 1N6NA 3C15C 1E99A 4GOJA 3GP8A 4JL5A 1S96A 4BZQA 5JZVA 1G7TA 1Z6YA 2ODEA 3UMSA 4F7WA 5DH9A 3C16C 5J4YA 4KFSA 2I1QA 4BFXA 3Q7QA 3WHLA 1CR4A 1F2TB 2QE7D 2ZRJA 3H4MA 1OH8A 1R8QA 1ZNWA 3KJHA 5HZHA 4C0HA 1CJVC 2NQ2C 5CJPA 3OIYA 4DDWA 5H68A 2IF0A 1SGWA 421PA 1IHUA 1JJ7A 1XU4A 2F6RA 5FPHA 2D7CA 4F38A 3KB2A 4EPYA 3THXB 2OXCA 2OZEA 4TYYA 2GF0A 4W9MC 3NH6A 4Q4HA 2QU8A 3ADCA 2KI5A 2GJAA 3DOFA 1WA5A 1IN4A 2JEOA 2OCAA 3QKSB 4IKEA 3TUIC 5IF9A 1TNDA 3I5XA 3B1ZA 2AX4A 4PHGA 1R4AA 4CEHB 2GCOA 2C99A 3UMRA 4EJSA 4BGDA 2ZROA 5DSZA 1GRNA 1CKEA 3AP3A 3K9HA 5JWRA 2ZI5A 2DWOA 2QT1A 3EAQA 4ACBA 2BEJA 3A4LA 5BWMA 2ORWA 1P9NA 3LBIA 1XB2A 3ASZA 4ZO4A 3U4QB 1HV8A 1XDBA 4G5SA 3FMIA 5FOTA 1TX4B 3VHLB 2R9VA 3CIOA 4IXMA 3RS7A 4A0GA 4HAUA 1ESNA 4RY2A 3LWNA 3QKTA 4KSCA 1XXHE 2GXUA 3Q72A 3VTKA 621PA 1KMQA 5JRJA 1TUIA 3DPUA 4FINA 4LWZA 3K09C 4WVFA 4PQYA 2ZJ8A 3K70D 3LH5A 2RGDA 1MR3F 3AF2A 4LY6A 5KNBA 1A82A 2W58A 4TL8A 1KYIA 2OM2A 5KSYA 2C9CA 1Z0DA 4DCSA 1XTRA 4URUR 2H7VA 4M8NE 1E9EA 2IL1A 2QBYA 3C41J 4KFRA 3SR0A 2GXSA 5BN5A 5EXSA 1NY5A 2RCNA 3CM0A 1SXJD 2ZSBA 1W44A 3GLHE 1E79D 3KXLA 4LJYA 3GJ6A 1N5KA 3VX3A 2CL6X 3KQNA 3MLEA 1WXQA 1M8PA 1TADA 5HPYB 3FPAA 2P5SA 2JLVA 3RRNA 4PO8A 2TMKA 1BIFA 1QBKC 4L15A 2ZI6A 1M7HA 1KO8A 3A36A 4B2IA 3SYKA 2BV3A 2ZS7A 1A5TA 1KJZA 4HUTA 1Z83A 3R9IA 3GLFA 3QXHA 2CHQA 2GETA 1LW7A 2EFGA 3WBJA 2C96A 4HZIA 2UZ3A 4U00A 1KSJA 4TLEA 3MD0A 5J40A 4IXNA 4KU4A 1XZPA 2BMDA 5AUNB 3Q85A 3U3KA 4WXPA 4EPTA 3TSOA 2DYKA 4Y0VA 3R9XA 3N2EA 1KIMA 4WOPA 2VP5A 1KO5A 3P1JA 1JALA 1XMIA 3DKPA 1CR1A 3MAAC 4AIIA 4DEXA 2FA9A 2QAJA 4ZCMA 1E2JA 1T8UA 2WSMA 2VHCA 3RAPR 2ZSAA 3GJ0A 1O87A 2XOKA 3O47A 4JLBA 1E2KA 1DOAA 1NN3A 1UADA 2VP0A 4OL0A 2G0TA 2VO1A 4FXPA 3X1WA 2QP4A 4C2UA 3A4MA 4NYMQ 1GNRA 4MKHA 3WY9A 1FOEB 1N6LA 1XTIA 1VCOA 4TMZA 4BECA 2FSHA 1UDWA 3LXXA 2PZEA 3B78A 5FUXA 1NN1A 5DGXA 3AB3A 4BLRA 5JS7A 4JIMA 1GDDA 3LX8A 5EZ6B 2FG5A 1QZXA
chains in the Genus database with same CATH superfamily
2PSHA 4G81A 4K6KA 4HVLA 5BUZA 1P0FA 5B1IA 4LJ7A 5LR6A 1BU5A 1KIFA 3NDJA 5BOSB 5L3SB 1CQJB 1SVNA 2FOLA 3W2TA 4MSUA 4A92A 1EVLA 5IANA 3OJEA 2QG9A 1GTSA 3DXYA 1LPNA 4OQXA 5AKLA 3K7EA 2HBYA 3R40A 1Y1RA 3SIXA 4URVR 2EF0A 1T0IA 5ERYA 2Z1MA 3QJ5A 4R8KA 4BP9A 2FMUA 4RPHA 1L4LA 5JCXA 1F2UA 2AXEA 3SZ3A 2BN4A 3HN2A 2XD4A 2HRRA 3KKNA 1KK0A 1Z4MA 4FGSA 3ZBUA 5JSUA 2OENG 2EJCA 4N5LA 2QUAA 2W37A 1HT3A 1XVVA 3ONWA 4YP0A 4NCIA 2GVDC 2Z8YA 3C4QA 3H9CA 5GV7A 3MJ4A 