3QEJA

S74e-dck mutant in complex with udp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
242
structure length
234
Chain Sequence
TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVELTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Post-translational phosphorylation of serine 74 of human deoxycytidine kinase favors the enzyme adopting the open conformation making it competent for nucleoside binding and release.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 234
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qejA00
2IYZA 2J0QA 2AK2A 5IT5A 1VMAA 2EFEB 2G1KA 421PA 1W47A 1CJTC 1UKVY 1ZP6A 1G291 4Q47A 4C3ZA 2JLVA 2QU8A 5E95A 1GP2A 1G17A 1G7CA 3LBHA 2O8FA 4LX0A 4DIDA 3FKSD 5FBRB 4F7WA 1OB2A 2EYQA 3K0FB 4MYHA 1Q21A 2AD5A 4ZI2A 1GKYA 1XPOA 1KZGB 1BKDR 1P2TA 4W9MC 1WB9A 3LW7A 3ADKA 3MWYW 2DB3A 4LJ4A 2G1JA 3ZIAA 3IBYA 1W48A 1ZW6A 4UJ3A 2A3RA 2D7CA 3PUVA 4BQSA 2ZJBA 5DGXA 5DHFA 4JLKA 3G82C 1JJ7A 1KMHB 4IOJA 2FV8A 2O8CB 3QVUA 3IIJA 5GVSA 4EPTA 1OFIA 4RD0A 4BFXA 2V4ZA 2KI5A 2F3RA 4PC1A 2ZE6A 2O0KA 3OE7D 1R5NA 3AKEA 4A6XA 1TQ2A 1FP7A 3K0CA 1N0UA 2QPOA 5KO2A 1N3BA 2IUTA 3E1SA 4KFRA 3GLHA 2IUSA 2W83A 2MSDB 2BIFA 4Q7MB 2VYFA 3QBVA 1BIFA 2ZRHA 3T34A 5ELXA 1GM5A 3QI2A 4DT1B 2WJGA 5HTKA 1ZIOA 3LDAA 3IO3A 4MDEA 4EQ6A 2O8EA 4WXRA 4Q00A 4YDHB 1FW6A 3C7KA 3T1QA 4JVNA 4QOSA 3MWLA 1XMJA 3O8BA 4HDQB 4Q4AA 3WP1B 3KQNA 1S4QA 1T3HA 1AKEA 1OKKD 1SKYE 3SHWA 4QGFA 2ZJAA 4V0MA 3I5YA 1NKTA 3MD0A 4I99A 1OFTA 3IKJA 2OO7A 3SYNA 3U4QB 1F2TB 3BB3A 3SBDA 4DRZA 3SFZA 4PHFA 4PSAA 2H57A 4Q02A 2XJ4A 1QHYA 3A36A 5IF9A 2NZJA 3WYFA 1PUIA 4HLQB 2OEPA 4NDZA 1E1QA 2GAAA 3U3JA 3TIFA 4B76A 1WCV1 3FB4A 1KI3A 4M1SA 4M9QA 2O5VA 3DM9B 3R9IA 2W2TA 3QBTA 4EDHA 2P3SA 1W1WA 3ECCA 2JASA 5BQ5A 3GLGB 4WIAA 2Z83A 1C9KA 1JPNA 3LLUA 1D8TA 2PJRA 1G3MA 1QHGA 4DKXA 1D5CA 1AKYA 5HCNA 1AS0A 1TU4A 2BEKA 4TSFD 5HKKD 4FN5A 1XTKA 2FSHA 1SVSA 1IJFA 3GLHE 5DISB 1RW4A 3M6AA 2XNDA 4QG7A 2RGDA 3BFVA 2CL0X 1VG9B 2XB4A 2J7PA 4Q1AA 1U2RA 1G3QA 4BFYA 2G0NA 2HF8A 1XPRA 5JI2E 5GVRA 4BASA 5FBVB 3BRWD 2B7BA 4M1TA 2XB2A 2F9MA 2ZE5A 3TW8B 4CEHB 1E3MA 1XMIA 2NOAA 3KQHA 1DAHA 2X8AA 3KXLA 1SGWA 2CCKA 1XRJA 1J90A 1EWRA 2WSMA 4JLDA 4B44A 1ONBA 2IEYA 3C8UA 3QUSA 1X6VA 1KSJA 4FMCB 3SNHA 1P60A 4B3DA 5FTLA 4DSTA 1GKUB 3TJZA 2J0VA 3GLFA 1KO7A 3Q3JB 1GITA 2Q3MA 4ZDJA 4PO9A 4V0ME 3QEOA 4CT5A 5B58C 3U7GA 3R9XA 5G53C 2WVJA 3IGFA 1U0JA 2OILA 4QGAA 2R2AA 3OZXA 4M22A 1E9BA 2ZJOA 2ZROA 4EPVA 3R8FA 3H84A 3GJ5A 2IYUA 4N3NA 2HCJB 4M1MA 3RDPA 3ZGXA 1SVLA 2PMDA 2BMDA 1QHNA 4Q5IA 3UKDA 4EIWA 4GDFA 4TLAA 4F38A 2X77A 1TPZA 1MOZA 1GG2A 3SJZA 1G41A 1N6PA 3IBGA 1U0HC 3ZQ6A 3GPLA 2GK6A 3CRW1 5FTMA 1XD2B 1W36D 1R0XA 1VKJA 1MT0A 1HQCA 1DAMA 2ONKA 1KI9A 2F3TA 3IIMA 4ZIRB 1AGPA 3EPKA 2OBLA 1ZD1A 2XOKD 4PANA 3AM1A 3TKLA 1X8LA 4PPGA 4FCTA 3CRRA 5P21A 1U8YA 3NHBA 2YYZA 1XJ0A 1PZNA 3Q9LA 4ZO4A 4TT3D 3THXB 2GHIA 3I8SA 3FWYA 4FXPA 2D4HA 2G83A 1Z5ZA 2ZRFA 4Q1DA 2JEOA 4NCNA 4RZXA 2CBZA 2FWRA 3BC1A 4LI0A 1KJZA 1YZLA 4C0LA 3QOFA 2IWHA 2VSOA 2WPDD 1DADA 2PMKA 4US1R 1UAAA 2BHRA 3LNCA 4O25A 4FI3C 3DM5A 4P4SA 3KQKA 221PA 2W6JD 3FFAA 4BLTA 3RS7A 1K6MA 1S96A 4AI6A 5JS7A 4NKRA 4EFNA 4A8JC 2KBEA 3CO5A 4L16A 3X1DA 4FCWA 4F91B 2GVZC 4A8JB 3GLFE 1CTQA 1Q1BA 1VCOA 3W9YA 2CNWA 3CNOA 3KZ1E 4XTCS 3W6NA 5KTYA 4IW3B 4TQUS 2V3CC 5FUYA 4AYTA 1VDZA 3L8YA 3WHKA 4F92B 2OCBA 5CLQA 4NCJA 4M8NE 1GSIA 1KK3A 4TYQA 3X1YA 3AEZA 1P75A 4JL8A 1Z6TA 4P4TA 1VCIA 1DS6A 4KI0A 1UM8A 3DZDA 3QQ5A 4IJMA 4JBWA 2NG1A 2JJ8A 3LAWA 5KNCA 1B23P 2OUKA 3QVVA 4P33A 4C0HA 2IW3A 4HB0A 4QBGB 4B47A 2IXFA 1JB1A 3GFTA 1LV7A 1H8HA 1S9HA 3B5JA 4I4LA 5F98A 3CR7A 4C0QC 1FTSA 3SS8A 2JLYA 1XEXB 2VSXA 3RYTC 2FDCA 5CB8A 2CVFA 1P5ZB 1E4VA 1ZM3A 1FMJA 2HYDA 4ZCLA 1G20E 2WJHA 1W4CA 3UMRA 2HLDD 2QRZA 3DO6A 3P26A 4OQFA 5J4YA 1KO4A 3R8CA 2GJ9A 2H7VA 4MYCA 4Q9KA 3FFBA 2FPKA 4FWIB 1W0KA 2Q21A 4PR0A 3GLIA 3DDCA 2ERXA 5JRJA 1LS6A 4P4UA 5KHOC 3NH6A 1HA3A 1KI2A 4WZBE 3AV0B 1ETUA 3LY5A 4A0RA 2C98A 1E9SA 3OIYA 3VR4A 2HLDA 2J46A 3GFPA 1EK0A 4HUTA 3PUXA 3AVTA 3CKLA 1P61B 3NDPA 4IKEA 4NYJQ 4PQRA 4QJ4A 1JI0A 4MH0R 4FMBB 1XZQA 3REFA 2ERYA 3SU8A 3PV0A 5JFGA 1SKYB 4U02A 4TLBA 2CE2X 1M34E 3U3MA 4GP6A 1LB1B 2WTUA 2Z4RA 3EPJA 4LYAA 4LSGA 5KSOA 1NN5A 5IRCD 2IF0A 1E9RA 1F6BA 1YQTA 1C1YA 5C4MA 1CR2A 1XD9A 2BBWA 1Z83A 1N2CE 1RIFA 2BVNA 3EZFA 5IK2D 4Z8YA 2YOHA 1TL7C 1LTQA 2BKEA 2JIZD 5JI3E 4HAUA 2GESA 2KSQA 1DE0A 4M53A 4IOMA 2HEIA 2BV3A 3QSYA 821PA 4PC3A 3U44B 1KMHA 3U5ZB 2O8CA 2P5SA 1E69A 1CJUC 3BGWA 4C0AC 1HE1C 4PHTA 2ZJ8A 3D7MA 8OHMA 2DYKA 4A2PA 4WXPA 4WA7A 1H65A 4AKGA 1XWIA 3B13B 3C41J 4C4PA 3T06B 2BCJQ 1NN3A 1UBFA 2ZTSA 4JSYA 3SYKA 1ELOA 1P2SA 2A2ZA 4ZDWA 3K9GA 1O87A 5DIFA 4AKEA 4P32A 1KSFX 4NCHA 5B64A 3VKHA 2I1QA 4A0FA 3QY0A 1ESNA 4OHXA 4LV6A 5EJEA 3NWJA 5K8IA 3GLIE 3FE2A 6Q21A 3AF4A 3BB1A 4PHGA 4Q7KA 5AJWA 1TUEA 4L9WA 4DLYA 3HPRA 1TEXA 5CJPA 2WKRA 4DT1A 1BYUA 3O8DA 1Z2AA 3X2SA 4C0BA 1CLUA 2CK3D 1RYHA 4AK9A 5KNBA 4QC2A 5EZ6B 4LJ6A 5FOVA 4LBVA 5E4FA 4E03A 4LBWA 1IM2A 4OKSA 1ZM2A 3EW9A 3I8XA 2A9KA 4LYHA 1NLFA 3I32A 1E32A 