3QEOA

S74e-r104m-d133a dck variant in complex with l-deoxythymidine and udp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
242
structure length
234
Chain Sequence
TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVELTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSMIRAQLASLNGKLKDAEKPVLFFERSVYSARYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Post-translational phosphorylation of serine 74 of human deoxycytidine kinase favors the enzyme adopting the open conformation making it competent for nucleoside binding and release.
pubmed doi rcsb
molecule keywords Deoxycytidine kinase
molecule tags Transferase
source organism Homo sapiens
total genus 87
structure length 234
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qeoA00
2ZSBA 4F4IA 1ZM2A 4H9GA 4XTCS 4AY2A 3U44A 2DBYA 2J0UB 2GZDA 1W5SA 2QTFA 5LDDC 1YE8A 1G3UA 2YHSA 5DGXA 1XCGB 1S0UA 4DLZA 2IK8A 1YU9A 2QNRA 3TVTA 4V0ME 1CEEA 1KK3A 1FFHA 3BOSA 4JJKA 4FCTA 2O0JA 4HLUA 2G1KA 3CBQA 1RW4A 1YHNA 3SNHA 2XNSA 1YZTA 1ZJ6A 2F3TA 2X2FA 3KQNA 3KKMA 1A82A 3TE6A 1DG1G 3WMFA 4MRNA 2Q0HA 2IS6A 1C1YA 4GFDA 1KY2A 5E7IA 4N0EA 3RYTC 2IYTA 5FFMA 3LBNA 1P72A 1W2HA 5J4LA 1SQ5A 3LW7A 4GZMA 2ERYA 2I4IA 4HDOB 3ZH9B 1XU4A 2HEIA 2GA8A 3BFXA 1JALA 2QP4A 1KNQA 2Z4SA 2JLQA 3FFAA 1NLZA 4KHZA 5F2EA 3SJZA 4QKQA 4RZXA 3LVRE 1FX0B 3M1IA 5CYOA 3DMNA 4B6EA 5F9FA 3AF3A 2CL0X 3LBHA 2D3WA 1T5IA 3NEJA 1R7RA 5EP4A 1JQJC 3IPXA 2RB4A 5DHFA 2W0MA 5SZHB 4V0MA 2A5YB 2ERXA 3GLIE 3U3MA 3AVXA 3IEUA 3PXGA 1E79A 1EFHA 4Q4HA 1E32A 4B43A 2VL7A 1KK2A 3CLVA 2C99A 1S1CA 1W4AA 1VKJA 5K8IA 3CRQA 3QUSA 2ZE5A 4Q1FA 4C2TA 3AH8A 3KFVA 3Q5DA 4ZDIA 1SKQA 2OBMA 4RD3A 1J2JA 2BVNA 1NNEA 1E9BA 3RNLA 4RY2A 