3MJFA 3TTSA 4R3WA 4D9CA 5EWLA 2WNSA 2I6UA 2ZYTX 4N03A 3DE4X 3ABOB 3ND9A 3FZQA 3K2IA 4M76B 5JOQA 5E7MA 4N3NA 1CZOA 4H7HA 1PLJA 4P54A 1N1DA 5H8WA 4KH0A 2JGAA 2FQWA 4FFNA 4BX8A 3BWDD 2HMSA 2RSLA 3RJ9A 2H1CA 1FDSA 3SHWA 3LWZA 1A7KA 3IPXA 4H1WA 3BWYA 3NHMA 4R81A 1JXQA 4FQ5A 1RD4A 4WLEA 1TKCA 1V16B 5EVJA 4C4YA 1NKTA 2RJNA 3F1LA 3KKQA 3QUSA 1NOIA 1SOWA 2ICAA 3OMWA 4NZZA 4TTVA 4KVFA 1Q92A 1RYBA 2FDXA 3O9ZA 1I1QB 4C0KA 1DEOA 1H2BA 2RB5A 3IBFA 1TK3A 5LP6B 3WGKA 1EGMB 4MP8A 3GRCA 1ID8A 5BN4A 2IEYA 4XM1A 3C43A 4IJQA 5DI3A 4ARVA 1SA0A 1JYEA 1Y9AA 3BJRA 2ANCA 3IHWA 2QZSA 1KI8A 2XRYA 1QX3A 1SBIA 4O4HA 1Q3TA 2C9OA 1MW9X 2QRNA 4C2AA 4GPAA 2Y1GA 4L3OA 2HC9A 1WDTA 3R8FA 2B7CA 5A05A 5A5VA 4HK4A 2IS4A 1PLKA 1MHTA 2BGGA 1Q21A 5D3KA 2J0SA 2X77A 2P0YA 4WERA 1IQPA 3CGGA 3FTQA 2J30A 3JQ8B 2CSXA 4NMXB 1TD9A 1I5RA 1WV1A 4IV8A 3PXDA 3H9UA 3KYJB 3QUCA 4H1VA 4HDKB 4LGVA 4C30A 4TQAA 1HDOA 1SEPA 2CL7X 2FZ5A 2O0KA 3D4OA 4PWYA 1RBQA 3C1TA 2JGNA 4PNZA 2WHXA 3FVWA 4A5OA 5FOXA 3AYXB 3HKBB 3QQPA 2GJ8A 3PWKA 4LDPA 1CNEA 1P29A 4V0KA 3K0EA 4Z9XA 3W1WA 5B36A 5IVKA 4MWZA 3ZH2A 3AVUA 2YN0A 3GFOA 4IGEA 5FPQA 1F7UA 1A95A 1H4TA 2OGSA 4CKWA 1R15A 4LXQA 3IEKA 4D9FA 4YXWD 4E5YA 4CDMA 4NP6A 4UASA 2YJ3A 2Z5GA 1Z5VA 1H8HD 1YWGO 3CJRA 4X3CA 5E95A 2NXWA 2VK2A 3FSEA 5KOIA 4YP9A 3TCKA 3LTEA 3EQ8A 1AKRA 2ZAYA 1PHPA 3CCFA 3G2LA 1CCWA 3LP6A 1NVAA 4XX1A 4Y2HA 1KEPA 4CIAA 2WSYB 3N5CA 1XT6A 4F3YA 3M9XA 1OJ7A 2OSBA 1MJGM 4WGFA 4WRRA 1NJGA 1X0VA 2R7AA 2AN9A 3GMDA 5L4NA 1MA3A 2MYTA 2F7SA 1QQ7A 3ANMA 4CF5A 4F4FA 3ESQA 5M29A 2JAWA 4GBED 3AF4A 3LXUX 3VTZA 4DRXA 3NHPA 4XB2A 2A0KA 3HLKA 4JOBA 3LE8A 4YGXB 4Q18A 1VJGA 4D2IA 1GG2A 1S7CA 2G36A 1KS2A 5DBIA 3WK4A 2JDID 1KA9H 1YK0A 4TMXA 3A3NA 2GAOA 3C6MA 4KE7A 4J03A 5DW3A 2AOWA 4AG5A 4XJSA 2XVZA 3R7SA 3F97A 1L7OA 1WLSA 2PUTA 2ZBPA 2ZRNA 4ZAVA 5HBRA 2JAPA 1TJNA 3OA2A 4LQ4A 3AVVA 3H11B 1PW5A 1T4DA 3O92A 4ZALA 2O7RA 3U3DA 4ARUA 4I5FA 4B76A 5CDTA 2PYIA 2R7KA 1A9XB 3IV7A 3O03A 1FFSA 2HA6A 2OCPA 4PAOA 4RHFA 1YQ9A 4C4SA 1XTSA 1OTXA 4MJ7A 1FFXB 4AJ4A 1MO5A 3C4JA 1IY9A 2EATA 4F4UA 2Z8ZA 5A1JA 3TL2A 1CUXA 1XIVA 3KT8A 4K46A 4A0SA 4P6VF 2MOKA 3KP1A 1FS6A 1LS6A 3NEJA 2ZRFA 4G36A 5ELLA 4QQ8A 5H1YA 2VDPB 1P2TA 1UBNA 3PQFA 4C78A 2VAVA 2VPTA 3LBNA 4GZ3A 4DT1A 4F4DA 4Q66C 3VJRA 1Z06A 3O8QB 1T3ZA 1Y42X 5EOVA 4DJFC 1BCRA 4DB4A 4I4CA 2YFHA 3RKSA 2F43A 5LL6P 3W5UA 1Q11A 4F9FA 3J81k 3AEQA 2JLRA 1P2VA 1I1OA 4K1XA 5ULLA 4CM3A 2O50A 4LF5B 3LLUA 1D2HA 