1RVDA 2IYTA 3NDBB 2AFIE 2Q3FA 5FI1B 2QUZA 4B2LA 1Y63A 3QXHA 4LV8B 2MMCA 1XP8A 3QNUA 4Q18A 2OXRA 2DFTA 2ZRPA 1NNEA 1HQYE 3U4QA 1F2TA 4KXFB 2CK3A 3RHFA 3UWOA 4LPSA 1Z6GA 4URWR 2D2EA 3UG7A 2ZRLA 1EX6A 2OCPA 2IS2A 2ZS9A 2H92A 3EC1A 2IYYA 4Z54A 1L4YA 4L15A 3CZQA 2AXNA 4MA4A 1E0JA 1KO5A 1VCMA 5FOTA 2P0EA 3I72A 3KJHA 5JWHA 3OIUA 3LVQE 521PA 3GLGA 1S1CA 2CLCX 2KWIA 1OSNA 4JT2A 3C5HA 3CIOA 4RD6A 5FFMA 3KQLA 4DDWA 2H5EA 4EPXA 1SQ5A 4A92A 2OBMA 4HAZA 4H1UA 5FTJA 5CK5A 1TAGA 4ZCIA 5TB5A 3CRQA 3BORA 4V02A 3TNFA 2PT5A 1E9EA 1RRGA 2CLDX 1G6OA 2H8KA 4PPFA 1OH5A 2CCJA 3CNLA 2OCYC 1YRAA 1IOZA 1KAGA 4EPRA 2GZHA 2NTYC 2HXSA 4KVGA 5E3HA 1GZSA 4UNRA 3NBXX 1TF2A 1AIPA 2CL7X 4S2EA 3RABA 4CEHA 1LY1A 1FQJA 1FUUA 3CPJB 1K5DA 1T3LA 3K70C 3D31A 4DCSA 5J4LA 3GJ4A 3QPVA 3K70B 3QKRA 3GFOA 4JJZA 3I62A 2Q3HA 1JXOA 2QSYA 3P20A 5DI3B 1CP2A 2ZUDA 3SEAA 3QENA 2FGJA 3GEIA 5CIWA 4BRUA 3GLFB 3M1IA 3FMOB 2WWHA 1JAIA 4JYCA 4TTPA 5BW8A 1WMSA 1Z6YA 2KB0A 3LD9A 4U00A 3NXSA 1G18A 2ZRBA 4I1VA 3CX6A 3AVUA 1I4TD 5KPDA 2YJTD 1ESMA 4G5SA 4TMWA 2MSCB 3HDTA 3NEYA 5FBLB 1IHUA 3QXCA 5KDLA 721PA 2ZVPX 2ZREA 1UKZA 5L3VA 1AZTA 1N25A 1IN8A 4LJ9A 4NH0A 1N6NA 1G8PA 1TQ4A 1E4YA 1XU4A 1ZNYA 1IJEA 3OEHD 1RRPA 3OF5A 4MRRA 1YZKA 5CLLA 3TVTA 4B75A 2NZ8A 3B85A 2WSSD 3ONWA 3IO5A 3MAAC 2VHCA 1ZMXA 1YJ5A 2GEVA 5EP4A 3PUYA 5C4GB 4BZQA 2IHBA 1KI4A 3QG5A 1XD2A 4B34A 1N0VC 2IXGA 3VKWA 4ZIRA 1COWD 3PEVA 2WIBA 2NGRA 5KUTA 1KOFA 3RSLA 4K46A 1FNMA 3PFIA 2RGCA 4KYIB 4BEBA 1RJ9A 3TUJC 1N5JA 2QENA 3THYB 3U6KA 2WSSA 3AH8A 4DJTA 1FX0B 1MV5A 3THXA 2I1VB 4L8GA 2QT0A 4RJLA 3H0KA 4HB2A 4MUBA 4OI4A 1WA5A 2BM1A 2JLUA 2BMJA 3A37A 4Q7LA 1RE0A 1AK2A 1N6OA 1OYYA 2A5FA 4M9ZA 4B2IA 5JHGB 1OFUX 3UK6A 1MKYA 1E2IA 1N6IA 2RHDA 1DPFA 2ZS7A 3GJ8A 3KKPA 3PVSA 3B1ZA 1A2KC 1DAKA 4JYBA 4P4SB 4F4CA 2XZLA 2QBYB 4FCVA 3NIBA 1G8HA 2FA9A 4GZMA 1WF3A 4YQFA 1IY2A 5G41A 5FL7D 1LNZA 1NJFA 1E2DA 4ON9A 2OT3B 2VA8A 4DZZA 5JLJA 3LO5A 3MGCA 2FEMA 3OHMA 4HB3A 4R9UC 2A5GA 3WBJA 1E1RA 3DMNA 2O0JA 1Z0AA 1E79A 3OESA 3W90A 1UADA 2VIIA 2WZQA 5EXSA 3PITA 4JJKA 4TYPA 4MDFA 5F2EA 2EFDB 4B3BA 5JJLA 3RC8A 2ZM5A 4TQAA 2IEZA 1A82A 1JALA 1E2LA 5C2JB 2VF7A 2BWJA 2YOGA 1EFHA 1FQKA 2Q9CA 5FL7A 3ZH9B 2VP0A 4LY6A 3AP3A 2QTHA 4NYIQ 1NP6A 1SHZA 1NVWQ 4DB2A 2KE5A 1SKQA 4FINA 4GSYA 2IS4A 4N1AA 3BJIC 1XZPA 2GNOA 3EASA 3FTQA 4RD4A 1W4AA 2ZRIA 1XEXA 1WQ1R 1G8FA 3W6OA 4L4UA 2I3BA 1DAIA 2P6RA 1KY3A 4A4DA 1ZJ6A 3RWMB 1FTNA 3EA5A 4DDUA 1W7AA 3UMSA 2QP3A 3SQWA 1Z28A 4DEXA 3JVVA 1QHSA 1UBGA 1BS1A 1P72A 2EFGA 4JS0A 4MRNA 5F9HA 4HUQB 3IHLA 1KDPA 2GA8A 4LJ7A 5JZVA 2ZE7A 4BGDA 1OIXA 4TZ0A 4NTZA 3T61A 1E2FA 2NO7A 2FNAA 3L0OA 4DCNA 1KI7A 3AVQA 1R10A 3SQXA 1ZU4A 3J81k 5H1YA 1QG4A 3Q8XB 4UKDA 2GWHA 3SOPA 3ZIAD 4KITB 1G6HA 1KO1A 2VO1A 2JLWA 1IXSB 1RPZA 1RKBA 3ZDQA 2ZYUX 3OIWA 2QMHA 1IN6A 3AKDA 2JAQA 3L2OB 4QBIA 2QGNA 3ZQJA 4LCBA 3Q7PA 3AB3A 1AA9A 1UDWA 1JECA 1ZVQA 3CX7A 1HV8A 1OV4A 3LQRA 5J4HA 2AK3A 4TMVA 3T1VA 2EVWX 1GUAA 2ZVQX 1GRNA 1Q44A 4Q1FA 3U44A 1PLKA 5DN6A 1T8TA 4N0DA 4IDNA 4UXHA 4MGYR 2D7DA 3VMFA 1VTKA 4FIDA 2ZEJA 3TBKA 4US2R 1T3SA 1OIVA 4CEJA 2GBLC 2QORA 4KO8A 3BB4A 3A6PC 1E6CA 5JSZA 4LBZA 1UKEA 4B73A 1UPTA 4JLAA 2ZSBA 2IHYA 3SN6A 1P73A 4PX9A 1CF4A 3GCGA 1O3YA 3BE4A 1OE0A 5G3ZA 4HLDA 1PLLA 1OFHA 2P67A 1Z0JA 3DHWC 4IDOA 4BFUA 2XXAB 1OW3B 3SDZA 2WWIA 1QHHA 2XTNA 1N6HA 4X8LA 5JCPA 3TSOA 4D2IA 3KJEA 1UDXA 5HR5A 4OHYA 3LFUA 4DC9A 1YR6A 3TMKA 4B43A 5GADl 3ADDA 1T9HA 2LCFA 2RB4A 3BK7A 5JEEA 2W00A 5AJXA 2BJVA 2WJYA 3EA0A 3HWSA 5EP2A 1M6NA 2VH5R 4QRHA 4U7DA 2GXAA 4FW9A 4GRAA 1Z8FA 1E1QD 1X1SA 2PCLA 5DH9A 5FPYA 4HZUB 2Q9AA 3EX7C 3KUDA 4AG5A 3I1FA 2ZJZA 3QXSA 2AD1A 1GNPA 4B71A 3ZLJA 1ZM9A 5BWMA 3AVYA 5LB4A 1NRJB 4LUCA 1M7BA 1PUJA 2VP2A 2WWFA 4XH9B 4DLZA 1SULA 3LX8A 3QXXA 4DUGA 1ZCBA 2C2HA 2FN4A 3Q7QA 5BYKA 2V8OA 4JLPA 1J2JA 4TL8A 3I61A 4UXIA 3PCRB 1T0HB 3NBFA 1M74A 4XVRA 3THOA 2V9PA 4GMDA 5G3YA 4Q21A 1E2PA 1D2EA 1KI8A 2DBYA 1WXQA 1OLOA 1OXXK 4NYJR 5K8LA 4WW0A 1S9DA 2AX4A 4RKFA 4LHVA 1NVXQ 5HPYB 2V55B 1KI6B 3RS5A 2GILA 1KSHA 4B2PA 2AXPA 2C03A 2XNDD 5FPTA 1F48A 3ND9A 1E2JA 3FHOA 1LS1A 1ZM7A 1KK1A 3KFXA 2J7PD 4HDCA 2O0HA 2C96A 2PX3A 2FG5A 3W5JA 5JS8A 4B48A 2C78A 4B3FX 4DBLC 4DLSA 1NY6A 1E0SA 2JLSA 3CW2A 3DKVA 1OPXA 2KBFA 3VR2A 4TMTA 2FMXA 2EYUA 2BKUA 5KYKA 3K70D 2QI9C 2FFBA 1R0ZA 2P2LA 4POAA 2YKGA 3Q5EA 3WNBA 1SVMA 1OHHA 3BIFA 3LVRE 3P4XA 4R2HA 3IQWA 4OBEA 2JGNA 4YLGA 1XTJA 4LC0A 2Q9BA 2PLFA 2FZ4A 2REBA 2NPFA 1KAOA 5GJCA 4JSTA 4R2IA 1MRSA 2QM8A 4F4IA 4EPWA 1XCPA 1XB2A 1EXMA 1ZBDA 3I4LA 2R9VA 4OK5A 1AM4D 1NJGA 3CH5A 4NYMQ 1Z0KA 3QKRB 3EZ2A 3MWKA 2VF8A 1UEIA 2X2EA 3VR6A 1W0JD 4KLNA 1I2MA 2G6BA 2DFNA 5DI3A 1XDBA 2FH5B 3HJNA 1Z3IX 3LA6A 1CBUA 2ZU0C 3MJHA 5GJVC 3AKCA 4GI7A 4PPNA 2W6ID 4XVUA 3QKTA 4DLVA 1SVWA 1AZSC 1W2HA 3G0HA 1G7SA 1KNQA 2VHUA 1G5PA 2NIPA 4RKEA 4YXWA 4WZAE 4C2TA 1KYIA 5BN5A 3T5GA 1CRPA 1W0JA 2VP9A 2WHXA 4IDQA 3AP2A 1M7HA 5H70A 2DR3A 1N6LA 3M0EA 4AYXA 5EP1A 2AWNA 3B6EA 1C4OA 1N0WA 2YVUA 1A7JA 4E22A 2JLXA 2FGKA 2W6IA 1QHIA 1XD8A 1FNNA 3Q72A 1KSGA 3TSWA 2R6CA 2FJUA 2HJVA 2ZRGA 