2ORWA 4DLYA 1W1WA 3AVOA 1IJFA 1FQKA 4WA7A 4D25A 1WP9A 1K5GA 2ZRCA 1E9DA 4M9SA 4LJAA 3TBKA 1O87A 4DDTA 2QSYA 3BK7A 2D62A 2Q3HA 4UNRA 1I4DD 4ESHA 3F3YA 3TH5A 5JEDA 2OXCA 2RKOA 4AIIA 2D2FA 1ZU5A 2RGCA 3R9IA 4AKHA 3QVVA 5LPNA 1V5WA 1VCMA 3QBVA 221PA 4TYWA 4D2IA 3EZ2A 2QSZA 4A2QA 1Q3HA 2NIPA 3QPVA 1H8ED 1KMHB 4Q02A 3T06B 4JL6A 2VIIA 3PCRB 3MFYA 4M0LA 3THXA 1Z0DA 1LFDB 5FL3A 2EFCB 1GSIA 1BOFA 2OE2A 1F2UB 4ZDKA 1LS6A 1CJTC 4FCVA 4Q4AB 3QF4A 5JS7A 1R5NA 5IDVA 4RD2A 1NN1A 3CONA 4HLUC 3TQCA 1Q3TA 2OO7A 1KZGB 2GWHA 4RD0A 2WOJA 2ZJBA 3TSZA 3CW2A 1GAJA 2AKAB 1W47A 1Z47A 2QE7D 2ZIAA 1KSHA 3LQRA 4C3ZA 4D0GA 4B2IA 3LAWA 1XBTA 4O3MA 2QZ4A 3TJZA 2KI5A 3K0FB 4LBWA 1RVDA 1X3SA 1Z0KA 4A4DA 2IXGA 3J81k 1VDZA 5JI2E 3Q72A 4UNSA 4OI0A 1T3HA 3RC8A 3KJGA 4CEHA 3Q8XB 5L3SB 3C16C 4HAZA 4LDJA 4MGIR 4C0LA 4HUTA 3ZVMA 5M04A 2YWHA 2ZI3A 4M4SA 1CKEA 4KJZA 3QKSA 2J9RA 5FTNA 5B64A 1S2MA 4IOJA 3DMDA 1AZTA 2B21A 1KK1A 2CLSA 4NONA 4IDOA 3MUFA 3GFTA 2GDJA 4URVR 5IK2D 1XRJA 2J59A 4PZYA 2GCOA 4OQXA 1XJ0A 4PTLA 4A0GA 4AKGA 2GF9A 3VHLB 1XTRA 2YC2C 3GEHA 1FNMA 2FFHA 4QBGB 2GJAA 5DE3A 3TAHA 5KTYA 2BKEA 3PITA 2ZS8A 5LD2B 4Q00A 3OFNA 5LB4A 2GNOA 3EIHA 1W4RA 5G3YA 2AD5A 2GRJA 1KKLA 1EG7A 1GL6A 4MYTA 1R0YA 3TIFA 1E2IA 1AK2A 3BJIC 2IX3A 4GPTA 1LB1B 4DSOA 1NN5A 1U99A 1IN8A 2QMUA 4Q5IA 4UJ5A 1Z3IX 2WWHA 4AKIA 4LJ6A 2RGGA 4MA4A 2I1VB 1CJVC 3H4MA 1ZUNB 4NL4H 4XOIA 2OM2A 4C0AC 2PLRA 3MLEA 1LV7A 1DBSA 3U7EB 3I72A 3QKRB 2J0QA 1LS1A 4I99A 1H8EA 1TF7A 2ZJAA 1XD2A 2P6UA 1R5BA 4CRWB 1GVNB 2X8AA 1NVXQ 1B0UA 1XEFA 5JJLA 2YNMA 3K70B 4UXIA 2GETA 4ABYA 1Y63A 5JJKA 5IT5A 1S4QA 2VF8A 4PC2A 3NBXX 2GXUA 3AUXA 1FPMA 3A1WA 2J0VA 5ANRB 5TVKA 2CEAA 3B9PA 1E2GA 4DIDA 1KO8A 5KNCA 