3QEJA

S74e-dck mutant in complex with udp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
242
structure length
234
Chain Sequence
TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVELTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Deoxycytidine kinase
publication title Post-translational phosphorylation of serine 74 of human deoxycytidine kinase favors the enzyme adopting the open conformation making it competent for nucleoside binding and release.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 234
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qejA00
2F3TA 1XZPA 2PJRA 1W4CA 2OBLA 1I4TD 3WMFA 3U44B 1TF7A 2JDIA 4KVGA 1QHNA 3MGCA 2QORA 4OQMA 4JMPA 3VKWA 3UG6A 3BH0A 4TYPA 2W2XA 5EXPA 3ZYCA 4CRWB 3GLHB 4ARZB 2HT1A 1FQJA 3NKVA 1E0KA 3ZZ0A 3O47A 2NZJA 2ZSFA 2QL6A 4MYCA 4RFSA 4W9MC 1KI7A 1TQDA 2IF0A 5GADl 5JWRA 3IDQA 2PCLA 2PCJA 4JBWA 4LOAA 4MRVA 2F55A 3SS8A 3D3QA 1HV8A 2ZRDA 3UXMA 1W47A 3DHWC 4NYMQ 2WSMA 2IL1A 3BE4A 4TZ6A 1G8GA 2QP4A 3CF0A 4BEBA 3DDCA 2RGCA 3LBHA 2IYSA 3NDBB 1GUAA 4OK5A 1G5RA 3FKSD 1TMKA 5D3QA 2ZE7A 3GLFA 5FPYA 4QRHA 1DS6A 1Z0DA 4Q4HA 2F9MA 5SZKB 1P61B 1EFTA 2GK6A 1II9A 2F7SA 1Z28A 4DVGA 4OQXA 4A0HA 1IN7A 3K70D 4FIDA 4MDEA 1ZNWA 1GFIA 4OHVA 2XNSA 5B64A 1G8FA 2RHMA 3U7HB 2FFBA 2IHYA 1KJWA 4QL3A 2GESA 4TMKA 3CRW1 1FX0A 2AFIE 4NPHA 5FUXA 4BE7B 4DB2A 4N1AA 4KBGA 3LXXA 4FMBB 3TBKA 2PZEA 3EPJA 1AQYA 4NYMR 1E9BA 4IVQA 3Q72A 3H86A 4Z8YA 4Q7JB 2ZE6A 1JJ7A 2OESA 3KXLA 2QMHA 1GAJA 1R5NA 1VCMA 2G6BA 5SZJA 3CPHA 1TEXA 1WF3A 2HF8A 1VIYA 1G6OA 3U61B 3AUXA 2EWVA 1VCNA 4B2LA 3WBJA 1W7AA 5BQ5A 4HDQB 1VG0B 3RS0A 3TVTA 1RJ9B 2XTZA 5C2JB 1ZINA 4UJ3A 4A2QA 4PHGA 3GJ0A 2ERYA 5JCPA 3QBVA 4Q5IA 1OFHA 2V6JA 1OHHD 2ZJAA 1FL9A 4Q48A 1U8YA 3GJ5A 1J8MF 2OCYC 1VPLA 621PA 3EZ9A 4MKGA 5FL3A 3ZS9A 3U4QB 3THYB 4UNQA 4C2UA 4LBZA 2AL7A 5J40A 1OE0A 4HAZA 5JS7A 3W8NA 4A82A 1NY6A 2Q9CA 1KSFX 1KI8A 4KLZA 2EFEB 3OEEA 4Q1AA 8OHMA 2JLQA 4UXHA 1FUKA 3PV0A 2GF0A 4TL9A 2HUPA 3QF4A 4MRSA 5CDFE 1KMQA 2KWIA 3HU2A 1K5DA 1N6IA 4F4IA 4MGYR 4URWR 1G20E 4A0GA 1GWNA 4PSKA 1OH5A 2HYDA 3ICEA 4FMDB 3E2IA 4YONB 1N6NA 1CR4A 3Q9LA 1F6BA 2AR7A 1OW3B 3LNCA 5AJWA 1OH6A 1GTVA 3TGPA 4LPKA 1J8YF 4KBFA 4TTPA 5GJCA 2FGKA 2O5VA 3GLIB 3K0CC 1BYIA 4B3GA 2QBYB 2C9CA 2C03A 1U90A 3QG1A 4JLNA 3RS3A 4DLVA 1H65A 3AVOA 1M7GA 2PZFA 1UBEA 1UF9A 4DSOA 1SXJB 2G77B 2JLYA 4B33A 4NYIQ 2V6IA 4LBYA 3SQWA 3JVUA 1KKLA 5B2ZA 5L3SB 2QAGB 5HKKA 1NL3A 1ZVQA 1NBMD 1S9HA 4A15A 4N0DA 5FBQB 2DBYA 5TY0A 2J0QA 1E2EA 1Z2AA 3IGFA 3K0AA 3KJHA 4I1SA 4TYQA 3OF5A 2OILA 3W6PA 3X2SA 3WNBA 3WY9A 4BASA 4H9GA 4QBHA 3LFUA 1DAGA 1Z6TA 1DPFA 1RW4A 1P2TA 1XF9A 4MYTA 4NH0A 4UXJA 5CIWA 4ZCLA 2VF7A 2Q21A 4DDTA 4AKIA 2ZRHA 4KYUA 2XSZD 4MRRA 4ZDJA 1P62B 2NPFA 3X1YA 4NDZA 4Q4AB 4B43A 4JLVA 2LKCA 3KL4A 4JZKA 4KFRA 3IO5A 2CVHA 1ZM2A 2WWFA 2HJVA 2REOA 2GZAA 2ANCA 3HU3A 3EZ6A 2H92A 3BFVA 3QXHA 1LW7A 2BKEA 2DWPA 1U0LA 4LGMA 5JZVA 1A2KC 2BEJA 3E5HA 3T35A 2IHBA 1XXHE 2VP0A 4JLOA 2V3CC 2DB3A 2O8EA 5JHHB 3RC3A 4YXWA 1W0KA 4JVSB 2GA8A 1NSTA 3AH8A 3IUYA 4LX0A 3GD7A 1OIWA 3K09A 1XEXA 3RRNA 1NLFA 3LBIA 4PR0A 4XSGA 4I1UA 3GFPA 1NVXQ 1K8RA 1G5TA 2IYUA 1TUEA 2G83A 3VTKA 1NVVQ 3TNFA 2WPDA 1QHHA 4OI1A 1Q0UA 4C3ZA 2GEUA 5FBWB 1GSIA 3CNNA 1Q57A 1PV4A 3WXMA 3H2YA 4OI0A 3TE6A 3K70C 4LYHA 4U5XA 3R9XA 2FV8A 3ZLJA 4LJ5A 4FW9A 1Q20A 2AFHE 2FE4A 2OG2A 2JLSA 4BLRA 3I5YA 5AUNB 5J4HA 4RFSB 4ABYA 1OIXA 5AJZA 4F92B 2AHOA 3RS5A 2FFQA 2CL6X 4EPRA 1TU3A 3LX5A 3SYNA 1Z0IA 3E1SA 3FOZA 3KXKA 1AKYA 1D5CA 4QHYA 2VHJA 5FOTA 3D31A 4D4KA 3OIUA 3B1YA 1OPXA 4AWXA 3N5CA 3W3ZB 4PZZA 4V0NA 3THXB 4IFBA 1G7TA 4DUGA 2A78A 1JI0A 1KMHA 4FCTA 1ZCBA 4JT4A 2ATXA 3GLFB 4BLQA 1HUQA 2VHCA 2V8OA 4KU4A 4Q4HB 2IYVA 3O8DA 5BYKA 1E2KA 3T1QA 3LQRA 1JQLB 3IKJA 4CVNA 1Q1QA 2GJSA 1GNPA 2BWJA 2XXAA 4XWKA 3QKSA 2ZITA 3DL0A 1MOZA 5IDVA 1M7BA 3LLMA 2OBNA 1T8UA 1ETUA 1M1YE 1YVDA 3CH5A 4HLUC 4JVLA 2F9LA 1L2TA 3U7FB 2G1JA 4O25A 1FX0B 3DEFA 5J4KA 5KNDA 4TQUS 2D4HA 1N6PA 2ORVA 1GVNB 2QG6A 3WMEA 4JT2A 3TKLA 4MITA 2PJZA 3SOPA 3ZVNA 3FMIA 2NPIA 3EZ2A 4AKGA 5AUQA 3T61A 3FVQA 4G5QA 2WM9B 3OEHA 1G7SA 2MSDB 4ZPXA 5A4JA 3B2EA 1W1WA 3GJXC 2ZJBA 1OFUX 1G64A 3ND9A 1AN0A 1LF5A 3PEYA 5EE3A 2ZE5A 4OI2A 1AGPA 4Q03A 1H8HD 1E0JA 4QKQA 3B6EA 5KDDA 3EA5A 4PO9A 4G5SA 1NN5A 2BC9A 3S1AA 1T9HA 2FZ4A 5JMTA 4P31A 4LHXA 1JBKA 4I4LA 5TXGA 4KO8A 4C0QC 1N6KA 4RD0A 1IQPA 2E9SA 2W00A 3P20A 2G3YA 4M9ZA 3L0PA 1T3LA 1XFAA 3B1VA 2UKDA 4GT1A 1DE0A 4JVNA 4Q1DA 1XMJA 4I1OA 4NL4H 1WBBA 1E2HA 5H70A 2JAQA 3NEJA 2GJ8A 4UKDA 3KFVA 1X8KA 2VA8A 2GVDC 3V00A 1XTKA 4CT4B 1VG8A 3RC8A 3H84A 1D9ZA 1VYVA 3I72A 5CB6A 2Z6VA 1YE8A 4OHZA 4ZDWA 3QF4B 4JLJA 2A5YB 4EAQA 5FTMA 1OKKA 4JJKA 1KO7A 1COWD 3ASYA 3EC2A 1IXSB 3BK7A 1DAKA 2FWRA 2PLRA 3F8TA 4TTQA 5J47A 3NTUA 3V9PA 1MABA 1EWRA 5DN6D 4KLNA 3OFND 1ZNZA 5LPNA 2IYZA 1P7CA 2ZVPX 1QHYA 4BECA 3A4NA 2GXQA 2OSBA 5DLQC 2IA5A 4LJ4A 3PIRA 4DCVA 4RD1A 2F1JA 2XJ4A 3EARA 2NGRA 2R44A 2FU5C 2QUZA 1P60A 2GHIA 2VHUA 4FN5A 4PC7A 3EASA 4CYMA 2RGNC 4E09A 3BERA 1KI2A 3MRSA 4LV6A 3LW8A 2IWRA 3FHTA 1QHSA 2C96A 3OE7D 