3THWB 4TMZA 2UZ3A 4LHZA 5EE1A 1K8RA 1WE2A 2ZYWX 4H9GA 5KDOA 1X86B 2JCSA 2W58A 4PAMA 1X1RA 2QPTA 4A2QA 1OH7A 2ZR7A 3W5IA 1WDTA 1RJ9B 2ZJ2A 3THYA 1HT2E 4BFZA 3U2QA 4FMDB 2V54A 3R7WB 1FX0A 3H1TA 2KJQA 1XF9A 1NG1A 5A4JA 4QBFA 2V1UA 2CNWD 3GJXC 3U7HB 4JKIA 3N70A 4PC7A 2ODEA 4MGIR 1KHTA 1IN4A 2WM9B 4Q1EA 4JBXA 4WVFA 4OJQA 1GNQA 1KI1A 1E2GA 2RCNA 2B7CA 4OHWA 1JBKA 1T91A 1ZD9A 2QBYA 4IFEA 2QNRA 1E9AA 4JVSB 3EIEA 3T1OA 2ZI5A 4PO1A 5J4KA 5HCIA 3VFDA 2AKYA 1Q12A 3T15A 4BUJA 4C7OB 2P65A 3EXAA 2VRWA 3ZZ0A 3L8ZA 1GAJA 2XSZA 2ATVA 1GWNA 4X8MA 1K5GA 1U0LA 2G77B 1H8HD 3I92A 3LWNA 3PR1A 4CZ2A 2RGGA 4JLVA 1KTVA 5JCZA 2VEDA 3E5HA 1GNRA 3KL4A 4CGZA 3RAPR 1I4LD 4RD3A 4B35A 3K9LA 4D4MA 1JEDA 2JJ1D 1E2MA 2AN9A 3CBQA 4DSUA 4M1WA 1XCGB 4I81A 3TK1A 4XD7A 2WKPA 2GTPA 2VBCA 4BWYA 4Z51A 1V43A 1JPJA 1MH1A 3K0EA 1W0KD 1G4AE 3MCAA 5CIQA 1VIYA 5L3SB 3GJ7A 2RAPA 3T5DA 3I5XA 1SXJA 1CIPA 1HYQA 1OH6A 1E9CA 3GP8A 1KZ7B 1Z47A 2OAP1 3F3YA 1DEKA 4PQFA 1E2HA 2GKSA 4BEJA 3HPQA 3K1JA 4HI0E 5KPJA 3CNNA 2JJ1A 2WWWA 5DI9A 2B6HA 3CPEA 1LF0A 5A5GA 2NO9A 2X19A 4HUQA 1HY3A 1E0KA 2Q6TA 1R8SA 5DYGA 1G8YA 2ZRDA 4CT4B 1L4UA 3EIQA 1YKSA 1MO3A 2DWQA 4DCTA 1LVGA 4PSVA 1PV4A 4RY2A 1GILA 3BFXA 4JLMA 3IUYA 4BLSA 3L0SA 1FOEB 2F1IA 4HLCA 3OFNA 4KBGA 5BYJA 4TTQA 5EXXA 2VHJA 2XZPA 2ZI7A 2D74A 1UEJA 4RZ3A 5K8UA 1KDOA 3O8RA 1E96A 1E98A 5AUPB 3C4JA 4N0EA 1G16A 1E0AA 5LD2C 4DLUA 4F4JA 3P4YA 3EZ7A 3ZD6A 1EFRA 3W3ZB 3EAQA 1D6JA 4KFSA 5LD2B 3A1UA 2ZI4A 3LBNA 4V0KA 2RHMA 1UKYA 4A36A 3X1XA 2ZSFA 4G3XA 2EWWA 4HLUC 4W5JA 1OXTA 1IN5A 5FPSA 1ZNWA 4G0NA 3RVBA 2YNMA 3ZVRA 2G88A 3TE6A 3KJGA 3LW8A 3T35A 3EWAA 2JLZA 1YR9A 1XCMA 3BOSA 3LQQA 5KSYA 2WOOA 3BWDD 2F1RA 4OQXA 3EPLA 4YMSA 2C95A 4IDHA 4PQYA 4MUAA 1CULC 4JKYA 3DOFA 3UXMA 5TXGA 1IXZA 3A8TA 4AD8A 2SHKA 2PEYA 4CEJB 3FVQA 1SXJE 2ZR0A 4PAOA 4HDOB 4A2WA 3AQ4A 5JSZB 3HU1A 3R20A 4PC2A 2VSFA 3KB2A 4MGZR 2GBLA 4B74A 2R6AA 4OQMA 1D9ZA 4OK3A 3L0IB 4QNMA 1P2UA 5EZ5A 5TDHA 3VHLB 4D82A 5KU1A 5GJBA 4IOLA 5EUQB 2PT7A 2XXAA 3SZRA 5JRZA 1A1VA 2WMNB 1QHHB 1G8GA 2ZE8A 2BBSA 1TADA 2E9SA 2IBMA 3EIHA 3HYTA 5EE9A 4B3XA 2WWXA 2XITA 1ZUNB 4NBSA 2C8VA 3TW4A 4Q03A 4LJYA 2QG6A 2GEDA 5AUNB 1XTSA 2BOVA 1DBSA 2OLJA 3FPAA 1DELA 2CE7A 1J70A 4QXAA 2AHOA 4PZLA 3KB1A 3G5UA 3EPHA 3A1WA 3CPHA 3SJAA 4D0GA 3NBYC 2FPLA 1U94A 2OAQ1 3K9NA 4HZUA 4CDGA 1RZ3A 1ZRHA 1ZAKA 3RSOA 1JR3A 2C5LA 1JQJC 4BLPA 1SVKA 2OLKA 2WBLC 1MO4A 3AUYA 3KKQA 3K0SA 4Y0VA 5JMTA 4LJAA 1U99A 2XZOA 2GJKA 4PFSA 4ABYA 1NG9A 2Z5FA 3BD9A 2QP4A 4LYFA 3UIEA 2WAYA 4I1SA 4LDJA 3REGA 1MR3F 1A4RA 4IXMA 4HAXA 1UFQA 1CJVC 1OYWA 3E70C 3ZVMA 5C18A 2PBRA 3H86A 3WYAA 3MUFA 3AUXA 1KI6A 1DO0A 4YMUA 4MYUA 4DLTA 1DAFA 2QROA 1G3IA 5CDFE 4AKIA 1GL9B 3WRXC 2MMGA 4Z8XA 2ZYTX 2ZXUA 4JIMA 1AS2A 4WAUA 1P6XA 2NO1A 2OXCA 3WMEA 2ZJYA 4M2LA 2P6NA 2P5TB 5EP3A 4YMTA 4D0NA 5KNDA 5FTNA 1FP6A 5JJKA 1JQLB 1T6NA 3UMFA 1N6KA 1XEWY 5SZKB 3ZS9A 4IEIA 3K09C 4B33A 4QJ5A 4U5XA 4C0JA 4PZZA 3WRYC 5FPHA 1QRAA 4FD2A 3CH4B 3OEEA 4QHSA 4GPTA 4XWKA 1RC8A 1TQDA 3B1XA 1IBRA 1R0WA 1XTRA 1XPUA 3WYGA 4KU4A 4G5QA 1QHXA 4ZI3A 5KOYA 2J9RA 2GDJA 3DPUA 1EX7A 5B57C 1TEVA 2LWIA 2AFHE 4Q4JB 4G5OA 4TMXA 1W4BA 1XBTA 3SE0A 3AGPA 1US8B 2ZSDA 2EFCB 1JR3E 4ESVA 1JAHA 2YINC 3BXZA 3TR5A 2PZFA 4BZXA 1M1YE 1KDRA 5FPKA 3KKMA 4LZZA 1T4GA 1W44A 4Z1MA 3TQCA 1P3JA 2DPXA 3DKPA 2ATXA 4XSGA 1P62B 4W7SA 3C15C 3D8BA 3GMTA 2A5YB 3AF3A 5C1BA 4LV5B 4RD1A 4FMCF 1KNXA 3EC2A 4TWZA 2HT1A 3L43A 4A82A 2VHQA 2EQBA 3H2YA 4G5RA 3TAUA 1YZGA 4LRWA 2J7KA 2CEAA 1NBMA 3KKOA 2ODNA 1Q0UA 2GK7A 2PJZA 2Y8EA 3DEFA 3X1ZA 4YMVA 1TTTA 3UANA 4NU0A 5DYIA 2ORVA 3C5CA 1W49A 4PAQA 4DIEA 1RRCA 2A30A 4Q01A 2VHTA 1Z6AA 2FSGA 3VNUA 4UXJA 4M1KA 3QF4B 1OH8A 4PXAA 2V1XA 4QBHA 3SYLA 3ZJYA 2CXXA 4LC1A 3UWKA 2R8RA 3BAFA 4KHZA 4Q48A 3THWA 3B2EA 5DE3A 2DCUA 4JLOA 5AR1A 2ORWA 2QTVB 4MRPA 5TV2A 1DTSA 1OB5A 2QM7A 2XGJA 1P9WA 1ZUIA 1SZPA 4E5UA 4Q9JA 1GL6A 4A0GA 4EKDA 4Q9IA 3Q85A 3QKUA 3R7WA 1IONA 3EWSA 4ZV4A 3DZ8A 1AQYA 4LHXA 1G3RA 1E9FA 4KYUA 5L3RA 2YWGA 1FZQA 2RGAA 2GETA 1E1RD 4QGHA 5AK0A 4RFSB 5GJWC 2IS1A 1E79D 1L8QA 3EG5A 1Y3AA 1S8FA 3CX8A 4DVGA 5JECA 2OG2A 2QRNA 4MKGA 2JATA 4BPBA 3WP0A 2O8DB 4E09A 3H4MA 5K8TA 1Q1ZA 3BERA 1YHNA 2ZJ5A 3NH9A 3NVAA 4FMDF 1U9IA 4DWJA 3ICEA 2F1JA 3FMPB 3IEVA 1W2GA 3B78A 1XEWX 3ETLA 3GEHA 1F2UB 3QPWA 4AWXA 1CR0A 4OI0A 1S0UA 4C7OA 1Q1EA 2F1HA 1ZUHA 4I1UA 4TLDA 5BXQC 2K5UA 4DLWA 2C99A 3PEUA 4JZKA 2YC2C 1PLJA 1X8JA 3IEUA 4IHQA 5AWFC 4A9AA 1L2TA 2FFHA 2I4IA 1CR1A 4YONB 4IEEA 3RS0A 5HZKA 1EESA 1LFDB 5EE0A 3RRMA 1Z6XA 3WXMA 1GIAA 1FL9A 4L5BA 2VQSA 5AUQA 4ESHA 2IL1A 1GOTA 2ODBA 2ZI3A 3V9PA 2ZRAA 4F93B 1QG2A 1NBME 1FUKA 2W0SA 4IDPA 3NEJA 1YE8A 2Q0HA 1EGAA 4BFSA 2BC9A 1SXJC 2HF9A 3SHFA 3MG9A 1SHKA 2JDIA 2OESA 2VP4A 1E2KA 1SXJB 1KK0A 4JVLA 5L3SA 5LPNA 1UBCA 5CM8B 4NCIA 1IY0A 4X8OA 2Z4SA 1R7RA 1GL7A 1KJYA 5SZHB 2QAGC 1XEFA 1SVIA 4LK2A 3RS2A 1I2DA 3JVUA 4C0SA 3OAAA 1R6BX 1TF7A 2QAGB 4GMXA 4ZCMA 2ZRJA 4NONA 2CMKA 3LX5A 3UPUA 3QF7A 2EW1A 3LRPA 1D2NA 4ZKDA 5F3WB 4CIDA 2QZ4A 3N2IA 1ZINA 1E2NA 1XMVA 4QNRA 2QQEA 4XIGS 4XVQA 3U61B 4CF7A 1YR8A 