3TGPA 1EWRA 4LHVA 3CX8A 4FWIB 2QE7A 4NDZA 4HDCA 4MKIA 5JMTA 1E9EA 2JLSA 1BH2A 2YWGA 3UK6A 4FWTA 4ZCLA 1IOZA 1NJFA 5FTKA 2REXB 3AM1A 4M22A 1H65A 4ZI3A 3A1VA 2WJYA 3HYRA 4RZUA 2NMVA 4OL0A 3LRPA 1U98A 5AUQA 2WIAA 4MGYR 4DDUA 4XVQA 1X8LA 2ZRAA 2J41A 4B71A 3WNBA 3B60A 4JIMA 2UVQA 2A30A 2V7QD 2H92A 1D2EA 3CM0A 4DVGA 3H0KA 1G8PA 2KBEA 4LRWA 1E0AA 1YZLA 5JSZA 1HEIA 3NEYA 1TF5A 1ZD9A 4MYUA 1Z2CA 3VX4A 3GLHA 2CHGA 1YZNA 4Q9KA 2J3EA 1GP2A 2WWFA 4HUQA 4LYJA 1OFIA 4OBEA 1DAKA 2ZVPX 1N0VC 2BCGY 3ZS8A 2VEDA 1II0A 4MRSA 3EXAA 1LY1A 3FE2A 5IK2A 4DRZA 4R71A 1G64A 3Q9LA 2IYXA 1IBRA 4TTPA 3R20A 1LW7A 4I81A 2JIZD 3RS7A 4L9SA 4TN1A 4TL7A 3SEAA 2ZTSA 1CJKC 1XPUA 5DIFA 2PZFA 3SFZA 4C0HA 5A4JA 3PEUA 4OHZA 1DAHA 2BWJA 5FR1A 2AK3A 1XXHE 4QJ3A 1R6BX 3BB3A 1AM4D 4LBZA 5C2JB 2A5DA 3SJCA 2ZJOA 4OKSA 2O52A 3A1SA 2YV5A 4OI4A 3U7HB 3IEVA 2VQSA 4WW0A 1GITA 4DT1A 1Z0IA 2F1JA 2C9YA 5DN6D 1GFIA 3OF5A 4E22A 1CP2A 4A0FA 2XB4A 4D81A 2NO6A 5K8LA 2J87A 1NY5A 3HWSA 4WIAA 4WXRA 2O8BB 5AUNB 1NVUQ 3AVQA 2YOGA 2CLDX 5P21A 3GLIA 4JT4A 4CT5A 1UDXA 3LY5A 2G0TA 1Z0FA 2DFKB 3TQFA 2N42A 4Q19A 2FFQA 4WOPA 1R0ZA 2QP3A 2W2XA 1DVRA 1RYFA 2D7DA 4HLQB 1PLKA 1FOEB 1XP8A 2BJWA 3D7MA 4PPQA 5EUMA 2WJVA 5FOWA 2ODWA 3P1JA 4ASUD 1CXZA 1Q12A 5IF9A 1FQJA 3UATA 1WA5A 1SXJD 4KCGA 1E96A 2ZRLA 1SVLA 3BE4A 4O2RA 2ZS7A 2XITA 2ECKA 3REFA 1TQ2A 2W0SA 2W6ID 2VP4A 3GLFE 4W9MC 2PJRA 1WE2A 4D82A 3OIYA 3UXMA 1T0JB 2C98A 1OB5A 1AS3A 1SHZA 2QRZA 3AEZA 4M9XA 1L2TA 1CJMA 3S1AA 2ZJ5A 1C9KA 4DBLC 4Y0VA 1QHHB 2PT5A 4OYHA 2G77B 2XNDD 1KI6B 3PUYA 4RFVA 1F2TB 1XFAA 4BZXA 2FX3A 2YWEA 2H5EA 4AG6A 2DB3A 2V54A 4KSBA 4BLOA 3GPLA 2VSFA 1SVOA 1E4VA 4HAYA 1T91A 2XSZD 2JEOA 3UMSA 3QKUA 2YYZA 2GVZC 1P3JA 4OQLA 