5DYIA 1I2MA 5L3QA 3T12A 3MWKA 2VTKA 2D7DA 3CWZA 4XJXA 3H1TA 1YJ5A 4Q66C 2J45A 4MYHA 2RGGA 2FEOA 2Q6TA 3D6TB 4BGDA 3FFBA 1W5TA 3K0AB 4PPNA 4C0JA 2ODEA 2PEYA 1U2RA 1QBKC 4L16A 3M1IA 4LHZA 5HR5A 3P27A 2RHDA 2FSIA 3DPUA 2J59A 2A2ZA 1GM5A 4C0KA 2NTYC 3ZH9B 3QENA 1J99A 2ZYVX 4TQ9A 1TUIA 1TPZA 1XD2B 4K46A 1ZM7A 5EE1A 2WHXA 1S8FA 4LJAA 3EW9A 1ZD9A 4ZO4A 3U3OA 3WRXC 1HQCA 2ODNA 1XPUA 3KJEA 4KV9A 2YVUA 3QUSA 3J81k 1VCIA 4LJ9A 3MJHA 1R10A 4N0EA 3DOEA 4TL7A 3MG9A 1W4RA 3A1UA 1G8YA 2XB2A 2O8EB 1Z8FA 2IUTA 1GILA 4PC2A 4ASUD 1E0AA 1YZGA 4XVQA 3WBKA 1XEXB 3THOA 5AR1A 3QVUA 1ZP6A 4B44A 5DHAA 5EXXA 4BFXA 2WSSD 4BEJA 4ESVA 4QGGA 2BJVA 4IKEA 4IW3B 5GJBA 2IYLD 1DG3A 2YOHA 3OZXA 1D2MA 4M1WA 2HF9A 1PLLA 3AGPA 4CGZA 2EFCB 3L0OA 5FUVA 2NMVA 3U6BA 1TL7C 5C4GB 1G4AE 4TZ0A 3QXJA 3PUXA 4EIWA 1RYFA 1U8AA 2D2FA 3PUVA 4W5WA 4RD6A 3W5IA 3KJGA 1K6MA 5FBVB 2KJQA 4ZV4A 2JASA 3LWNA 2EW1A 4RD2A 5JHGB 1GRQA 2ZPTX 3K53A 3U5ZB 2DWQA 1ZAKA 1AM4D 2P0EA 3EIEA 2YC2C 4YMUA 3MD0A 4F4JA 2YZ2A 2PMDA 3K0EA 2ZM5A 4ERNA 3AVVA 3W5JA 4OKSA 4B71A 1N0WA 1ZW6A 2CDNA 4IVRA 2O8DA 2ZJOA 1KMHB 2IXFA 1E9EA 1JR3E 3EZFA 4US1R 4P4TA 2N1BA 1YZNA 4XWOA 5JRZA 4QGFA 2RMKA 3E70C 1A7JA 3IEUA 4G5RA 4GOXA 2OM2A 2QE7D 4HAWA 4Q9IA 4E22A 1FW6A 5CM9C 2JLZA 2YV5A 5LD2B 3CBQA 1P2SA 4DZZA 2V1XA 1JXOA 3GPLA 5HCNA 2R6AA 3QIAA 2Q9BA 3QKSB 2V7QA 4QBFA 4BPBA 1JEEA 4QC2A 2J5XA 4LHVA 3IIJA 3P4XA 1N0UA 5CJ2A 4BZXA 3HPRA 5KO2A 3A1WA 1OXXK 2J0UB 3EPKA 4TYNA 2FGJA 1CJUC 4IDQA 4K81B 2ZRFA 5FTJA 2W0MA 3P26A 1TQ6A 1UPTA 4CEJA 3THYA 4QOSA 2AWNA 2R8RA 1A4RA 5FOXA 1KDPA 3IIMA 4NYJR 1IJFA 4TT3D 3VAAA 2EU8A 3GFTA 4PQYA 1DELA 1YRAA 5FFMA 1YRBA 2VEDA 4OJKA 1G4UR 1FP7A 2EWWA 1ZMXA 4QFMA 4QM6A 2ZR7A 2AWOA 1JR6A 4NCHA 2GJKA 4QNMA 5DI3B 3W9YA 2OZEA 3DZ8A 3S1AB 2UVQA 2C9OA 5EXTA 3I61A 4NBSA 2ZVQX 4KFTA 1NIJA 3BRWD 2OCPA 2O0HA 2ZREA 4WIAA 2OLKA 5EE0A 4R9UC 4U00A 4TLBA 2EFHB 2QSZA 3U3JA 4IFEA 1TU4A 3ZIAA 1Z07A 2QROA 2QPTA 3AUYA 2W6IA 3BAFA 4C9BA 5B58C 1F3OA 1AK2A 4LRWA 2IX3A 3ZD6A 2J0VA 5FR1A 1HT2E 3TR5A 1JPNA 2G9NA 2WKRA 2ZRKA 2G1KA 1SXJA 3IQXA 5TB5A 3SYKA 4AY2A 1P75A 5L3SA 2Q0HA 2H7VA 2F43B 3JZAA 3RS2A 2QAGA 1XTSA 3IQWA 3LD9A 1Z5ZA 3GJ4A 3KKMA 4V0OA 4E5UA 3BXZA 2ZYWX 4PHFA 1ZC3A 4HUQB 3IBYA 2P65A 3KKOA 4R7ZA 1E0SA 2ECKA 3WYGA 2J0SA 1P73A 1MABB 1N0VC 1PUJA 3MWLA 5DYGA 4D26A 1IHUA 1T3SA 4NONA 3CM0A 2HXSA 5JSZB 1EWQA 4QHSA 4DDUA 2XGJA 2VSOA 1MO3A 5AUPB 2WAYA 4IEEA 4NHOA 3ADKA 2F1RA 2IYQA 3AGQA 1U8ZA 3NHAA 4POAA 4TMTA 221PA 4XOIA 3NDPA 1S0UA 3BFKA 2QTFA 1FTNA 121PA 1EK0A 1UBGA 2BHRA 2ONKA 2HEIA 1TEVA 2JJ2A 4PAMA 5DO9A 4YMTA 5KSOA 4LJ8A 2BM1A 4MH0R 5L3QB 2W6JA 1P2UA 3X1ZA 5GJVC 2Z4SA 2VHTA 4RY2A 3QF7A 3AVTA 2A5DA 2YJTD 3TUIC 5C4MA 3GLIE 4WBSA 2LCFA 1KI4A 2SHKA 2PBRA 2VP6A 1E2JA 2WIAA 2ZRJA 4LC1A 5C46F 3RYTC 1F60A 4V0MA 2HYIC 3R20A 4NCJA 3TH5A 4BFTA 4KXFB 2ZE8A 3LRPA 3TW8B 3AVWA 4ZDKA 2AD1A 1GKYA 4R71A 2I1VB 3CZQA 2QQ0A 3CONA 4WXPA 1KSJA 3PCRB 3L2OB 2QT0A 2HCBA 4LCBA 3VR6A 3QKTA 1K5GA 4B3DA 2HCJB 4KODA 3V4FA 2R62A 3LQQA 4W5JA 1MO4A 1M34E 4GP6A 2XJ9A 3SE0A 5FUWA 1T4GA 4H1UA 2GAAA 4M9XA 1N25A 1AS0A 3NHBA 2VO1A 4M1OA 1IY0A 3OHMA 4HAYA 3C5CA 1CBUA 1CLUA 1KJZA 4DLUA 4FWTA 4L15A 3THXA 2Z4RA 3Q5DA 2H17A 1FOEB 5GVRA 4TMXA 2WJVA 3FHCB 3AF1A 4AKHA 2LWIA 3KJIA 3UATA 2OAQ1 2W0SA 4Q19A 1S1CA 4IOJA 1U99A 5DSZA 1XD8A 2YKGA 3HYRA 1X8JA 3M0EA 3AKDA 1EESA 1US8A 4YC7A 1R7RA 1ANKA 2VH5R 2IWHA 2OT3B 2CL0X 3B1XA 2QRNA 1NN0A 1Z0JA 2FOLA 4MGIR 4TTRA 4M1KA 4URYR 1BH2A 2IC5A 2QP9X 4FI3C 1XMSA 3LAWA 3OIVA 4L9WA 1OH8A 4O0MA 4DCSA 3ZVMA 3I5XA 4UNSA 5G41A 1XB2A 2J7PA 3BOSA 1BYUA 1GKIA 3A36A 5F3WB 4EJSC 2X8AA 1X3SA 1IM2A 2Z43A 2O8DB 2ZUBA 1TQ2A 2ONJA 5DIFA 4EFLA 1WP9A 3HWSA 4QJ4A 2BCGY 3BD9A 5JLJA 4AC9A 1N5IA 4P3YA 4BUJA 1JQJC 1SVSA 4JBYA 4RJLA 4IDOA 3VFDA 4QBGB 3SEAA 5IRCD 2DY1A 4BFZA 4GI7A 1JAIA 4FWIB 3K9GA 5FBLB 2Z0MA 1TF2A 1XBTA 2BM0A 3LLUA 1SKYE 3VR3A 3V4RA 1E1QA 2FN4A 2H16A 3PITA 2BOVA 3GLFE 2B7CA 3BGWA 3LW7A 1LNZA 2FSGA 2QT1A 3I32A 4HLDA 4PO8A 4DSNA 4CEJB 1NY5A 2WAXA 3FKQA 2WBLC 3VNVA 3K0CA 3GLGB 4B74A 5AWFC 2R6GA 2GAOA 1XPOA 4M9SA 2DFLA 3GCGA 2QPOA 4QJ3A 4ZCIA 4WVFA 5HE9A 2GKSA 1AZSC 1KDOA 2AXPA 3FB4A 2XTMA 4GOJA 4Z54A 1HE1C 3T1OA 2G0NA 2JLWA 2CNWD 1OIVA 4KSCA 1SKQA 4B2PA 1W36D 4MUAA 1CJKC 4UNRA 4X8MA 2CK3A 3C16C 2PMKA 5SZIA 2FF7A 3AM1A 3B7GA 1LB1B 4B76A 5KPJA 1II8A 4JJZA 3EWSA 2ZI5A 1KOFA 4ACAA 1QRAA 1W49A 4PQRA 4Z51A 2FPKA 4HEJA 3R7WA 3SFZA 5HZKA 1FQKA 2AX4A 1GP2A 4OBEA 1M7HA 1IN4A 1NF3A 1T3HA 2GBLC 4PC6A 5AJYA 1UKVY 5KU1A 1RZ3A 2QI9C 1QHGA 3PFIA 2JJ1D 3QQ5A 4M22A 2Q3FA 3SHWA 1ZUIA 4A1FA 4DT1B 4J0QA 3FYHA 4B32A 4TLDA 1E3MA 821PA 4TMZA 1PLKA 1PJRA 1F48A 3CF2A 4DBLC 2FFAA 4LWZA 1D8TA 2WOOA 5KNCA 1XP8A 2YWFA 1OXTA 2D62A 4RZUA 4QXAA 3G82C 1XJQA 1RFLA 3L43A 4PC3A 4ACBA 2CHVA 1KO1A 1WXQA 2REBA 1FMLA 5FPKA 1C1YA 1CS4C 2ZXUA 1NIPA 2J87A 2VL7A 2BBOA 2EYQA 3WP0A 4NCIA 3AVYA 3FKSA 3U7EB 5D3MB 3GEEA 1XJ0A 1LVGA 4P4UA 1R6BX 1H8ED 1XEFA 3PUYA 4AURA 3B13B 2VP4A 1VTKA 2IXEA 4LV5B 1Z0FA 3O8RA 4R98A 1CR2A 1U9IC 1XD2A 1XD9A 2C77A 3W6NA 3W8RA 4Q9KA 2QGZA 4C0HA 1CJVC 4M2LA 3DVLA 