3KJGA 3OCYA 1GZVA 1OKKA 3DT9A 3IAM1 5KX5B 5IT9A 4FCWA 4DDTA 4QODA 1WV0A 3V8PA 2QVCA 3MXOA 3R3ZA 1DJNA 2ODAA 4FFBB 5TGDA 1VKNA 3V2GA 3OFJA 1E5VA 4ANFA 1Q20A 3FLAA 1COZA 3DT6A 3PU6A 3R4VA 5ALNA 5ARBA 3G7UA 5KYVA 3UJ8A 3Q1KA 2B78A 1JLLB 2OD7A 4EF6A 4OUDA 3VVCA 4YWHA 1D2CA 1H2AS 2ZUUA 2BDTA 4LYAA 4NENA 4ZRDA 2V1UA 1GO2A 2NO9A 2WG2A 3GA7A 2OPBA 3KBOA 3MRTA 4JOSA 4N0QA 1D9XA 4NECA 3AGQA 1NE7A 2IPNA 4URWR 3K8ZA 4IMIB 2YHAA 3G8DA 2G6BA 3DZBA 4RZ3A 4A7PA 2P30A 3ESRA 1H2ZA 2CMHA 3IP3A 3MPOA 2ESRA 4I6EA 3TNJA 1NVTA 4JNCA 4BB9A 3NEAA 4WN3A 1L3IA 2P3QA 1N8KA 3MGBA 4JEUA 1ZQ1A 1SXJA 1O95D 5EFZA 4CZ2A 4FD2A 3TKYA 2NT4A 3NKLA 5IW8A 2IW3A 1TT5A 2QYSA 3OZGA 4K9DA 4RFSA 4TKUB 4DJ5X 4EG6A 4ZVMA 3X2EA 4BY9E 1JMKC 1L0BA 1DQNA 2X8AA 4LXIA 1BE8A 2IYAA 5DU2A 3P96A 2F9MA 2ZQ5A 4WA8A 2BMJA 1NIJA 1G21B 1QCZA 3N3BC 4DABA 1O6GA 4B2YA 1PWYE 1N2HA 3EXG2 1CUSA 1SG6A 4BKUA 3PGKA 1Q44A 3UJNA 1Z6PA 2AL7A 2CF5A 4HKTA 3CLSD 1DWQA 3GN2A 1M2NA 4Q5IA 4BE9A 1HC7A 2RHMA 1LZKA 4P32A 3NWBA 2Z3ZA 3EXHB 2J32A 2OESA 1MAWA 4RAQA 4KXQA 4V3BA 5ARCA 4WY2A 1XEFA 1J39A 1C50A 2W4MA 3GUVA 3CFYA 3QTBA 4YDRA 4ZT7A 1RAIA 4YLYA 1PG0A 2FKNA 3NVAA 4BLSA 5HKBA 5JNRA 1INLA 4E7OA 3U7JA 3ZD7A 1TA4A 2XE6A 5F98A 4IGKA 1ECGA 1YNOA 1KTVA 3B1FA 3KETA 1DXOA 1MLDA 4EBBA 3CTPA 3R75A 1T24A 3AESA 1CB7A 3DBHB 1L9XA 3H5NA 3Q7SA 5LOVB 1PYDA 1JKMA 3A58B 3A6DA 3DTVA 3ORYA 1F8UA 4D9JA 1E20A 4IG4A 4MR9B 4V38A 3JD1A 4BQPA 5K09A 5LZ8A 1EFTA 2RHOA 4BJHB 4MUMA 4AQ7A 5E8RA 3ELBA 2NYUA 3GT0A 3IUMA 3N2GB 3PHIA 4KXVA 5EZYA 3CINA 1FMTA 3C6ZA 3LZCA 2AFIE 4QNRA 2RH5A 2JKZA 4HMPA 4WIAA 1XRNA 4PX5A 3KOOA 4PCUA 5AKXA 1I2ZA 4XOUA 3RVBA 5KCZA 1X7YB 3ND5A 4MYCA 1QLJA 4HLUA 2QLLA 3V4OA 3JWGA 4YIKA 2JKVA 2W8BB 4R2JA 1KAHA 3C3YA 4DV5B 5H4HA 2ZTHA 3G68A 4GL2A 2J3JA 4FSDA 1QH8B 1OA0A 2XTNA 1KEZA 1RR6A 3MCTA 1JG4A 2N46A 3TZKA 1E1CB 1W36D 5JY1A 4JGGA 3HCDA 1EFVB 2FN3A 2D59A 3QE3A 2VPQA 3MAJA 4Q01A 1CY7A 4IIVA 1XN4A 4RS3A 4TQGA 5DYGA 4J7AA 2ZVQX 4YRTA 5DM0A 2IHNA 5G0WA 1JG7A 2NU6A 2JLWA 2Q6KA 1SD2A 4R1SA 5FWNA 3AUAA 3GQVA 2H17A 3EIHA 2FN7A 3L1IA 1SKYB 2G04A 3P27A 2BFFA 4GXNA 3P5SA 4JJKA 5TMBA 1HFJA 1T6BY 4DIUA 1V5EA 2QHXA 5HS6A 4UDXX 2V7QD 3NUGA 5ALDA 4DL9A 3NUQA 3AOEA 4Q9DA 4QDZA 4G4GA 2ABWA 4UEOA 2G1KA 2M6RA 5FI0B 5J5VA 4F8JA 1UZLA 3S2EA 4RIFA 4RVFA 3ETCA 1JI3A 2B35A 4U7WA 2J6HA 3TTUA 4EA9A 1MJGA 3WQRA 4IDOA 1JHMA 4FZ5A 2ZSHA 3OLZA 5IG2A 1DAGA 1U7UA 1W2WB 3WLMA 2IODA 4DCJA 1G55A 2ACVA 2D5BA 2V7VA 3MTDA 