3QEJA

S74e-dck mutant in complex with udp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
242
structure length
234
Chain Sequence
TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVELTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Post-translational phosphorylation of serine 74 of human deoxycytidine kinase favors the enzyme adopting the open conformation making it competent for nucleoside binding and release.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Deoxycytidine kinase
total genus 89
structure length 234
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qejA00
4K46A 2EFDB 3VR2A 3DO6A 4EQ6A 2RGNC 2BIFA 5EJEA 1EESA 1K5DA 1NBMD 1CBUA 2XOKD 4TLAA 1DTSA 1VG9B 1U90A 4NDZA 4URZR 1MO5A 2ZRGA 1GRRA 1G1MA 4DCVA 5EE5B 2ODNA 5FBVB 4WVFA 3GJ3A 4W9MC 2F55A 4I81A 1YU9A 1IN4A 3PUWA 1U2RA 1TAGA 4Q4JB 4G5SA 5JSZB 2FDCA 3UANA 4AKHA 2IS2A 2ZYTX 4Q7JB 2IC5A 3SR0A 1S3SA 4MGZR 4RSGA 5G41A 4CEIA 1XX6A 2Z83A 4IOKA 2QT1A 2XTZA 4II7A 4Y0VA 2H16A 3H86A 2CL7X 2QRNA 1RYHA 2FFAA 5G3ZA 5JBQA 4Q1FA 2C98A 2ZRLA 2FFHA 1BOFA 3I73A 3P20A 1FMJA 1NVWQ 2GVDC 3FMPB 3N5CA 2F1JA 3RRZA 4YLGA 5F9FA 2QM7A 2WAXA 2NO6A 1RRFA 5IK2A 3IO3A 2NOAA 5DHAA 5AJXA 4KV9A 2BJWA 2ZRAA 4PSKA 3VMFA 4B3DA 2JDIA 4P4SB 1W5SA 1BMFA 1ESMA 1X86B 1R5NA 1YZQA 3G82C 3QVVA 4PQFA 4NCIA 4QHYA 4E07A 5B64A 4RZUA 4JVMA 4Z1MA 2OZEA 3AV0B 5GVSA 4FMDB 4BUJA 1E9FA 4DSNA 4CEHA 5EE9A 1NI3A 2P6NA 2GXSA 4MRSA 3MWLA 2V4ZA 2ZE8A 2FSHA 3EZ2A 3OEHA 1F2UA 1G3RA 4OI0A 3TH5A 4LRWA 4A92A 1WCV1 1I2MA 3EPKA 2XITA 2RGNA 4MKHA 1PJRA 3UMRA 1OHHD 1TNDA 3Q72A 2CL0X 4EPXA 3B1ZA 3KKPA 3K53A 1AGRA 5DYIA 3SJAA 4CEHB 3ZD6A 2V7QD 4DCUA 3GJ6A 3EG5A 4XTRA 3SI7A 3FKQA 2OESA 3Q3JB 3CUEF 4DCNA 2ANBA 4XWAA 2EFGA 4JLMA 2IXFA 2DPXA 3GLHA 1OV4A 3AP2A 5KSYA 2ZJ2A 3SNHA 2RMKA 4FCVA 2ZRCA 2H1LA 3C5HA 5C4GB 2ZJZA 1VTKA 3THYA 2YJTD 2R2AA 1XJQA 3O8CA 1LW7A 4HUQB 2ZRIA 4AWXA 2RGAA 4LGMA 1JI0A 1F60A 1GM5A 3TVTA 2GJAA 3ZIAA 3KX2A 2JJ8A 2AD5A 3G0HA 1CRPA 3L8ZA 1UEIA 2KSQA 1OE0A 2DYKA 5C1BA 5JI3E 2VTKA 3PVSA 3SQWA 1EXMA 1JR3D 2EFHB 4MYUA 3GCGA 2QGNA 3BC1A 5EXSA 3THXA 1ONBA 4OI4A 3ADBA 4V02A 1ZCBA 4DHEA 4DIDA 5KNDA 2A5YB 1MRSA 3CWQA 2D4HA 6Q21A 1OIXA 4FN5A 3PV0A 4PZLA 2NZ8A 3GLGB 5L8VA 3KUCA 1CJUC 3QKRA 1K6MA 1CJTC 2D3WA 3GJ8A 4OQMA 3I4LA 2BBOA 4URUR 1P60A 4CT4B 5FH9A 2QN6A 3B2EA 2F3RA 4DT1B 1JEEA 1X1SA 3W6OA 1JQJC 1O3YA 3SU8A 1NVUQ 1DG1G 1OB5A 4E09A 1TL7C 2E9SA 3L8YA 5EXTA 5BWMA 1ZM3A 1G3UA 1T9HA 4TN1A 3NC1C 1A7JA 1NIJA 4KFTA 5H1YA 2C9YA 2W6IA 2WWWA 3NC0C 1AM4D 3ZS8A 4PAOA 3A36A 4L15A 5DLQC 5DIFA 4AKIA 3WNCA 2F1RA 4LJ4A 4C0AC 1G291 1ZUIA 4IXMA 1RPZA 5CLQA 4CVNA 2HYDA 2L0XA 4LYHA 3KQKA 1UM8A 4M1TA 1FQJA 2CDNA 3U6KA 2VA8A 1Q22A 3E70C 1G19A 4NTZA 3I72A 4B2PA 1GUAA 3F3YA 3BOSA 4NONA 4ZDIA 4ARZA 4C4PA 2HYIC 5AUNB 3I3SR 3KXLA 2EFEB 3GJ4A 4C30A 4QBIA 1WP9A 2W6ID 5J4VA 2ZROA 1UF9A 3F0TA 4V0NA 2IXGA 2NGRA 1CS4C 1CKEA 3RS7A 3M0EA 4IDOA 4RZ3A 1R8QA 5F98A 3IEUA 1XTSA 4MDFA 4ZO4A 2XNDA 2ZM5A 3DMNA 4B44A 4IEIA 2WOOA 2TMKA 1NN0A 2O5VA 3NH6A 3OFNA 4RD4A 2CCJA 2H18A 1CU1A 2P0EA 2VP2A 5TDHA 3IIJA 3ICEA 3FB4A 1FX0A 1GG2A 2RHDA 2J87A 2KI5A 1G3IA 1SZPA 3CRMA 2GXAA 2Q3MA 3W8RA 2C9CA 3L0SA 4OHXA 4BZXA 3GJ7A 2MMGA 2YVUA 5DH9A 3H84A 1YKSA 1UDWA 1VIAA 1IAQA 3DKPA 3I8XA 3U3RA 4C2TA 4HB4A 2J9RA 4PC2A 5TV2A 2YYZA 3LY5A 3PJRA 3FMFA 1YZKA 5JCPA 3QF4A 3U7GA 4NH0A 2PZFA 1OXUA 3AUXA 4E5UA 1HH4A 1XWIA 2FSGA 3VX4A 2GCNA 4KXFB 4KITB 1DAGA 5JJLA 4Q18A 4A0FA 2C77A 3OAAD 3LVQE 3QKUA 2VP6A 2GAAA 3QIAA 2G3YA 2OM2A 5F3WB 2IXEA 1DOAA 1WRBA 2CLDX 4Z1MD 3BH0A 1E94E 1U94A 1OXXK 3AF1A 2C78A 3PIRA 1G5PA 2R8RA 2PT7A 1A4RA 1BMFD 5HTKA 3BFXA 4WBSA 1WQ1R 2B92A 2ZUCA 4HB0A 3TJZA 4C0QC 1U81A 5JLJA 1VYTA 5LB2A 2D7DA 1JALA 1E2NA 1KI4A 1OHHA 4BWYA 2DWPA 4LHYA 2BOVA 3UG6A 4H1VA 4A2WA 1NNEA 2O8FA 2DWQA 2O0JA 4JLDA 1X6VA 2ORVA 1ZP6A 4GZMA 1E2DA 1N5IA 1VPLA 3QI2A 4D0NA 4NYJR 4FCTA 1G8GA 3LQRA 5L3SB 1X8LA 2ZU0C 2FEOA 4Z51A 3A1SA 3KKMA 5FPKA 1Q21A 1Z0KA 2FSIA 3L0PA 3C4JA 1DEKA 3EIHA 4IFEA 4Q01A 2OHFA 4KYIB 2AWOA 3BFVA 4MYHA 4EDHA 4GP6A 1LB1B 4EJSC 4F92B 1CJKC 4X8OA 3CR7A 2P6RA 4Q9JA 1KAGA 1RVDA 1MO3A 2YOHA 3AVYA 1IN5A 1E0JA 4HUTA 4BFYA 2A5FA 1DAKA 2F43B 3AVVA 2BBWA 2E1RA 3AGQA 3PITA 4TSFA 3T12A 3QSYA 3QBTA 3DPUA 2ODWA 1O87A 4LV8B 3SFZA 4A0GA 1L4YA 1J8YF 1T8TA 2QG6A 4JS0A 4CZ2A 4IXNA 2C95A 5AUQA 3CZQA 1NG9A 1UPTA 4QM7A 1KI7A 1E96A 3P26A 4GP7A 3T1TA 2KBEA 1WDTA 2IT1A 1ZCAA 4GT1A 2GZHA 2CNWD 2BCJQ 2XXAB 3AVUA 2B21A 2F9MA 3EAQA 3TQFA 2Q6TA 4L9SA 5FFMA 1E0AA 5H68A 4PQRA 2A78A 1ZM4A 1XEFA 2OBMA 4Q02A 4Q7MB 2YV5A 2JLZA 3I5XA 3B85A 1PZNA 5DE3A 4RJLA 2UVQA 3KJEA 5KSPA 5JCZA 1KNXA 1SVWA 4HB3A 5D3QA 4IOJA 4YQFA 2ZEJA 2P6UA 5CIWA 4IEEA 4U7DA 1PLKA 1YR7A 3S1AA 4PZZA 4RD2A 4MGIR 1ZIPA 3KUDA 3TQCA 5JWOA 1T8UA 1S4QA 1NBMA 4M9QA 4V0LA 1EK0A 3IIKA 1FW6A 1XPRA 1I2DA 3AVOA 1XJCA 2ZR0A 1IY0A 4QM6A 4HZIA 2C03A 1W4RA 2MSEB 4UXHA 1S9DA 5JHHB 1KJYA 2EYQA 4HAZA 4D4MA 1Q3HA 3BORA 2YWHA 3IBYA 1E1RD 1KZ7B 2VSOA 1TF7A 2ZRFA 3MLEA 4UNPA 4EJSB 5BN4A 4ESHA 2P5TB 2ERYA 3T34A 1GSIA 3MRSA 3PUXA 4KBGA 5CK4A 3CNNA 1OFIA 3TGPA 