4OK3A 2OFOA 2IS2A 1NLZA 4GMDA 1A2BA 1KO4A 2DR3A 1V5WA 4QGAA 3I8XA 5E7JA 5E7IA 2WMOB 4URZR 4W5HA 2C2HA 2A9KA 2RCNA 3CUEF 2ZJYA 4XTCS 4YQFA 3QPUA 2XOKD 2GEDA 1E9SA 4ARZA 3KQUA 4H1VA 3T06B 1HT1E 2OHFA 4Z1MD 3VMFA 3U7GA 2JLVA 4V0LA 2QU8A 4Q47A 3BH7A 1XRJA 2WTUA 2GILA 3MWJA 5HZHA 5CB8A 5IK2D 1N6LA 4Q00A 3TQCA 4BFSA 3EPHA 1EFRD 2IYYA 2WJGA 2XZOA 1KNQA 2P67A 1DO0A 4WW0A 1SHKA 2ZRGA 2ZETA 1G6HA 3ETLA 3CF6R 1N5JA 2PT7A 4KAXA 4OHYA 1R5BA 2XAUA 2J3EA 3LXRA 5L3RA 3AF3A 3PQCA 3TUZC 1P9NA 4GSYA 1PZNA 2WJJA 3OESA 5TMPA 1XEWY 3CX7A 2ZS7A 3IPYA 1D9XA 1GIAA 4HLUA 2ZSEA 1NMXA 2G88A 4BLSA 3QOFA 1OHHA 4TQAA 3VR4A 2WWWA 3HJNA 5F9HA 3QVVA 5KTYA 1VYTA 3VKGA 2ZEJA 4N3NA 1Z2CA 1T5LA 3C15C 4O2LA 4Q4JA 4TSFD 3NG1A 2MSCB 4JL5A 1ZUHA 3C8UA 1PVOA 3PEWA 1P5ZB 3A1SA 3MWYW 2W2VA 5HPYB 2RGXA 4DB4A 1YZLA 2ZI6A 4Q7LA 4B73A 3AP1A 2OV2A 2BDTA 5IHPA 5P21A 2IUUA 2ZR0A 1US8B 3T34A 5FOWA 1YZTA 2BMJA 4I81A 5FTKA 5BN3A 1BS1A 3GJ3A 4CZ2A 1YQTA 2E1RA 3IBGA 4O2RA 2VSFA 2J0UA 3R8CA 1EFUA 5UKDA 4R2HA 1TX4B 1ZIPA 1ZM4A 1Z0KA 4BLTA 1T8TA 1Q3HA 4D0NA 5F2EA 4HSEA 5FI1B 3A6PC 1XCPA 3I3SR 4HAXA 2AD5A 1E94E 2XZPA 5ELXA 5E3HA 4A9AA 1Z22A 1KNXA 1JR3D 3SHFA 1Q12A 4EQ6B 521PA 3LVQE 4DIDA 3MCAA 2VP2A 1W36C 1IJEA 3PJRA 2AKAB 1S96A 1Z08A 3BH6A 4IOKA 4RSGA 1NBMA 1E9AA 4XWAA 3SZRA 1LS1A 1UEIA 3AVQA 2GK7A 4DEXA 3BWDD 3FE2A 5DI3A 1CEEA 4WA7A 4FXPA 1FTSA 5J4VA 1JB1A 1DG1G 5L3VA 1DVRA 1UEJA 2XB4A 2ORWA 2C8VA 4BFVA 4Q4LA 2A30A 2BCJQ 2ZI7A 2D2EA 1E1RD 1XZQA 3EZ7A 2XSZA 3I73A 4HB0A 2ZJ8A 1DAEA 2GXAA 1GZSA 4PPQA 2QSYA 3W6OA 5L8VA 1CIPA 1SVKA 1VYUA 4JKIA 3C14C 1CR0A 3MFYA 2WWYA 2NQ2C 4PX9A 1QG2A 5FTNA 1OV4A 3ONWA 4AIIA 2RGNA 2F43A 4MRPA 4AYXA 4MKFA 2XNDD 4P32A 1N2CE 3UWOA 3ZS8A 3I92A 2RGEA 1I4DD 1DADA 1W5SA 2ZU0C 4QG7A 4F7WA 1OF1A 2EFDB 1VECA 2IBMA 4HB3A 2IYXA 1E79D 4TYWA 3O8BA 1I4LD 4I1VA 1KJYA 1Z6XA 3NC1C 2ORIA 4QJ5A 4HUQA 1E9FA 2ZUCA 1FUUA 3FPAA 5C18A 5KSPA 1ZBDA 2QP3A 1II8B 1ZIOA 3LDAA 3R9WA 4PPFA 5JSZA 4MUBA 2CVFA 3QPVA 4A2PA 4IXNA 4DLRA 5FOVA 4FINA 1NI3A 1LY1A 2CLCX 3R7WB 4XVUA 3H0KA 1SULA 421PA 2BBSA 3AB3A 3KKPA 2FDCA 3B78A 4ESHA 1VHTA 1NLYA 1GDDA 1ZUNB 5JFGA 1CR1A 3T5DA 2PX3A 4DSTA 4HZUB 1KI9A 4NTZA 4X8OA 2XZLA 2DYKA 3LO5A 5DISB 1E9DA 5CJPA 1FP6A 2A5GA 2XEXA 2O8FB 2ZRNA 5FBRB 1G291 3SFVA 3B1WA 3CPJB 4JIMA 3CRVA 3HPQA 4DEYA 4WZBE 5B57C 4D2IA 2WJHA 4ZDIA 1QHXA 1W0JD 4CEHA 3ASZA 4IEIA 4O3MA 1U81A 3FFAA 4D0GA 1ZD8A 2ZJ5A 3T1TA 4E03A 3TSWA 1G3UA 4PQFA 2OCBA 3K70B 3Q85A 2ZUDA 1MO6A 1UKEA 3RS4A 2KSQA 3TMKA 4Q9JA 1RRGA 2CHGA 1T0JB 4B6EA 4IVPA 4URUR 5CLLA 4A8JC 1JNYA 4BFWA 1E2IA 2CCKA 4DLTA 5FL7D 2VQSA 2FSFA 4D81A 1M6NA 2XTNA 1NG9A 3EWAA 3IHWA 4M4SA 5EZ6B 4DLSA 3U2QA 2B6HA 2RKOA 2CLSA 3CX8A 3NEYA 1RRCA 2QAJA 4HDOB 5IT5A 2B21A 2ZRIA 2GWHA 4D80A 1D6JA 2DPXA 1G3IA 4TLEA 1MV5A 2ZI4A 1XNJA 3NC0C 3QSYA 3CRQA 2X2FA 2QMEA 4XD7D 1QF9A 2CJWA 1FNMA 2YWGA 3T15A 1H8HA 3GJ6A 1NN1A 4RCYA 4PAQA 1P9WA 2J41A 4LK2A 5E4FA 2JEOA 2GCPA 4RKFA 4B3CA 2JIZD 4YDSA 2O8CA 3OAAD 1CP2A 2NZ8A 1RRPA 5DH9A 1DAFA 2FX3A 2IYWA 2VPPA 5CK5A 3QEJA 4EPTA 1BMFD 3KQLA 5JJIA 3HYTA 1Z6GA 3QBTA 3C5HA 4LPSA 4D82A 2C04A 3RS7A 1T0HB 1IY2A 4HATA 4NYJQ 4C7OB 2GVZC 3GLHE 3LY5A 4WXRA 4EPWA 4Q4JB 2UZ3A 5FH9A 2O8BA 1G5PA 4P33A 2HLDD 1Q1BA 3WYAA 4C30A 4AG6A 4DLWA 1XTQA 1M2OB 5GVSA 2GETA 3G0HA 4BFYA 3N2EA 2P6RA 1VCOA 1ONBA 4RZ2A 1KY2A 1XWIA 4UNPA 3UMFA 5BWMA 4B47A 2KE5A 4M0LA 4CEIA 1ZM3A 2DWOA 2YC4C 1OJLA 3QJYA 4NU0A 1OXSC 2IS1A 1COWA 1G3QA 1GKUB 2OXRA 4P0TA 4B48A 2C95A 2WIBA 4Q7KA 2GZHA 3O8CA 5DN6A 3OFNA 1HURA 5JWOA 1CRQA 5EP1A 4OQLA 1XPRA 2C99A 2JDID 1L8QA 2F1HA 1DOAA 3ND8A 4BZPA 1BO6A 1S1MA 2ZRAA 1E2MA 3VU9A 3WMGA 3MSXA 4NZYA 2FFHA 5AK0A 1E2FA 3GLGA 3M4YA 3ZQJA 2ZYTX 1G7RA 1G19A 2ODWA 3GEHA 3NBFA 3W3AA 4IDNA 1GITA 1TF5A 2IK8A 5EE5B 3U3KA 1AA9A 5H68A 1OYYA 3ADBA 3OE7A 1XX6A 4JLAA 4MGZR 1T6NA 4CF7A 3GEIA 2WV9A 3L8YA 4AKEA 4B6FA 2C78A 2E87A 2WWHA 3RRYA 4BRUA 4LHYA 1KO5A 2V1UA 3KFXA 1E96A 4GDFA 5KOYA 2AK3A 1KAOA 5KSYA 2Q9AA 3RHFA 5BN4A 5JCZA 2ANBA 3C4JA 2IYRA 3Q5EA 4Q1FA 2R6FA 3GQBA 1V43A 1I2DA 3BJIC 3MJRA 2WWIA 2ZI3A 1P6XA 1Q21A 4UJ5A 2PH1A 3AP2A 4DT1A 2JLUA 1ELOA 2AN9A 4WZ6A 4M1TA 2X2EA 4DDWA 3DMDA 4GNKA 3RRMA 2NO9A 4IJMA 3SNHA 2A7QA 3SYLA 2YWHA 4M1MA 3CX6A 3K1JA 5TV2A 3SJBA 4DRZA 3L82B 4IRUB 3RABA 1QZXA 5JJKA 2OUKA 3MMPA 5FR2A 3U3RA 1FZQA 4C0BA 4ASUA 4JLBA 1NSFA 1WMSA 3UWKA 1J2JA 3HR8A 3K0FA 1ESMA 1MKYA 1SHZA 1E2QA 1KI1A 3ECCA 1G17A 2WSSA 5H8WA 3ZZUA 5D3MA 1NRJB 3CH4B 2KB0A 1P72A 4DHEA 4AYWA 3PEVA 4F4CA 2OAP1 2Z83A 1Q3TA 4F38A 3C7KA 1N3BA 1ZCAA 1RYHA 2V9PA 5JI2E 2ZI9A 4JLMA 1FNNA 4GMXA 2MMGA 3Q7PA 2ZRBA 1II0A 3QI2A 1KO8A 1NKSA 4TL8A 3K9HA 3KQNA 1OXUA 4B3FX 2IW3A 1Z63A 5KUTA 4V03A 2AXNA 1P3JA 1R0XA 3A8TA 3NH6A 1WB9A 1DAMA 3ZVRA 1N5KA 1X1RA 3JVVA 2DFKB 3FMPB 5CM8B 2BMDA 1F2TA 3LV8A 4L5BA 1DAHA 4A4DA 3CO5A 4C0LA 1XEWX 1OB5A 1NMZA 3AV0B 2ZSBA 5K8TA 3QPWA 2ZRMA 1VG1A 5FPSA 5EE9A 1UJ2A 2P3SA 3CNOA 4GL2A 5EJEA 4KJZA 4CDGA 4P4SB 4CEHB 4OQFA 2HDNB 1U98A 3KB2A 4D4MA 4RZ3A 3SR0A 2QTVB 1KHTA 4Q9LA 1SXJE 5HE8A 5LBIA 3RNLA 1B23P 2QAGC 3HP1A 5DHFA 2QE7A 2WWXA 3OEED 2YHSA 4AK9A 