4OD0A 3C2QA 3B6JA 4J0DA 1IWOA 3C74A 3QWFA 2WBLC 3K35A 3BHJA 2RGRA 1N2XA 2QLBA 2ARKA 1X1DA 3DYIA 4Q1EA 2I1VB 4G0OA 4C4OA 1VKHA 1U8EA 1K5HA 2FPGB 5ISMA 3QRWA 4KPEC 2JCYA 4QVGA 1XLUA 5BQOA 1HE8B 5FR1A 4Q34A 4P7GA 2GM4A 5AHOA 1QHNA 2ZFUA 3Q1LA 1JMVA 3X1ZA 1A2BA 4E5SA 4FB5A 2P41A 3WLTA 1G6OA 2WP8J 4IILA 1CF9A 3A6ZA 3ZQUA 2O0JA 5C5EA 3VPSA 2GN8A 3NWOA 5BVGB 3V55A 1QP7A 5H0IA 2YRFA 4PHHA 1H2YA 4X24A 1AD2A 1B3RA 4F3RA 2GCNA 1V8DA 2ECFA 3OQ6A 4V0RA 4OG2A 5SY4A 1VJ0A 3BHIA 4IINA 4OHXA 2DUWA 2REQB 2AXPA 2ZRQA 5CB6A 3P9SA 3ANXA 4FEGA 5IHPA 1UP6A 1JEDA 5HKLA 3BRQA 2VAWA 1EH5A 5IBRA 4G0QA 2JZOA 1A88A 221PA 3P4UA 3OG9A 2G67A 4WJKB 4Q05A 3T9EA 3U3RA 4QVIA 1L5YA 4LZPA 2B6NA 2I91A 4ZC8A 4BO6A 4P84A 3X1DA 4L6CA 3WX0A 3QX8A 1IWPB 2CLHB 3AUKA 1WPRA 4ISCA 4LKRA 2FFQA 3RVDA 3RU9A 2O2CA 3ZE0B 3INGA 2YYYA 3W9BA 2C2OA 2P9TA 2VYVA 2V6BA 1BHJA 1L5FA 2W0MA 5EHZA 4Q03A 1XDDA 4HWTA 4KUGA 2AZXA 1JDUA 1UXKA 3FWYA 4UCQA 3EG9B 1YQDA 3WRYC 4EJ2A 3AH8A 1UZMA 4N18A 1WB4A 3OUZA 4K9LA 2DCMA 1I7NA 1TFUA 4K6HA 4L85A 4WZ6A 3N2KA 3N8IA 4B85A 5JCJD 1D5WA 4QAQA 1T9KA 2Q6OA 4HB3A 1L4YA 3B53X 4UPDA 5L4SA 1O0CA 3PHLA 2P4HX 4CI0B 3A2KA 3RD5A 1NW6A 4LJRA 1Z4LA 5MN6A 4FGUA 2BFMA 2G70A 1NQTA 2BCEA 3ILSA 3P94A 4JEHA 4R1OA 3OESA 3VYUB 3AR2A 1IZ8A 2DPHA 3TW8B 2K7FA 2SICE 3O6VA 5CJ2A 1AK1A 2O2EA 4PPNA 1YZVA 4E5KA 3A4VA 1BTOA 1K1EA 2GZRA 3LQFA 2YJ6A 3TPFA 1N6RA 3WGGA 3I2IA 4FYWA 4G0NA 1VG8A 4KUEA 3X3HA 3GLGA 5HK8A 1CP3A 3R0VA 2WWWA 5F7JA 4UD2A 1SAYA 3ZKAA 1F8GA 1MAVA 4FOOA 2Z1DA 1VYVA 1N33B 5EMMA 5B55A 1F5NA 1IVNA 3PFFA 1OBVA 2CJWB 2QEQA 3LT2A 4NBVA 4R2WA 2PO5A 4R7GA 4M8SA 3WE7A 3PJRA 1IXRC 1K7CA 4F2DA 3O8OB 4Y1EA 5DGCA 1XAIA 4P3PA 4QZVA 3FBTA 1MTOA 3ZV3A 3HJHA 4JC8A 2IBSA 3P20A 3PC6A 4RXTA 3BGVA 4KQ9A 1LBSA 4PX9A 4GLJA 5ALWA 4R7ZA 5MN5A 2J31A 2NZYA 1TD1A 2VUUA 3KJNA 4L75A 4Q7EA 1N0VC 4X65B 7REQA 4OX9B 2BMVA 2PMCA 2X2PA 4V0NA 1ZIXA 1KE1A 3L41A 2X13A 2DH6A 4QGAA 1H8EA 4DM7A 5HVNA 5A2GA 3ZXUB 4MA0A 3ONNA 1J7JA 4CV3A 4LYGA 2N0SA 1R2QA 1A9ZA 10MHA 2OB1A 4DA6A 5E0OA 5AESA 5I4KA 3WK6A 1SU6A 2B8TA 4R6XA 5FTLA 4C05A 5FQOA 2FF5A 2I2DA 2IPAB 1BA3A 1KK3A 1WMSA 3AEZA 3L5KA 4MV8A 4ZCQA 3U26A 3V2UA 4B6JA 2GAJA 1GL6A 4UU7A 5LXTA 4JI6B 5C37A 3L5OA 2GM9A 1UJ4A 4P82A 3UHFA 2C42A 1N9KA 3HXKA 3N9IA 2DAPA 4NZ9A 1U8YA 2Q2QA 5LD2B 2G9NA 1JG3A 1I6LA 4IM7A 4DYVA 1M3SA 2G0NA 3RFUA 5D5QA 4QA9A 3L0BA 3VDNB 4OO3A 3SD7A 2J5QA 3X1YA 1I5EA 2BBOA 1OBFO 2X0EA 3AINA 1D6MA 4ZOLA 4X64B 1ABFA 