2QTVB 2HEIA 1E99A 2R65A 4LHWA 3DM9B 1RYFA 4TQ9A 1JR3A 3VU9A 3BGWA 4B3GA 2IYSA 2ZSBA 4AKGA 2XNDD 3CX7A 421PA 1KI8A 2ZU6A 1EFRD 3ZDQA 2C8VA 4LWZA 3WYFA 2FV8A 3NG1A 1FMLA 1BYIA 2H5EA 2W2XA 4D81A 1W36B 4EPTA 5SZKB 3NEJA 1AQYA 3CWZA 4NBSA 3U7FB 1R7RA 4ACBA 2QQ0A 4E22A 4ON9A 3VU9B 1N5KA 2XJ9A 1G3MA 2JASA 1WMSA 1Z47A 1NJFA 4M2LA 3GLGE 2FPKA 3LNCA 4JL8A 2ZRBA 2QP3A 4F4CA 5LDDC 1QHYA 4QHTA 1ZC3A 4PC7A 1HUQA 4JSTA 4ZV4A 2CMKA 1MV5A 2D06A 1N5JA 2P5SA 1YZUA 4JT2A 4DDWA 1OFHA 1Z0AA 1J8MF 1Z29A 4PPNA 4JLVA 1P75A 4LCBA 3MAAC 1D6JA 221PA 4NYMQ 2BMDA 5B57C 4L9WA 3GLIB 2O8DA 1CP2A 1KZGB 2ZVQX 4TL6A 3RDPA 4TTPA 2O52A 1FQKA 1Z6GA 3IEVA 4FCWA 1OB2A 2VP9A 4M4SA 2O8CA 2CVHA 1KO1A 4POAA 3I5YA 3FFAA 3FHOA 3ZZTA 2YZ2A 1F3OA 3A58B 4KODA 1HEIA 1KI3A 3QXSA 4RY2A 3SYNA 5K8UA 4AY2A 1XZPA 1A2BA 4Q4JA 2RB4A 3U3OA 1QVRA 2XEXA 1F2TB 3H2YA 4JBWA 3CNLA 4L5BA 2O8DB 4QKQA 1OXVA 3NTUA 3TBKA 4JZKA 5LBIA 1QHHB 5EXPA 3T06B 1GNQA 2KE5A 3LX8A 2CK3A 3RRMA 4DT1A 4KCGA 4G5OA 5KTYA 1D8TA 1W0JD 3K8YA 2DCUA 1T3SA 1N6RA 1Q12A 3ZS9A 2X8AA 4MITA 2IUUA 3UG7A 4DC9A 1NKSA 4UJ5A 2NG1A 3B13B 4IOMA 4TSFD 2ZJ5A 4O3MA 1AN0A 1P5ZB 5LPNA 3RWMB 1E9AA 1OW3B 4RVCA 1PV4A 2GZAA 1HV8A 2QPTA 1E9SA 2CLCX 3ZQJA 1JEDA 2D2FA 1G9XA 3C7KA 5TB5A 3T5GA 3RSOA 2UKDA 1AZTA 3BK7A 4P31A 3A1VA 2FA9A 1QG4A 5M04A 1XEWY 2VF8A 1ZD9A 4OHYA 1SXJA 3DHWC 2W6JD 3KQHA 2ZJBA 3Q7PA 5AUOB 4JSYA 4JJKA 2PJZA 4ZIRB 5FR1A 3ZD7A 2IS4A 1HA3A 5JRJA 3BD9A 4PHHA 3CBQA 2GWHA 3X1ZA 3TW8B 3FE2A 1KMHB 5DO9A 4URXR 3K1JA 3UIEA 4M22A 1G3QA 2XOKA 4TWZA 1Z6AA 2J41A 4DZZA 1P2UA 3CNOA 1RIFA 1R2QA 1AA9A 1DBSA 1S1CA 2QE7D 4GSYA 4HAVA 1U98A 3A6PC 2QZ4A 3IILA 4D2IA 4V0KA 1Z83A 4Q1BA 4TZ0A 2RAPA 4DIEA 4UXJA 3SEAA 4EIWA 4F7WA 1CJMA 2JIZA 3B5JA 4CRWB 1IN6A 1C9KA 3RYTC 2ANCA 3WYGA 4DLUA 5HCIA 3I62A 3VKHA 3LO5A 1A5TA 4B43A 2QAGC 4QNRA 4QG7A 3PCRB 1TQ4A 3EZ7A 3V4FA 2FMXA 3R9XA 3EXAA 1SKQA 4HAUA 4I1UA 1H8ED 2F43A 4XIGS 4IVRA 3ZZUA 5K8IA 1NMXA 2FH5B 3VX3A 4N0EA 2WSMA 1ZJ6A 3W3AA 1KKMA 2BJVA 1KJWA 2OFOA 1J99A 3L0IB 1JB1A 3SZRA 3QF4B 2FSFA 2ZYWX 4OQXA 2RGXA 2GBLC 4NMMA 5CM9C 4CEJA 4CW7A 1GKIA 3NDBB 1V43A 2FGKA 2Z5FA 3A1WA 5JSZA 3W8NA 3MCAA 2LWIA 1PUIA 3NBFA 4ESVA 1ANKA 1Y63A 2C99A 2GDJA 1MH1A 1N2CE 1AKEA 1LS1A 2NO1A 3B1XA 1GFIA 1QHSA 4FWIB 3FFBA 1VIYA 4LV6A 4OQFA 1I4DD 2OEPA 5JECA 1HY3A 3W9YA 4BPBA 3EPHA 1CEEA 4IJMA 3AM1A 1D9ZA 1IM2A 3BAFA 3P4YA 2J0QA 1R5BA 4QGAA 2RCNA 2OCYC 1S3GA 3LX5A 4C0HA 1TF5A 3BJIC 4QRHA 3B82A 1N6IA 2XX3A 2A2ZA 4TL8A 1G5RA 2CE2X 3BBPA 3V9PA 3S1AB 4J0QA 3H0KA 2EYUA 3QVUA 1ZUNB 4M9ZA 3AB3A 2W00A 2GCPA 3GLIE 5KHOC 4DLXA 2XJ4A 2QBYA 3PFIA 2R6CA 5AJVB 1QBKC 4Q03A 2JJ1D 3U60B 1IXRC 5BYKA 4EPWA 2OFXA 2AR7A 3IO5A 3JZMA 4NE2A 1UBCA 3IDQA 2ZRJA 4B3XA 2EW1A 2WM9B 3U2QA 1NKTA 3TE6A 1II8A 4LYJA 1VCIA 4MKGA 3MG9A 2ZRHA 3T15A 1S96A 3M1IA 2ZE5A 3KL4A 4TMKA 3CF0A 5A0FA 2VP0A 4F91B 4JKYA 4Y0AA 3F5FA 1F2UB 1KK3A 4RCZA 2QBYB 4URVR 1XCMA 5TY0A 2D2EA 2QP4A 3AF0A 2REXB 1AKYA 3DOFA 5CB6A 4DLSA 3LH5A 3O8BA 3JVUA 1DE0A 3K70C 1COWA 4UXIA 4QBFA 3P32A 2PT5A 3R7WA 2F6RA 3UMFA 2QAJA 4WOPA 4B34A 3U3JA 3R9IA 3UWKA 2ZE6A 1FP6A 4PAQA 4WA7A 3UKDA 5DN6D 2VHQA 1ZM2A 1Q57A 3JVVA 3RSLA 2GKSA 1Z6YA 3KQUA 4AD8A 1AQUA 1KK0A 1D2MA 1G7SA 1TU3A 4TYPA 2MMCA 4Q4AA 4NKRA 4TLDA 2DY1A 3KKOA 2EWWA 3OIWA 1KNQA 3CPJB 2WIAA 3QXXA 1JXMA 3VR5A 1VHTA 4Q7KA 1T91A 4US2R 1X1RA 3EASA 4YMSA 1XD9A 3LDAA 4FW9A 2Z6VA 3K0FA 3T5DA 2QAGB 3IPYA 4LSGA 4RKFA 3QOFA 5FTLA 4P33A 1G4UR 2QSZA 2HDNB 4N0DA 3TAHA 1T0HB 1N25A 2ZSFA 2HT1A 4N1AA 3BFKA 3U44A 4DDTA 2GJKA 1P7CA 5CM8B 2RKOA 3GEIA 1E0KA 3TUZC 4ERNA 1L2TA 2PEZA 3HJNA 2ZXUA 4TMZA 3M6AA 1W4CA 5GJBA 3X1YA 3K70D 4C7OA 2R9VA 4MQBA 2OFWA 3PENA 4JVSB 1DPFA 1YZNA 1C1YA 1RE0A 3OE7A 5P21A 3TNFA 1E1QA 5K8LA 1E79A 3TMKA 4BE7B 4CGZA 4AK9A 3FTQA 4FMCB 3HU2A 5EUMA 5FUVA 1GL9B 2WWGA 3CX8A 4M9XA 4DLTA 4TYWA 1ZW6A 3RRNA 3A37A 4LV5B 1R10A 3THOA 3MUFA 3AVQA 3QKSB 2OG2A 2WPDA 2C9OA 1DO0A 2HUPA 1C4OA 2ODBA 1SHZA 1KSGA 4M21A 2WJJA 2OAQ1 1VG0B 1EGAA 1XU4A 4XOIA 3Q9LA 2Z0MA 1KDPA 2JLYA 2IBMA 1CF4A 5CITA 3BB4A 2QMOA 5KYKA 4RZ2A 4BQSA 1E1RA 1S1MA 4C0KA 5E3HA 1LY1A 5FOVA 3PXGA 3VKWA 3W5JA 2ZPTX 3MMPA 5KOYA 2CEAA 2CNWA 4OK5A 4PPQA 2IUTA 1U8ZA 3LXRA 2ZSEA 4FD2A 2WPDD 1G6OA 4RD1A 2BM1A 2Q9CA 1CLUA 1OFUX 2LKCA 1GWNA 2FX3A 1E2GA 4TZ6A 3IIMA 2PCJA 2QSYA 4JMPA 3LBHA 3CRRA 3LAWA 1I4LD 3EWAA 3DMDA 4AYWA 2H8KA 2ZI6A 5J5CA 4BFUA 3AH8A 1M2OB 4PFSA 1QDEA 3IHWA 4BECA 2P2LA 2VPPA 1JQLB 2QA5A 4AYXA 1E2QA 4B75A 1ZINA 4EAQA 3WXMA 3EZ9A 1E0SA 4B33A 3QQ5A 3ZH9B 1KO7A 5C18A 5JEEA 4GL2A 4N3NA 2I4IA 2G9NA 1N6LA 2J0VA 2RGCA 4HLQB 4O2LA 3WMGA 1QHIA 4C0JA 3CM0A 3HPRA 3LWNA 4DSOA 3U4QB 4NP6A 1NF3A 2C2HA 4DDUA 5DSZA 2J3EA 2H92A 3FYHA 2FE4A 4FI3C 3ND9A 4GBMA 2FGJA 1QVAA 4R98A 1VCNA 1NY5A 4JBXA 3WMEA 1W48A 2IYQA 4A8JB 5KUTA 1JR6A 1Q44A 4LDJA 4BLOA 1MOZA 4QL3A 3RS0A 1GITA 2KBFA 4BFWA 4EPVA 3AVTA 2I1QA 2DFLA 1T5IA 4B35A 4DEXA 2ZI9A 4JLOA 3FKSD 2GETA 1J7KA 1LVGA 5FPYA 4C0SA 3AQ4A 1JAHA 4JLBA 3PEVA 4LY6A 2VP5A 3RVBA 4OHWA 3TRFA 1Z08A 3QPUA 2FNAA 3OESA 4C0LA 1H8EA 3RLFA 2PCLA 1OXSC 2J0UA 4U5XA 3WRYC 3WYAA 2Z43A 4D25A 3MWYW 