3X1XA 3A4LA 2CL7X 3Q3JB 4A2WA 2GF9A 4EKDA 4IDHA 3IEVA 5SZHB 5CYPA 2CEAA 4QNRA 1IXZA 5J5CA 4S2EA 4B2IA 3TK1A 1AIPA 4URVR 1SVIA 3RWMB 4BZQA 1DEKA 2H18A 1KZGB 1R0WA 1R4AA 3UANA 1IONA 2WKQA 5K8LA 2GCNA 2OCAA 3GJ8A 3GMTA 4KCGA 3AQ4A 5HTKA 1CF4A 4ZI2A 1KAGA 1WA5A 3RLFA 4KSBA 3EIHA 2C5LA 4NCNA 2ZAMA 4DLZA 4EJSA 2O0KA 2MSEB 4TT3A 3DM5A 5JBQA 4Q7MB 5F9FA 3HDTA 1N5LA 4LJ6A 3SJAA 1G8HA 2JLRA 1AS2A 3B9QA 2GXUA 1RVDA 1Z06A 2CJWB 3BFXA 4W7SA 1TNDA 2OLJA 4Y0VA 3REGA 4YMVA 5HKKD 2QZ4A 4HLCA 1MR3F 3L0IB 4YDHB 3B9PA 2NO7A 3WNCA 1W4BA 4RD3A 3CRMA 3RANA 2R2AA 1J7KA 3DM9B 2O8CB 3EIQA 3F3YA 3VNUA 1W2GA 5LB4A 1E2LA 2JJ8A 1A5TA 5CK4A 2V55B 4JLKA 4V0ME 4D6PA 3REFA 2G0TA 5AJXA 3BB3A 1KK2A 1G41A 4WOPA 3P4YA 4ON9A 4A6XA 4AG5A 3TUJC 4DIEA 1LV7A 4WZAE 2B7BA 3FMFA 2O8BB 2ZTSA 4RD4A 2BIFA 3EXAA 3QY0A 4PO1A 4G3XA 5HCIA 4EQ6A 3UMSA 2KBEA 2ZROA 4LYFA 2ZU6A 2FEMA 3BB4A 5LDDC 4QHTA 1EFHA 5CDFA 1WE2A 1E98A 5LB2A 2GXSA 2IS6A 1G21E 2ZSAA 4LDJA 4YXWD 1W0KD 3HU1A 4CEIB 1DAIA 1F2UB 2ZIAA 2FJUA 2ATVA 2BMEA 1VG9B 2IXGA 3QXSA 1E99A 4Y0AA 3WP1B 4EDHA 4LHWA 1Z6YA 2QMOA 1Q1EA 2WPDD 1GNRA 4V02A 5GJWC 1GL6A 1RIFA 3A1VA 2CE7A 3PUWA 5EUQB 4DSUA 4ZIRB 1WCV1 3UKDA 2K5UA 1EX7A 1IOZA 3PUZA 2GCOA 3VU9B 4TLCA 2IYTA 4Q1CA 2GBLA 1E4VA 1VMAA 1Z6AA 5JS8A 4KI0A 2P6UA 1JJVA 4G1UC 4HB2A 4AI6A 4B3BA 3CB4A 2FPLA 4PFSA 3L8ZA 1W2HA 2GNOA 3SJCA 4F93B 3KUCA 3QG5A 3B8HA 3FGNA 1Q22A 1DO2A 1BOFA 2ASEA 2ZRLA 4C0SA 2YOFA 5F98A 3EC1A 3SU8A 1SGWA 1SVWA 4LC0A 2NO0A 2J9RA 2FG5A 4R2IA 1XCMA 3F5FA 1GRNA 4FMCF 2PT5A 1YR7A 2VP9A 2BJWA 1F5NA 1P2VA 1W46A 1W44A 1NVUQ 3F0TA 3A4MA 5KDLA 3VR5A 4EUNA 4DUGD 4Q01A 4D4LA 3LVRE 2PX0A 4KVAA 1O3YA 4JYCA 2GEVA 1KSGA 1SZPA 3K8YA 3PVSA 3IIKA 2R9VA 3D8BA 3NWJA 5J4LA 4PANA 1Z47A 1U9IA 3KB1A 3K9LA 4JSTA 2ZAOA 2CMKA 2OXCA 3WHKA 1IBRA 3MLEA 4HZUA 1O87A 3GFOA 1JECA 1AKEA 3LH5A 2OBMA 4C4PA 1W48A 5FUYA 3X1WA 1G3MA 1XXHA 3KXIA 2QN6A 2O8FA 1HY3A 1OLOA 3BS4A 4GFDA 1X1SA 5KSZA 2ZJZA 1IY1A 3I1FA 5CYOA 2WOJA 5DGXA 1CJMA 3EAQA 3UPUA 2ZSDA 1Q1ZA 3K0FB 4GRAA 3A1TA 2D74A 3SDZA 2RH5A 5A0FA 3WNDA 4X8HA 2I3BA 2P6NA 3NIBA 3B82A 4PHTA 4HLQB 3KKNA 1TTTA 1KK1A 3I62A 4PC1A 3SJZA 2F6RA 2BBTA 4HI0E 3SQXA 3OEHD 3RWOA 1DBSA 1ESNA 4XVRA 1X8LA 3PR1A 4NE2A 1OT3A 4DCTA 1J90A 2RGDA 4L8GA 3UMRA 2PL3A 4URXR 4BWYA 3T5GA 3CNLA 4G5GA 4JSYA 4S35A 5BXQC 3CPEA 2WWGA 2JLXA 1SVOA 4D25A 4KFSA 3ADCA 2C98A 1CU1A 2VHQA 2N46A 3IPXA 1HE8B 1IXRC 4UXIA 1AS3A 4LSGA 3THWA 2V4ZA 4LBVA 4TMWA 3CR7A 1F2TB 1SQ5A 2F1IA 3BC1A 4U02A 4CW7A 4DCNA 4OHXA 1KI3A 3FDIA 1NJGA 5CIQA 1B0UA 3AP3A 3QKRA 4DCUA 4U7DA 5K8UA 2ERXA 4C2TA 2VSXA 5EXSA 3AVPA 3CLVA 3QXXA 1UKZA 3KQHA 1VIAA 2ZR9A 4Q18A 2VP5A 4DDVA 4GP7A 2OFWA 1J70A 1U0HC 2J7KA 2VIIA 3SN6A 4Q1BA 2XITA 1QVAA 4IOMA 4Q02A 5KNBA 4JL6A 3AVXA 2R65A 2CBZA 3IHLA 3RSLA 1A1VA 1KZ7B 4ZI3A 2A5JA 4NYIR 4Q1EA 1ZRHA 1KTVA 4FD2A 2HV8A 4JVMA 1T5IA 3U3MA 1OKKD 2EYUA 1OFTA 2WZQA 1XMIA 4JLPA 3PENA 4M9QA 4M53A 3U60B 2YINC 3BORA 2BBWA 5FPTA 4IXMA 2VRWA 3IILA 3NVAA 1HYQA 1PLJA 4FCVA 5A5GA 4E07A 2B8TA 3ZJYA 1NMYA 2VLIA 2X1VA 1RRFA 2QENA 2QRZA 1YR8A 2RAPA 3SBEA 3U6KA 4C7OA 4M1YA 4LZZA 3TR0A 1XTIA 1ZYUA 3KTAA 1HA3A 1NP6A 5KDOA 1L7VC 1YZQA 2QEQA 4EJSB 1IN5A 2FH5B 4ZKDA 5G40A 4KYIB 4NP6A 5G3YA 3ICQB 3WHLA 2CNWA 1UBFA 3AVUA 1LTQA 1R8QA 4IOLA 1KI6A 3TAHA 4MDFA 1S4QA 4AYTA 1CJTC 3K09C 2GJAA 1G9XA 2PLFA 3NBXX 5AUOB 5IF9A 4NKRA 1Z83A 2QNRA 1XTRA 3CWQA 4M8NE 1SKYB 2DFTA 2WVJA 4QBIA 4ZKEA 4JBXA 2ZRPA 4ILEA 5JECA 3QE0A 4QGHA 2BKUA 4MKHA 5KPDA 1X6VA 1NVVR 1P9RA 2CCJA 4LYAA 2A3RA 2NIPA 1DTSA 1AJEA 3G5UA 5FPHA 3IO3A 1HQYE 4TWZA 4Z8XA 2JJ1A 4TMVA 2JGNA 2BV3A 3D7MA 5FTLA 2IEYA 4DKXA 4G5OA 2QGNA 4MGKR 1UDWA 2ZS8A 4YMSA 4HAUA 1Q44A 4L9SA 1Z29A 1MRNA 3CKLA 2WMNB 2FZLA 4X8LA 4MQBA 1XMVA 2VF8A 2XX3A 1XJCA 3TAUA 1UKYA 1AGRA 2V54A 1UFQA 1G7CA 2DFNA 5JWHA 1YR9A 2GZDA 4ITRC 2ZRCA 1E2NA 2FMXA 5JRJA 3CW2A 1TQ4A 4JKYA 3Q8XB 1U0JA 1H8EA 3ZD7A 3AEZA 3FMOB 4Q21A 3LA6A 4RVCA 4LY6A 2QPAA 2EQBA 3EPLA 5LD2C 3BB1A 4A0RA 2W2TA 2GCOB 4MRNA 4OHWA 1XTJA 2REXB 3TLXA 3TVDA 2NO6A 4II7A 1GG2A 1CTQA 1R2QA 5EQTA 4A92A 1LFDB 3GP8A 4I99A 2L0XA 1AQUA 3SI7A 1R0YA 1XDBA 2XOKA 5JEEA 3WRYC 3X1DA 5EUMA 4LUCA 5FI0B 1XU4A 4PTLA 4Z1MA 1S2MA 5AJVB 1N6HA 3NBYC 4FMDF 3UG7A 4HYYA 4EPVA 4RFVA 1Y63A 2OE2A 3TIFA 4M1SA 5K8IA 1UADA 5IK2A 3FWYA 1NNEA 4A36A 1EFRA 1G18A 2CCGA 2QM7A 4D4JA 4KHZA 3RDPA 1KYIA 2C9YA 3AF2A 2QMUA 1E32A 3VX4A 2WJYA 4C0AC 3SBDA 2YNMA 4OQNA 6Q21A 1NBME 1PUIA 3CZPA 2ZQ5A 2O52A 4B3XA 2RGBA 2Z5FA 2CXXA 2V7QD 1ODFA 1OYWA 1JALA 5ANRB 3OIWA 1M74A 1GL7A 1E6CA 1XXHB 4A8JA 3NBZC 2O0JA 1D2EA 4XH9B 4LYJA 4XIGS 3EG5A 1MRSA 3CIOA 1EXMA 1QG4A 1E4YA 2I4IA 2Y8EA 1KIMA 3QNUA 5TDHA 4JL8A 2DHRA 4JYBA 3QEOA 3KUDA 1E69A 4TSFA 5KYKA 1YKSA 3EA0A 1ZU5A 2HJGA 3JZMA 5KHOC 3GJ7A 2CLDX 4P4SA 2F3RA 1MO5A 1D2NA 2YYZA 4EPYA 5TARA 1GNQA 1L4YA 4OJQA 3RSOA 3KDSE 4GZMA 4KITB 1ZC4A 3ZDQA 1N6OA 2NG1A 1SVMA 4B34A 1DARA 4HDCA 2LKDA 4OK6A 3ZZTA 4K8OA 2D3WA 3PG5A 4DC9A 3P1JA 1KDRA 4M21A 1ZU4A 4GBMA 1ZNXA 1CRPA 1RPZA 1KKMA 3FHOA 5EP2A 3U44A 2H8KA 3THWB 3HR7A 1NJFA 3B85A 3RAPR 1QHIA 4HZIA 1YU9A 5BW8A 2I1QA 