3T12A 2PEZA 2ODWA 3VTKA 4ASUD 4EUNA 1KO8A 1R8QA 1G3UA 3U3RA 5L3QB 5JJIA 1MO5A 4II7A 1GKIA 1Q20A 5AUOB 3QXJA 3KJIA 3BFKA 2FPMA 1M7GA 3TUZC 5DN6D 5TARA 1S3GA 1J8YF 2Z43A 4MGKR 3BS4A 4KV9A 3QEJA 2UKDA 4AC9A 4BFVA 5E7IA 1G4UR 1R2QA 1CXZA 4ASUA 4HLUA 4MRVA 3V00A 3PUWA 4CW7A 2IS6A 5JWOA 4D25A 1RFLA 2GJAA 4ZDKA 2B92A 1W4RA 2FX3A 4Q9LA 3PUZA 2FF7A 4LJ5A 1N5LA 3SJCA 1CU1A 3FYHA 2ZPTX 1OXSC 3SR0A 4C9BA 3SC3A 5DO9A 2ZI6A 1G1MA 1F60A 1Z2CA 4RFVA 4XWAA 5D3QA 1JJVA 1T5LA 1NL3A 2ONJA 1II8B 2A7QA 2QPAA 1VG0B 1ZIPA 2QTFA 4MKIA 2QY9A 4MITA 5CK4A 5SZIA 5FUVA 2QT1A 4RVCA 1L7VC 5D3MB 3LH5A 4TLCA 2DY1A 1DAEA 2WJIA 3ZZTA 3PEYA 4LPKA 1M2OB 4TL9A 2REOA 4UQOA 4KBFA 4BFWA 3QIAA 4HYYA 1N5KA 2DWPA 2CHQA 3CRVA 1NMZA 3FKSA 4DUGD 2UVQA 3MFYA 1TX4B 4DEYA 1MABB 2AWOA 4NCKA 2TMKA 1GFIA 2V6JA 2XTZA 3A1TA 3V4FA 1EFUA 3BBPA 2QMUA 4C30A 1DOAA 4TLEA 1D9XA 3ZVNA 1CKEA 2GEUA 1UJ2A 2RGNC 4FWTA 4G1UC 4AIIA 4RZUA 2CDNA 3VX3A 4BLRA 3AVWA 1W5TA 2ZRNA 4AY2A 1NI3A 3HR8A 4UJ5A 1TQ6A 4J0QA 4JLBA 3OE7A 4B32A 3FMFA 1QF9A 4DSOA 5AJVB 3FHCB 4US0R 3CRMA 4K8OA 1TNDA 5FTKA 4XTRA 3FMIA 1CJKC 1U8AA 1D2MA 1Z29A 4OI1A 3RC3A 4EJSC 5HE8A 3HU2A 4DLXA 4TN1A 4YMWA 4EJSB 4JMPA 1CS4C 1CEEA 3MWJA 2ZUBA 3KX2A 1OHHD 1YZTA 1VHTA 1NKSA 1XTIA 2QN6A 3A4MA 4QHTA 1GTVA 1VYUA 1II9A 4D6PA 4NL4H 2XTMA 1Z63A 1QVAA 3EZ9A 1TUIA 3CF2A 1ZU5A 2RGEA 3VR3A 1E9DA 1YRBA 1DG1G 2HXYA 1X3SA 1G5RA 2WIAA 4BE7B 4D81A 3VR1A 5CITA 4EFMA 3IILA 1KY2A 3GEEA 1Q57A 3V4RA 4QFMA 2B21A 4B6FA 3ZVLA 1P9NA 1G19A 2ZAOA 3QJYA 4D0LB 5JWRA 1F5NA 1OKKA 4RZ2A 5E7MA 3PXGA 2CHGA 2D3WA 2R44A 4URVR 2YWFA 3IPXA 4LYJA 4KSBA 5AJZA 3K09A 4ERNA 1J8MF 4KFUA 4O3MA 4O2LA 3TRFA 4EFLA 5BN4A 5DNYB 1J99A 2VP5A 2JA1A 2IYSA 1J7KA 3LXRA 2GVDC 1B0UA 3SFVA 1FMLA 3K0AA 4P3YA 2DWOA 4GL2A 4TYWA 2H18A 1XJQA 1IXRC 2AL7A 2BM0A 2IK8A 3KDSE 2BDTA 4CRWB 2WAXA 2QGZA 2IYLD 4Q4JA 4YXWD 4GT1A 3ICQB 2E1RA 1A2BA 2RGBA 1R5OA 2J0SA 1US8A 4TL7A 3IIKA 4AYWA 4BLQA 1VECA 2WV9A 4JLNA 2F6RA 3TUIC 1WRBA 4PC6A 4JVMA 1OJLA 2CJWA 3B1WA 5FR2A 4DDVA 2PX0A 2WMOB 4DDTA 2OFWA 1H8ED 1CRQA 1HEIA 2ZANA 1P2VA 3BH6A 3S1AB 621PA 3AVOA 2YC4C 1GRRA 4KODA 2QA5A 3CZPA 4TSFA 4ITRC 2PCJA 5LB2A 5HKKA 2J45A 3TVDA 2WWYA 2V6IA 2GJSA 4LGMA 4JL5A 5FOXA 1YZNA 1ANKA 1NN1A 3A1VA 3MSXA 3RRYA 4DCVA 2HCBA 2OFXA 2GF9A 1BH2A 3KXKA 5G40A 4AG6A 3FHTA 3D6TB 2WJVA 4URXR 2HDNB 2GXSA 5L8VA 2YWHA 3UG6A 4DSNA 3MRSA 3RS3A 2IYQA 2G9NA 2H17A 1P7CA 1S2MA 1H8EA 3QF4A 3AP1A 4NZYA 1XMSA 2ZQ5A 5FI0B 3UATA 2PH1A 2X2FA 4TZ6A 3GQBA 5B2ZA 3PIRA 4V0NA 5J5CA 5EXPA 4URUR 2QEQA 2GF0A 1NY5A 2O8BB 1XNJA 2FFAA 2OM2A 4IRUB 1UBEA 1AGRA 4ARZA 3M4YA 3K9HA 3I73A 3VKGA 3VQTA 1NVUQ 2J0UB 3WNCA 5EUMA 1Z0IA 1ZC3A 2XSZD 3CM0A 2IXEA 4A6PA 2J3EA 4RFSA 1VIAA 2A5DA 5J47A 3KXIA 5FOUA 1U9IC 4GBMA 1NVVQ 4MKFA 4AKHA 2O8DA 4Q19A 1EWQA 3VU9B 1GRQA 4QL3A 4RSGA 2BCGY 1E2QA 2A78A 2D62A 1DO2A 3LXXA 1WBBA 4V03A 1P4SA 4QM7A 1Z22A 1F2UA 1Z07A 2RMKA 1U98A 2AR7A 1S3SA 3QE0A 4P31A 3RRNA 3N2EA 1VCNA 2R6GA 4URZR 4XD7D 2H16A 4D4LA 5CM9C 2YZ2A 3ZS8A 3QKSB 1HH4A 4ILEA 3B9QA 2CVHA 1GDDA 3MMPA 4DHEA 4B3GA 1Z0DA 2XOKA 2IYVA 4M1YA 4C2UA 1SXJD 1NSTA 3WHLA 4CYMA 1G5TA 1VG1A 1NN0A 1XXHA 4WZ6A 4V0OA 3KFVA 3T1TA 2R6DA 4AURA 2IYXA 4MKHA 2JLRA 1VPLA 3AF2A 1CJMA 4KLZA 4Q4HB 4TT3A 4IXNA 5M04A 2OCAA 3RWOA 3KTAA 1XJCA 4B6EA 4GOJA 4UNPA 4OHVA 4RCYA 2RKOA 1U90A 5E7JA 2BMFA 2XAUA 5HZHA 2DFLA 2WPDA 2HT6A 1M8PA 4IFBA 4D26A 4YC7A 3TR0A 4LOAA 1AN0A 2GRJA 2W6JA 2N42A 3HP1A 4UNQA 2QQ0A 4E07A 4M0LA 3OFND 4JL6A 2GCOB 1ZD8A 5EXTA 5KSPA 2B8TA 2X1VA 3DOEA 3R9WA 5FBQB 2FFQA 2O52A 4L9SA 3AF1A 4QJ3A 2ZRMA 4EAQA 4CVNA 1QVRA 3U60B 2QAGA 4C0KA 4HAVA 1EFRD 3NG1A 2R62A 4ZPXA 5FR1A 3U7EB 3DL0A 1PVOA 4M1OA 1KJWA 3PQCA 2ZRKA 1YR7A 4V0LA 3F0TA 3N5CA 2OFOA 1W5SA 3O47A 4Q1CA 2YHSA 4EPYA 5LBIA 2BBOA 1G7RA 2WJJA 2F43A 3IQXA 3SJBA 1G64A 5L3QA 2E87A 4TYNA 2JLQA 1IAQA 2ZIAA 1DVRA 3FOZA 2VP6A 2ZETA 5HE9A 1DG3A 2OHFA 3SBEA 4CEIA 5JEDA 1NMYA 5SZJA 2AKAB 2YV5A 5ANRB 1MO6A 5J40A 4QHYA 4PTLA 4NE2A 1XXHE 2PZEA 3CWZA 3IPYA 1KKMA 4GP7A 5TVKA 1VYTA 3TGPA 3K53A 3CF0A 1IY1A 2DHRA 2WWGA 3OIVA 2VLIA 3HU3A 1NIJA 4KVAA 4OQNA 5DSZA 3WBKA 2J5XA 1QZXA 4KAXA 3BH7A 1Q22A 4OYHA 1S1MA 2NO0A 2D2FA 2HJGA 2J1LA 2PL3A 4OJKA 5CDFA 2O8FB 1R4AA 4ACBA 1Q3HA 1RRFA 1TMKA 1YZUA 4W5WA 3K0FA 2GJ8A 2VL7A 3PG5A 1II8A 2BMEA 2FSFA 1A5TA 2N46A 3CR8A 4IOKA 3P1JA 1IN7A 5EQTA 3ASZA 4G01B 1VHLA 5D3MA 5AJYA 1HT1E 5FOWA 3RLFA 4NYIR 3NC0C 1T8UA 3WMFA 5B30A 3LLMA 3BH0A 2NQ2C 4PZYA 1JR3D 1U8ZA 2G3YA 3MJRA 5CYPA 2CCGA 1I4DD 2IX3A 1EFTA 2NO6A 4DCUA 2OV2A 3K0CC 3VHXA 2UZIR 4D4KA 1MABA 1ZNXA 2ZSAA 3E2IA 2HUPA 1HTWA 3SI7A 4QM6A 4Q66C 4D80A 2B8WA 1WBDA 3B82A 3A4NA 1RYFA 5IK2A 1SVOA 2NMVA 3CUEF 4URYR 4XOIA 4B3CA 1AQUA 2FOLA 2JIZA 3CB4A 4GNKA 4UNSA 4Q9HA 4A0HA 1NSFA 3ASYA 2GXUA 2WKQA 2J41A 3EARA 2ANCA 2RGXA 3GLHB 3QG1A 4DXAA 3FGNA 5DHAA 1JXMA 3KKNA 4ACAA 4BZPA 2RGNA 2R65A 1KKLA 3Q5DA 4NMMA 1E94E 2J59A 4MRSA 4JLJA 2A5JA 3F5FA 5IHPA 1XX6A 2ORIA 4WOPA 3A4LA 1P9RA 3ADBA 4EQ6B 4XWOA 3MLEA 2O8EB 3LBIA 3JZAA 1R5BA 5IDVA 1G7TA 4MQBA 1KK2A 2FE4A 4O0MA 1OIWA 2GCPA 2CHVA 3PJRA 3X1WA 1F3OA 4Q4AB 