1W0KA 1ZRHA 3E1SA 2AKAB 1XP8A 1ZNWA 4RFSA 2YNMA 1U0LA 1E2FA 2HV8A 4LYAA 4TMWA 1SXJB 3GJXC 4YMWA 1TMKA 3W6NA 3Q5DA 3ZVMA 1CR4A 2BMFA 4PHGA 4PX9A 2QRZA 4KLNA 1KO4A 1TQ2A 4OYHA 2ZRPA 4F4JA 2FPLA 2YWGA 4KAXA 4GOKA 4ZPXA 3KQNA 3HPQA 3E5HA 1OH6A 1YR9A 4OI1A 2FEMA 4LJYA 2RHMA 1P2VA 2JLXA 1MT0A 1N6OA 3KKNA 4FIDA 4FMDF 3QBVA 4PO9A 1P4SA 1XEXA 4JVNA 3MSXA 3TIFA 3W90A 3GEHA 1S8FA 4NCKA 2WKPA 5JFGA 2Z4RA 1E2PA 2PZEA 3KJIA 4BEJA 3P4XA 4PC3A 1FTSA 1E2LA 2DHRA 4LJ9A 3NKVA 4BFTA 1NP6A 4V0MA 3BXZA 4TMXA 2AN9A 2XSZD 5GADl 1XTQA 1UKYA 2B7BA 2ERXA 2ONKA 3P1JA 2BC9A 2ZANA 1F5NA 2QT0A 3BERA 4TMVA 1Z2CA 5DGXA 4EUNA 4B6EA 2GJ8A 2GA8A 2ZAOA 3AF4A 3CRVA 4RCYA 3THWA 5L3QB 2IF2A 4JYBA 1DAFA 1SHKA 3FHCB 4JYCA 1ZAKA 1E2EA 2QMEA 1TEXA 2GK6A 4Q1CA 4M53A 2V6JA 4C3ZA 3CIOA 2CJWB 4WZBE 1NN5A 4HDOB 5FOXA 1COWD 2QM8A 2PMDA 2OCPA 4Q4HB 4LHXA 1QHXA 4EKDA 3MWKA 1KI2A 2OE2A 3W6PA 2IYLD 3K9LA 2Q21A 5E4FA 3W34A 1Q1ZA 4BFXA 1E3MA 1AS0A 2WJIA 2FF7A 2JJ2A 1DO2A 4GMDA 4WXRA 1KK1A 1ESNA 2G0NA 3VR4A 1FUUA 4XVRA 1P9WA 1M1YE 2O8EA 3T1QA 2BDTA 3U6BA 4M1WA 5FOUA 4BZQA 4DSTA 4A36A 3WNBA 1VCMA 2K5UA 4LUCA 4DCTA 3N2IA 4LX0A 4Q9HA 4DUGD 3T1VA 3J81k 2OSBA 1MKYA 1PLJA 4BLPA 5EXXA 1NBME 3ICQB 5JJIA 1JXOA 3KQLA 3VAAA 1KJZA 3TR5A 2D74A 4B47A 5DHFA 4CT5A 3ZGXA 1BO6A 1TTTA 1GRQA 2R6FA 3A8TA 5FTJA 3U61B 1KI1A 2ZS8A 1Z63A 2Q3FA 4I1SA 1XFAA 4L16A 3RNLA 2XTMA 2Q9BA 2W58A 1TUIA 3QXHA 4FINA 2PZGA 3EIQA 1RRGA 3KTAB 5CIQA 2ZTSA 2NO7A 4HDCA 2AXPA 2QMHA 1UBEA 1R0WA 1W47A 1G18A 4MYTA 1KK2A 3TSWA 4LJAA 1E2HA 4NL4H 2MSDB 3QG5A 1OKKD 1NY6A 4PHTA 1EFRA 2YWFA 1QHNA 2ZI5A 1OFTA 2H7VA 3EIEA 4TQAA 5EP1A 1TUEA 4LJ8A 3D3QA 5KDDA 4DLVA 2OBLA 2IYZA 1UKZA 3W3ZB 3X2SA 3CRQA 3WNDA 2ZJ8A 2GILA 3VNVA 2J46A 3SE0A 1E2IA 4TL9A 1ETUA 3DOEA 4DKXA 2N46A 3HR7A 1KHTA 2AK3A 1NN3A 5C2JB 1IHUA 2G1KA 3O8DA 3WP0A 2IWHA 4A2PA 2PMKA 4JL5A 3GLIA 2GESA 5GJCA 1JJVA 3NEYA 4A2QA 1Q0UA 1N0WA 1Y3AA 3BH6A 3HP1A 4X8MA 3U44B 2OXRA 1AIPA 2RGDA 4Q47A 3SBDA 2IW3A 5AJWA 1F6BA 1ZNYA 4BLSA 4D4JA 4DVGA 1B23P 5HZKA 1CXZA 4B32A 3AKDA 1G16A 4L4UA 3FVQA 4C7OB 1EFHA 5SZJA 3WY9A 5IK2D 3KJGA 1PUJA 3QXCA 4K8OA 2IYYA 3DVLA 2P3SA 1GKYA 2Q9AA 2BMJA 5HZHA 2GEDA 3M4YA 1GAJA 3NHAA 1JAIA 2ZI3A 1QHHA 3C8UA 3A1TA 2W2VA 2ZJAA 3MGCA 2PEYA 3BH7A 5B2ZA 2CHQA 4Q00A 3TR0A 2YC2C 2CCKA 3PEWA 3V4RA 2HXSA 3TVDA 1Z0JA 1ZUHA 4KVGA 1W36C 2WWXA 3LV8A 1HE1C 3WHLA 2GXUA 2UZIR 1T4GA 2RGEA 4XSHA 3NXSA 2VH5R 3SQXA 2GK7A 1BH2A 1IJFA 1NLZA 1XD8A 2YOGA 3HR8A 2EWVA 1LTQA 1PVOA 2REBA 5CJPA 2XZPA 2CVFA 1JPJA 1OYWA 3CF6R 2CK3D 2I3BA 4NYMR 2PLFA 5EZ5A 3FKSA 4A9AA 3IUYA 3ZVNA 2YINC 4D26A 4ZIRA 2QPAA 4TTRA 4GPTA 4ABYA 1I4TD 2JGNA 2J0UB 1KMHA 1NVVR 1XEWX 3QY0A 2ZRDA 4M8NE 4LHVA 2YHSA 4Q9KA 3R20A 2H57A 2ZS7A 2XTNA 1M34E 4D80A 4HLUC 2O0KA 3IPXA 1EG7A 3OEEA 4U00A 5EE1A 3AVPA 4EFLA 4YXWA 2VF7A 1Z5ZA 4KBFA 1WXQA 4BEBA 4TYYA 1ZMXA 2OV2A 4JVLA 2GEUA 4R2HA 5FPTA 5AUPB 1VKJA 5G40A 621PA 1SVLA 1W5TA 3SDZA 1II0A 3ONWA 3ZQ6A 4XWOA 2XB4A 3TK1A 5JS8A 3WHKA 5SZIA 3K09C 4MDEA 3LW8A 4UKDA 2IWRA 5AK0A 1T5LA 3ASYA 1IJEA 2IK8A 3BE4A 1F48A 3I1FA 4ACAA 4CF7A 2RGGA 2ZSDA 4HSEA 4NPHA 1HYQA 5DI3A 4Q7LA 3K0FB 5FOSA 4QJ4A 4KFRA 1GKUB 3LA6A 2A30A 1GNRA 4Q9IA 2PX0A 1VYUA 4PZYA 521PA 5E7MA 2CXXA 1E69A 2HT6A 2VEDA 2VSFA 2ZETA 3B7GA 1M7GA 1NMZA 2ZAMA 3BB3A 2J0SA 2W0SA 2WSSA 3K0AB 2GBLA 2WKRA 3NWJA 5HCNA 2VHUA 3GLHB 4EJSA 5FTKA 4LJ5A 3GLFB 5DN6A 1TX4B 4M1MA 1WB9A 1Z2AA 1E6CA 1SGWA 3C41J 4BLRA 4D0LB 4ASUA 2ZREA 3H1TA 3PG5A 4YMUA 3LFUA 2WJHA 3GFOA 2AXNA 4HB2A 4BASA 4NCNA 1AK2A 2ZIAA 4M1KA 1IXSB 2BKUA 2LCFA 4TLCA 3LVRE 1N6PA 1L8QA 3B1WA 3I92A 4DRZA 3OZXA 4MGYR 4XVQA 5TXGA 3ZZ0A 1E32A 3SN6A 2OLJA 4HLUA 5IHPA 3TAUA 1VG8A 1FP7A 1ZM9A 1DAEA 1DAIA 4AKEA 2FWRA 2Q3HA 2V55B 3GFTA 3O47A 3PUZA 3T35A 1XMVA 4M1OA 4QOSA 3EARA 4ILEA 5J4KA 1G4AE 2VO1A 4Q1AA 1CRQA 1G64A 4KSCA 4A82A 5KSOA 1S0UA 3QF7A 2BVNA 3NBXX 3ZJYA 5H70A 2FPMA 1OH7A 2QI9C 2JAQA 3DM5A 3TUIC 2X1VA 3ECCA 1BYUA 4A8JC 3ADKA 2QU8A 3UWOA 4KJZA 2FFBA 1ZVQA 3QEJA 4MUAA 2IYXA 5LD2B 3AEZA 1A82A 3IHLA 3L2OB 3KFVA 1G8PA 4BRUA 3NH9A 1Q1QA 2ZJOA 4RZXA 4D82A 1G8YA 4MYCA 4OL0A 4HAYA 4ZCLA 3I61A 5IRCD 2XZLA 4RD6A 1A1VA 2YKGA 1YHNA 2CHGA 1NMYA 2ZQ5A 2O0HA 2NO0A 1W4BA 2X2EA 4LZZA 1M74A 1GZSA 4LBWA 1DARA 2B8TA 2AFHE 1T6NA 4PR0A 3ZVRA 4PHFA 3KFXA 1T3LA 2IEZA 1S2MA 1RJ9B 3U7HB 2IYUA 4G5RA 3NDPA 3KB2A 3WBJA 2FZ4A 2IL1A 4NCJA 1ZU5A 1Z06A 2G77B 2OCBA 5KNBA 2IS6A 5JJKA 2E87A 4XJXA 1UAAA 1Q1EA 1KMQA 3CPEA 2VYFA 1IN8A 3CW2A 3AKCA 2F7SA 4PXAA 3R8FA 3UXMA 3ZYCA 1OLOA 1KDTA 4LPSA 2A5JA 1OF1A 5EP3A 1WF3A 2GCOA 2QMUA 3MJRA 2NZJA 1U99A 1KSHA 2BM0A 4UQOA 3QUSA 4QBHA 4DJTA 4DLZA 3RC8A 3UATA 3BRWD 3CR8A 2V3CC 5G53C 2BBTA 3CZPA 2YC4C 3LLUA 1U8YA 4QBGB 1DG3A 1EFTA 4GZLA 3C5CA 1SQ5A 3K0CC 4MRVA 5CDFE 3V00A 1EFUA 1KI9A 2IA5A 3ND8A 5FI0B 1NJGA 1TF2A 5L3SA 1W44A 2DFTA 4LBZA 1JPNA 5FOTA 2AKYA 3SJCA 5BN3A 3TSOA 3AKEA 3OEED 4FMBB 2ECKA 4P4UA 1W46A 1RZ3A 1VG1A 4WIAA 2F3TA 1G17A 5EE0A 1G7RA 1KO5A 3CX6A 3GJ0A 4P32A 4I1OA 3WP1B 4FWTA 1GL6A 2DFNA 2BV3A 4GNKA 2AD1A 2G0TA 2WMNB 4DUGA 2AWNA 4GOJA 3B9QA 1J70A 2PL3A 3GJ5A 3NHBA 4O25A 1XDBA 