4B74A 1ZINA 2REBA 3EZFA 2XXAA 3IILA 1Q20A 4M9QA 2ZUDA 4Q1EA 1P9NA 4OHWA 3OIVA 1L7VC 5L3RA 3ZQ6A 4NYJQ 2ZJZA 3ZS9A 2CJWA 5TMPA 2G0NA 3VKHA 2VA8A 4ILEA 2V1XA 4QJ4A 4Z8YA 4JLDA 1X8JA 1YR9A 5LBIA 3TR5A 4CDGA 5FTMA 1UBGA 4PXAA 1HA3A 5CDFE 1SVIA 3V4FA 3C7KA 1VYTA 1L4UA 3KTAA 1Z83A 1ZNWA 2QBYA 1E2FA 1GRQA 2JIZA 4TMZA 4F93B 2EVWX 1AZSC 1NKTA 1GDDA 2YC4C 2FFBA 3LXXA 1MKYA 2BEJA 2E1RA 2L0XA 4QXAA 2HT1A 3CNLA 2N46A 1CIPA 3OE7D 1RJ9A 2PEZA 1I2MA 2Q21A 2FF7A 3DDCA 4GI7A 1UM8A 1OH6A 4P3YA 2BM1A 4FCWA 1GRNA 1S96A 2CDNA 2EYUA 2QGZA 1SVKA 2CVHA 1XTIA 4TL9A 4LBVA 4XWOA 1Z08A 5E4FA 2KB0A 3D3QA 1EFUA 3U7FB 2FG5A 3BXZA 3K9GA 4RD6A 2IHYA 3Q5EA 4DLRA 4EQ6A 2HUPA 4Z51A 4KAXA 5CDFA 3WNDA 1XEXB 3QEJA 3ICEA 3AVVA 1IY2A 1J8MF 2GILA 5FI0B 1OKKD 2KWIA 2UZIR 4P31A 5F9HA 3WYAA 1DAEA 4ASUA 3EPKA 2JATA 3QQ5A 4KVAA 4JLKA 5FOXA 3RRNA 2ZAMA 4GOXA 5HTKA 5TARA 1KI8A 1TADA 2FN4A 1NLFA 2P0EA 2OCAA 3DZDA 2VH5R 3QPUA 3B8HA 3EC2A 2P65A 5CLLA 4BWYA 4V03A 2OFXA 2HCJB 4QNRA 3CIOA 2NPIA 2QY9A 3WRYC 3K0AB 3SQWA 3RAPR 5G41A 2GCPA 3RRYA 3H84A 3ZZUA 3T5DA 4EJSA 2P5TB 1NL3A 3QPWA 4S35A 4YMVA 1S3SA 4V0NA 1DPFA 4FMCB 3D31A 1JR3E 3GLGE 5DSZA 2V6IA 2XNDA 3W9YA 2C9OA 4O0MA 1CU1A 1IJEA 4JLMA 4QNMA 1RRGA 1US8B 1DTSA 3QBTA 3X1XA 2FV8A 1JB1A 3VR3A 1OW3B 3DPUA 2J7PD 1CR0A 4EAQA 3EPLA 3VNUA 1P9RA 2R6FA 3A37A 4NTZA 4FXPA 1NJGA 3IQWA 1E2MA 1NN0A 3BRWD 1G21E 4QC2A 3W8NA 5A5GA 3IHWA 4GRAA 4TSFD 3R7WA 2EFDB 2CHVA 2EFHB 3FFBA 4EPXA 1W36B 4A36A 4NH0A 1U2RA 4A8JA 4B34A 1IXSB 5HCIA 3JZMA 421PA 3HPQA 4UJ3A 3GQBA 3I3SR 2FSGA 3BB1A 5FUVA 4DLXA 5BN4A 2ZRNA 2B7CA 1F48A 4DDWA 2PEYA 1JR3A 5AK0A 3L0PA 4MKHA 4URUR 2DWOA 2O8CA 1U90A 2OCBA 2BM0A 5AR1A 5KNDA 1ZCAA 2ORIA 2FSHA 2VP2A 4IFBA 