3AVVA 1T5IA 2BJWA 5C46F 4EJSA 2ZITA 3NKVA 3ND8A 4NP6A 2IC5A 5TMPA 4OL0A 3OEED 4GOKA 2QAJA 1JNYA 3TQFA 3CONA 4DB4A 3U7FB 4O2RA 4NPHA 3NHAA 2LKDA 1ZC4A 2Z0MA 2BEJA 1IQPA 2V7QD 3DVLA 5EE3A 5JHHB 5CYOA 2W2VA 2XJ9A 3C16C 4HZIA 3CLVA 4LJ8A 121PA 2ZU6A 4BLOA 1DAGA 1BO6A 1Z0FA 1Z08A 1QDEA 1LW7A 3B9PA 3P32A 4HB4A 3TLXA 1WP9A 1ZNZA 3L0PA 4HAYA 3U3OA 1YU9A 2JJ2D 1R0YA 3I3SR 2ZAMA 3RRZA 3VAAA 1W46A 3FKQA 2GXQA 4Z1MD 1XTQA 1ZM4A 2V7QA 2MSEB 4M9SA 5H68A 3ADCA 3K0AB 5FH9A 1QBKC 1HUQA 2FSIA 4TQ9A 3GD7A 1LF5A 5UKDA 3W34A 4R71A 3TH5A 1BYIA 4W5HA 1KGDA 3JZMA 1GVNB 1NBMD 2BBTA 2FU5C 4TTRA 4ZKEA 3W8NA 3W6PA 2JJ2A 4R98A 4A15A 3U6BA 3AVPA 1BMFD 3PENA 2CJWB 4YDSA 4BFTA 3ZD7A 1FPMA 2VPPA 5H8WA 1MRNA 1KDTA 1CR4A 2W2XA 3F8TA 1N6RA 5KSZA 2C77A 2Z6VA 3FDIA 2CLSA 3VR5A 3S1AA 2LKCA 3AVXA 3WMGA 2GCNA 4I1OA 1E99A 2YWEA 4KFTA 4X8HA 2IUUA 5FBWB 1NF3A 4M4SA 1UF9A 1YVDA 1PJRA 5LDDC 2EU8A 2VTKA 3VX4A 5KDDA 5EE5B 1BMFA 2IYWA 2J87A 2QSZA 2C9CA 3LV8A 2PZGA 4PSKA 3NBZC 3RANA 3KQUA 2PLRA 3A58B 4RCZA 1NIPA 2R6FA 3ZZUA 3B1VA 4HATA 2O8BA 3GJ3A 4WBSA 1BOFA 4XJXA 1TF5A 4ARZB 5BN3A 1NLYA 3B7GA 2C9OA 4BRWA 1VG8A 2N1BA 2J0UA 2D06A 5CJ2A 2XNSA 3PEWA 2ASEA 4IVPA 2ZYVX 3GLGE 5J4VA 1HURA 5DLQC 3NC1C 5JBQA 4KSCA 1OF1A 2QMOA 4PO8A 2ZS8A 2ZR9A 4QGGA 2P6UA 4KJZA 4UNNA 3VU9A 2REXB 1T0JB 3DMDA 4BECA 2HV8A 1JR6A 4M21A 3OEHA 4H1VA 3AGQA 4JBYA 2IA5A 1U81A 2GZDA 2OSBA 1FFHA 5FL3A 3WY9A 3D3QA 2QE7D 1OXUA 2WICA 1W36C 4LWZA 2F55A 1HE8B 1N5IA 2G0TA 2RH5A 1W36B 1OT3A 4Q1BA 4QKQA 2IYRA 1AS3A 1Z06A 1EFCA 1Q1QA 3QKSA 1Q3TA 3U3KA 2FZLA 4GFDA 1COWA 4DLRA 4D4JA 4PPQA 1II0A 2JDID 2F9LA 4KCGA 4LBYA 4HEJA 2L0XA 3A1SA 2ZRCA 2OZEA 1DARA 2ECKA 3L82B 4NYMR 1XXHB 3IHWA 1VYVA 3WNDA 1V5WA 3C14C 1TU3A 3GJ0A 5FUWA 3W3AA 4HSEA 1NMXA 2GZAA 2QE7A 4Q4HA 4IVRA 3IDQA 3ZYCA 1G9XA 3KTAB 1OXVA 2EWVA 3AF0A 2NPIA 3B1YA 4A8JA 4OHZA 1KIMA 3OAAD 3TAHA 4IVQA 1AJEA 4ZDIA 3KUCA 2GAOA 1G21E 4TMKA 2QMEA 2IF2A 5FOSA 4P0TA 4M9XA 2YOFA 1E2EA 2QP9X 3TSZA 4TYYA 5F9FA 4R7ZA 2GCOA 3QPUA 1NLZA 1XFAA 2OE2A 2W0MA 3CWQA 4OI2A 5FUXA 4NHOA 4XSHA 2ZUCA 2H1LA 3B8HA 4S35A 2DFKB 4Q4LA 3HR7A 3P27A 3RS4A 2IWRA 3AKYA 2F7SA 2WOJA 4HAWA 3GJ6A 2EFHB 1ODFA 3O8CA 4GOXA 2ANBA 2FEOA 3K8YA 1ZYUA 2CL6X 3HYRA 4OK6A 5A0FA 3NTUA 4JT4A 4MYTA 2C9YA 5TY0A 3RNLA 5CB6A 4RD2A 2F43B 4LHYA 1YZQA 4G5GA 4Y0AA 4Q7JB 2ZSEA 2IT1A 2C04A 4LHWA 4TL6A 3CF6R 3EZ6A 2OBNA 3GLIB 2XX3A 1KMQA 4GZLA 4CEIB 1ZCAA 1NVVR 1X8KA 4K81B 1JEEA 2HYIC 1EG7A 3VNVA 2XEXA 2ZI9A 4A1FA 4OQLA 3W8RA 4PHHA 3B60A 2QL6A
chains in the Genus database with same CATH superfamily
5AI6A 5JJBA 1VE9A 5HDBB 5IANA 5IT5A 2EFEB 2G1KA 1MZPA 4J1TA 1CJTC 1XC7A 3SX4A 4BNUA 1B8NA 1DCTA 4X24A 4ED9A 3UFXA 3R75A 3MJ4A 4HH3C 3GFGA 2HSJA 3PD7A 4J49A 2C5SA 2JLVA 4NDAA 3V7YA 5JRDS 4L5AA 2R68A 2QVZX 2VYCA 3EOZA 3TG8A 3ZQ4A 4LX0A 4R0NA 2L69A 3OD1A 3IL2A 1Q21A 3RODA 4QOFA 1P5JA 1ND6A 1XPOA 1KZGB 1KQPA 3LCCA 1A9QA 2IPOA 1P2TA 4H6XA 4KO3S 4QUIA 5DDIP 4W9MC 3AEUA 2EQAA 3G02A 2Y1XA 4DTCA 2O20A 4G4JA 3QKWA 1EP9A 1IK4A 2BFDA 4QWMA 4XAQA 2A3RA 2HWXA 3A06A 3PUVA 5CVEA 4B17A 4ENUA 2VRCD 4G07A 5DHFA 4DRXA 4JLKA 1JJ7A 4IVNA 4ZT3A 3QVUA 3MCUA 4WASA 2PNFA 4LA4A 5F2KA 3R9KA 1H2FA 4TKUB 3AI3A 3NLLA 5K45A 5F3DA 5A0VA 2WFZA 1DFIA 1MPXA 2FEPA 1JE1A 1ULUA 2YWXA 2XDYA 3OE7D 4A6XA 5E1BA 1OI7A 3D3NA 3C3CA 4O4LF 3K0CA 1FP7A 4FKMA 2R1ZA 3NHUA 3KYBA 4GLLA 1GZUA 3RBXA 1PNTA 3ROZA 3QU9A 5GY7A 1BE0A 3AFGA 3D9QX 3ZXXA 2MSDB 2X15A 1YRWA 5TPZA 3VYRB 3MLBA 1GGHA 2I7TA 4AUKA 2ZRHA 3CURA 2I29A 3MMXA 5ELXA 5F3RA 4E1BA 1J42A 3EEQA 3EEOA 4ILKA 4WI1A 2JL1A 4B4KA 4NLLA 4EQ6A 5CX1A 2B5WA 4NABA 2QIPA 3VR3D 5IN4A 4BNYA 4KPEC 4ARCA 2Q3DA 3DYVA 1XMJA 3O8BA 1I6KA 4L0QA 1HBJA 5DYNA 1YIAA 3EAGA 2VDQB 1QH8B 3DL2A 1XRMA 4GWLA 4J16C 5D86A 3AIMA 2QM3A 4K0KB 1KL7A 1T3HA 2AVDA 4ZOCA 1K9VF 2PL9A 3PXAA 3P9RA 2NU9B 3VNBA 3ZYZA 2Z2KA 4QGFA 2ZJAA 5LJIA 3KLMX 3CGGA 3EMDA 3TBFA 2XE6A 1OFTA 3IKJA 2H8GA 1F2TB 4OHBA 2FMTA 2YW2A 4PHFA 1CY7A 5FWNA 3LI2A 1I7QB 3IV6A 1AF7A 4JEUA 5IF9A 3G17A 3L8MA 4YRTA 1W1UA 1E1QA 4QU5A 4ZVRA 3TIFA 3H9GA 3IEIA 4D0RA 2AF3C 2XMZA 2HRBA 3A1FA 3HJTA 1YA4A 4M1SA 2JGIA 1FNDA 2O5VA 3RYIB 4DV3B 4BGIA 3LQ2A 4CTKA 1Q15A 3NVKI 3K8OE 1G2OA 1USKA 4MS4A 4N18A 1M2KA 4F6CA 3GLGB 5ICCA 2O9JA 1QGUB 2CVOA 1FMFA 3VZCA 4X61A 3LLUA 3QUAA 5THQA 2HQ1A 2PJRA 2BISA 4CLXA 1W2WB 1OMOA 1ZH8A 3KV1A 4KR9A 2HLPA 3IP3A 1L5LA 1NSYA 3AQIA 5T3YA 1TU4A 2BEKA 2PT6A 3HFJA 1U6JA 2FSHA 2VBGA 1ODIA 3M6AA 2XNDA 2J9ZB 1ZK0A 1MPTA 2CL0X 2F8LA 2RGDA 2HRQA 4ZYVA 2WM2A 1YVPA 3RSSA 1U2RA 4BQEA 5K0TA 3VNAA 1G3QA 1OZAA 2G0NA 1U1GA 4BASA 1TCCA 1HYHA 2B7BA 2DBZA 2Z56A 3BRWD 4M1TA 3NOQA 4X54A 2R86A 5HF6A 3QFCA 3KQHA 1NLUA 4KXYA 3ROFA 1CUJA 1E2UA 4A91A 5FT9A 4C2AA 1EDBA 4EKIA 2K7FA 2GD0A 3E2PA 2RFLA 3JD1A 4JLDA 5JMWA 2FZWA 2HPAA 4YS6A 3LT0A 1KSJA 2PKEA 3E22A 4GGOA 1P60A 3Q0EA 3K16A 4X92A 4B3RB 4DSTA 2NWQA 1IY8A 4FFSA 1KO7A 1Z88A 2YCBA 4GX1A 4YROA 1E18A 1TZBA 2FVYA 3BRWA 1A71A 1QOZA 2ZT5A 4WDRA 1G21B 5G53C 2QLJA 3AHJA 5K2MA 3D7LA 3ZDXB 1C30B 4HTFB 4V38A 2WVJA 4YI3A 3V8PA 4D8XA 4E6EA 2VDKB 2MYNA 2PV7A 2Q4EA 3OZXA 3QVSA 