2JLSA 3K9NA 3QG1A 2IYWA 3BIFA 3LBNA 2C5LA 4BGDA 2BCGY 2OILA 2VBCA 1DVRA 3KKQA 2NTYC 3EA0A 5FBRB 4OJQA 5E7IA 4D4KA 3N2EA 3PEUA 3D8BA 3VR6A 2CE7A 4BLQA 2IX3A 1NG1A 4BZPA 2ODEA 4LHZA 4B76A 2VLIA 1D9XA 4KYUA 2JDID 3BWDD 2B6HA 4KSBA 4O2RA 1GOTA 2IEYA 4URYR 4GFDA 3CH5A 3HU3A 1K8RA 1XRJA 2GF9A 1TADA 1P62B 2DR3A 4R9UC 3CO5A 1FL9A 2FZLA 2CHVA 1QZXA 3FMIA 2D62A 3K0SA 1YRAA 2WMOB 2XGJA 1UJ2A 3REGA 4LBYA 5EQTA 2WV9A 3ASZA 4KVAA 1DAMA 2AFIE 3W5IA 4Q4LA 1JECA 3PUVA 2XNSA 1R0YA 4YDHB 5H8WA 2HJGA 2QQEA 1OKKA 1E79D 4QXAA 1VMAA 4UNRA 5HKKD 4JLKA 2WICA 3C14C 4WAUA 1U9IC 4WXPA 4R2IA 5FUYA 4G1UC 4ZDKA 4KO8A 5E95A 4YXWD 2GNOA 2ZRKA 3LQQA 1U8AA 1CJVC 4D4LA 1W0JA 3A4NA 3BS4A 5DI3B 4B6FA 2WWYA 5JHGB 4DB2A 5EUQB 3Q5EA 2WTUA 4QGFA 2V1UA 5JMTA 4PPFA 3QNUA 1GRNA 2A5DA 5UKDA 1KSFX 1SKYB 3K0AA 1H8HA 4DLYA 2GF0A 5FR2A 2AK2A 3MD0A 5C46F 4QJ3A 3KXIA 3KDSE 3HU1A 4OQLA 4TYQA 4YONB 4TLBA 3WRXC 4R71A 1FZQA 1XPOA 1M8PA 3FMOB 4HI0E 4LJ7A 1XZQA 2R6AA 4V0ME 1P6XA 3VHLB 2V54A 4DLRA 3QKRB 3GLGA 2J7PD 2AHOA 1G8HA 3R7WB 2WJVA 2ZSAA 4Q19A 4XH9B 4UNQA 2A5GA 4P3YA 4EPYA 1E2KA 3GEEA 4TMTA 1X8JA 4PSAA 3EPLA 1W1WA 2JJ2D 1KDOA 4G5GA 2XZOA 5CJ2A 1AGPA 3DDCA 3KXKA 1X3SA 2BWJA 2KWIA 4IFBA 1KAOA 1E9EA 2JEOA 1P9RA 1NLFA 1N0VC 4F4IA 5JEDA 3VNUA 1SVIA 3NIBA 1E98A 1FTNA 1XTRA 1HE8B 3CRW1 4OHVA 1G7CA 4A6PA 4ZKEA 3I32A 3C15C 4KFSA 5KO2A 5HE8A 3K70B 2QAGA 2ZITA 4US1R 2F9LA 4IW3B 2ONJA 2EQBA 2V1XA 1SXJE 3T61A 4P0TA 2VP4A 4JLAA 3EW9A 3OE7D 1XD2B 1GIAA 3FOZA 3WMFA 1NRJB 2ZE7A 2HXYA 2ZJYA 3QEOA 1XBTA 3VFDA 1X8KA 2V7QA 4G01B 2QEQA 2QP9X 2WKQA 4DBLC 1OXTA 3SHWA 4ZI3A 2Z4SA 4B3BA 4EQ6B 4F38A 2RH5A 4NHOA 1KY3A 4BFZA 4PQYA 3OIVA 1G21E 5GVRA 4OBEA 2ZUBA 3RABA 5HKKA 3ADCA 4KFUA 1CULC 1KDRA 1E4YA 1GP2A 4MKFA 1P61B 4QC2A 3B78A 4G5QA 4MRNA 1N0UA 3HDTA 1ZIOA 1ZM7A 2W2TA 4CYMA 1WBDA 1G8FA 2GHIA 3K9HA 1XXHA 4JIMA 4Q4HA 2MSCB 2KB0A 3T1OA 3RS2A 3U3KA 4JJZA 1TQDA 4CEIB 4QFMA 4A8JA 1EX6A 5FPHA 4UNSA 5FI1B 2HLDA 4ASUD 2O8CB 821PA 2BMEA 2CBZA 2PLRA 2ZRNA 1P3JA 3MJHA 4UNNA 1R4AA 3QKTA 4TT3D 5JWRA 2NPIA 1E9CA 1YR6A 3GPLA 1E2JA 1LF5A 5LD2C 4KI0A 3TUJC 2LKDA 2WSSD 4A4DA 3UK6A 3DZ8A 4ZDWA 1SVMA 3HYTA 1XCPA 4DEYA 2DB3A 3D6TB 4HAWA 4ZCIA 1T0JB 5AJZA 4QNMA 1Z6XA 4ZDJA 4P4SA 4BFSA 1GL7A 1BIFA 4Q1EA 2B7CA 2R62A 2W0MA 2J45A 2QTFA 2HCBA 4LC0A 1A2KC 1Z0DA 2BBSA 1CR1A 3PQCA 2IF0A 3TW4A 1MRNA 1XTIA 4PANA 5LB4A 2VHCA 2Q0HA 3R8CA 4KHZA 3IQXA 3DZDA 3RHFA 1XTKA 2QORA 2B8WA 5CDFA 4TTQA 3OIYA 3SBEA 1UFQA 4LPKA 3TKLA 3U7EB 4D6PA 4C0BA 1R0XA 2GVZC 1XJ0A 2QTHA 3CF2A 3IGFA 4L8GA 1GVNB 4DSUA 4IKEA 5J4YA 2VHTA 1YRBA 4AIIA 3K0EA 2XSZA 4M0LA 4YMTA 3DKVA 1MABB 2ZUDA 3NVAA 1P72A 3RC3A 1W2HA 5L3RA 2G88A 1R8SA 3E2IA 2H17A 2WWIA 5A4JA 2GXQA 4QHSA 4HLDA 1FFHA 4B71A 3A4LA 2C04A 2BHRA 1DELA 2JA1A 3EA5A 3SYKA 3HYRA 1JNYA 2PJRA 3K09A 4A0HA 1MABA 1NSFA 2G83A 2NMVA 1KY2A 1OPXA 2EFCB 5D3MB 1UDXA 1D2NA 3THWB 4NYIQ 3L43A 4H1UA 2GCOB 2ZYVX 1UEJA 1OJLA 5TARA 4ZI2A 1ZD1A 1Z0FA 1BS1A 5CYPA 1P2TA 3WBKA 1UADA 2DWOA 5J47A 4IDHA 4LK2A 1Z6TA 1G5TA 5KPJA 4OK3A 3X1WA 3GLHE 3KJHA 2WWFA 4RD0A 3X1DA 3L0OA 4XVUA 1RW4A 4OK6A 4PC1A 4OHZA 2REOA 4O0MA 4CEJB 4CIDA 1E1QD 1ZNXA 3UMSA 1YQTA 4M9SA 1XMJA 5FBQB 3LXXA 4ITRC 1BKDR 1KYIA 2OCAA 2O8FB 3A4MA 1NN1A 2J1LA 4B3FX 2FG5A 3PUYA 3RWOA 4TT3A 5KNCA 4DCSA 4M1YA 4NYIR 2IYTA 5TVKA 4BRWA 1N6NA 4BFVA 1Q3TA 2AL7A 2X77A 1DAHA 4XTCS 5AWFC 1N5LA 1P73A 3RS5A 3VKGA 4DLWA 2HF8A 2YOFA 3Q85A 4S2EA 1Z22A 1OIWA 2P67A 2ATXA 4IVPA 1PLLA 5C4MA 3SC3A 5DI9A 4PAMA 1JJ7A 3NBZC 3GFPA 1OH8A 3OFND 2GTPA 4ARZB 4AI6A 1QHGA 1KO8A 1UKEA 1XCGB 3KTAA 1YR8A 4OI2A 3N70A 121PA 2GZDA 4A6XA 4I99A 3OHMA 4AYTA 5J4HA 1L7VC 2A9KA 2QUZA 4OQNA 2O8BA 2D7CA 5F2EA 2EVWX 1II8B 4PPGA 1ZBDA 3LLMA 1AZSC 1Z28A 1IONA 1WA5A 4W7SA 1LF0A 4QGGA 2KJQA 4Q9LA 4OKSA 4MKIA 5GJVC 1Z8FA 3JZAA 2FU5C 5KPDA 3ZLJA 2Y8EA 1R6BX 4LI0A 5EZ6B 2HF9A 8OHMA 4X8HA 3EWSA 2NO9A 5TMPA 4JT4A 1SKYE 2BEJA 5DISB 2WWHA 5CLLA 3D7MA 5JS7A 3FWYA 1VDZA 4A1FA 3RS3A 2NQ2C 2A3RA 4HUQA 1Z07A 2IUSA 4OJKA 3OF5A 4Q4AB 4KU4A 5JWHA 4JLPA 4WW0A 4ZCMA 2WJYA 1IN7A 1OYYA 3AVWA 3AUYA 4Q21A 2VHJA 5B30A 3GLFA 3B8HA 3RRYA 2JLUA 5CYOA 1Z0IA 4H9GA 4V0OA 1OIVA 4DB4A 1XNJA 3KZ1E 5FTMA 4V03A 4EFMA 3VTKA 1M7HA 4R7ZA 4C9BA 3GP8A 1CR2A 2OO7A 1EFCA 1H65A 4C2UA 3K9GA 1ODFA 5ANRB 5KDLA 3DL0A 4Z8XA 1US8A 5ELXA 4B48A 4TQUS 4WZ6A 5FL7D 4Z54A 2ZR9A 5DNYB 1KGDA 2EU8A 4PC6A 4GDFA 1OSNA 2V8OA 1HQCA 2JJ1A 1TPZA 3Q7QA 4IDNA 2ZS9A 1SXJD 4Z8YA 1E4VA 3CH4B 1Q20A 4HATA 2GEVA 3G5UA 1E9BA 3ZIAD 5FBWB 2QE7A 4RFVA 4HAXA 3VR1A 2N42A 1M7BA 4TYNA 2C96A 4A15A 2XAUA 1US8B 1IQPA 5B58C 5BYJA 2HCJB 4DXAA 1S9HA 4IHQA 2ORWA 1GTVA 4FXPA 1H8HD 3RS4A 3IBGA 2QL6A 4GOXA 4YDSA 4JBYA 2VRWA 2J7PA 3KB1A 2ORIA 1RKBA 3QKSA 4W5WA 1MO6A 4RD3A 4M1SA 3QENA 4Q5IA 2ATVA 3K0CA 3LD9A 1NIPA 3H4MA 1MO4A 2QPOA 5A5GA 1IXZA 2QENA 3DEFA 5CK5A 3C16C 1N6HA 1ZYUA 2GJ9A 1YVDA 4JLNA 1XB2A 2WBLC 5BN5A 3LRPA 4QJ5A 4P4TA 1VECA 1TU4A 3D31A 2BEKA 1HT2E 1KTVA 2QNRA 1SVSA 5BXQC 2DBYA 2SHKA 3O8RA 1QRAA 1ZU4A 1VCOA 1SXJC 3QJYA 2PH1A 3OIUA 1J2JA 1MR3F 1AS2A 2OXCA 2ZR7A 3U3MA 1SVOA 1TEVA 721PA 1JBKA 2DFKB 1DS6A 1W7AA 