4C0BA 1FXSA 1IOWA 3IQIX 3LKDA 3SAJA 2R8EA 1KU6A 2VVTA 3QUBA 2GASA 3G0HA 3GZNA 2VSFA 2YINC 5E6UA 1RYZA 3LVQE 3M9WA 5L3QB 1EEHA 5EE3A 2AMVA 1EK0A 2JVIA 2MIIA 3QIAA 4TKZA 1M76A 4FI3C 5C8DA 2ZDHA 1YB1A 4ESOA 2HW8A 4C5AA 1TQHA 4D25A 3DLIA 1XRJA 3B89A 1O54A 5E0KB 1JEAA 3KEFA 3H2BA 2XGGA 1T5LA 3EE6A 3KUUA 3KYCA 4HRXA 4M54A 1V25A 2IYNA 1TO1E 1ZC3A 5I45A 1Q57A 1WSBA 3GGPA 2ZW9A 1X19A 2OFOA 3LK6A 4WZAA 2W6PA 2WTXA 1NP6A 2QU7A 3MK31 5CT9A 4ZYVA 2YIJA 1GTG1 3TXAA 2Q49A 1C4KA 4Y2QA 3V7NA 4UTVA 1E9BA 3NANA 2QUIA 5LMZA 1PX2A 4ONEA 1KYTA 4N12A 3H3JA 2Q9BA 3K92A 5K0FA 2DT5A 6ADHA 1PWZA 3EODA 4MUFA 3ROMA 5U9CA 3GN1A 2WNIA 2GEJA 4IQ8A 2BFNA 3I2FA 4ILKA 3FZGA 4NIMA 5KNCD 2QX4A 1GU0A 4PCVA 2BTEA 1DHRA 3AU9A 1L4NA 1EXVA 2PJDA 3SS9X 4RJJA 1Y3DE 1UANA 5JARA 2V7TA 2VR1A 5CFMA 1YI0A 3GIWA 1QFXA 3AY0A 5TJ9A 4YV1A 3MRVA 3MHTA 5SZKB 5JD6A 2QTRA 2BZ1A 3N75A 4CETA 5AK3A 4YI3A 3VR0A 5JALA 3ZG6A 3PNBA 2OZLA 4D6YA 1PUJA 1JQBA 1T35A 2AZMA 2WZQA 5DNAA 3TTWA 3DR5A 4I1VA 3VNSA 5DX0A 4ARZB 4CKEA 3HCWA 1P7VA 1J8VA 1U7ZA 1WU7A 2EW8A 3Q9SA 3AEUA 3KZCA 5I9MA 1VKZA 3LQKA 4B0OA 4QL3A 4QXOA 1AF7A 3HYLA 2M1XA 3ESBA 1R9JA 3IODA 2DG2A 4LVOA 3OTWA 5CW2A 1X92A 4CU2A 3Q8WA 3U2QA 1QRSA 1U0BB 1XTPA 1IAVA 1L5KA 1EWTA 4MVJM 4GPBA 1QHEA 2P8SA 3G79A 2WTNA 5CBKA 1H3FA 3M5CA 1II9A 2D2FA 4L5BA 1WY5A 2A1IA 1E6WA 3V4SA 1G3RA 1E2HA 1Z12A 1VMDA 2DQZA 1UP4A 3IO5A 3R6TA 3EYAA 3INNA 2JFVA 3L6EA 4EYGA 1SXPA 3OHSX 4JBHA 3JU3A 2I3DA 4LDQA 4L5CA 5LZ4A 2HI0A 4DFDA 4D26A 2YS7A 2VPWA 2FZLA 1IIBA 4C4ZA 1KFBB 3ER6A 3HCNA 4PX3A 2HRCA 4IHQA 3AF0A 2HT6A 1MMFB 2H54A 4BZZA 2B34A 1JHUA 1A7JA 4S0XA 4IOJA 2ZM6B 2E5WA 2RGWA 1Z82A 5ALFA 3UTDA 5IC4A 4NCNA 1C4WA 4MVXA 3A3PA 3BFKA 3D8HA 4HVTA 3NBYC 5IM5A 2HSWA 1M5TA 2XF8A 3WYNA 2YHSA 1I7LA 2ZUWA 5KX5F 3KV3O 1UWVA 1W93A 4I1OA 4TWZA 3F7TA 1CLUA 3PFWO 3VO2A 2NZ8A 2B6HA 5KYYA 2IF2A 1KGDA 4HQRA 5AW9A 4RVSA 3W6OA 2IUUA 1O9BA 3WGLA 5CD1A 4NYJR 1Y82A 3N6VA 4C0JA 3G9XA 1Y6GA 1RYHA 1V1MA 3D7SA 2V5UA 2NZ2A 3EZ2A 3D0OA 3HBFA 4OI2A 4WNAB 2OFWA 1RLUA 2QM8A 3GFBA 1YJCA 2VA9A 2IOFA 3KHKA 4EMUA 1NR7A 2VWHA 1CUJA 1AGNA 4UUMA 5A7HA 4EQZA 1JWLA 1GGEA 1TUEA 2JAOA 2ZJAA 1AV6A 3PSAA 3WL6A 4DZRA 3OHPA 4BJ1A 1Q3KA 2ZULA 3GRPA 4P4GA 5DGIA 2XNDA 5IAAA 1F0KA 4CI9A 2Y9MB 3EF3A 1ZG3A 3MQFA 1MNAA 1JEEA 1X39A 1OGJA 1G8PA 3H1BA 3IT2A 1C0KA 3O9MA 4M3NA 4RK5A 4U2KA 3AHDA 2PQMA 5AI8A 4YCSA 5A3JA 5DNYB 3G13A 3O3NB 4I1SA 4GAEA 5TS3A 5ADVA 3F73A 1GPDG 3JQPA 1WMFA 3HI4A 5DCUA 