1JHRA 2ZROA 4RZIA 2B82A 5EINA 4BNWA 3H84A 3R8FA 4X97A 3WGYA 1YVUA 2IYUA 4O4HF 4P9NA 5F73A 3RDPA 4CM4A 4E1AA 1Y3CE 1EFPA 1QHNA 2PZ8A 3R3UA 1RWKA 4I4IA 4Q5IA 4FGJA 4IUCS 1QYRA 3OCUA 1N6PA 1UINA 3H65A 3HI6A 2HBZA 4RVSA 4PBRA 4ZGWA 1XD2B 4K2HA 3IAS1 4JUAA 4UOQA 5DGTA 3HYLA 4GKAA 3R76A 2JKVA 4U7HA 3AOGA 1AKNA 3ILYA 3EBPA 3LX4A 3OCVA 2IIQA 2OBLA 3ESBA 1QMGA 4XUDA 3O94A 3SIWA 5EZYB 4PANA 5CLIA 2Q4RA 3IE2A 5AICA 1PU2A 3P9QA 1XA3A 4FCTA 3CRRA 1U2ZA 2WR8A 4JP5A 2I4OA 1N1DA 1QHEA 5P21A 3ZJ5A 5I9IA 1PZNA 2DMRA 1C3OA 2HMAA 4ND2A 5K3SA 3THXB 1NQTA 1DX6A 5DZSA 5IMSA 3GWGA 1UK6A 2D4HA 2G83A 3DULA 4EJ6A 2GBFA 4ENTA 1Y6GA 2JEOA 3B5IA 5DTQA 1K98A 4LI0A 1GVHA 4WLNA 1RQLA 4MLDA 4V2IA 1XQ9A 2GKOA 1UM9A 1KJZA 1WM1A 5EESA 3DFMA 2VSOA 3IYLW 4OHKA 4ITUA 4US1R 3CFYA 2O1SA 3GYBA 3LNCA 4O25A 5HRUA 3ZZNA 1IUNA 2POQX 1Z7BA 1DWQA 4BLTA 3GEGA 4LTNA 5LYJB 1BDJA 4JYAB 1HYEA 1M5TA 1S96A 1Y3FE 1XE3A 4PZAA 4ROSA 4TZTA 1VJ1A 3ANTA 3E5RA 3HDQA 4A8JC 2H06A 4ZEMA 4N65A 2BSXA 4F91B 4A8JB 3HRIA 1HRDA 3W9YA 3CNOA 1G8MA 4N39A 4KIWA 5JNTA 2FX5A 4TQUS 4J4BA 2G7MC 3KC2A 3IBCA 4FGLA 5FUYA 4G86A 3IRVA 2JAUA 3NZEA 3L8YA 4TM7A 5SYAA 3WHKA 4C03A 5CLQA 2XQJA 1V47A 1PX2A 2Z8YM 4ZAVA 5IKEA 5J59A 2ZUVA 1GSIA 4TYQA 2QW8A 3X1YA 5KNDH 3AEZA 1G98A 1Z6TA 4QJBA 2MINA 4KI0A 5A4KA 1KDVA 1TFUA 2HHHB 4KWHA 4JBWA 3KEQA 1I94B 2NG1A 2JJ8A 3LAWA 4LJSA 1QTRA 3KR1A 4YI5A 3TRKA 5KS2A 3HUTA 5KNCA 4ZODA 5AXBA 3QX9A 4C0HA 2IXFA 4BMDA 4IX9A 3B5JA 5F98A 4A7PA 5D5HA 4C0QC 6GPBA 4OYLA 1XEXB 2VSXA 3RYTC 1XRSB 4DFDA 4EX6A 5AKEA 3QX3A 2JW5A 5CURA 3NHFA 1P5ZB 2D4AA 2MDTA 1E4VA 1ZM3A 4OFBA 1FMJA 5DLEA 3KFLA 1M2VA 2OHHA 4ZCLA 5BQPA 1G20E 2BFEB 4XIYA 1KYVA 2AFRA 2QRZA 3DO6A 4XIIA 5J43A 3X0DA 4NNJA 2H7VA 1TO2E 3FYCA 5FV4A 3HCOA 1W0KA 2D2XA 4BNJA 2XT6A 5FPPA 2ERXA 5JRJA 1LS6A 4FX5A 4P3PA 5C5DA 3HBNA 5KHOC 4PG7A 5HBGA 1FC0A 3AV0B 2H29A 3H19A 3LY5A 2RJNA 4FKZA 4AJ9A 3TE7A 3RUCA 4EMTA 3NJRA 1JHVA 2OKGA 1I13A 4G25A 4GE0A 4XDHA 3ZQKA 1WVMA 3TL3A 1EK6A 3GPCA 4J43A 4ZQHA 4HUTA 3PUXA 3AVTA 3FN4A 3F3KA 4AUEA 4IKEA 4ODIA 4OLAA 3BSSA 3GLQA 4AG3A 1JI0A 1VXRA 3MERA 1O9HA 4FMBB 2DUUA 3SU8A 3UFXB 2BH2A 1DC5A 3DS8A 4LKOA 4KZKA 4AIRA 1OLSA 1NI4A 2X7HA 4U02A 1BXRA 4ZI7A 1M34E 3I2JA 2K7ZA 1V9SA 3SBOA 3PNPA 1WMDA 1KAHA 4C07A 3ENWA 4LYAA 4J0KA 2IHJA 2QPLA 3LKBA 5ALEA 1VZ3A 3IIIA 4O2BA 3JRWA 1CR2A 3L5OA 1Z83A 3LM8A 1E6UA 4ARSA 4EW3A 2HN9A 1R88A 2VSYA 1DJNA 3QA3E 2VXOA 5CLFA 2BFDB 2QV0A 1QZ3A 5TT0A 1JKIA 1TYDE 4BTEA 4WUVA 2BV3A 1MENA 4PC3A 4KQXA 3BIWA 4RW0A 4H2DA 4BFLA 3DVQX 1HE1C 3PQDA 8OHMA 3D7MA 3PX7A 3HC7A 3P0EA 4C7MA 4WXPA 4M87A 4KYTA 4DPKA 1C8LA 4C4PA 3T06B 3F9IA 1R00A 5A1TA 1J24A 5HHTA 3GB9A 1MC8A 1FTQA 3G8YA 4X3CA 4XOUA 2A2ZA 2C1ZA 4PNHA 5AO9A 2PSSA 4AKEA 3FZGA 3GROA 4NECA 4J0JA 2O0LA 2JI8A 3O8NA 4FU0A 5EJEA 5K8IA 1HTTA 1HXHA 4CKYA 1Y8QB 3JQ8B 3SX2A 1JLHA 2YHIA 3AF4A 2Z3ZA 3PHJA 2QUHA 2AOTB 2V6GA 2XGMA 2DPHA 3PJEA 4MUHA 4PG5A 4Q7KA 3HPRA 5CJPA 1BSVA 4NK4A 4ZRNA 3S2UA 3UMGA 4DT1A 3BFJA 1LLFA 3WIDA 1Z2AA 2G9VA 4C0BA 3O0DA 1KQNA 4E12A 1BA3A 1GSHA 1W5EA 2IW1A 3FNGA 2E55A 4IS2A 1ADFA 4B9EA 3TLYA 4JHXA 5CFMA 1Q7GA 3T5CA 1GFSA 2NN3C 3EW9A 1K4MA 2A9KA 3I8XA 4F06A 4ETMA 1SUWA 4MCJA 1ZH4A 1ZMBA 1XA0A 2GLTA 3K3PA 5EVJA 2VYND 1DUIA 3TDMA 2LCIA 4ME6A 2WSBA 5FI1B 4IZOA 3F8WA 4B2LA 3QXHA 1CZNA 4IWXA 1HDYA 1RCUA 1J39A 4AMBA 1V6SA 3R7BA 4WFJA 2RAVA 3U4QA 1RMYA 2I1WA 2OV6A 4CV2A 4EBBA 2HJRA 3DHEA 4HEA1 4AX4A 4S24A 1EEXB 4D6XA 1Q0RA 2HX1A 5AW2A 4CM3A 2VYNA 3LZ6A 3ZV4A 4AJNA 2W9XA 1KH2A 2ZJ0A 2IYYA 3EC1A 2Q07A 1GY8A 3FPSA 3HGMA 1PYOA 3HVUA 4GUDA 3NR2A 4WLEA 1PQ4A 5JW6A 1GUZA 1K0UA 2AXNA 2H2DA 3LHDA 4YCNA 3DVSX 3JARA 1DCKA 3PWTA 1NYLA 3KJHA 2EKZA 5EHQA 2NVUB 3WLIA 3ZLUA 4A73A 4NHEA 1RYDA 3CIOA 3E2MA 2YS7A 3T8YA 3L1HA 1HE4A 4DJJA 4MDYA 2EX4A 4EPXA 3NVDA 4ZZ1A 2P30A 4HMQA 3JPWA 5CK5A 1TAGA 1SG0A 2D6FA 5TB5A 3OCJA 3WX0A 3DT9A 3R3YA 1WW2A 3BEOA 4HPWA 3SZGA 2PT5A 4TZKA 5DU2A 3U1BA 2CLDX 1J0EA 1G6OA 3GFVA 3JCZA 2ILTA 1T43A 2IZ7A 1JKMA 4U2EA 4GOND 4Z7JA 2P3QA 4EAAA 2ZOSA 3ZXIA 2Q4TA 3MRVA 2OBXA 2OK8A 4EPRA 2NTYC 2Y0CA 4K6MA 4KVGA 3NBXX 1TF2A 4ZANA 1E66A 1AIPA 1RD4A 2CL7X 4OXKA 4CEHA 3HKEB 2R60A 4W1PA 2AXEA 3GG2A 3LL7A 3SKVA 3E9DA 3K70C 1G1AA 2XUHA 3BMOA 3QPVA 1QP7A 1UFRA 4CBVA 4EG8A 3K70B 1SBQA 3QKRA 2JFGA 1B26A 3GFOA 3KUKA 4JJZA 4V2UA 2AZDA 3MOIA 2CNNA 2QSYA 4IICA 4RL4A 2JD0A 3P20A 3UWMA 1UZLA 1CP2A 2VJLA 1FXWF 1C3VA 2I4TA 5GWXA 1AY0A 5C53B 1ABEA 4BEWA 2I78A 3BUSA 1EZ1A 5LBUA 2KB0A 3LD9A 4BNGA 3HP4A 4RTRA 3NXSA 4QOGA 1ZI9A 2ZRBA 3RO7A 2OY0A 1GPKA 1WVIA 5IKPA 4ITVA 3P8ZA 2OK7A 5KPDA 2YJTD 1ESMA 3LUBA 4EW6A 1ZA1A 3C3DA 2A6PA 2ZVPX 3NWPA 3WGGA 3CXRA 5L3VA 1I2AA 1N25A 3PTAA 4F1JA 4RJJA 4KZPA 4MA5A 1ZNYA 5HVNA 3OEHD 1RRPA 1TZMA 3OF5A 5CLLA 3L6OO 5EKDA 3RFVA 1KYYA 3SJ7A 1QGYA 4OIMA 4TXMA 3ZZ1A 2B5VA 4HV4A 2F17A 1F8UA 1P2FA 2M2IA 2WSSD 3IO5A 2VHCA 1ZMXA 3HVIA 4WNCA 5EERA 5EP4A 3S44A 2CUNA 4BMPB 2EQ5A 1V8OA 3DE0X 3RI3A 3H9UA 2F4NA 1S3FA 3W2IA 4DIOA 2QG9A 4R41A 1N2HA 2A1IA 2WIBA 1FU8A 1KOFA 2JHGA 3G0GA 2XECA 3D2BA 1LQTA 1TM3E 3A4TA 5ISMA 2GYUA 1G20B 2B4KA 4K46A 4RAOA 