4UJ3A 4Q66C 1RJ9A 3GQBA 2JLQA 2VIIA 4WZAE 1LV7A 3AVXA 2QROA 3ZVLA 4DWJA 3U5ZB 4G0NA 5AR1A 2CLSA 2WAYA 4US0R 1YJ5A 4ZKDA 5BQ5A 2YWEA 1LFDB 2AX4A 5K8TA 4I4LA 2WJGA 4HLCA 1R5OA 1P2SA 2OUKA 5HPYB 1N6KA 1F2TA 2ZI4A 4W5HA 2W83A 1ZC4A 3AF2A 2ZVPX 3QXJA 4HYYA 4MH0R 4NZYA 1II9A 3THXB 1U9IA 3MWJA 4FMCF 1ZD8A 4LJ6A 5E7JA 2FJUA 3AKYA 3U4QA 4XD7D 2J7KA 4I1VA 5FOWA 1IY2A 2NPFA 1W36D 2I1VB 4HDQB 2J5XA 4RFSB 1AS3A 3QPWA 4JKIA 1E9DA 4PO8A 3VQTA 5JZVA 1OH5A 2JIZD 3ADDA 2QY9A 1EX7A 2OAP1 2XB2A 3IKJA 3B1VA 1KI6A 2N1BA 2IYRA 2R6DA 1UBFA 1XPUA 4Q1DA 1ELOA 1SVKA 2WVJA 3PEYA 2R44A 1FUKA 4B74A 5FBLB 3CKLA 4AURA 1HQYE 5FUWA 4MRRA 1M6NA 5JRZA 4A0RA 2OBNA 2RGBA 1FPMA 4PO1A 1LS6A 4B3CA 1QF9A 3TSZA 3X1XA 5FL3A 1FOEB 3R9WA 2BKEA 2R6GA 1RFLA 2ZRMA 4B2IA 1XEXB 1KIMA 1GNPA 2WHXA 1KI6B 3F8TA 3B9PA 4B2LA 3FHTA 2UZ3A 5EP4A 3QE0A 4S35A 4EPRA 4URWR 1YE8A 2VSXA 1OT3A 3RAPR 4JLJA 1NSTA 3L82B 5J4LA 1UKVY 2OT3B 2W6JA 1D5CA 4E03A 4JL6A 1NVVQ 3CLVA 4EFNA 1J90A 1G6HA 1FNMA 2IYVA 2F1IA 5IF9A 1GILA 3REFA 1IBRA 4LOAA 3IQWA 3THYB 3SOPA 4IVQA 1YZGA 2V6IA 1UBGA 3SHFA 1L4UA 4PSVA 1U0JA 2WZQA 5G3YA 4YMVA 3B1YA 4NYJQ 4YC7A 3LW7A 2JLWA 1G7TA 2NIPA 2G1JA 1KKLA 1XF9A 4KLZA 1RRCA 4HZUA 4IOLA 4AC9A 3AP1A 5EP2A 1XMIA 4MUBA 2XXAA 3MFYA 4B73A 1VHLA 1FX0B 5KSZA 5DYGA 4GRAA 1YZTA 1W49A 5FL7A 2O8BB 3FPAA 1E2MA 5D3MA 1NVXQ 1ZNZA 1FNNA 3B6EA 3CONA 3FGNA 3EPJA 1DADA 5FPSA 1G20E 3I8SA 2FFQA 4PTLA 3AP3A 5EE3A 2PX3A 2HLDD 3EZFA 2ZYUX 4TLEA 4HZUB 5GJWC 1GDDA 4HEJA 1B0UA 4G3XA 4W5JA 1T3HA 1U0HC 3CB4A 2FN4A 3NBYC 1RC8A 2GAOA 3A1UA 1NLYA 1XXHB 3ETLA 5SZHB 4CDGA 1QG2A 2JLVA 1Z3IX 4DDVA 1HURA 5L3QA 3EX7C 3FDIA 2G6BA 1N3BA 1Q1BA 4GI7A 4NCHA 1CIPA 3BB1A 4QGHA 3GLFE 3UPUA 3B60A 1XMSA 2CJWA 3RANA 3VR3A 3HWSA 2GRJA 3EC1A 3EZ6A 2J59A 2V9PA 4XD7A 1WE2A 4MGKR 4Q48A 2A7QA 4IDPA 4BLTA 5J40A 1VYVA 2PBRA 4IDQA 3GMTA 3SJBA 2O8EB 2FOLA 1YZLA 1W2GA 5BW8A 1SULA 3Q8XB 2IS1A 4LC1A 5KDOA 1KOFA 1W4AA 2WOJA 2VQSA 1IOZA 4K81B 2HJVA 5IDVA 1G41A 4LBVA 4MRPA 3VHXA 3QPVA 5AJYA 1W0KD 3EC2A 4D0GA 2JLRA 4GMXA 1XXHE 5HE9A 4XSGA 5HR5A 1KSJA 1XTJA 4AG5A 1D2EA 1HTWA 1CTQA 4MA4A 3P27A 5FUXA 3SYLA 5JI2E 4LYFA 3CPHA 4X8LA 4IRUB 1E9RA 5KU1A 1EWQA 3SJZA 3PR1A 4NU0A 1R0ZA 4AG6A 1V5WA 1K5GA 1TQ6A 2CL6X 2VL7A 2CCGA 1HT1E 3GD7A 3OEHD 2P65A 4TL7A 1EWRA 3AGPA 2IHBA 3LBIA 3SS8A 4XWKA 4RKEA 2JCSA 1WBBA 2WIBA 5IT5A 1CR0A 1RRPA 2IHYA 4U02A 2QGZA 3AF3A 4F93B 1XD2A 2GJSA 1IY1A 1P9NA 2OLKA 5FTNA 3SFVA 2ASEA 1AJEA 2F1HA 2ZI7A 1LNZA 5L3VA 2X19A 2JATA 3TLXA 5F9HA 1NL3A 5CB8A 3OAAA 1JR3E 2X2FA
chains in the Genus database with same CATH superfamily
1RXIA 5G0SA 8ABPA 2JGKA 3FGOA 4D7AA 1W94A 3ZXSA 3PJGA 1SHTX 1JFTA 3NHJA 2ET6A 4JITA 4UBMA 1U90A 4EUHA 3A9RA 1FP4B 4KDCA 4TUYA 2A58A 5EE5B 2G63A 3RUEA 3ONDA 5FBVB 1JDBC 3GJ3A 2P90A 4WVFA 4CG2A 1D5WA 4TMYA 4LDAA 2FPSA 3DL4A 1TAGA 2PUTA 5JSZB 2G1PA 4GUDA 2OBXA 3KE8A 3NOOA 1DJPA 2XHEA 4IJKA 1LDNA 4JCCA 4ER7A 2IS2A 2IC5A 2PXAA 3LYHA 5F52A 3NVMB 1VA5A 4IOKA 4BCBA 2R11A 3OETA 1XPJA 3MTAA 1CQJA 3HCBA 4BVLA 3G2KA 1PWEA 1QP8A 3RTEA 4RTPA 4BRZA 1WX1A 2IPAB 3V80A 1LPNA 1P1JA 1QANA 3C43A 3QBDA 3OBIA 2CT8A 3L7OA 2VDLB 1T2VA 1VL1A 3FYUC 1SBHA 2XCQA 3K9QO 4Q1FA 2FFHA 2ODQA 1XQXA 4ZHQF 3UT5B 1YZFA 3P20A 3S6JA 1FMJA 4QYIA 1VE7A 2GTHA 3DAYA 1CLEA 3CZ4A 3N5CA 4TKZA 2QL5A 5F9FA 4R9VA 3N0XA 1XELA 1E8DA 3OX4A 5LYJF 3S8EA 5I5EA 3LPDA 4LJSA 3S81A 4YJFB 4B3DA 4L3WA 1L8OA 5K6RA 2ZRAA 3QVWA 2TMGA 2F62A 1W5SA 3LY9A 2GPWA 1ESMA 1YZQA 3G82C 1K8ZB 4O2AF 4CM1A 2BR3A 4NCIA 4E07A 2Z30A 2O7NA 1A7UA 2VSQA 3LCCA 4EQZA 2NUTB 3FJ1A 3F3SA 2W2KA 1GG5A 2NN3C 3OTWA 4ZOCA 4B6JA 4BUJA 5GVSA 1M5RA 1W88B 2P6NA 1FYEA 2I9PA 4MRSA 2V4ZA 2BLLA 2I6TA 4EB3A 2WD7B 3INTA 1RKVA 2A4MA 2OD7A 1WCV1 2OCGA 2WJAA 2J85A 3T3EA 1KPIA 1TNDA 1CX9B 2CL0X 2VHZA 1EGQA 5ISMA 1DEAA 3M9WA 3SZUA 1RRMA 3CPSA 4UEJA 3DCYA 4M0CA 4IUCS 2QYSA 4DR2B 4CEHB 3PIIA 4CL0A 1Y9AA 3ZD6A 1ICIA 1RDFA 2V7QD 2XPCA 3WWOA 3CKYA 3BPSA 1UBNA 3EG5A 1QQ7A 2DOKA 5T6BA 3UFXB 1Z8NA 5A5FA 1SXPA 3WDMA 1JKMA 1SZJG 2E6KA 2FSVA 2OESA 3CUEF 5AHOA 4FT2A 2EFGA 4JLMA 4X9XA 5CA0A 1EUZA 3W6UA 2QLMA 3OF3A 4L02A 3WLTA 2ZJ2A 2Z5LA 1SBIA 4UHDA 2VPIA 3BQNB 3OUTA 4KWIA 1JDNA 2CFCA 4NMWA 1K8QA 1PEAA 1QFXA 1VTKA 2O2XA 2FFRA 3WV5A 1R4MB 1CP3A 5FQNA 4F1KA 4HDSA 3LZCA 1GU7A 4BB9A 2DUMA 2CWWA 2OGWA 2R2AA 4LY0A 3WNZA 1YKGA 5B58C 1OLXA 2Z9CA 2ZRIA 4HN2A 4ZEMA 4RVNA 2RGAA 1CUAA 4IPTA 1JI0A 3MJVA 1VFNA 2P62A 3GFBA 1GM5A 3G0HA 4FHDA 5DHSA 1OE0A 1O6FA 3JQBA 2JHCA 4YS6A 1L8AA 4MYUA 3V8VA 3BC1A 3N28A 3RF7A 4OI4A 1M8JA 4V02A 3LI2A 4HYEA 1ZCBA 3NS7A 4DIDA 4BZWA 2A5YB 3H5LA 4FYPA 2D4HA 3RU3A 5CPFA 3A6ZA 1UM9A 1YMUA 4PZLA 1QNFA 5L8VA 3DLBA 1CJUC 4CM8B 2ZXFA 1CEQA 1CJTC 3OQ1A 3GJ8A 3I4LA 3ZCPA 3QJ5A 4CT4B 1ZR2A 4MS3B 2QN6A 4DLLA 2WHEA 1ULUA 4K6OA 4PR3A 1KQNA 3W6OA 2ON6A 4O1HA 3GP5A 3RIGA 3SU8A 3UTCA 4S1VA 3OQ6A 3TZHA 4LDPA 5AKIA 1SKUA 2E9SA 2EL7A 2WA2A 1LNSA 2V6FA 4ZAVA 5ECWA 5H82A 5BWMA 4Y1RB 3EF0A 1ZM3A 2X23A 3WK6A 4GS5A 3G5TA 4F0JA 4DV0B 2X5NA 3NC0C 2HNBA 4ZEVA 1TCAA 3HBFA 2DHEA 3ZS8A 3A36A 4BVEA 3ITKA 2UUOA 3L8CA 1NGSA 4LJ4A 2BPOA 3G2LA 1SY7A 4RF5A 