5EEGA 4Z9AA 1EAMA 5KVCA 4XQCA 3WQHA 1Z9BA 1DKLA 3ETNA 4KX3A 2O5CA 1Q2UA 4KGZA 1OBCA 5LKRA 3TIXB 4CL8A 1MFZA 2KM1A 4MUEA 1VCNA 2A1UA 2NOAA 4Q0MA 4KI0A 1TPZA 2Z43A 5GOZA 4B32A 4U6QA 2IBMA 3FF1A 3T94A 1BWQA 1QCCA 2VXYA 4QASA 3WK5A 3F7OA 4ZI7A 4IW3B 1JRLA 1QB7A 3OFKA 4QYSA 1OSNA 4RD4A 4W4TA 3ADDA 3RVKA 2H65A 3EGVA 2F9LA 3W2GA 5CCBA 1ZMXA 5GJCA 2NV6A 3W5HA 2W6JA 1WKCA 3N8KA 3WC4A 1NZJA 4FFSA 3K1AA 3JQ7A 3DZCA 1BC5A 3OZCA 2A8YA 2VH1A 2IA5A 2P6NA 3I9JA 2QBYB 1U5CA 5AUPB 2WWHA 4BFTA 4CM1A 4AROA 4XFKA 2Y4NA 2C8VA 1BXGA 1HSOA 2XD9A 2BSAA 2WSSA 4N5NA 5REQB 3RS9A 3TLGB 3WIBA 3MCVA 4EX7A 3ACBA 2QIPA 1D3AA 2X9NA 3BZBA 4I4LA 4PFSA 5G3YA 3UW1A 5JBNA 5L95A 2BSQA 1LK7A 3DFUA 5GGXA 1A72A 1JSXA 1XKXA 1QHFA 1V6SA 3BXPA 2RARA 4I6JA 4IUBS 2C07A 1VBMA 2ZT7A 5TMEA 4B3HA 2D5AA 3EQ9A 4EATA 1PYOA 3PFCA 2BH2A 4EFNA 3W8NA 4KSYA 4HNSA 5CITA 5HQ3B 1KDTA 4F71A 1MRSA 1GTJ1 4XVQA 4ODIA 2C98A 1N9GB 2MINB 1N1EA 2BFPA 1TF5A 4PG7A 5EP3A 4CGYA 2QKYA 4QX6A 4WEOA 4NZYA 1IB0A 2HDHA 4HDSA 1SZCA 2I3BA 3EC1A 4P7KA 1QTIA 2F8LA 3ME5A 1NBIA 1ETUA 4C7MA 1C7EA 1P17A 1NL3A 1PVDA 1QYRA 1REQB 1V8BA 2P1RA 2VYFA 4UAJA 5EIAA 3JQAD 3AO0B 5IKOA 1ZZEA 4LJ5A 4BE7B 3AF1A 4OHRA 2EFCB 3OD1A 2HAEA 3GV0A 5AI5A 3JAWA 4G9GA 4O2BB 5JC1A 2EG5A 3I9V6 1P44A 1UINA 4C3UA 4RK0A 1JDZA 1OXTA 2FPPA 2ID7A 2OMEA 2PGDA 1ESCA 4MRRA 3PIIA 4MGIR 4S3MA 5CNKA 5AWFC 3K0SA 2VSXA 1N75A 5K8IA 3W3AH 1RKUA 1ZGBA 2ZJOA 3H65A 6REQB 2X8JB 4AP6A 3BK1A 4RK1A 4PC7A 1JAHA 3F3MA 1SBCA 4D98A 4P3NA 1LPSA 4MNTA 1HEUA 1QTNA 1U0TA 2NSLA 4X0EA 1U11A 4OYYA 4X8OA 3UN1A 4ABYA 4J1SA 2I4MA 5DYTA 3AP1A 2WAMA 4MVWA 3SMVA 4DJTA 2A2ZA 1GLNA 1ADBA 4QBHA 2JIZD 1F0PA 3UMCA 3KQYA 4QU9A 5TQJA 3WICA 3EA5A 4X90A 1OLSA 5FCDA 4CG1A 1M73E 4EGQA 1C3EA 5JXIA 2NP6A 4AJNA 1M2OA 1UMKA 2W6CX 1CZRA 4GC5A 4DUPA 1BWRA 1JSCA 1FLAA 5CT6A 3DOHA 4B8YA 4DBVO 2NYVA 3QLEA 3MS7A 1G8FA 2X1LA 3ZEIA 2V6FA 3RFTA 3A7EA 3LS2A 1MD9A 4LDNA 3L6BA 4OFWA 5HF9A 3CG4A 1XUOA 2EOAA 4DIEA 2PKWA 2R25B 3JQGA 4MVJA 4XH9B 1KPHA 3L1HA 4DR7B 1M8JA 2RKOA 4R8VA 1OD6A 1XD8A 2XRZA 1R66A 1R8YA 4W8HA 3EBOA 1EJ6A 5FI5A 1JGTA 3FMGA 4K0KB 4UTXA 4XUDA 5F2EA 4DLTA 2VTBA 1GRVA 1K0UA 2PX0A 3M6XA 5EMHA 4PONA 4DEYA 2FK8A 3WDSA 4YB8A 3O4IA 1UJBA 3E9EA 3MJVA 3SKVA 3LPNA 4D5GA 2LR0A 4B6OA 2XNJA 2Q3HA 1EB9A 1J70A 4G97A 4JQOA 4CQMB 1E3MA 2REOA 3MQ4A 2OC4A 3VUFA 2WM3A 4FJ0A 3UEOA 3G85A 4OK3A 3ZDEA 4F97A 1O9HA 1R0YA 2GTPA 2ZCVA 4I9GA 3RADC 3ITKA 1TM5E 4NDNE 4WLVA 5IAGA 4FKMA 4F2HA 