1E2GA 2H5EA 3Q7QA 3ZIAD 3VHLB 3GLHA 3QKRB 1GOTA 2H57A 5EP4A 1EGAA 1WRBA 1YHNA 1R8SA 2W6ID 5E7MA 3TRFA 2IUSA 1RKBA 1A82A 5E95A 4DLYA 3B5JA 1CXZA 1JR3A 1KK0A 5EP3A 3TQFA 3R8FA 1MH1A 1IN8A 1SXJD 1E2PA 2QTHA 3AF4A 3OIYA 4JLDA 1CKEA 4PZYA 2X19A 1WDTA 4GOKA 1Z0AA 2W58A 4BQSA 1NG1A 4OYHA 1IN6A 1VKJA 3SC3A 4TYYA 1ZD1A 2VYFA 2JATA 4TLAA 2UZIR 2QY9A 5DI9A 3R9IA 2JA1A 1G3RA 3A58B 2CE2X 3TJZA 1KSHA 1S3GA 2RGAA 5B30A 2B8WA 1QVRA 4HB4A 1QHHB 1E1RA 1UM8A 4A0FA 3KQKA 2GJ9A 2ODBA 3BBPA 1NN3A 1RE0A 1HTWA 4BLOA 1OXVA 3DO6A 5EZ5A 5C1BA 4BLPA 1OH7A 2EVWX 4DXAA 4DWJA 2PEZA 3KTAB 2VBCA 2R6CA 2OEPA 2D7CA 3KZ1E 3PXGA 3RRZA 3ADDA 4US0R 2Q3MA 2JJ2D 3UK6A 1G16A 4LV8B 4RKEA 4BFUA 1AZTA 4G01B 2XNDA 1CULC 1FMJA 721PA 2QM8A 1W36B 3VX3A 1KI6B 1KY3A 2W6JD 4KFUA 1BIFA 1E79A 1F2UA 4MKIA 4F91B 4PHHA 2FPMA 5FOUA 3CR8A 4PPGA 2OFXA 1UDXA 1KK3A 1SVLA 1C4OA 1MT0A 2N42A 2PZGA 4XSHA 1X86B 1TADA 3QKUA 2J1LA 1XCGB 4A6PA 4HAVA 4IDPA 2NOAA 4ZIRA 4CT5A 1M8PA 4RCZA 4TL6A 3DZDA 2ZANA 1FPMA 4V0KA 1IAQA 3W34A 1OB2A 2P2LA 2IT1A 3AF0A 4AD8A 1T91A 2AK2A 2B92A 3H4MA 2YOGA 1RJ9A 3NH9A 4MYUA 2XXAB 1UAAA 1ZNYA 4WAUA 4UNNA 2WICA 4PAOA 3CRRA 4Q9HA 3TSZA 1LS6A 3UIEA 4HUTA 1R5OA 2AKYA 1EFCA 2H1LA 4LBWA 1E9CA 5DE3A 1G1MA 2ZJ2A 3MAAC 1HH4A 3FTQA 1NVWQ 3K0SA 1TAGA 5DNYB 3AKEA 3U4QA 3K9NA 3LBNA 4YLGA 1YZUA 5JEDA 2GTPA 2OO7A 1S3SA 3EX7C 3AKYA 3TSOA 1LF0A 3C41J 1W0JA 1WQ1R 2RB4A 2KI5A 4QM7A 4LI0A 2X77A 5JJLA 4DLXA 4EFNA 2ZYUX 4LJ7A 2W83A 3B1ZA 3P32A 2NO1A 1QDEA 3PEUA 4PSVA 3RVBA 1OFIA 2IF2A 1HEIA 3DOFA 1YZKA 3B60A 2BMFA 1Z3IX 2Q3HA 2P5SA 4NCKA 4FMCB 1C9KA 2A5FA 5FL7A 5CLQA 2IS4A 1NKTA 1G8PA 3ZQ6A 4EPXA 4OL0A 1JEDA 3BIFA 2ZS9A 1Y3AA 4GPTA 3TW4A 5FOSA 1E2DA 1EX6A 3ZGXA 1KGDA 3I8SA 2QA5A 4GZLA 5BYJA 3GLIA 3L0SA 1L4UA 3N2IA 1S9DA 2QBYA 3MUFA 4RZXA 4YMWA 2J7PD 1GRRA 3A37A 4PZLA 2FNAA 2JCSA 5G53C 2EFGA 3GLGE 4D0LB 3M6AA 4BRWA 2D06A 3VR1A 1JAHA 3VR2A 4LJYA 4XD7A 3LX8A 3ZVLA 4B75A 2FA9A 2GRJA 4JS0A 4XTRA 4L4UA 1RC8A 5CITA 2BVNA 2WJIA 4B35A 4MA4A 5JI3E 1R0ZA 2J46A 1FFHA 1ZM9A 2HT6A 2MMCA 3I4LA 4UQOA 2JIZA 4ZCMA 3OAAA 1JPJA 3DKPA 1U94A 1GL9B 4A8JB 2IEZA 4US2R 1N6RA 2KBFA 3VKHA 3NXSA 1E1QD 1VDZA 3AKCA 5M04A 1YR6A 1BMFA 4FCWA 4G0NA 1BKDR 1KDTA 4OI4A 4PXAA 5J4YA 2WKPA 2GDJA 2FSHA 4Q4AA 4PSAA 5G3ZA 2QQEA 3N70A 4CIDA 3KKQA 2DCUA 3DKVA 3VQTA 2HLDA 4IHQA 1SXJC 5TVKA 5H1YA 5BN5A 2YWEA 1P4SA 2CHQA 1JXMA 2BEKA 1W4AA 1ZJ6A 1EG7A 3QXCA 3T1VA 1UBCA 4EFMA 4DJTA 4NMMA 1WBDA 2R6DA 2CK3D 2TMKA 3VHXA 1VHLA 3WYFA 1E9RA 3KX2A 1OSNA 3W90A 3DMNA 2P5TB 4TN1A 2HXYA
chains in the Genus database with same CATH superfamily
5HIKA 4TWRA 4NBLA 1KARA 1W4CA 3RTBA 2PGOA 1NOKA 1QORA 1RXYA 2D3TA 4LQCA 1QGOA 2JDIA 4HDAA 4J43A 3ZCUA 1OZGA 3ESYA 2QORA 1IRXA 4D8YA 2YASA 3UG6A 3BH0A 3SHVA 1YKGA 4EKNB 4CRWB 4ARZB 1T8SA 3FETA 2W22A 2VDJA 2NZJA 3GW8A 4S1OA 1ORRA 2OPBA 1W0CA 3I9V6 4NBVA 5GZ1A 4MYCA 5DRYA 1GL3A 1KI7A 3SQMA 2M1ZA 2IF0A 4DYDA 1RS0A 3AEXA 2ACWA 3IDQA 4H7JA 4OU5A 2PCLA 2D2IA 2WIFA 5DEIA 5F3RA 5BOSB 2F55A 1E1NA 3SS8A 1OVMA 2VUIB 1O08A 2YUTA 3WHIA 1KEVA 2Y1OA 4QU0A 3T4UA 2YH2A 4BQEA 5A7FA 3JRXA 1Z13A 2WWVD 4F06A 1IDOA 2QR2A 4NYMQ 5C8YF 3MCWA 2WSMA 4GX5A 2R8OA 1U2GC 3WWEA 1R3DA 4JENA 1P18A 2C88A 3TMAA 3DDCA 2OC4A 5AW5A 3QRWA 1KTIA 3S0JA 1J2UA 2EQAA 1UMBA 4D45A 3DYBA 3QU9A 5FPYA 3ILSA 2YJ4A 1DS6A 3GLFA 1CERA 3T7RA 4TS4A 1R5JA 1YL7A 2NPOA 2H5LA 2ORED 1ZIXA 1A9QA 2QLLA 4HAIA 3M4JA 4DVGA 2QVZX 4D42A 4NE9A 2J4CA 8ABPA 4E70A 1ZNWA 3O38A 3V7WA 4OHVA 4CF5A 3RODA 1T9GS 3RFFA 1MQ9A 3L1KA 2RG1A 4HDKB 5K4AA 4YCJA 2RHMA 2X8JB 1JIIA 3OE5A 4YMIA 1CY6A 4DLNA 1VE9A 3F78A 2CXSA 2JFHA 1KJWA 1OA1A 3HI4A 3GEDA 4MS4A 3CRW1 2VLBA 2AFIE 4NPHA 2EJWA 3A6DA 3L0CA 4KBGA 4WUTA 2YBDA 3JQGA 5IKMA 1IG0A 3L84A 2QRKA 5MN6A 5LLSA 4LY0A 1A9XB 4B31A 2EKLA 4IVQA 4W8GA 3PEEA 3NCTA 1KEEA 3LF2A 4CUZA 4I8XA 3RUHA 4C1BA 5ITZB 1I8TA 1PJBA 2ZE6A 1DP4A 2AQKA 1GCOA 3MMZA 3WQHA 1JG2A 4XIJA 5IM5A 3UQYS 3ZDEA 3NYRA 3W1WA 4YJFA 2PS3A 5KAMA 1VCMA 1RDFA 1U8XX 1GZ5A 2G6BA 1Z36A 1K7YA 1WF3A 5E2BA 3HA2A 3HFGA 3H5OA 1G6OA 1CVRA 3AUXA 2WT8A 3TB6A 4BN0A 3IQIX 3Q3CA 1SOWA 4GF5A 4H0CA 5BQ5A 2EKZA 2NVUA 4E15A 4FGKA 1Q7BA 3TVTA 1DBVO 5I7HA 2W2NA 3FLMA 2XTZA 3BMQA 3O1JC 5C2JB 3OY7A 3K9FC 2B5VA 5BR7A 1ZINA 3M34A 4O5AA 2V8BA 4QU5A 1INLA 3BPSA 4A2QA 3DMTA 2F8SA 2ERYA 2HLHA 3QBVA 5C37A 3EQ7A 4KUHA 3SZUA 2D00A 1ZHHA 4HGNA 1LLUA 1U0FA 2VHVA 3TMYA 2RH8A 4Q48A 5BSUA 5HIAA 4MCAA 3IBSA 3ZGLA 2O0LA 3EZ9A 3Q7RA 1USIA 2OY0A 3GJSA 5FHQA 4ZHQF 3ELYA 2AL7A 3W8FA 4HAZA 1DAOA 2W4MA 3AEYA 1YFLA 1Z5NA 4BFWA 1I14A 4DNFA 4HUJA 3TD6A 3FNFA 5FWNA 4Q1VA 1KSFX 3H2SA 3PSAA 1KI8A 4S24A 4ZYUA 3M4XA 1LPOA 1SCKA 3LHIA 3R3XA 3VC3A 8OHMA 3DEZA 3FDZA 5DYTA 3T9DA 1MPXA 3DMFA 2J9ZB 4UXHA 3PV0A 4AZVA 5EQJB 2AXEA 2YYAA 2WE7A 4IR7A 1NU6A 4NBWA 1P1JA 3CV3A 5EJFA 5LA6B 3RVLA 2A0FA 4X64B 3HU2A 1K5DA 5IUNC 4F4IA 2X76A 2JGLA 1PT5A 1QGAA 1SXHA 4DG8A 4GWLA 1LPPA 4RIHA 5IDWA 3D2BA 3OZBA 3HFJA 1OW3B 1O95D 2GYYA 4QYIB 3AR4A 1V6CA 4LPKA 4KBFA 3M3DA 1RR6A 4OPMA 4TTPA 2PX4A 5GJCA 3SXUB 4DMFA 2AEFA 3K0CC 3TPFA 1SNYA 1WOMA 4C5BA 4B3GA 4R1OA 3DFIA 3IP5A 4O4IB 5ALSA 