2E4XA 3NEPX 2X86A 3GWGA 3V34A 5CB4F 1SO8A 2CL5A 1VI2A 4CVNA 5L40A 2V7BA 4LYHA 3UW3A 2JRCA 5LNK6 4DR5B 3KQKA 1UM8A 4M1TA 1FQJA 2CDNA 4GEKA 5A9TA 4JOSA 3U6KA 3SM3A 3VV3A 3E8SA 4NTZA 1SUAA 1GPMA 5CX1A 3Q4GA 1Z39A 3PDIA 3VPBA 3S4YA 1LH0A 4NONA 4ARZA 2ZAIA 3I3SR 4EECA 4RTKA 5PNTA 3EGWA 4CLEA 1FXWA 4P0QB 1WP9A 5HRCA 3F71A 4XR9A 5IWAB 1JZSA 2KQUA 1QQTA 1UF9A 4MUFA 5B1YA 2NGRA 4D3FA 4MQUA 1N9KA 4GMKA 4HDNA 3O0DA 3ZHCA 1MW9X 1UOQA 3WLFA 2AQKA 3HV0A 2R86A 4EY4A 2YUTA 2C42A 3PEWA 2AS0A 2H2FA 1QIGA 1YRQA 3EYAA 1C9NA 4MP3A 4CI9A 1Y5MA 2XNDA 3DMNA 4RVHA 4B44A 3NH6A 2TMKA 1GN8A 3Q2OA 3U3ZA 3UGJA 2VP2A 3VGJA 4L4YA 1BN6A 2VQ3A 3NWPA 4IV0A 1FDIA 1ARZA 5B4UA 1JIXA 2GXAA 1JT2A 3T5CA 4HVCA 5K01A 4NG4A 2Q6VA 3W8RA 3L0SA 4BVHA 4BZXA 2IIBA 4ZALA 4QEKA 4ZYLA 5EINA 2XF8A 5DH9A 1RLTA 2YIVX 3GUUA 4EGSA 1IRXA 4PLZA 5IG2A 2HV9A 3ZQKA 1D2CA 4TRJA 1E63A 3EXEB 4FP9A 1LK0A 2Q1UA 3GA7A 1SK9A 4QICA 4BL5A 5CDSA 2YYZA 2HOQA 2Y05A 4P08A 2WPNA 5TRTA 3SXPA 3QF4A 1UBHS 2EATA 1M0TA 3O3OB 4E5UA 3CKMA 2PV0A 3U4MA 1ENOA 2E4ZA 2FSGA 4O4HB 1XIVA 2HB6A 3M33A 5EMNA 5B3JA 2YS6A 4RJTA 4KITB 5ICMA 4N3BA 5JYDA 3AFHA 2EGGA 1NTRA 3N0TA 2C77A 2O2JA 1GD1O 3LVQE 3OU2A 4QATA 1T43A 2YVAA 4BAUA 3QIAA 1OBOA 2G3YA 5KNCD 1Y3BE 4U6QA 3I45A 3RUDA 3ETGA 2XR1A 1QS0A 2IXEA 1H6AA 5DSTA 3BH0A 3SEZA 1UT8A 2C84A 2WIDA 1D09A 1CIVA 1E94E 2N9UA 2C78A 2PQ2A 3ZDBA 2A1UA 4L75A 2SBTA 4P5DA 2NXNA 5HTKA 4LE1A 5A71A 1WQ1R 2B92A 2ZUCA 3BMQA 3TRIA 4AVYA 1WETA 2Y1OA 4Y9SA 1XQ9A 2YZGA 1L5FA 3B3JA 4JLSA 2D7DA 4BNGA 3FYDA 4BWYA 3ESCA 2DWPA 2OK7A 3AETB 2BOVA 2B20A 4A2WA 5LU9A 1EWKA 3KO8A 1NNEA 3W4IA 1JKXA 5KOHA 2J9YB 1AF4A 2ORVA 4B3IA 5LSAA 3TF5A 1PYOA 3L7CA 3RVRA 4I3HA 4XQGA 3O8OB 4R0VA 2WA1A 4NYJR 2HHAA 1X8LA 2MSLA 1C7JA 2FEOA 3M3HA 2EL9A 3A1SA 4QDJA 4RXMA 4DLNA 1RXVA 1SIBE 2V65A 5CCXA 3E53A 4MX8A 1OA0A 3R7DA 2H9IA 4HTFA 1DEKA 2NXCA 4R9NA 4D8WA 4KNYA 3WQSB 2XVYA 3K9BA 1MZVA 3BFVA 4MYHA 4JLUA 2AOUB 3AHGA 3TLYA 1L5VA 2IYOA 4GP6A 4RK0A 4MMXB 1CJKC 3C3PA 5G4KB 3H8SA 4NE7A 3ZY6A 4RJ2A 2P6RA 1KAGA 1RVDA 3NASA 1P29A 5EHNA 1XKQA 3CLHA 5MN4A 1E1LA 2A5FA 3PDWA 1SC3A 4PWZA 5BN5B 1YGYA 4UD6A 4XE5A 4FU0A 1L4YA 1J8YF 4UDXX 3DXFA 4QYWA 4E31A 1B6TA 1L7BA 3QHAA 3L0BA 2GKGA 4GHWA 1V7PC 3JSXA 4QM7A 3FWKA 1KI7A 3PVCA 4V1CI 4RE5A 2H1FA 1UBKS 4GT1A 4O4IA 1ZCAA 1UP7A 2BCJQ 2PX8A 5C1OA 2QN1A 1KJ8A 1ZH6A 5HS6A 4V1CB 1NMQA 3QLEA 1YVPA 2HA7A 2G06A 1AHNA 2A0FA 3KLBA 3NBQA 3Q98A 4ZCTA 3CVOA 3LWDA 1ZM4A 3DR3A 4UBJA 4KIFA 4MAFA 1KE2A 2A9FA 1H4QA 3WLRA 1FDTA 2Q5JA 4CF5A 1U9JA 3AM3A 1PQUA 2JLZA 4IXDA 2YRFA 1FQWA 1PZNA 1TQHA 4YQEA 4CMJA 3I5XA 1E3JA 1V47A 3AX6A 4CTJA 4F8JA 2B4YA 2UXDB 4X20A 4HB3A 3T95A 1YOVB 3TO5A 1WVMA 2P6UA 5CIWA 2QTBA 1NC3A 3HCDA 3GC6A 3IOCA 4NK4A 3S1AA 2ZYSA 3KFLA 4RD2A 4MGIR 1EUDB 2F00A 2SECE 5LMNB 2ID9A 4FX2A 4JSRA 3RYIB 5JWOA 4BRSA 3IDSA 5JQGF 1S4QA 4EHLA 4V0LA 1X19A 3IPCA 3MWDA 2Z3WA 1WY5A 3D1LA 4EBFA 1HEYA 2B5VA 2O07A 3KZVA 1TOAA 3HUDA 2ABWA 5BQOA 1SZDA 1RQPA 4HZIA 1J8VA 1C1DB 1NOJA 3QP9A 5DMXA 4E70A 4KPUB 1S9DA 2R96A 4XDHA 1EFAA 3SR3A 3KCQA 3FSEA 4HGNA 1Q3HA 1DKQA 2XUHA 1A8QA 2GO1A 4LW8A 2G1AA 4NU8X 1E1RD 2VSOA 4JEMA 4UNPA 1M1YA 1JE1A 2CLKB 5BN4A 5K0LA 4RY0A 1MOSA 2ZK7A 3KHSA 4PW0A 3PUXA 1YASA 3QEMA 4FYXA 5CK4A 4B7ZA 1YZHA 1U1GA 5D85A 2POCA 4OGKA 4B2YA 4C7VA 1MBZA 3H05A 3CUKA 4BS9A 1A0OA 3KOWA 1TRKA 1OBFO 4KG7A 2ILTA 4BKMA 2HK6A 2HTFA 4KPYA 2HK9A 4C03A 1JR3A 2QVBA 3BGWA 3VU9A 2IYSA 2ZSBA 1NPYA 3MGKA 4ECAA 2UU9B 3CTMA 4Y18A 4HQFA 3NUQA 4GYKA 1CQPA 4HXFB 1C3LA 1CG6A 1T3ZA 2HTEA 1ORTA 1Q7BA 4NARA 3QI7A 4LWZA 3WYFA 5LXTF 4IIJA 4OOEA 4YCMA 3BXFA 3NG1A 3N87A 4JD5A 4BO4A 3ZU5A 2VDRB 4MVJI 4AF6A 4D81A 1W36B 5GWXA 1PTJA 4RIEA 4LF9B 1AQYA 3P8ZA 5JQGB 1APBA 1P4HA 1Y9JA 4BNFA 4E22A 4DMUB 2F67A 4ON9A 2EC5A 3OVMA 1N5KA 2G6TA 3P9SA 4YCAA 3TTYA 2JASA 4B7XA 3A04A 1DFIA 4S1OA 5GAJA 2TS1A 1NJFA 4WASA 3AEUA 2FPKA 4L50A 4JR1A 2FQQA 2AI3A 2CNKA 4DQVA 4D97A 4YUYA 3ELWA 3NBMA 1NBIA 4F4CA 1CUWA 1QHYA 4QHTA 1JE0A 1HT0A 1Y1PA 4I1IA 1G2QA 4PC7A 1J56A 4C5CA 5COBA 1MV5A 1LTKA 1ZXLA 2GHQA 2R1VB 3IJRA 3KEOA 2P5SA 4G25A 3P0IA 4V3CA 4JC5A 3EXIB 1E1KA 4JT2A 1OFHA 3AFIA 4GRDA 1J8MF 1SBTA 1O1YA 1Z29A 1H05A 2VJAA 4JLVA 4LCBA 5T4FA 1TYZA 3U31A 3GROA 4RTSA 5KWIA 1Y8ZA 1V95A 4HG2A 1HOTA 3WYEA 4KPGA 4ENQA 1CP2A 3I53A 1JHZA 1NVTA 4D9EA 1BW9A 2CFSA 4KQCA 1YWGO 4KMSA 3KYIB 1LQUA 3P9ZA 2A14A 2F90A 5ALFA 1NW8A 2BGKA 2X0IA 3MYRA 2TYSB 3FDZB 3A58B 4JASB 3I5YA 3DOOA 2R1ZA 4KODA 1HEIA 1JGTA 4PLPA 4YGXB 4AJJA 2EEZA 4P2BA 4ZYZA 3KQOA 2IDZA 3F6PA 4CUKA 1M2JA 4JFAA 5AI5A 5JSQA 3ROEA 3CNLA 4RLQA 3K2EA 3NTUA 2ST1A 4YUVA 5LBIA 1Z56C 4JJAA 4DTCA 5AK4A 3L7NA 4GX2A 2KE5A 3K1YA 3ZV4A 2CK3A 3RRMA 2YMQA 4KCGA 4DT1A 5KTYA 3R76A 2NWQA 2VYNA 2W93A 1D8TA 5EJ9A 2XUFA 4RHFA 1YJBA 1QGUA 1I32A 2YZ7A 4JQZA 4D4GA 3IOEA 1TI7A 1E2BA 3D4BA 3UG7A 4BX2A 4WZBB 4MWSA 2QN9A 2WUEA 2HMAA 4L1KA 1UT5A 3UK2A 3O4VA 4XQEA 3PWTA 1Z33A 4TKLA 3D1VA 1F8UA 2PY6A 4NV0A 4C6RA 2W6ZA 1AN0A 3AM4A 5HDQA 3ROKA 4INOA 3LCRA 3U4QA 2QG9A 1ENZA 3EFHA 2GZAA 1HV8A 1XWFA 1E9SA 5BW5A 4XZ3A 3ZQJA 4LOKA 1QPZA 1QONA 3T5GA 2IQIA 2QV7A 3DEZA 