4KYIB 2CV2A 3BDIA 3AJRA 4OGWA 3OZRA 2JFWA 4GICA 1RJ9A 4GX5A 4Q34A 3THYB 3W3AD 2WSSA 4DJTA 2HW8A 1FX0B 2ESRA 2IYEA 2I1VB 2QRLA 1RLMA 2GCIA 2R1VA 1G0NA 3K20A 4L8GA 4YRPA 3WGUA 2G70A 2JLUA 2XDAA 4Q16A 1UQUA 1PKEA 1TTQB 2DY0A 2OSVA 3EE6A 1YA6A 4Q7LA 2XCTB 3WSTA 3ZWNA 1XHEA 2VUTA 1ZCFA 3IP8A 2OGSA 1E2IA 4DMGA 4JYBA 3PDJA 1YFKA 3JYHA 5IJAA 4KOEC 3TOVA 1A2KC 3WBBA 2XZLA 1VFNA 5EWJB 1ICIA 3FCUB 1N8NA 4D42A 3NIBA 1G8HA 4PGMA 2PYDA 3B8EA 1IY2A 1BWQA 4PN7A 2FB9A 3EW7A 5FL7D 2VNSA 1L8AA 2XUGA 1CUIA 2Q8PA 4ON9A 4TRJA 2BEWB 4GXTA 1ODTC 1OU4A 3D4IA 2L18A 1CLEA 2FEMA 3HCNA 1NA5A 4HQ0A 2EW8A 5DLQC 3RFUA 3WBJA 4RTQA 4L8FA 4N5MA 1L0BA 4X64B 1M34B 4EARA 1E79A 1D4AA 3OESA 4LZNA 4YH1A 1J21A 2R25B 1MAAA 4EDFA 1GSOA 1X0VA 2VHYA 2ZAIA 4FI3F 3C3WA 2XD4A 4MDFA 4KN9S 3HCFA 5F2EA 1HE3A 4AO7A 2OECA 5JJLA 2BFWA 2HV9A 1R1DA 2Q7DA 3USZA 2GRAA 4C7VA 5JD6A 2B0CA 3DOIA 4RO0A 1LBTA 4W8GA 5FL7A 3U9LA 1QNLA 2AEJA 2R97A 4RS4A 3ZH9B 3HHEA 1JYFA 3L0DA 2UYYA 3LOPA 4KRGA 4XIFA 3T54A 1C0EA 2EIHA 2IS4A 4L95C 3OTIA 1NBAA 2G1UA 2GNOA 4H31A 3FNQA 3ZE9A 3RRJA 3ZV3A 2X3UA 3CMCO 3FTQA 4RD4A 2BGJA 1Z5GA 2W2LD 4GOOD 4YJ3B 4W6ZA 1UMCB 1QIJA 4OL9A 4L4UA 3W6OA 1L8OA 3IXMA 1J09A 3ADOA 1M2VB 1WY7A 3ECSA 3EF1A 5ARBA 3OPMA 4KMMA 4DDUA 4RE5A 4I7EA 2ZB7A 3RWMB 4ARIA 2ZJ6A 4WKOA 3UMSA 4YRGA 3RC2A 4HNUA 3IR7A 2RIRA 4HNAA 1Z28A 3EVEA 1AC5A 3UV6A 1QHSA 1BS1A 2NXNA 3BIJA 4D4HA 5MDHA 1X1EA 3RJMA 5F9HA 2OZLA 2GA8A 5F51A 1F17A 5JZVA 4KNVA 5KC8A 1C3XA 2ZE7A 1OIXA 1GUDA 2OLEA 3G89A 2FETA 4X1YB 1Z45A 1PFGA 3T61A 4DCNA 2C7QA 5MN4A 1B8OA 2QTCA 5JATA 2EJTA 1ZCJA 3FLMA 4DABA 4DPMA 4YV7A 3LY8A 3J81k 3IBTA 3NBQA 5K0NA 3DOUA 4KLRA 3T7DA 3EWIA 4L6AA 3ZY5A 5H1YA 2Q4OA 1CEXA 2C1EA 1OLUA 5ILOA 4UKDA 2J3HA 2DQYA 1HORA 4EVRA 2PUVA 4PVDA 4Q3AA 1RCTE 2VO1A 4U0JA 2JLWA 2VXCA 1IXSB 1WMAA 3I04A 3TXAA 1NI4B 4LYDA 2AZTA 3PVZA 4W82A 2CJXA 4K1LA 1B3RA 1BXRB 3VV2A 3OIWA 4DIUA 2QMHA 5MN5A 3AKDA 2JAQA 3L2OB 1OZ0A 4YJFB 2VJNA 1ZKDA 2ZT8A 2QGNA 5I8PA 2XTJA 3Q7PA 4LCBA 5JPDA 3T9FA 1AA9A 4ZU1X 1UDWA 3V33A 4IEFB 2D00A 1E1LA 4B3JA 4OGLA 3EIOA 4HS9A 1P1HA 4XDGA 2Y66A 2HZBA 2JGLA 4QQFA 3M9LA 4ZHQF 2XY4A 3D3JA 1GYPA 1ICEA 1QFYA 4TMVA 3GYGA 3P9ZA 2ZVQX 2AMVA 4Q1FA 1S7CA 1H2HA 1K7FB 1CS0B 1PLKA 3UCXA 2HMTA 4AJPA 3U44A 4OLBA 5T3UA 4AUMA 1IWPB 1XWFA 3AX6A 1VTKA 3H17A 3MVEA 2ZQYA 5LXTF 3TBKA 2O19A 2AYZA 1TYCA 3L46A 3OX4A 4CEJA 2D2IA 1YNSA 1IBSA 1NUQA 2JLAA 2KHZA 3G8DA 4FZVA 4OOEA 4LBZA 4LQCA 4UUQA 4YBRA 5DT9A 3RK1A 1DLJA 1YBMA 1TIPA 1Q7EA 3EFOB 1OZHA 5IJ9B 2WDPA 3LDHA 4J1SA 2G08A 3GCGA 5AI0A 3RTEA 4CG1A 1XDSA 2JVKA 1F7VA 3FOCA 4TKMA 3HTXA 3DHWC 3KKEA 1MAHA 1L9XA 4KN5A 1C1HA 4MWSA 3N8HA 1QHHA 4CHGA 4EMUA 1N6HA 4TWJA 4N4AA 4X8LA 3W7AA 4DC9A 3T9DA 3F7NA 4HZGA 2JK0A 2PXCA 1YQGA 2RB4A 3HN2A 2FRDA 2WLSA 2X6TA 5JEEA 2WJYA 4CV1A 1LDBA 1UKBA 1AO3A 2O7QA 3KLOA 3MNFA 4QRHA 2HH9A 3PVCA 5T6MA 1ZMRA 4CMHA 4U7DA 2E7ZA 4FW9A 4GRAA 1X1SA 2GQ0A 5FPYA 2ZJFA 3W1WA 3IEMA 1T1RA 2BRUC 2VRNA 3CNEA 3QUTA 3KUDA 3QZUA 2JD2A 4HZUB 2JCXA 1BN7A 3I1FA 4GI3A 4S12A 1U1FA 4Y2RA 1IB6A 3ZXSA 3ZLJA 3C7CB 4B81A 1Q7RA 1WU8A 1X74A 1NRJB 3JQGB 1TT5A 1Z68A 4OTZA 4DLKA 2LTAA 1Z4LA 4DLZA 3LX8A 2C2HA 4IS3A 4HC4A 5LC1A 1EVQA 4JLPA 2YV4A 4TL8A 4UXIA 4WHMA 4BN4A 1T0HB 3NBFA 3THOA 3K9CA 4DHWA 2NUPA 1LDYA 1P0PA 4GMDA 4MQ6A 4Q21A 1TC1A 1KI8A 1UZUA 1S6YA 1X7WA 3EK2A 4C6TB 1XAGA 3GG9A 3JQQA 2H85A 1BFKA 4WW0A 1S9DA 2AX4A 4BQQA 3G8CA 5B3AA 3TD2A 4GGPA 2QTTA 2YXNA 3RS5A 4MJ3A 4CU5A 1KSHA 1I7LA 1Y7LA 1Y8RA 2WJ4A 3O91A 4AU1A 1NM5A 5NULA 2PWPA 4YPOA 1BHJA 4UPEA 5AVWA 1Z2OX 3WSVA 5I47A 3RVDA 1Z4KA 1ZK4A 4RTSA 4DR1B 1LK5A 2QYHA 3N0WA 3QELB 5G2OA 4D4IA 1T9ZA 2PXAA 1BJTA 3WRXA 4B3MB 2C92A 4B3FX 1SC9A 4CE6A 4QQ8A 4QBTA 1E0SA 1FRVA 2V0CA 2JBAA 5IUKC 3CW2A 5U9CA 1IOWA 3EGIA 2KBFA 3UK0A 1YI1A 3MTIA 3QLUA 4JUBA 4X20A 2BHLA 3C3EA 1VJRA 3NIDB 4Y6SA 3WNBA 1V7ZA 5IVKA 1OHHA 1M1NA 3P4XA 4R2HA 1TO6A 5E8JA 3WDLA 3F7TA 3M2TA 4N6OA 3KEGA 1DJLA 3FFTA 4LC0A 3H1EA 5CCEA 5FDFA 3GDFA 3I2YX 1UFKA 2FPGB 2I34A 5THXA 3DMPA 3S2YA 5AW5A 2GJ4A 3K92A 3KQQA 3C3AA 1A8PA 4KR3A 5ALWA 2QM8A 1R6UA 4OLFA 2ZBEA 4N3CA 1SD1A 1MVNA 3I45A 1B8VA 1XB2A 1EXMA 3QWBA 3BMOB 3I5MA 4K7JA 3NHJA 4M89A 2VPWA 3I4LA 4OK5A 4RFLA 4XGIA 5H59A 1NJGA 4BVBA 4DPLA 4Y2GA 2BI4A 1NR5A 1I10A 1Z0KA 3QKRB 3CNBA 4E51A 3MWKA 2VF8A 3LQYA 5BSRA 5IVHA 1KZ6A 2EGGA 3M49A 1GLGA 3VR6A 3WDKA 1I2MA 3WK6A 5J23A 3CBGA 3O74A 1BW9A 1DG9A 1U1IA 4P92A 4YYEA 3I01A 3GRKA 1CBUA 1B16A 3PUJA 2XH8A 2HTFA 3EIUA 3AKCA 4I50B 2M1ZA 5CAEA 4B8WA 4EO4A 1O57A 4UUNA 4EVIA 2AI2A 3WLSA 5B6PA 1KNQA 3TPFA 2VHUA 3CCCA 1B7GO 1L7PA 4G5YA 4ISCA 3TDKA 4RKEA 1DUVG 2EBHX 1KYIA 2PZAA 2PANA 1KWGA 2P1DA 2FWMX 2PZLA 1OX4B 1NLMA 1GZ4A 3DCIA 2AG5A 2W6CX 3N76A 2B4RO 4IDQA 5H4HA 3WLLA 3WWCA 4O3FA 3FVRA 3DL4A 2EWMA 2VT6A 4HBZA 5EP1A 3HKCA 2QT9A 1A7JA 1R37A 3OPXA 4E22A 2VLBA 2FGKA 3ISVA 2JLXA 5LWQA 1QHIA 4JFAA 4FUQA 1FNNA 5IYZF 2IDKA 3ZI7A 1O77A 3CF4G 1IEQA 2ZRGA 3Q3VA 2B1QA 2PGAA 5KDOA 4DR5B 1H9BA 5DM4A 1MX1A 3UB2A 4PAMA 4FT2A 3TQHA 3NAQA 1DIRA 1VJ0A 3BWVA 3A25A 1RJ9B 5NLLA 1XYGA 4B1FA 2V6BA 3QVWA 2ZJ2A 4D99A 4OOFA 