2QBYB 1KETA 3MHPA 3ILHA 3RS3A 3BJRA 1H65A 3UJCA 3D0QA 3EIXA 3FGOA 4OSOA 3O84A 3UMMA 2VUTA 4DSOA 1E7MA 2LW7A 1Z0ZA 2AOUB 2WJ4A 1EK5A 1WULS 3MUNA 3VGPA 5GTDA 3SQWA 3ORRA 2CSXA 3A3NA 3G0DA 4TS1A 1JLLA 5F7XA 3VOAA 4WHMA 4JBHA 2FPGB 3RIEA 3ROFA 2VWHA 4F2PA 5D2CA 5BVGA 4I5GA 2WU3A 3OZAA 1X74A 4I1SA 3LC0A 4TYQA 1UFRA 1WUJS 3C7DB 4YIKA 4ZVQA 3WY9A 4EB6B 1ISGA 4H9GA 5B2EA 3UXHA 2IPLA 2VQ3A 1WQ4A 1XF9A 1RW4A 5A4KA 3ES9A 3NS7A 1Q0SA 2RGUA 1XG5A 3I04M 1C0LA 1DV1A 3P2MA 4WFIA 2ZRHA 4KYUA 2C2YA 2DZDA 3I8OA 3UICA 3QQPA 2CL5A 2DTEA 3X1YA 3U1VA 4JLVA 4E5VA 2LKCA 3OM0A 4P83A 3IO5A 2Q1XA 2WWFA 2HJVA 3MFQA 1KXJA 3CCBA 2XAAA 2B99A 5CP8A 1NT2A 3N58A 1UZMA 3BHNA 1C7ZA 2JBAA 1QFSA 3BFVA 3QXHA 1LW7A 3U44A 1FW8A 2CV1A 4QTYA 2I7XA 1NF9A 2BEJA 1BGVA 3E5HA 3RVSA 1ECJA 1P4AA 1Y7HA 3GLRA 4QEDA 3GCWA 5KOHA 5K1ZA 2V3CC 2O8EA 5JHHB 3MWEA 2C1EA 3CUUA 5KJEA 3RHSA 3GP5A 3A3YA 5E1MA 1NSTA 3VHXB 3NTLA 1UPUA 3AH8A 4CM4B 2D0PB 2OAEA 1NZFA 3DTNA 1M0EA 1QGDA 3OOJA 5LC1A 1CE8B 2PUAA 4PR0A 2B37A 4G4IA 2A3NA 1L7NA 4EATA 1PL8A 2W6MA 3TNFA 1QX4A 4KR9A 1Q0UA 3ZQUA 2PL9A 2VJOA 2Y0CA 3B5EA 3ONEA 4W5TA 1Q57A 1IFXA 1NQVA 3VI4B 4ZJPA 3WXMA 5IFKA 5ARCA 3H2YA 4OI0A 5T64A 1DKUA 1PTKA 4U5XA 4CPDA 8ADHA 3K70C 3ZLJA 1NOIA 2LP4Y 3N8NA 4LJ5A 3UHAA 4AJHA 4WZAB 1NUHA 4Y3UA 1V95A 3WFZA 5J4HA 1GZDA 1CUVA 2XUHA 2H1RA 3D5TA 4DMHA 1M0SA 1L5GB 4F92B 1KPGA 2O3TA 2E6KA 1WKCA 3RS5A 3I9V1 1XRNA 4M99A 4U4AA 2FFQA 3KZOA 4HG2A 5LP1A 1N34B 1H9CA 4H18A 5K45A 3LX5A 3E1SA 4LQ4A 4MV4A 4ZANA 2CDAA 1BNCA 4KN6A 4D4KA 2I6QA 3NKFA 4GSKA 4UFNA 3AUTA 4PY2A 3KCNA 2C5HA 3CO0S 2JKZA 3GR6A 4G4GA 3LX6A 5FORA 3RVKA 3U17A 1A97A 3UH0A 1U1IA 4WKPA 3W3ZB 1J0BA 2A78A 2I2FA 2BGLA 2X23A 1ZCBA 1VKOA 4JT4A 2ATXA 3VBCA 3R7BA 1VP3A 4ZU3A 1E1LA 2Z8XA 3GLFB 3FDFA 3H9QA 2FZWA 2IYVA 2NN3C 1NUAA 1F9EA 2PDAA 2CFRA 4G5FA 1E2KA 3T1QA 3UW1A 3KLOA 3VTAA 1YZYA 3H2HA 3NTQA 5JQGA 3IKJA 1CJSA 4MJ3A 5J63A 2B94A 5IAJA 3TNDA 3I62A 2XXAA 3ITDA 1IQ0A 2WT9A 3FFTA 1MIHA 4NS4A 2CMGA 3UJHA 1BE8A 1TO1E 3B52X 4UD6A 4XWKA 3LUBA 4JU8A 1V6AA 1YK0A 2IHZA 4PYLA 1M7BA 2HQRA 3LLMA 4ZTBA 1GGHA 4F60A 4MPTA 1JLMA 1ETUA 3R0IA 3G6WA 1WKBA 2F9LA 2HA5A 1QFZA 2G1JA 5DWDA 5FLXA 2R87A 4MS4B 1IUPA 4Y2VA 4RV5A 1AUQA 3WMEA 4EA6A 3TKLA 2O2YA 4MITA 3WRYA 3ZVNA 1T8RA 2G76A 5K3AA 2HN9A 1KEEB 5KYKA 1GZVA 1V7PC 3T61A 2J85A 2RBGA 4G5QA 4ZCSA 1GRVA 1SHUX 5D51S 2JFBA 2AG6A 2WKWA 3O4IA 2QMQA 1P2FA 1FXWA 1THZA 2FPRA 2GUWA 2ZJBA 3GJXC 3NV7A 4B84A 1G64A 3ND9A 3SC6A 2ZE5A 3LCMA 1N2GA 5LP6A 1E0JA 2RG7A 3EA5A 3NIDB 1GZUA 5ALFA 1RWWA 3PJGA 1I0LA 4EKYA 1IHYA 1K8YB 4JJ6A 4KN5A 3KHSA 1KZYC 4P31A 1YCFA 2FZGA 4I4LA 2OQRA 5BY2A 5AK3A 4KGZA 1IY8A 3MTQA 3V33A 1OAAA 3NRCA 1QKJA 4JUCA 2AN4A 1I1QB 1JIKA 3DBVO 3ETEA 5CT5A 1XFAA 3PGA1 3DHEA 2UKDA 3T3MB 4L5JA 4U2BA 3M6FA 1L5QA 4RZQA 3I6YA 4MYRA 1UC5B 4RS4A 3A4VA 5EEHA 6REQA 4R1QA 4NL4H 3OZRA 4OG2A 2DXIA 1GNLA 1E2HA 1Y8RB 5AI4A 5BW6B 2JAQA 2G71A 3LFTA 1I3MA 1ECGA 2GZ3A 1QONA 5KOJA 3ET5A 1VMDA 1XTKA 4CT4B 3MIIA 1A27A 3DEYX 3N05A 4R7TA 4BDSA 3RC8A 3KPJA 4EJ0A 1KIAA 2WJ3A 3HY4A 1D9ZA 1UBLS 1A9ZA 2QW8A 1YE8A 1BE6A 1AE1A 1VIVA 4PU0A 1ZQ1A 4JLJA 3BDAA 5FTMA 1BFDA 1JTEA 4HPWA 3L04A 4C7VA 1KFCB 2JFPA 4NJOA 3ASYA 1IXSB 2WTAA 1ULHA 2Y68A 4IUCS 2PLRA 4LI3X 4NY1A 2VPQA 1PVVA 4TTQA 2VVTA 1KP3A 5DM60 4DWOA 3OP1A 3ORSA 1MABA 1O6ZA 4HNGA 4IYJA 2MDTA 3OQ1A 1GCUA 4ECAA 5DN6D 5A2GA 3F9CA 3SYRA 3DNFA 3LUAA 4GPAA 1P7CA 1QHYA 4BECA 4BNTA 1L4LA 2ZW9A 3F2VA 1KFBB 4R5HA 4HRVA 3OFSA 2I9KA 1N7HA 3WB2A 4CF6A 2XHEA 5C8ZA 1J21A 1ID8A 4FTWA 1F8XA 3IP7A 2VHUA 5AVWA 2QUZA 3AIIA 4J91A 5JISA 1FLVA 2G63A 3QVMA 3REQB 3CLUD 3FSRA 3MRSA 4LV6A 2IWRA 4TROA 3FHTA 3OE7D 3CKMA 1JJBA 1JLLB 1I2MA 3ETCA 1DRJA 4XGRA 5DYIA 4XJXA 1HSZA 4NFHA 4ZOQI 2EZ8A 3H1TA 5BVGB 3I45A 4Q66C 5KOIA 1C3EA 2CFTA 4YP6A 5J59A 4RDXA 2FEOA 3EG9A 5LZ7A 5TJHA 4F7DA 5JOQA 4PPNA 4C0JA 3AR8A 1Z17A 3KXDA 5AW9A 4WJKB 1EEXB 5IKXA 5HR5A 3P27A 2HJSA 1ZSYA 2RHDA 3TZEA 3UQZA 4EGJA 4M8IA 1MJNA 3OHPA 3MJSA 4M87A 5AP9A 1MHTA 4K9PA 2UU9B 1BXKA 1E3DA 2PYZA 3C1UA 4FGUA 2WG2A 3DP9A 3IVRA 4LFAB 2BMVA 2JBHA 3H65A 3NRJA 3VPCA 2NUBA 3OCJA 4HQRA 4ZO4A 2QNIA 3U3ZA 3WYEA 1Z2DA 1K9SA 2HBRA 4IHKA 4UTPA 4LF6B 4ME6A 5I9MA 4OLBA 2JBAB 3NAZA 3ZI7A 2FUG6 4KIGA 3QUSA 4PLCA 1SCAA 1YDHA 3PC7A 3UUWA 2FR8C 4FDLA 1T15A 4KG7A 1E4EA 3F5QA 1R10A 4TL7A 2XB2A 2OYRA 2FYTA 2Q1UA 1G8YA 3EIOA 3HV2A 3IVXA 1Z12A 4PZPA 4PC2A 2O8EB 1PT7A 3NJ8A 5FQOA 4PPYA 4MQ4A 4ASUD 1E0AA 2WU4A 2YFKA 4NC9A 2FSUA 2I8CA 3WBKA 4CTNA 2VSYA 3LQYA 1L7RA 5E8JA 4QOIA 4TV9A 1KZHA 5AR1A 2BFCB 4N0PA 1L6IA 4B44A 5DHAA 3GNQA 2W4IA 5IMBA 1CY2A 1KY5A 2GO7A 4M0DA 4QGGA 1LZKA 2QZZA 1N9ZA 1VLJA 3C7CB 2Q62A 4GGOA 5CFRA 5GJBA 1JWLA 2JA2A 2YOHA 4I4TF 1ILWA 3AERA 1G5HA 3OZXA 1D2MA 2Q50A 3HJGA 2HHLA 3EXHC 2C57A 2WINI 2AJBA 1JEYA 8MHTA 3P0JA 4GEGA 1E3WA 2QF7A 3GDOA 4G0ZA 4RC9A 1PIWA 1Q5PA 3DCIA 1VQ1A 4LK3A 1AUPA 3O82A 4P38A 4EIWA 1PG0A 2EGGA 1MBZA 1UFVA 5THXA 5DASA 5FBVB 4HAOA 3G1TA 1QU2A 2I2WA 1QJCA 1LSUA 3IVCA 5HJ7A 2JCYA 3BRQA 3K53A 4DA8A 1RP1A 2DWQA 1AM4D 3ISVA 2VAVA 2YC2C 3DHNA 3GBPA 5M2QA 2NQ8A 3NUZA 1OX5A 1ODTC 