5EZ6B 4IDPA 1UKZA 1VHLA 4CZ2A 3ZYCA 4HYYA 3NG1A 3B1WA 2GF0A 3QNUA 1Z06A 1FMJA 1NBMD 2O0HA 3QKTA 3SU8A 4DEXA 1OJLA 1IAQA 4W5HA 4HDQB 2C95A 3EAQA 4FINA 3EW9A 2BBOA 2H17A 2IW3A 4XTRA 4ARZB 1XPRA 3L43A 2ZRMA 4HAVA 1X8KA 2DR3A 1E1RA 3ZQJA 4D0LB 3CPEA 4F38A 1NVVR 2NQ2C 1SXJC 4WVFA 1F5NA 2G88A 521PA 3L82B 5EP3A 1EXMA 3VFDA 5BN5A 1OKKA 2XJ9A 1W0KD 3BFVA 4RSGA 1P9WA 4ZIRA 1N6IA 3OEEA 4N1AA 3WXMA 4DCVA 1KO4A 3F0TA 5KSYA 3DM9B 4M1YA 5A0FA 4GMDA 4GDFA 3RS4A 3A4NA 4EJSC 1DAFA 4LPKA 3IIJA 3B85A 2Q9AA 4G5QA 4DLWA 4CEJB 5GJVC 3X1DA 3IPYA 2IEZA 1VPLA 3A58B 1KAOA 3GFOA 2DYKA 2H57A 1N6NA 3PV0A 1ZC3A 2Q9BA 3K53A 2VSXA 1E79D 3A36A 4LJ4A 4NMMA 2R62A 4F4JA 3UWOA 4G01B 1BMFA 2IT1A 2P67A 4NYMR 3T5GA 4NCNA 4RJLA 2AWNA 3SR0A 1O3YA 3N70A 3ASYA 4LYHA 2ONJA 3IDQA 2BDTA 1D8TA 4HAXA 1TEVA 2WJHA 2GEUA 3KUCA 1G41A 2Z5FA 2X1VA 2RMKA 2G83A 2ZYVX 3O8DA 4Z1MD 4YMWA 2J7PA 2JLZA 2MSEB 3EWSA 4A8JC 2AR7A 2EU8A 3FWYA 2MMCA 3SHWA 3U3OA 1FUKA 4Q4JA 1RC8A 3E70C 2JJ8A 2JLVA 3PUWA 4BASA 3KB1A 4MITA 2HYDA 2JLRA 3SZRA 2C78A 4HZUA 1ZVQA 2H16A 3E2IA 6Q21A 4C7OB 1WDTA 1J70A 4X8MA 4JL5A 1MOZA 2DCUA 3W5IA 3NBFA 1G3QA 1VYUA 3L2OB 2NO9A 2ZEJA 2C9CA 4I4LA 2WJIA 4FMDF 4KFRA 5KSPA 3X2SA 4BFXA 2CE7A 5G40A 5JHGB 2QQ0A 5KSOA 2XGJA 2IF2A 5KHOC 4AYXA 5JWHA 2PL3A 4PANA 1OIVA 2CBZA 4OJQA 2XZLA 5SZIA 3HYTA 3UKDA 2OAP1 4C9BA 2IYVA 4P33A 2Q3FA 1KSFX 1NBMA 2J0UA 2WSSD 4GOJA 3TW4A 1E0JA 1N0WA 2XEXA 3TNFA 4TMTA 3NBYC 2QT0A 3F8TA 4FI3C 4RZ3A 2OBLA 1QHXA 1Z07A 1Z8FA 3T35A 4BEBA 1CS4C 3GCGA 1G1MA 3BBPA 1KDOA 5BYKA 4ACAA 4OQFA 3HU1A 1P2SA 1KGDA 1OXUA 2VHCA 4IOLA 5FUXA 3BAFA 1P73A 2XOKA 1MRNA 1OYYA 1PLJA 2FPLA 4PZZA 4HLCA 1W0KA 3RS3A 1QHSA 4JJZA 3LNCA 2E9SA 3TSOA 3SJBA 1E2KA 4Q7LA 2HV8A 