2OC9A 4D9EA 1WCYA 5CA0A 2PH3A 2QRJA 5AJUA 2GAFA 1URPA 3DBIA 3GCZA 1BG6A 2O07A 2E9SA 3Q5GA 2R6AA 4O4LA 3WSTA 4ZZ1A 3KC2A 4DMUB 3VDQA 5FL7D 4WW0A 2CHUA 1PV2A 4HGQA 1QS0A 3STUA 4KVZA 1YS7A 3I9OA 2PV7A 3VZDA 2DTXA 2PKYX 4TXLA 2NUAB 1F2VA 3RC8A 5FFMA 5B5SA 5BQPA 2M2IA 1J9ZA 3X2SA 1K8ZB 3CXUA 5DHQA 3UWOA 1NAHA 1EQAA 4O4IA 3MWEA 1G2IA 1WEKA 2DBVO 2EKBA 4RSGA 1APBA 2FPKA 3HWRA 5ILGA 4DA0A 3O82A 3WLKX 5A0VA 3A4IA 4M37A 4UW9A 1MG0A 1B8NA 2YWXA 1G17A 2RHLA 3ET4A 2NSJA 2DWPA 3PEUA 1E6LA 4NYIQ 4EAQA 2H1OA 1AHHA 1Y9ZA 2GK7A 2EP8A 5E3JA 4CMCA 3RRZA 4BO0A 3RS5A 3LHDA 1E3LA 1WDWB 3ZLTA 4GW3A 1U3CA 1CY1A 3CF4G 4MUXA 1GYRA 1J2YA 1LNZA 1CQZA 1U04A 2ZYIA 4RE6A 4AMGA 3D5EA 2BFEB 3AUXA 4MQBA 2DC1A 2E48A 4P34A 5ESXA 1H1DA 1R88A 1ZZGA 5JS8A 2R66A 3G7SA 3P8ZA 4YO8A 1O94D 2KHZA 3JWEA 3SHFA 4X1KB 4LY9A 5KOHB 5IP5A 2MSDB 5JDCC 2UVQA 1E32A 2QT0A 3QEJA 1F4LA 4P80A 1BDJA 3PNLA 3L7CA 5K4HA 1G8GA 1FNSA 1X86B 3HXMA 4DIOA 2ZZNA 1V9LA 1Y8ZA 1V7PC 1ISJA 5FB3A 2Q5FA 3OX4A 2B94A 3G2PA 1JXOA 1I3LA 5TARA 5B2FA 5FTNA 3SG0A 2WILA 4TZ6A 3KJEA 1IM8A 2UVDA 5TXGA 3UJBA 3ACDA 5BV2P 4WNYA 4ZI2A 1L7NA 2BGMA 3UKOA 4NX2A 1SCDA 4EB6A 1ZYUA 4R1QA 1U9IC 1WF6A 2GXQA 1XNJA 4CFYA 3A2NA 1SM4A 1XCJA 1XKLA 2UZ1B 3NTVA 4A8JC 2ZAOA 3U4DA 2QN9A 1KEEB 3F5SA 2ZWOA 1SVSA 5JHGB 2GZSA 3MHPA 4G0VA 3T5GA 5DLDA 4JQSA 3USES 4N0EA 2QI9C 3KX2A 2QPTA 5DK6A 1KP2A 4ZI3A 1DG3A 1Q19A 1RYNA 3IT3A 2C7VA 2GRUA 4I99A 1AO3A 3L7IA 5ERXA 3JWHA 4MI3A 3PQ6A 4FLEA 3VC7A 3EFBA 2XWQA 5L40A 3EVAA 2IHUA 5YASA 2B2NA 3I05A 3D81A 4ZDJA 1B6TA 6PFKA 5JDIA 4PG5A 4JB0A 1VLZA 3ZU6A 1JEJA 1YO6A 2JPDA 2QLTA 4GLBA 4AMVA 4B47A 4YQFA 4YMVA 3U4MA 1SC6A 4HX9A 4OXXA 4DNXA 1CJTC 3N87A 1SB9A 1NJ5A 3THYA 1B00A 1P1JA 5C8VA 4E6EA 1B0ZA 2H2IA 5AW6A 5JYEA 1Z4IA 3I5AA 3IP1A 3ZXSA 2RC5A 3SX2A 4B3RB 2QUBA 4YRBA 3RYHA 2OWEA 4IX1A 1DKQA 3KZNA 1F3OA 4JC0A 3KPUA 4E2YA 3AGPA 2WPDA 2RH4A 3EULA 2X6QA 1ADYA 1RWPA 1JQKA 4TQUS 2C54A 4KXUA 1QPZA 5AOVA 3LQQA 3WRYA 2Q9AA 4MDYA 1CY4A 1M72A 5HFNA 4EHKA 4ZJUA 1GSAA 2BEUB 2PU7A 3OJXA 4BVFA 3ETHA 4F9EA 1P80A 2JI8A 4YN3A 4KQMA 3FBGA 2Z1NA 8AT1A 1N2CE 2FSSA 1R4ZA 1JKXA 1K3UB 2YJ4A 1DTSA 1DRKA 4JHXA 3JR3A 1JEQA 1EQ2A 3L6CA 2QOEA 2O06A 4LZNA 2EGUA 3BHNA 1C7JA 1PL7A 1FUKA 4KQHA 4MI1A 3FLBA 3PI7A 3SCZA 3WYDA 2VT3A 4H18A 1DUIA 1Q0SA 2RAFA 4PIPA 1HT1E 1Y80A 4JU8A 1JDTA 1LLUA 1SBTA 1G3UA 3LY8A 4YMIA 2JLCA 3AC0A 3IT1A 1X70A 1O5TA 1JH8A 2BRUA 3K0AA 2F2TA 3QVVA 4BDTA 1YSCA 3LY7A 1V7ZA 2ZRDA 2DFKB 