3GOQA 4JLSA 4UHJA 4B7CA 4OF4A 3GGOA 3AVVA 1F14A 5ALXA 3ZDBA 5EKSA 1N0WA 1ZW6A 1JHYA 1F8YA 1QLHA 2CDNA 1K5PA 1JZSA 1RWVA 2Z2IA 5AK4A 5L4NA 3T7AA 4US1R 4BE9A 1YZ3A 4P4TA 1WCWA 2WUWE 2AJLI 2OHXA 4G5RA 1T3ZA 1E1CA 2HMSA 3KU4A 4JHXA 5JQGB 1MUUA 1O8CA 1YVUA 2BR3A 4LRUA 2EL9A 2YV5A 1NQTA 1BX3A 2JGMA 3EUFA 4ALJA 4G0QA 4KMSA 4TUYA 1MV8A 2R6AA 1WQ3A 5L51A 2Q9BA 1XSEA 4QBFA 4F97A 4LE1A 5HFAA 2P41A 4N82A 4FD3A 1VDMA 1JBQA 3WLOA 4WKGA 4X7RA 3KUUA 2A9VA 3VO1A 1XZBA 1ML3A 2I29A 1CJUC 3LUHA 4F6LA 4KQJA 1M8GA 1G55A 4MI3A 1TQ6A 1UPTA 1HLDA 4E32A 1NVMB 5CA1F 5AHOA 4PBSA 3ST7A 3THYA 2R8RA 2IHTA 5GIOE 5KNCA 5FOXA 3I58A 2HJRA 7REQA 3KYDA 2Q5CA 4NYJR 3RJ5A 1ZOOA 3O94A 1A69A 1QLJA 3HUFA 1EP3B 1RLTA 2BEWA 4OHRA 5LYYA 1X42A 2PY6A 3PXUA 3FNQA 3KU1A 5JSQA 3ZZNA 1YE3A 3IR5A 4NBTA 4V1CA 1G4UR 3GGSA 1FP7A 4ZI7B 1MMFB 2IPNA 3H0EA 5LP6B 5EMKA 2OQIA 2GJKA 4WGGA 3N3BC 2PT9A 2VK8A 5TVGA 3Q8LA 3DZ8A 3T6KA 2DUJA 2B9EA 4RMNA 2AV6A 1W25A 2PX6A 3C6BA 1ENYA 1COZA 4G8BA 1T1EA 2QHXA 4IINA 4KFTA 4D96A 4QELA 5H83A 1N3YA 5IN5A 1ZRNA 3MCZA 1HFWA 1G6Q1 4QICA 4E0BA 2OLKA 3ICPA 5EE0A 4HK4A 3KQNA 3U3JA 5JCOC 1PDOA 2FKAA 1Z07A 1V3TA 1C2YA 3OCXA 4N48A 2QPTA 3AUYA 5D7BA 4AJ2A 5C3MA 2ZCJA 1QE3A 2I3ZA 1F3OA 1AK2A 3OOWA 4LRWA 2W4QA 1RYYA 2FFJA 6REQB 2EW8A 5MDHA 2QRJA 1YI1A 4P3XA 1NJSA 2PVSA 3U7RA 1A0OA 2G9NA 3ONDA 2G1KA 1SXJA 3QTBA 2GN1A 2MR6A 1P75A 1QQAA 1EB8A 2VWQA 4EZIA 2J3IA 3LGAA 4F2HA 3E18A 3HNRA 3IQWA 1M8FA 4P4NA 4YCBA 2ZYWX 4D43A 3BXXA 4PHFA 1R1DA 2P65A 3I9KA 4IZ6A 3FI0A 1ZFNA 2ECKA 1ENOA 4XJVA 5I4CA 1MABB 3P5BA 1PUJA 3MWLA 5K51A 1T3SA 3NEAA 1ZOSA 1SU6A 1ABBA 4EA8A 2VRCD 4EZEA 1P1BA 3DUFA 2ETVA 2H2FA 1RI2A 4C22A 5A9RA 4IEEA 2ZULA 4LZOA 3NHAA 4BYMA 1U8ZA 1AKNA 3F5MA 4NCXA 3NDPA 3GU3A 3U09A 2YV3A 4RL4A 4W1QA 3OLVA 4YROA 4YJ2A 4I08A 1ZJWA 5LM3A 4K86A 3PGKA 1LQ2A 4YCMA 1L4FA 1UBGA 4N9WA 1TEVA 2PZ8A 1P0FA 1VPVA 4MB2A 1PL7A 1QYIA 5K6AA 4YYEA 1EFDN 3DLHA 3OO1A 4TPKA 3W7VA 3MT9A 2P7IA 2W6JA 3ND7A 1P2UA 1EQ2A 3PPXA 3P9ZA 4F9TA 2Z4SA 4GO1A 1VIMA 2VHTA 4UTOA 3QF7A 4WY2A 1Z4PX 4HF7A 3NMUF 3AVTA 1U9ZA 3EG9B 2YXNA 3TUIC 5C4MA 1P5RA 4PRZA 2PBRA 4LC1A 1E2JA 3IVAA 1DBPA 4AJ1A 2HREA 1KYWA 3VR5D 4H4EA 1EUCA 2R66A 5A9SA 3LY9A 4MVJI 4MWDA 1GADO 2R3SA 4MVJE 3JD0A 1GA6A 4DLBA 5IXSA 4EYEA 4BKMA 3AYXB 4EECA 3DWEX 2YY6A 1E4OA 2ZE8A 3LRPA 3MJTA 4F5WA 1MRZA 1PT6A 5A5EA 1UXHA 3RBZA 4C14A 1GKYA 1N2BA 2I1VB 3EGXA 1KSJA 3PCRB 2JD1A 5EKXA 3LKZA 1I0IA 5TE9A 1I80A 1VGVA 4PX2A 1YRYE 1O9GA 3TL2A 4XD2A 1P9OA 1OLXA 2R62A 2YDXA 1C8BA 4W5JA 3AJRA 2CSUA 1G21A 2FUG1 3WJ2A 2RJNA 4XQCA 1L1FA 3WK7A 3FOWA 1TUBA 4MJLA 4JXXA 3SXJA 3I5UA 3EBOA 3HYNA 2GEJA 1UH5A 1IY0A 1J5EB 2J09A 3OHMA 4FWTA 2J07A 4KO4S 4TV9B 1EGMB 3PX7A 3OJ0A 4L15A 5HS6A 1UT8A 1V2HE 5CXQA 3THXA 2GR9A 5A3VA 4TMXA 1OGJA 3D6JA 2QD1A 2A33A 5LQJA 2DAPA 4Y9RA 3UATA 3DF9A 3EGDB 1XF1A 5CVUA 3IL2A 1O9BA 4Z4IA 3DC7A 3AERB 4FGLA 3FPEA 3HYRA 1XZ8A 1JEYB 3AKDA 3LQ4A 3MHTA 2F62A 1E3WB 3IA2A 4KBYA 4CIWA 1E89A 2C84A 3F98A 2B82A 2CL0X 3PYMA 4R0VA 4WT7A 3RE1A 1RZRA 4M36A 4NJMA 4TX1A 4DQLA 3HCRA 2XQFA 3ONVA 4BQQA 5ALDA 4IICA 4QSHA 2FOLA 1QH0A 2J9YB 4MGIR 5A4MS 3GK3A 1QS0A 3GT4A 1T2AA 3NANA 4MUJA 2QM3A 5C35A 4PLGA 1OUMA 2X6TA 3OIVA 1SCBA 4L9WA 4RIFA 3NAGA 4R05A 4ZRMA 1CUUA 2IZOA 1BRTA 5EL0A 1V47A 4UNSA 3D7NA 4TKMA 5G41A 1XB2A 2GCEA 3FMVA 3K4QA 3P0FA 1GKIA 5K7SA 3PQ5A 5F3WB 1Y3FE 2X8AA 3ABSB 3HA7A 2DKNA 4TWAA 4CN8A 3E9NA 3R74A 1O58A 4IM7A 2CXRA 1ACMA 4IHJF 2ONJA 4EFLA 1WS6A 1YAHA 2BT4A 2BCGY 1XJWA 1Z2OX 5JLJA 1KBOA 1N5IA 2HPHA 4QQKA 1JQJC 1MXFA 1T1RA 3LK7A 2CHUA 4KIFA 4DTCA 3ETJA 4R69A 3I2GA 4JBYA 3C2QA 4ND7A 4IS3A 4RJLA 3EGOA 3GT0A 2UZ1B 2X4DA 3L8HA 4QBGB 5BSWA 4YUVA 1L5MA 3H4VA 5IU6A 2QTTA 1MFZA 3ZU5A 1V1JA 3DTTA 1BQ4A 4UHHA 1WMBA 1S5PA 1TF2A 2M6KA 2YXDA 2RIPA 2O3QA 1I2BA 1FQWA 1KC3A 1XLTC 3PUKA 1E5LA 2FG6C 1R9NA 5BQFA 3WIDA 1CDEA 3AUUA 5TQVA 6YASA 3LQKA 3CHYA 3GLFE 5A4AA 2WD7A 2B7CA 4HNVA 4KQHA 1KWGA 1EE9A 2QT1A 4DSNA 3RTGA 2DU8A 3DDNA 3SX2A 2OGUA 1PGPA 1QAOA 2WAXA 5C5DA 5EIEA 4J16C 3R5JA 1MAHA 5J1SB 4E5YA 3GLGB 2VHEA 3GRFA 2R6GA 4XR9A 3KYDB 1I7LA 1ZL2A 4IKOA 2JAWA 1X0VA 4L8FA 1QIHA 4EW6A 3FW1A 2GKSA 3ZHBA 2AXPA 1CR6A 1SO8A 4Z54A 1GU7A 3PWSA 5JSFA 3T1OA 4C4ZA 3CZAA 1H0KA 1T5OA 2WD9A 4I2NA 2B98A 1SKQA 4B2PA 4M7RA 5U4QA 4V1CB 1P7ZA 1W36D 3W9UA 2PMKA 4FOSA 3EVTA 4BNUA 5GV7A 3HO8A 2ZTMA 3B7GA 1TVEA 3IMEA 5EXEA 5HKOA 5KPJA 2X5XA 1GQ2A 2G5TA 4HFMA 1X38A 4DA7A 2BTOA 1D1QA 5MHTA 1II8A 2FQQA 1HF3A 3AINA 3PD1A 3NDRA 1KOFA 1MJGA 1DV2A 2CDBA 3QLVC 5LMCA 2XCSB 1TKAA 4BP3A 2IOHA 4OQYA 4Z51A 3NZEA 1TM2A 2Q0QA 3KPUA 3SFZA 1P0QA 5FPPA 1EUYA 2VTBA 2WNSA 2ACVA 1J09A 2AX4A 1FMFA 2IELA 1A9TA 1IN4A 1NF3A 1UXOA 3KG2A 5KU1A 1UKVY 1IQRA 2GM9A 3CN7A 2ZRQA 2NVOA 4YGXB 1I7SB 3UMYA 5CTAA 3PHHA 3IKTA 2DLNA 4QQFA 1N2IA 2H1FA 4XYGA 3UXYA 2XOEA 3P9KA 4TMZA 3LZCA 4HJRA 1YULA 7MDHA 4O2AA 3RIXA 4E08A 4O4HF 3BICA 2NU6A 3RVJA 2B20A 4I5DA 3L43A 4KQ2A 3UJ7A 4YAWA 4FHFA 4MKXA 3JV7A 1BJKA 2NZYA 1TA4A 4UZSA 3W2IA 1V6SA 2PGLA 3O9MA 2XADA 4ZQGA 3WP0A 3ANLA 3GCZA 1UP6A 3DW3X 3BMXA 4Q7EA 4W6ZA 3WVNA 5JZ9A 3SJ7A 2WRZA 4KXMA 4PIMA 