3FMPB 1R5OA 1OB2A 3X1YA 4AYTA 1TEXA 1WQ1R 1DADA 3HU2A 1H8HD 2C8VA 1FX0A 2IYUA 5BW8A 4M9ZA 2HXSA 4MGZR 2OUKA 2IHBA 1P60A 2CLCX 2IYRA 4WAUA 3LH5A 3NDPA 4XWKA 2J0SA 1E2QA 2GZAA 1KKMA 4J0QA 5UKDA 4A1FA 3R9WA 5KPJA 4OQNA 3RABA 1N6LA 2QQEA 4KLZA 1ZBDA 5EE1A 3OFND 3CF0A 4PSVA 3RVBA 2PX3A 1IM2A 3FB4A 4KXFB 3SE0A 4G5SA 4RCYA 4Q4HB 5CITA 1TPZA 2OHFA 4Z1MA 3VR1A 3WRXC 1JXOA 2GESA 1Q57A 1QZXA 2PBRA 2HCBA 3O8BA 4QBFA 4AK9A 4RCZA 2ZRDA 4JKIA 3T1QA 4IFEA 4UKDA 2V3CC 4RVCA 3BS4A 3FKSD 1AQUA 3LBIA 1XJCA 2PCJA 3NDBB 3TRFA 1GRRA 2CE2X 3JZAA 1JNYA 4AI6A 2IUTA 1JAIA 3ADDA 1UDWA 3NTUA 4GL2A 3THWA 1TL7C 1G8YA 1OSNA 1OXSC 3CR7A 2A5FA 2PJZA 2VP5A 3IGFA 2C77A 2IUUA 2GJSA 2NZ8A 1PLLA 3QXXA 3NBZC 3Q7QA 2YKGA 4Q48A 2B6HA 1XWIA 2P6NA 2WJGA 4PC7A 4JLNA 5JHHB 1FNNA 5FPHA 1KMHA 2W6JA 4B3GA 2CK3D 4M1OA 4RD4A 4TTQA 3SBEA 1OV4A 3CRVA 4Q1DA 2YWFA 1F2UA 1T5LA 4IDNA 3ONWA 4Q4AA 1UJ2A 1BS1A 2GZHA 1E98A 1NKSA 2JLUA 3ZGXA 3AVPA 2WSSA 2HF9A 2FEMA 1YZQA 2UZ3A 3OAAA 3THXB 3RSLA 1SGWA 4POAA 3CPHA 2BBTA 4KO8A 4PHTA 1IXRC 3CZQA 1II9A 3GJ6A 4JVMA 3BWDD 4V02A 3X1WA 2C2HA 5L8VA 4KBGA 1MT0A 1F3OA 3K0FA 821PA 3TUZC 1GKUB 3A1TA 5JWOA 2MSCB 1VYVA 1VCNA 3B1VA 4YMTA 3BGWA 3AKDA 3ADKA 4JLPA 3WMEA 4C2UA 2ZS9A 1SZPA 3A4LA 4MUAA 4L4UA 2QPTA 2ZRFA 2O8EA 3B7GA 4CEIA 3KXKA 1ZC4A 5L3SA 3U60B 2ZRIA 4YMSA 1D6JA 1T3LA 4LUCA 4DLVA 3OIUA 1H8HA 2FNAA 4MDEA 2GAAA 2GXQA 1M8PA 2FH5B 2G6BA 2RHMA 1AJEA 4QJ5A 2H7VA 2RGDA 2F9LA 3FYHA 4CEHB 5AUOB 1OH5A 4Q7MB 3TVDA 2XTZA 2BMJA 3A4MA 1GILA 1ZNXA 3P27A 3V4RA 4R2IA 1FL9A 3CO5A 5EP2A 3TAUA 1FMLA 2FWRA 4TQAA 5EXSA 4TTRA 4B32A 2CCGA 1NG1A 3T15A 2AHOA 4JLBA 2ZRHA 1W7AA 2WKRA 1ANKA 1XF9A 2IS1A 4DSNA 1J7KA 3AGQA 4XD7A 3EA0A 3ZVNA 5L3QB 1T0HB 