3SHOA 1P1IA 2H2AA 2I4OA 3L0YA 2LTAA 4DV3B 3QXGA 3BILA 3QVGA 1RRCA 1TGVA 1ZI8A 3K70B 4MI9A 2JGDA 1WXGA 5EUBA 4DILA 1R6DA 3TQFA 3ANLA 1G3IA 1YS9A 2J08A 2ZIFA 3K32A 3T9CA 1ES9A 1S3SA 2Q2NA 4DNOA 2IU3A 4DTCA 1LBHA 3HJFA 3FFWA 2O7VA 2BSXA 1KQPA 2DUNA 2QQGA 4MR8B 4UOEA 3IALA 2UYCA 2AC2A 4EELA 4EZEA 8MHTA 3RHFA 2XCUA 1QIKA 3N2LA 1HE4A 5A4FS 3THXA 1RHMA 2NVUB 2R1VA 2VQEB 1QP8A 1Z7EA 4X3OA 1YCFA 3G3EA 3RASA 3LV8A 1VL2A 4I4TB 4OF4A 4MOWA 4MRMB 1VQ1A 2CEAA 3ZDFA 4U0JA 4CR7A 1AG9A 4DCCA 2ZS9A 1EGQA 3QKSA 3K15A 4HNUA 2ZWIA 3VPCA 4DV1B 1K7SN 1P3DA 5DZSA 2Q0HA 3DFMA 3WO0A 5CFPA 2UUBB 5B58C 5AUQA 2EJTA 4Z4QA 3H2ZA 4UMEA 1KO1A 5BQ5A 3O21A 2IX3A 2RGXA 1J21A 1K8XB 2P4EA 5DM4A 4TTPA 3RC2A 5CLLA 2YVKA 1WF3A 1OZHA 1MGPA 1VFPA 1CRLA 1NNI1 2I6FA 3L0OA 4WXMA 3UAZA 4NXNB 3HA3A 2O59A 5J5CA 3ETDA 2B37A 1QQ6A 3MWFA 3ZJUA 2JGKA 2WJ3A 1LBTA 4JT4A 4OQQA 4MVJH 1YL6A 1PSWA 3M6MD 5B1SA 1EVYA 2GHTA 5JFTA 1MVLA 1ZOIA 1QXSA 2B5VA 2GFIA 3OAAD 3TB6A 2YY7A 3CUWA 5AW8A 5KYTA 4E30A 1G66A 4DV4B 2MYNA 2C29D 2ATXA 3B5IA 5ADHA 3ZQKA 4O08A 4WCFC 1GN8A 2GGSA 3OEED 1WB9A 3D3JA 1W5EA 4CHGA 5TPZD 2C4NA 2FFBA 1IK4A 4HOYA 3RLFA 5C5CA 1K08A 4CT5A 1KMHB 2YASA 1IY1A 3DL0A 3F4LA 4GKAA 4CBVA 3U62A 1T1SA 3PIRA 5CAEB 1QONA 3FI9A 4FGLA 4HX2A 3VR6A 4V0SA 5J47A 1PR1A 4N40A 4B2LA 4RNDB 3OZUA 4B3XA 3N0TA 1HQCA 3VR4D 1Z17A 3MJHA 4TYNA 3E3AA 3FOAA 4BO3A 3KQQA 1EJ0A 2WYHA 4L8FA 1PW7A 4FFWA 3II6X 2LW7A 4DIMA 3GGJA 4PLTA 1J1IA 1OXKB 1P0MA 5B12A 3ND6A 1R0WA 3N59A 4DY4A 3F7MA 1VJ1A 3I2KA 4U7GA 4BUZA 4JSYA 3GBVA 3ESCA 1I2DA 2PUWA 3V97A 5LKAA 1SUFA 3K4HA 1II0A 1NULA 2JFPA 1T6YA 1U3VA 2O6LA 3BORA 3FLMA 4LJSA 4CKBB 1XLTA 1XBTA 1ZLXA 4D6PA 3A9CA 1V1RA 2JLYA 3AILA 2UV8A 4FLMA 4YRPA 2VHYA 4KQ1A 5JFGA 2C9DA 2HMWA 2PR7A 5D86A 3RSQA 3TXYA 4CE6A 2E5FA 4F5DA 2PR2A 4XQGA 1MKYA 1RAAA 3EXG1 2XB8A 1ZFNA 4YDQA 3SVTA 2WTUA 5FI1B 2MSCB 3K96A 2YC2C 2CSUA 3ADPA 4BMNA 1M7BA 3LY5A 4RSHA 2Z4TA 3WOVA 4YRSA 4EB0A 1N25A 3STYA 1PNOA 2D5IA 4LMPA 2C2HA 2FOXA 4I9HA 1W2HA 3E8MA 3DAHA 1BVYF 4OQLA 2IUYA 3WHIA 5BWCA 2JI4A 1N7JA 4IIBA 2WFLA 3K1TA 5A5DA 1PVOA 3OOWA 3FI0A 4CKXA 2IEZA 3UHAA 1M0SA 4HLQB 4BO5A 3QOWA 1EK2A 2HDWA 3NIFB 4KMSA 2C5HA 1V3UA 4X8LA 2QXTA 1A5SB 1RXYA 3AONB 1N5IA 4R16A 1I9CA 4AZ0A 4CQLA 3L7YA 2PN1A 4QSHA 4B8ZA 2WHQA 1TFRA 5IZCA 1U9ZA 4PHCA 5ELXA 3OC0A 1YA4A 2WF7A 2WZDA 2GPJA 2PH1A 2XCLA 5LMCA 5IRCD 2J0EA 3ND8A 4RJ2A 1NI4A 4OB8A 1A4RA 3D7NA 3KIPA 2H5EA 3KQWA 4M1QA 3USZA 2OCDA 3A4NA 1QK4