3KTDA 1E1NA 1WUJS 2B0JA 3A2LA 1D7AA 3DKKA 5M04A 3BIJA 2VF8A 1X0VA 2F3QA 1QLWA 4RWEA 3WLEA 4WV3A 3SQLA 4OHYA 2I2AA 2R00A 2W6JD 4A8PA 2BTEA 2ZJBA 3Q7PA 4C87A 3MCTA 5AUOB 1M0WA 4NVRA 4WJLA 5ENVA 2O8NA 2PJZA 4Q3AA 3MVEA 1HA3A 3X1MA 1QKIA 3FE2A 1KMHB 4XUDA 1ONPA 2PR7A 5DO9A 5A5VA 4ENPA 5JNTA 4ZEXA 1UEXC 2PH7A 1RMYA 2DFVA 1AA9A 1K63A 5EJ2A 4FFSA 3ACBA 1OROA 3A6PC 3FD8A 1P8AA 2OWEA 5DRTA 2C7QA 2JEZA 1TCBA 2R47A 4DR6B 3FCUB 4TZ0A 4P5PA 2QW8A 2K4MA 4RE6A 3GBPA 1YTLA 2IZOA 4EIWA 1C81A 4IMPA 3B5JA 2YY5A 4CRWB 1NA5A 5JE8A 3RYTC 5AW7A 4DLUA 1TO6A 3VH2A 3KJZA 1MXHA 3LO5A 1HETA 4RIIA 4B43A 4QNRA 1W2WB 1UZMA 1E20A 3AHEA 3AOEA 3I28A 2FPOA 3HO8A 3N07A 3ZNNA 5TLSA 3PCRB 1ZZGA 2FWAA 1L0BA 1QX3A 4FS8A 2C2XA 4FGLA 3SJUA 4DADA 2OWDA 3OX1A 4DW8A 3K96A 3WGVA 1H8ED 2F43A 4XIGS 3W2HA 3CCBA 4MINA 2JAXA 3NM5A 3ZWCA 4E5DA 3RAGA 2V7EA 4NU5A 1ZJ6A 4X92A 3E05A 4HDSB 3X0DA 1KJWA 1IHOA 1O5IA 2AF3C 1ZCJA 2OFOA 5AOAA 1C0KA 2FKAA 1T2CA 5AI4A 2R5WA 3DEYX 4FDUA 4LNUA 3LQKA 4TXMA 2L42A 3K6SA 3DCIA 3H4VA 3I9V6 4YIHA 4MIOA 2NUPA 1DTEA 5BSWA 2XLBA 4RX1A 1W73A 2FGKA 2J48A 3OZBA 4JV5B 5DLPA 1QCDA 2C97A 3MQFA 1L5KA 3MCAA 3BA6A 3W8NA 4AJIA 4D6XA 4W1QA 2W2QA 2GDJA 1H66A 3S2GA 4FWIB 1QHSA 2C3MA 1ZUNA 5CNKA 1XRPA 2QRQA 5JECA 3TL3A 3AL2A 5ERYA 3FZQA 3F1KA 1OYOA 3QPAA 3KOYA 1RXWA 4QUHA 3ZE2B 1D9ZA 2WYOA 3BAZA 1WABA 5IFKA 1QQ6A 1TTQB 1TVKB 4UARA 4X84A 2PKQP 4K3UA 3UV3A 1ZH4A 2E4VA 1E4EB 5LDGA 1OC2A 1S8AA 4DXDA 3R3UA 1G8SA 2A2ZA 4AUNA 4BLUA 1G5RA 3CEHA 4G85A 1QF6A 4J0QA 5D84A 3TBFA 1ZPDA 1MG5A 1J00A 3AWDA 2IPXA 1U2SA 1PGOA 2W00A 2SCUA 4YI3A 4ZO6A 1OLSB 3G2QA 4G0MA 1NYTA 4DLXA 2XJ4A 3ZDZB 3PFIA 2OYSA 3HCEA 3OIFA 4Q03A 2X8WA 3HXPA 1ISFA 1IXRC 1J8FA 1YR3A 2ZJ1A 3T9DA 4YUXA 5IC4A 2XWQA 3E18A 4L73A 1JHPA 5BVHB 2HRQA 3ORSA 4JU8A 2OFXA 2QZJA 3RSZA 2QT9A 1Z12A 3IDQA 1YULA 3JD3A 1EZZA 4XJSA 4YBRA 4QA9A 4AT1A 4NAHA 4DYHA 2PGDA 1HDZA 4F91B 2ZE5A 5A0FA 3EGDA 2VP0A 3AERA 1F2UB 4HF7A 1Z82A 2EHJA 9ABPA 2D2EA 3EQZA 5AVTA 1P9OA 1VGVA 2BI4A 1VPTA 4EVRA 3F74A 3FUUA 4QBFA 2D1QA 4Q3DA 1JH8A 2F6RA 5GGYA 3QX3A 3LTNC 2QAJA 4WOPA 5THKA 2QTZA 1UMBA 3H5TA 3UWKA 1OAAA 3TOZA 4PAQA 4AN4A 1ZOLA 4PZEA 3WLOA 4BMZA 1Q0LA 3NTLA 4V0RA 1ZM2A 4G23A 4OHBA 3DGEC 3RFCA 5TGZA 3UJAA 1HKHA 3VZCA 1P2BA 4AD8A 3PWKA 4LRTB 3EJWA 3NT5A 4ER3A 1OC4A 2PUVA 3FYUA 4Q4AA 4NKRA 1Z7EA 4TLDA 5T3YA 2DY1A 2WLTA 1DV2A 2EWWA 1J7JA 1YL7A 3GDOA 2IPNA 2WIAA 1JXMA 4L3VA 2GD1O 2XMPA 4OHMA 3VR5A 4OREX 2XRZA 3PT5A 2H2DA 4ZMBA 2XUDA 3T0FA 1XRLA 3QX9A 3NAZA 1M6VB 3GAZA 1NUPA 1GUDA 3K0FA 1H2YA 1JL3A 1VGRA 3T5DA 3DLHA 3IPYA 5HTOA 2DJ5A 4YPFA 4PFKA 5DRYA 4PRKA 5IZCC 3QOFA 1JMYA 1VPVA 3H5WA 2HDNB 1XXLA 4FZRA 3ZYZA 4ABTA 1HL7A 1R15A 1KYVA 2GJKA 4PYQA 3SC6A 1Y33E 5LQSA 5CVCA 4YRCA 2INGX 2I03A 3A32A 2OECA 1NZDA 3ZDDA 4H17A 3IQZA 4BP9A 1BHJA 2A88A 3K70D 1I5OA 1LRLA 3N05A 2RI1A 5IWCA 4MQLA 3JWIA 1GRVA 4XDYA 1SQGA 1OLUB 5KYUB 1PQWA 2DVMA 2JBAB 1X87A 4CKEB 1U9ZA 4RSRA 4B4WA 2OOSA 1LSSA 2H4HA 3GQVA 3MJDA 2GUGA 4DJ5X 1ZONA 1XZFA 1Y5LA 5P21A 1NQVA 4X1YA 4L7VA 3R6GA 4OFWA 3GFGA 1BEEA 1E79A 3UAVA 3KB8A 4CGZA 4AK9A 1WPRA 3B2QA 2Z8XA 5LC1A 3BJZA 3Q3GE 2B82A 2WWGA 4M9XA 4DLTA 4MW0A 4TYWA 1ZW6A 4ZMSA 4DSAA 1P4JA 3OZVA 3DOUA 1I7LA 3MUFA 2C5GA 2QTNA 2HWXA 2NO5A 3RHZA 1XVVA 1OFVA 1JMVA 1P7WA 1U2QA 2WPDA 4MEAA 1ZR4A 1R6VA 1JBEA 5IAAA 2E37A 2DHDA 3UN1A 2OLEA 1LJUA 3D43A 1N2ZA 2KLHA 2WJJA 1EGAA 4UU0A 3L4KA 2QJOA 3Q9LA 4HNSA 5BWCA 4KIUA 2Z2ZA 5JS1A 3C0KA 3ZXYA 1CF4A 3AG6A 4Y2QA 4RGBA 3IQGX 1PUXA 5FFFA 3RV3A 3SCZA 1S6YA 1U2DC 4TM7A 1C8LA 4EZBA 2D1TA 4U8HA 2PUDA 2V96A 2BE7A 3NIDB 4F6RA 5JVDF 1QYWA 1WHSB 3L4BA 3WQBA 2ZB2A 1C9JA 3NM6B 3LXRA 2F4VB 4F1WA 1A88A 4HR7A 1KIFA 1MPTA 1NVAA 1QIDA 1U11A 1UZAA 2CF5A 1S8OA 2BM1A 3F3MA 1GPH1 4IZIA 5EESA 4WXEA 1HT3A 1YE3A 1E2GA 1G1AA 1ORIA 3IIMA 1F9AA 3OQBA 2ZUFA 3NHUA 4IP0A 4MRMA 1BQ3A 1WCWA 3LBHA 4B9AA 3ANSA 1IIBA 3CGGA 1YUMA 4OGWA 3O8QB 3SZ3A 1JT9A 5TEVA 3RYCA 4U5QA 2V8BA 5J5CA 5CCDA 1NNI1 2HRCA 1M2OB 3ELDA 4MV7A 4MUIA 3RG8A 2B5OA 1SC9A 3IHWA 4BECA 4OSPA 1JQLB 2ZRQA 5LJIA 2OYCA 1KR2A 1E2QA 3V5NA 4FGWA 4HAOA 1I33A 3C1AA 3D6AA 1BVUA 3P0HA 1GU1A 2MOKA 2DBZA 2XWSA 3EZ9A 4CTOA 4LQ4A 4MP8A 2Y1CA 1A8IA 4G1BA 3SF0A 4B33A 5LQCA 1VBMA 4F3RA 1TCVA 1KO7A 4O1MA 5ALNA 4LYEA 1TVEA 5JEEA 5DYYA 4GL2A 4EJFA 5JO0A 1I1QB 2G9NA 3O8NA 2GPTA 3WMXA 2RGCA 3WMGA 2J6IA 4AULA 3HPRA 3LWNA 4DSOA 5MHTA 4DQLA 1GL3A 4NP6A 3ZDXB 2FQWA 2C2HA 3U49A 4DDUA 1NXPA 2H92A 2Y1WA 3DOJA 4FI3C 4GBMA 4C7BA 5J63A 4K6HA 3BA1A 1YFJA 2RI0A 2WFLA 3EOAI 3GH1A 4R98A 3T5BA 5JPCA 2GERA 2EARA 2P9JA 3LT4A 3OM8A 5ERXA 2QVXX 2F8TA 2I3DA 5EC8A 4EW2A 1W48A 4JR2A 2PV7A 3H16A 4JT9A 1Q44A 4ZMRA 3PT9A 5ER6A 4C20A 5TQJA 2MHCA 4WA8A 2NUAB 4QL3A 5B2FA 1A8HA 1QO0D 3F47A 2DBRA 3SZMA 4B6SA 4C3UA 2OD9A 2Q8QA 1IG3A 1L7RA 4GXNA 2C2YA 1L4GA 1BMQA 3KHUA 3ODGA 3OZFA 4H6PA 3AQ4A 2OCXA 4JLBA 3UA3A 2Z6UA 2VP5A 2H1WA 2QTWB 1KVQA 2UVPA 2PCLA 4YB8A 3I30X 5FUBA 3MCWA 3I2JA 4R5HA 4DR3B 2ZM6B 5CYGA 5MN6A 4D25A 3E1SA 2AKAB 1UC4B 2I66A 3KZOA 3KUXA 2J6CA 4X6YA 1KMNA 4DARA 1RZRD 1JHQA 3GZTB 4LDNA 4LYAA 3GJXC 4DZTA 1NUUA 1ODLA 3FUVA 4WCFA 