1YZKA 2AFHE 1U94A 4GZLA 3NH9A 2VP0A 1QVAA 1XZQA 1MO3A 3QG1A 2KJQA 4LJ9A 3T34A 5F3WB 1R0WA 3FKSA 3IKJA 1S9HA 4Y0AA 1JJ7A 2F43B 1GNPA 1HE8B 3QXHA 2V9PA 2F9MA 2X19A 3B1ZA 3TSWA 2BMFA 1KI1A 1ONBA 2WAXA 8OHMA 4JYCA 4TYQA 3N2IA 4QL3A 4M1MA 4TMWA 3QENA 3T12A 2IS2A 2ZI6A 2CK3A 2X77A 4IEEA 3WNCA 3QIAA 4CGZA 2ATVA 2OCYC 5ELXA 1UKEA 2PZGA 1U0JA 3QXCA 3I61A 3I8SA 1KZ7B 3WBKA 4QOSA 3FHTA 1DG3A 5KU1A 4BEJA 1UAAA 4HATA 1FW6A 1M7BA 4L16A 1XD2B 1TUIA 1II8A 3K9NA 4Q03A 1GOTA 2A2ZA 4QGGA 4WZ6A 1E9CA 2CNWA 4Z8XA 3EWAA 5JRJA 2IS4A 4PPNA 4KODA 3AF1A 4DEYA 1SULA 4JMPA 4BLRA 1W46A 2DWQA 3B78A 1UBCA 4DHEA 3E5HA 1AS2A 3QSYA 3QG5A 4I1VA 4URWR 2AFIE 3RWMB 4AC9A 1N6PA 1G7RA 4MYHA 4N3NA 2B92A 3GJ8A 3WMGA 3PJRA 4IVPA 4PAQA 4G1UC 2QP9X 1EWQA 1N6KA 2QA5A 1VCIA 4YXWA 2RGXA 4K46A 5HE8A 2V1UA 3KQKA 4UNPA 3B82A 1EX6A 3CPJB 3TUJC 1QHYA 1NVWQ 2OBNA 2QORA 1N6OA 4LI0A 5CIQA 4R9UC 3H2YA 4RKEA 3EZ9A 4BFWA 4GT1A 1G20E 5C1BA 1KOFA 5JSZB 1KDPA 1LNZA 4JVSB 1SKYB 4CW7A 3BD9A 5BWMA 2PZEA 3GLHB 2VSOA 2FZ4A 5AUPB 2BOVA 5EXPA 1E0KA 1OFHA 3DVLA 4HUQB 4A2PA 4C4PA 1D9XA 2EQBA 2QAGA 1BKDR 5HR5A 5DI9A 4QGFA 5JFGA 1TNDA 1JEDA 3B5JA 3EASA 1PUJA 3BH7A 1E9SA 1VMAA 5AJZA 3RWOA 4BUJA 2R65A 1QVRA 4D6PA 2OSBA 1W4BA 1QHGA 1UFQA 5HCNA 4B6FA 1B23P 4YDHB 1E0SA 3DHWC 3MCAA 4NBSA 1XMSA 4U5XA 5CK5A 4JVLA 5CK4A 2YZ2A 3C5CA 1I2DA 2AL7A 2WBLC 4Z54A 3EZ6A 3CRMA 1BYUA 4BFZA 4BRWA 3CH5A 4TL6A 5IHPA 2GKSA 3VR6A 3LD9A 1NSFA 3WP0A 2O8BA 2OESA 2XTMA 3DOFA 2RHDA 4KV9A 1Q1EA 4BQSA 2Q6TA 4DT1B 4DIEA 1G5RA 1RPZA 2QGNA 1JECA 3TMKA 2ZRJA 1XEWX 3I5XA 3KKPA 5HZKA 3M6AA 2AD1A 4B3XA 1AIPA 1XXHA 3VKWA 3MRSA 4Q9IA 4R7ZA 2ZANA 1A5TA 1WRBA 2DFTA 4NYJR 2FPMA 3WYGA 3GLIB 4KU4A 4PPFA 1HQCA 1ETUA 5EE9A 1E2LA 