3U7EB 4NG5A 2G7ZA 5KTRA 3KSAC 1R6BX 4AURA 2Y1WA 3B13B 3G68A 4NFYA 1QLWA 2NZ2A 1OFUA 2AQIA 3AMVA 3HYSA 4LV5B 4EWLA 1T2CA 4E30A 1CR2A 3ZOKA 2DPMA 1PJ4A 1U9IC 2EARA 3I23A 1OBOA 1XD9A 4Q05A 3W8RA 4CWAA 4OX9B 4XEUA 1A8QA 1BJRE 1CJVC 1DQNA 1LNSA 4YJ2B 3PDIA 3N0RA 5LQKA 1C81A 2OFOA 2QQFA 2PKEA 2NO5A 4X44A 2IS2A 1KEPA 4P5PA 3A2MA 5KWIA 1V5WA 4NMHA 2QUBA 3I8XA 4G1VA 5EHQA 4RYDA 1MTOA 3GELA 3LLVA 2A9KA 3CUEF 1LBHA 1UQUA 3P9NA 1IZ8A 3A3OA 5AI5A 2XOKD 1NI4A 1Q84A 5IBQA 2VCEA 5CGQB 5KI6A 2OHFA 3M6LA 5C3UA 3TWOA 3U7GA 1VL2A 4V0LA 2IXDA 3B9RA 3O7MA 4EYGA 1U0RA 4Q47A 3BH7A 3MTJA 1NZDA 2GILA 1OC4A 4PLVA 5IAEA 2GBGA 4P53A 1EUCB 3WLRA 5IK2D 5A9SB 1RWKA 4JYAB 1N6LA 3UC5A 5C81A 3D3KA 4K6MA 3DB1A 4G0XA 3TQCA 2OBXA 4UDNA 5CA0F 2IYYA 2WJGA 2XR1A 1UKAA 1VJCA 4AMZA 1I33A 1J8VA 1KNQA 2QRLA 4WW0A 1SHKA 2VOJA 3ANMA 4L1KA 3ETLA 1YF3A 4G37A 1ENZA 1E5TA 2QN7A 4FBLA 4KAXA 4YCDA 3V1NA 1R5BA 5LUBA 4P58A 3D3WA 4UPEA 1JI3A 2WR8A 3M89A 1H1LA 3PJEA 4UE6A 3RG2A 4RH1A 1UPAA 1AXGA 2WJJA 1GN8A 3V3KA 3IPYA 1OLXB 2AMJA 1GIAA 1O94C 1NP3A 3OTIA 4LN1A 1NMXA 2PZAA 3RJMA 3QOFA 2HU8A 5ADWA 2AA3A 1ZOIA 3HJNA 2HTEA 1U8FO 1VYTA 4JOBA 1TUBB 4G5XA 2KYRA 4J0IA 2ZEJA 2WLSA 4EENA 3GYGA 1T5LA 3SZGA 4Q4JA 3NG1A 3AIMA 4WV3A 1UMKA 3PXEA 3TOXA 4D9IA 3HTXA 3DYVA 4X1IB 3HXTA 5HPYB 1KEKA 1M2OA 7REQB 1Q0ZA 4ARSA 3ABQB 1SUFA 3P9QA 3K9QO 4NXNB 3NIFB 4Q7LA 2PUDA 5HEKA 1QH9A 3L05A 1LC3A 3Q9SA 2NU7A 4RPJA 4U7HA 2Z5LA 4CM1A 2NQTA 3G7UA 2ZR0A 1HE4A 5I3CA 1O5OA 2BMJA 1FNDA 3TLJA 1B2RA 5BN3A 1GJRA 3GJ3A 1AKTA 3AHHA 4LJLA 4MS1B 1DJNA 2WTXA 1C14A 1CC1S 3ETDA 5J1TB 4O2RA 3TS1A 1DC6A 4HXFB 3CR3C 4HEQA 1O95A 3H3FA 3IQGX 1QS0B 1J0CA 4BLTA 2BFBA 1ZGCA 4HTFA 1IB6A 4FC6A 4JC5A 1DJLA 4MUNA 4HSEA 4O33A 4N7MA 3BAZA 1XCPA 4Y2TA 1XZJA 5FI1B 3I3SR 5B7QA 5DCUA 2VC2B 5ELXA 1XDGA 3VI3B 5HW0A 4RTMA 3O0TA 4GOMD 5H3HA 1JR3D 2OKGA 1VE5A 1CF9A 1P8JA 3NHRA 1VJ1A 4FXOA 3UT5A 1VJ5A 3W8DA 4II2A 3HDQA 1WSAA 4OATA 4DIDA 3MCAA 3WLHA 3L6EA 3EJWA 3C3YA 3G9ZA 4Q16A 1SU7A 1Z08A 2XE7A 2WYUA 2KS6A 2R7NA 1H6DA 3UMCA 1LS1A 1GGMA 3V7FA 1IIBA 5DI3A 2IW1A 1YASA 3AHJA 3Q10A 4ZT7A 1OOEA 3TCKA 4ZWNA 3KHTA 5J4VA 2P0YA 4D74A 1BWPA 3LPCA 4HZGA 1DG1G 3KQVA 3KLNA 1QIDA 1HNNA 2AQHA 2WABA 2ORWA 2W93A 2FHPA 3AK4A 1XLVA 3L7AA 4UATA 2E6UX 3GXOA 4Q4LA 4UM8B 4BFVA 4WACA 4UEKA 2HNAA 4B3MB 3PFKA 3EZ7A 5E9WA 3DP7A 2WD7B 3I73A 4HB0A 5A3SA 4M7WA 2OORA 4P93A 4S04A 1DAEA 1R64A 3DT9A 1U6JA 1TU0A 1GZSA 1ORWA 2QSYA 3CS3A 4K03A 1CIPA 3FTCA 1VYUA 4GMHA 4JGIA 2FDXA 2G07A 3G23A 3PGJA 4K1XA 2FW0A 1CR0A 5JTUA 2NQ2C 3HEBA 5HILA 5FTNA 2YVKA 4KPUB 2B4TO 1LH0A 2F43A 2RGNA 4WEOA 3ZKAA 2QX9A 3NYQA 5F3DA 3GVXA 3ZK9A 3I92A 3ZS8A 1I4DD 4MSUA 1W5SA 4QG7A 1XA0A 2P35A 3SPXA 1VECA 1E79D 4IWYA 3O8BA 1ZAYA 1KJYA 3DMPA 3LSYA 4RJJA 3NC1C 1Y80A 2CV0A 3RUPA 1S2LA 4YFYA 4HUQA 1E9FA 4G1FA 4QUIA 5CBPA 3FPAA 5C18A 1GPNA 2EFYA 2XUGA 3ZBQA 2NXWA 1II8B 3R9WA 2PGIA 2V98A 5JSZA 2W98A 4U2EA 2CVFA 1C3VA 4FYYA 4I1YA 3QPVA 3PE4A 4IXNA 5FOVA 2JIMA 3GRCA 2UXDB 2R47A 1RXEA 1ODSA 1Q0PA 3H0KA 4K6CA 2VTBB 3HYLA 4O4LA 3B3JA 1OX4A 3SK0A 3COYA 3AL0C 3B78A 2ACEA 4H0FA 3C3CA 4AG3A 3TEMA 1U0NA 2XIJA 4RIGA 1CR1A 2AJCA 4DSTA 3TIXB 2HA4A 3BA1A 4O2AB 2YQ5A 5CFOA 2NU6B 2OXFA 4AO7A 4YO7A 1TO6A 1WW2A 2NUAA 4PLPA 5BSEA 3EVCA 3B1WA 4B40A 4JI1B 1MGPA 4G5YA 2O9JA 3UWDA 2Q0SA 5C5CA 1D04A 1M1XB 1YB1A 4DEYA 1GA4A 2FRXA 5FUMA 2EIHA 4GUAA 1I6KA 4WBNB 2AN1A 4D2IA 3D5QA 1BFKA 3T5MA 4YI5A 2CYCA 2DULA 2ZJ5A 3HLKA 4GBJA 1EBBA 1EWVA 3T7CA 1A4UA 3T1TA 1L1QA 1KC1A 1DMSA 1YA4A 1TRKA 3LRTA 4IFIA 4PQFA 3NFRA 1JXAA 1ABEA 4JXKA 2OCBA 3E7PA 3Q85A 2B2NA 4PEVA 5JW6A 1GN9A 1UKEA 2KSQA 3DOUA 1U7XA 3IRUA 1P0IA 2YFHA 3KK0A 3MWDA 3TMKA 2JHCA 1VKZA 3LUFA 5ABPA 3OQ6A 5HF8A 3GLUA 5ADUS 4BB5A 5B1EA 1JNYA 3ZJTA 3ENNA 1PFWA 2FSFA 3DNPA 5IX8A 2XTNA 2B1JA 5IP5A 5TF4A 3EPRA 3MA0A 3A25A 4M4SA 4B8ZA 1P6UA 4WESB 3EHEA 3R3ZA 3ZWNA 5JPDA 1NI4B 2RKOA 4WLNA 3TE7A 3DE4X 3H05A 4JA2A 4FYKA 3MNFA 2GPNA 4HDOB 4OHBA 2ZRIA 2TSYB 5IT5A 3S8EA 1P31A 2VCYA 3E9CA 3UM9A 2H4WA 2YHAA 1D5WA 2DPXA 3PT9A 3QA9A 4J1QA 3L7IA 3OU6A 4BN5A 4DFDA 1NXWA 5EUCA 4FI3F 5HGXA 2QV0A 3NC0C 4IDEA 4RF5A 5A7GA 3D43A 2BZGA 2VQ6A 2Q8NA 2CVZA 3ZWCA 2WG1A 1JJIA 1FNMA 4ZYXA 4QE3A 3ITKA 1U6IA 2ZSJA 4M49A 5T6MA 4KO3S 1CFJA 4B4VA 1P9WA 2J41A 1P39A 5E4FA 3I34X 3D3WB 4RKFA 1GPYA 4KQXA 1H1LB 3B3AA 3R0VA 4QJBA 1GG5A 3WX0A 3K8OE 4D4GA 4ZIRA 2O8CA 2L2QA 2NZ8A 2BP7B 2YV1A 2OV4A 3QOWA 1RRPA 4A73A 5DH9A 2PX8A 1R15A 4B7ZA 1GUZA 1MG0A 3JZIA 5CK5A 3QEJA 4U2GA 4H1WA 4UVIA 1YACA 4B8WA 5HA5A 2DHDA 2NSDA 3C5HA 2ZIEA 2VF2A 4C7OB 1WP4A 1P4GA 1T9CA 1UBRS 2RC5A 3O95A 4Q4JB 1R4ZA 3EEBA 4R8VA 5DBGA 5HIIA 4ZZ2A 4F4DA 2HLDD 1CB0A 3T3PB 5FXMA 2OGWA 1R0KA 3JALA 1JLRA 3WYAA 1MA3A 4AG6A 4C0WA 4DLWA 3RTDA 1M2OB 4ITVA 3D6MA 1F0YA 2V7EA 1XZCA 3QYFA 3TBFA 4BFYA 2P6RA 3FPKA 1KY2A 1D03A 1XWIA 3INRA 4D8XA 3F7MA 3ZX5A 1P7WA 2ROQA 2KE5A 3C3JA 4M0LA 3G02A 1PQWA 1ZM3A 2CJYA 2YC4C 3SOZA 4R9NA 3THRA 3NCHA 4ZARA 3V9AA 1U0EA 2ZFUA 4IUBS 5B6IA 2OXRA 1G3QA 1Z74A 3PHBE 5BN3B 5BPFA 4RELA 1WXDA 4H7PA 5D5QA 3IODA 1SY7A 2R11A 4CL3A 3H42B 3C5VA 4H2DA 5DN6A 4BU0A 5