3ZVMA 2JEYA 3IEKA 1G8KA 1XHLA 4E13A 3DTVB 1OU0A 3CZ9A 3HBJA 3O90A 3ZU3A 1O96A 5K09A 4PN3A 4PHGA 2PL5A 3DDWA 3FPBA 1F4LA 3T94A 4F4JA 2ZRPA 4WESB 4PXYA 1JYEA 4HBGA 1BE0A 3IFSA 4ZPXA 1MIHA 1NDUA 2IU6A 1JP7A 4CCSA 3E5HA 3QITA 9MHTA 5FAXA 4ZI5A 5KKCA 1I1NA 2AF4C 3FCSB 1VMIA 2PKCA 3NR2A 4HJXA 2PTHA 5EZSA 3DWIA 1PTJC 4PO9A 3VJLA 2PWAA 3U7RA 1V5IA 1YZVA 4QPPA 1PJZA 3LKZA 2Z04A 3HJCA 3KE9A 4NJOA 2Q5EA 1SXQA 1T9KA 5T5QA 4IJUA 1S8FA 3EUWA 1AKMA 1HZZC 2WKPA 2EJCA 4GC5A 1EP3B 1BC5A 4ALMA 5AVVA 2HC9A 1I3LA 3EHEA 3KAQA 3P4XA 4WINA 3ELBA 2OHIA 5AMXA 4RTNA 1QFZA 3NKVA 1LBEA 4XXHA 4POOA 4JQCA 4LZWA 2L69A 4UCXA 1YCHA 3AW8A 1EKXA 1T2AA 2FETA 1XTQA 2QK4A 4Y6GB 4BMPB 1E92A 1QH1B 2ZANA 3WMRA 3T3GA 3ZNOA 4F5WA 4B6EA 1ACMA 3TM5A 4EK9A 4QDTA 4DV7B 2H1HA 3CRVA 5KMGB 4RCYA 1D04A 4JYBA 1DAFA 1ZI9A 2NPOA 2XB8A 5KJFA 4JYCA 5DHTA 1ZAKA 1I1HA 2QMEA 4NFSA 3UAZA 5K0SA 5JMOA 4M53A 3ENWA 1WY7A 3ZGLA 4EO4A 4S1TA 3B6ZA 2CJWB 2FMKA 5I7VA 4OGFA 5FOXA 1COWD 1A5SB 1DBVO 2AYYA 3A9CA 2PGLA 2Q5LA 1WZ2A 3H2JA 5FO0A 1QHXA 1QHFA 3GHHA 3MWKA 2OE2A 4N6OA 2ACKA 2OHVA 3L1UA 4GKJB 4ALIA 4XKJA 4IINA 2XYGA 1UAYA 2XNCA 3ZIAA 5JH7F 1E3MA 1DO2A 1MA0A 2N0SA 2G0NA 1ESNA 3AEKB 3DCJA 3OMWA 2YFQA 4WXRA 3RJTA 2H5JA 4W5RA 1P9WA 4B83A 1K0UA 5HW0A 2PSEA 2BDTA 2HJSA 3G0IA 3U6BA 4BZQA 4A36A 4RSHA 1VCMA 1YKFA 4DV1B 3PDHA 4DL9A 4QQFA 5K45A 1UJNA 4HX9A 3N2IA 4IH1A 3J81k 2OSBA 5I01A 3S2FA 4J03A 4AJEA 2PAAA 1NBME 1E0DA 1X7YA 2WV7A 4HDMA 3ICQB 1I3MA 4J1TC 3PFNA 3MCVA 4DMFA 3PXDA 4CLOA 2IODA 3FFWA 4HO1X 4IIEA 5FKJA 4ROTA 2B4QA 3DUFA 4U3JB 3A14A 5DHFA 3H7IA 2CNDA 5AJTA 3R5XA 5JAHA 2JCVA 1REQA 5FTJA 4QZVA 2GBCA 1KI1A 2ZS8A 5H83A 5TNXA 2Q3FA 2X5KO 4C4YA 3IT2A 5KQPA 4CM7A 1R4NB 1FPQA 2Y71A 3HXQA 3CH6A 3PLAE 1TUIA 4X63A 5KINB 5K8VA 1R5JA 5J1TB 1S2OA 2IEIA 1T36A 3KXDA 2VRCA 3N8GA 2J4CA 3ZUPA 1DKRA 4UM9B 1PYDA 2HSZA 2LCQA 4B8ZA 4K87A 3F90A 2NW6A 4K9RA 4MYTA 5EZYF 4YMHA 3I9LA 1KK2A 2GLUA 3AY0A 3X44A 1LWNA 5E0OA 5EJFA 5A3JA 1E5QA 1Z8HA 4UVDA 1E2HA 1PKEA 3DLPX 3ENNA 1PHRA 2AMJA 2Q2OA 5L53A 4EGCB 1J25A 2HZ7A 1U4NA 2X22A 3SLRA 1E6KA 2ZI5A 4LF6B 2X8LA 3EIEA 2R84A 3IH5A 3TGLA 1MT3A 2GX6A 3WDLA 3Q8KA 2OBLA 3E9YA 2C9DA 2IYZA 4I9FA 3T3OA 1T2NA 1UKZA 4RUKA 3UMBA 3UCEA 1I6WA 2GILA 2J46A 3VNVA 4OP2A 2NYAA 3HR7A 1KHTA 3HA2A 1NUTA 2OD2A 2WUGA 1IHUA 2NAFA 3HDHA 3KYDA 1A2OA 2IWHA 3S7ZA 3OCXA 4YR7A 4A2PA 3L7AA 3GLIA 1ZG3A 5GJCA 4L28A 5AW3A 1R16A 3WGNA 2VEOA 4ZODA 2I6GA 4A2QA 2H1OA 3HP1A 3NOQA 3LTEA 3U44B 1QUFA 3GLTA 3GN2A 4F6CA 2GCEA 4KAJA 4P4GA 4RULA 4LNUB 2AQIA 1C7QA 1PDOA 3SBDA 5IAGA 5AJWA 1ZNYA 1V96A 3AKDA 4WNAB 4L4UA 4LZLA 4Y2GA 3U0VA 5JDIC 1EFHA 1N9GB 2DHCA 1HTBA 3H5VA 1FP2A 2H52A 4MWBA 3ETHA 3QXCA 5EVJA 1Z38A 5IUNC 3P5BA 1R0LA 2Q9AA 2BMJA 1ZD5A 5HZHA 1EUCA 2RFLA 2ZIWB 3NHAA 2G9RA 2X76A 1FFSA 2ZI3A 3CE9A 3C8UA 5I7OA 1NJ5A 1IXKA 4OKNA 3T1NA 2CHQA 4Q00A 3TR0A 4PG4A 5KVCA 1Q0ZA 3N8NA 4KO2S 1LW6E 3T9FA 2HXSA 3PDCA 5I8WA 3TVDA 1GZ6A 5FDFA 3FCXA 5AO9A 2NYVA 3V4OA 1W36C 1V71A 4QU9A 1D1SA 2Q3DA 3ND5A 1RQLA 2EP7A 3NYRA 3NXSA 4G0YA 2GK7A 1BEZA 3HA5A 4YUZA 4CQMD 1NLZA 3DZIA 3HR8A 3HFSA 3KHTA 4Q82A 2AEMA 1NUQA 1C9MA 4PZPA 1I94B 3TIGA 3MJFA 1OYWA 1FY2A 2J3KA 3OKCA 3K1AB 4FX5A 1AD2A 1IB0A 2P68A 3RBXA 4OYYA 1N5MA 1ZW1A 1DLJA 2FCRA 1YBMA 2Q0XA 3AEQB 4LISA 4O2AA 4QXOA 3LYUA 3VBCA 4O0LA 1GKKA 4D26A 4GGOA 1MH9A 2QPAA 3NTOA 1I4TD 4YALA 4YMIA 3C7CB 5B53A 1NE2A 4F12A 1XEWX 4R2WA 5BT9A 2YHSA 4Q9KA 1BWRA 4PY2A 3HKCB 2XTNA 5K5EA 4HGOA 1VL6A 2IXAA 1RT9A 2O0KA 1EG7A 3OEEA 4RVGA 1EXVA 3AVPA 3HYLA 2NSLA 2HBRA 3FLMA 3ROFA 3C5VA 4Z1OA 2PK3A 1MEEA 2W2KB 3FPGA 4RXTA 4D9KA 1TIPA 1J33A 2VG8A 2NSDA 3VSEA 5LWQA 4TYYA 3FOFC 1VKJA 1ODJA 4MQ4A 2CFIA 2BCEA 4F8EA 1IY8A 1DKMA 1II0A 3AJAA 4MXDA 1L7QA 5AVUA 3NW9A 4QOFA 2ZTHA 4IJVA 3V4PB 1ORHA 3ZTWA 5SZIA 5TPWA 1KC3A 5B4VA 3CVUA 2CV1A 2PUEA 3RU9A 3IODA 3U4DA 5KAPA 2A1TR 2IHTA 1IJEA 1L7OA 3BE4A 3DOCA 3H75A 4RANA 2XD4A 1KZ4A 4YYZA 2RGGA 4NPHA 4HSEA 4RV5A 3BTOA 2O20A 2A9VA 2AW3A 1KEEB 4MKXA 5DI3A 3M81A 3K0FB 1D1QA 3EH2A 4OBWA 3SC4A 4IX1A 3VH1A 2GSWA 2IZ0A 3PNMA 5LYYA 4Q9IA 1A5AB 3IAFA 2J9FA 1IXYA 4AJ1A 3EEQA 1DU4A 3K94A 1E69A 2X6QA 3BB3A 3DJYA 1M7GA 2ZAMA 1Z13A 3DLAA 4MVJD 4F3YA 1JLRA 2BUBA 5EJ5A 2XE4A 2QVCA 1ZD3A 2JHGA 2FE1A 4RZQA 5FTKA 1FYXA 2M32A 2QZZA 5DN6A 4M1MA 1MRZA 1E6CA 1PSZA 1Z2AA 3DYBA 3NHYA 4ASUA 3E0QA 4E5NA 3H1TA 3GCWA 5JMPA 5AVXA 2WRZA 4A91A 3WNVA 4F06A 5JNVA 1HE4A 1F06A 3NRCA 3OC6A 5IKMA 2ADOA 3FWNA 2JFPA 3G85A 4HAIA 1SM4A 4FBLA 4NZPA 1V6SA 2IXDA 2P6MA 4JJEA 4YO8A 1R9MA 4F7DA 3RVLA 3BILA 2YWCA 1ISMA 5JJCA 2P75A 4X1YB 2OG1A 3B53X 3AIMA 3C39A 3KPJA 4PVDA 3I92A 3F7TA 4IYRA 3E3OA 4URHA 4M6WA 3GGSA 3OZXA 4MGYR 1NQWA 2ZJFA 3VPSA 3SN6A 4ETMA 1ZVKA 4HLUA 5KTPA 2EW2A 4ZAZA 1H0KA 2XVMA 1KZ9A 1Y82A 1NQAO 2XUAA 4KE8A 2EG9A 1LRJA 3EDOA 1ZM9A 3G5LA 1DAEA 1C7RA 1A9TA 2XRYA 2FWRA 1TGYA 2WAAA 3AILA 3WV4A 4N48A 5F4BA 1XMVA 2VRCD 3KPYA 2WU4A 2FFJA 1AK1A 1G4AE 3L6BA 1U3VA 4ILEA 1H3NA 2QR2A 2JFBA 3HACA 1VIDA 1S0UA 3OPYB 3QF7A 4MEBA 2I6XA 3FG9A 4ND8B 2FLKA 5KX5B 4QGSA 1FDSA 1NJSA 1VIVA 3AFNA 5LCXA 1VLVA 4Z9XA 3H9UA 4JX9A 3IQEA 4N5DA