5IKOA 2F64A 2FUEA 2QZ9A 1THMA 4BFZA 3LP5A 4AJ2A 4BNKA 3R7WB 3K71B 3IAUA 3P2JA 3QQPA 4DUZB 5A4JA 3EXFA 3L05A 1B73A 2YIMA 3GLRA 4II2A 1Z13A 2WJ6A 1LBHA 1FU4A 2NNLD 1WUJS 1U65A 4IDGA 3LYHA 3N70A 3ILVA 3HV0A 4ZGGA 2Z95A 4MGIR 1AURA 3HKBB 4I19A 2KW5A 1C41A 1KGSA 3G8AA 2Q5JA 2PJUA 4Q1EA 3M1AA 4OJQA 4YGYA 4COKA 1KI1A 3SK0A 2OB1A 2B98A 2WIJA 2Y6UA 3LYAA 4IG4A 4DAOA 4BX2A 1T91A 3TN7A 1RJDA 1ZD9A 2PAFA 5ARCA 4LCJA 4CN8A 3T1OA 2ZI5A 1T2VA 1EUCA 2WSIA 2ZBGA 4KIGA 1ZSVA 2EEPA 2WFAA 5AM5A 1ZGHA 2AE1A 3ZGZA 3EXAA 2NUBA 4IJ6A 3V7NA 1B3BA 5ICEA 3SZUA 5I9SA 2FEWB 1O95D 2WABA 3ETHA 3T1VA 5HIKA 1K5GA 1PJBA 4EENA 1RWXA 2X1LA 3M6VA 1U0LA 2G77B 5T57A 1H8HD 3WJ1A 4ZGBA 3JRNA 2RGGA 4DL9A 4PLCA 2C5BA 3ZK9A 3QUBA 5JAZA 4HPJB 3AIIA 3JVDA 5EQFA 2C4WA 1X7YA 3KL4A 1THGA 2P8SA 2NM0A 2PFKA 3RAPR 4LWOA 4CMEA 1JEDA 1N2EA 1C8KA 3LDGA 2AN9A 4WLVA 4M1WA 4PQEA 3L49A 4RTPA 1XN1A 3TK1A 4KWCA 3FBTA 2VBCA 1YFLA 4BWYA 4Z51A 3KD2A 4YAEA 1K2WA 5TPWB 4YO7A 3WO1A 3K0EA 5JS1A 4MI9A 3QMMA 1G4AE 1OY1A 5KJCA 4MV4A 2F90A 4QNNA 2MYTA 3GN1A 1VIYA 3EOAI 4IY1A 4KX5A 4ZQBA 2W70A 1A7KA 3GJ7A 1E4OA 1SXJA 1CIPA 1E9CA 2QV7A 5EL0A 3GP8A 1KZ7B 1Z47A 3F3YA 1UT8A 1UOEA 2ZUUA 4ND8B 4IGIA 1UEXC 1CY0A 3H2HA 1HI9A 5CXUA 4HNAB 1QK4A 4OKIA 5K4GA 3DTTA 4JKOA 1BFUA 3CPEA 3R2JA 4EY5A 4G8BA 1ORRA 4AO6A 1MO2A 1PL6A 5A5GA 1BEZA 4ZZ3A 1NPTO 5LQUA 3W5BA 1K1EA 2OZLB 3SHOA 1BX1A 4OQEA 1HT3A 1HY3A 1RWWA 3JAWB 1FRZA 1G8YA 1IEWA 2NX2A 1OTYA 1A0OA 4BQFA 5ITZA 4YK7A 2GHTA 1OBFO 1R8JA 3OLWA 1BS9A 1YONA 4YJKA 3W9BA 1PGNA 4YT2A 4N0PA 4BLSA 1E0DA 1X1CA 3L0SA 4HLCA 2OV8A 1KMNA 1DQZA 4KBGA 4N5DA 4NU8X 4RYDA 2Z9BA 5BYJA 1MAWA 2P1RA 3LLVA 5HUHA 4GD3Q 3IDSA 3A6GA 1WXIA 5DRTA 1IXKA 1ZONA 1B6SA 2HPZA 4NH4A 3O8RA 1CQIB 5AUPB 1C81A 3BILA 3F6SA 4N0EA 1Z5UA 2F3SA 1GA1A 4HNHA 1M54A 3ZGLA 1GL3A 4MVCA 4DLUA 2VJBA 1ARZA 2JGDA 2ZKLA 4ER0A 3LWZA 4HR7A 3A1UA 3EXIA 1SVNA 3IJEB 1MTZA 2ZI4A 3A2NA 2B94A 3DMTA 2PUDA 2O5RA 3BF7A 1TCUA 3MMSA 3X1XA 3N87A 2DJ5A 3A9WA 1DBIA 2OP0A 3N86A 2DQ4A 4LK3A 3FPCA 1GZDA 4HLUC 4V39A 4W5JA 5LLSA 1E64A 2XYHA 1ZNWA 3RVBA 4JWKA 2OP1A 5K3FA 5AKYA 2G88A 1K8YB 1QGDA 4JEHA 2IJGX 3T35A 1NJ2A 2FG7C 2OTCA 4RPJA 4OF4A 2E4XA 4WOJA 4X6UA 5AIBA 2GZ2A 1MB3A 4HNRA 3RVOA 4KWEA 5E3IA 3MXTA 3V4ZA 1AUPA 1S2DA 2WF6A 3V7WA 2C95A 4IDHA 1Y5RA 4P4NA 4PQYA 3C5EA 3M9WA 2WNHA 2NAPA 2PRSA 3UXMA 4RQTA 4O5OA 1IHDA 4CEJB 1SXJE 4FKBA 1P1BA 5H80A 3FPKA 3N53A 4DZRA 5CMLA 1T0UA 4RPHA 2Q2OA 4ZVLA 4O2AB 1N2ZA 3L0IB 4QNMA 4BOYA 4BX9A 1I3KA 4FJ1A 3PQ4A 4RTJA 2CXTA 1QAQA 1JZTA 4QEKA 1LJUA 1M6HA 3KAQA 2XXAA 3SZRA 4V1CA 5JRZA 1ISPA 2G36A 3RIHA 2WMNB 1A1VA 3I39X 1QHHB 1G8GA 3I4CA 2HB6A 3EUFA 4HYQA 4RNDB 3EVDA 1UQRA 4HWKA 4I36A 2FPIB 2WWXA 4NBSA 4BN5A 4Q03A 3BWYA 3FCXA 1XZIA 1SCUA 3NTXA 3PXDA 4RVDA 1NQXA 2DTDA 3H0EA 5K4HA 3JD2A 2GN4A 3ZJUA 3FZNA 3OJOA 3SS7X 2VDWA 1O03A 1DL5A 2NZXA 4AJOA 1WXWA 4KQKA 3CPHA 3OPYI 3E7DA 3NBYC 3KIPA 1CUSA 3NTVA 3K9NA 1JVBA 2LR0A 1ZAKA 3RSOA 2I1LA 4G85A 4YR7A 1AO0A 2C5LA 1IBMB 1JQJC 2Q62A 1TT5B 3AJAA 3D7RA 4BLPA 1SVKA 1XVTA 4RF4A 3AUYA 4MV5A 4C4OA 5BURA 4ZAZA 3UJ8A 1SKMA 1YTUA 1EE1A 2O3QA 1RXEA 3HVHA 2GJKA 3AONB 2OMKA 1QIMA 2QS9A 4GOLD 2H5JA 3AW8A 2MSLA 1DP4A 3N2ZB 4IIFA 4LYFA 1G38A 2Y6VA 1DMRA 3UIEA 1QVZA 4I1SA 1JSZA 1LI7A 1TGVA 4LDJA 2ENUA 4P7KA 5DNWA 2PD6A 4LYYA 3WWOA 1B0AA 4BP9A 3FTEA 2WY2D 2I2BA 1L4LA 3B1FA 3WLEA 4IQ8A 5DBEX 1CJVC 3F6RA 2YZ7A 3ZXYA 1CDZA 1ZJJA 3W5SA 1Z4IA 3J81A 2XF8A 3AUXA 1KI6A 3FCCA 2DX7A 1SCAA 1Y8RB 3ZLBA 1R9NA 2DQSA 3EYAA 4I9NA 4IRXA 1DKRA 2B30A 1R66A 2JGFA 3R7AA 1GPJA 3AU9A 5C35A 1G3IA 3I0MA 2YQZA 4XRRA 4TKVA 1SZDA 1GL9B 3OCXA 3R09A 4P7BA 3WRXC 4Z8XA 2B34A 1PCXA 3RJTA 1ZPDA 2DHQA 2NO1A 2P6NA 1VLVA 2H65A 3LPLA 5KNDA 1CYDA 3A28A 5JE8A 1KPHA 3CLTC 2GN6A 1JQLB 1WV1A 3JASA 3PZBA 3NNSA 1RBQA 3E81A 2OHJA 4G4IA 3UMFA 1XEWY 4IEIA 4YCMA 5DTMA 4U5XA 3ZGOA 1IOLA 7ABPA 3CH4B 3HDGA 3OEEA 1U80A 1B0ZA 4QHSA 5KSWB 4NOMA 4L4RA 4AJJA 4FNOA 1Q1AA 1R3UA 1TQDA 3WFJA 3PXUA 4YRFA 1YRQA 4F4HA 4IF4A 3IAS6 1ABBA 2O48X 2JH9A 4YRQA 5B2EA 2I22A 5JCOA 1RHUA 4KO1S 3UGQA 1E6MA 2GM3A 2J9RA 4G1MB 1DQRA 1RAIA 5E6SB 2LWIA 3IKTA 1GCUA 1NZDA 4I9GA 4TSKA 3SSOA 5ALZA 1W4BA 2W2QA 3SE0A 3GGCA 3H87A 5KCMA 1YA8A 4RPKA 1BW9B 4BO2A 2WJAA 4G0YA 3LUDA 2YINC 4EY4A 2GEKA 1YL5A 2XMRA 2JI9A 2XYRA 5A5DA 3UOWA 4D3XA 3JQ9C 2E5LB 1T10A 1XZNA 1O9GA 4MQ4A 4ENWA 1W8DA 4XWYA 5IM4A 5C1BA 2D1FA 4RD1A 2DUMA 3MWGA 1I1HA 4RHTA 4Z0PA 4E13A 4ESEA 4Y2TA 2Q27A 1PD1A 3L43A 3MUOA 4UBNA 1NTRA 2OCKA 3BL5A 4A82A 4G5RA 4URFA 4DMLA 5FUMA 5CA1A 621PA 3G1WA 5IW8A 4JLUA 4PF1A 3AHHA 2CBGA 2RHLA 3O3CA 2YJZA 5LU9A 3KKOA 5HJ7A 2GK7A 2Y8EA 3OKFA 5FADA 3DEFA 3HSSA 4IHJF 2I2DA 2C94A 5JJ5A 3ZU4A 1U1CA 1EDEA 1U1EA 2VDVE 2Y1DA 3C5CA 4L5YA 5KWSA 3OP4A 2HK9A 1FJHA 3DG9A 3PWSA 4Q3OA 4DIEA 2A30A 1RRCA 4H18A 3AFMA 1Z6AA 2ZZMA 2ACEA 2B37A 1W93A 2G06A 2Q50A 3OZ7A 5E4TA 1KYXA 4QBHA 1CUZA 2H1SA 4HQ6A 3ZJYA 1X14A 3UWKA 1REQA 4G0VA 5CDTA 3THWA 1EWYA 4TWAA 1A9ZA 3VO8A 2QTVB 4Q7EA 5JVDF 1CG6A 4K9NA 4MRPA 2QM7A 3LDUA 1NE2A 4CCYA 4DRYA 3I12A 1P9WA 2XGJA 1SZPA 3ONVA 4EM6A 2QM0A 3PJFA 3L8EA 1OZFA 2ZIXA