2ZR7A 1P2VA 1R0XA 2FGJA 1XTKA 3UG6A 3MD0A 5CLQA 2QPAA 3ASZA 2NGRA 1T8UA 3W6OA 5EUQB 2Z0MA 5JZVA 4KYUA 3LA6A 3W5JA 3LX8A 4GP6A 4K8OA 1G5PA 2CCKA 4NCJA 5FOVA 1WBBA 1GNRA 2V55B 2QM7A 5DISB 2XX3A 3MWKA 1T3SA 4D80A 1KNXA 2WWYA 3U3RA 3I92A 1LF0A 2XTNA 4LSGA 3FHOA 4EUNA 3AP3A 4E03A 4ZKDA 2BMDA 1QHHA 2WM9B 3GFPA 3MGCA 1PJRA 2QRNA 1F2TA 2AKYA 4JLJA 3LLUA 4EIWA 2QM8A 2F1HA 1P2UA 2RGNA 3HU3A 4HAWA 3GEEA 5C4MA 4M1WA 5B57C 4BLTA 1OLOA 2ONKA 2R6DA 4N0DA 4P4SB 2P5SA 1TU4A 3HJNA 4Q1AA 1CR2A 2QAGC 4NYIQ 4TLAA 4QRHA 1UBFA 3CNOA 5D3MB 4E09A 1ODFA 4EPRA 2NO7A 4IOMA 1M7GA 1KMQA 4PPGA 3O47A 1IQPA 1JR3D 4TLEA 1A7JA 5FOSA 5J47A 1G7CA 4NCKA 2BBWA 4PHFA 2CJWB 2C96A 1Z22A 2R8RA 5GJCA 3WYFA 2F1RA 4PQFA 3VTKA 1XX6A 2ZPTX 4ACBA 1QHNA 1RYHA 3RRZA 4LK2A 1IXZA 2H18A 3LXRA 3TUIC 2VP9A 1WF3A 2RGEA 2QBYB 2ZR0A 3KB2A 1Z63A 1U8YA 4YLGA 2P3SA 3MSXA 3WHKA 3DO6A 4EDHA 5AJWA 3C5HA 2R6CA 3ECCA 4DXAA 2VP6A 1KY3A 2ZAOA 3LDAA 1M1YE 1TQDA 4BFTA 1E1RD 1YZUA 2D06A 1SVSA 2DY1A 5FPTA 4P4TA 4BFUA 5CB8A 4BGDA 3FVQA 5JCZA 5K8UA 1OH8A 1W44A 3M4YA 4XWAA 1U0LA 4KITB 3QF7A 3LFUA 2ZRGA 2RCNA 4IDQA 1NMZA 5DH9A 3JVVA 3OEED 1UKVY 1XEXA 4GSYA 1ZIPA 5KDDA 5FBWB 3VU9A 5IRCD 4OHYA 1J8YF 2QL6A 3IHLA 3A1UA 1IY0A 1AGPA 3KKQA 2V4ZA 3BFKA 5DI3B 4IHQA 4G5RA 5LB2A 2OCPA 2BIFA 1XEWY 2Q3MA 4EQ6B 4M21A 4AYWA 4PZLA 2PH1A 3NHBA 4AG5A 4P0TA 3T1TA 2XB2A 4ERNA 1OFTA 1R2QA 2QENA 4G5OA 4NU0A 3KQUA 2GXSA 1XB2A 5E7MA 2IYWA 1BMFD 2G1JA 5JJIA 2BHRA 4JZKA 3UMFA 1KHTA 3K0AA 1E94E 3K09A 2ZE6A 4TMXA 1Z29A 1SXJB 3EZ7A 4BFVA 1C4OA 1X1RA 4DSTA 3BERA 1UADA 4QM7A 1N5KA 1P61B 4A92A 3AUYA 4H1UA 1KO5A 3L0IB 4HB0A 3C15C 2MMGA 1NG9A 1VIAA 4HB2A 1DE0A 1V43A 1J99A 3QJYA 3KL4A 4LJ5A 2O8DA 3HR8A 2ZU0C 3Q3JB 3DL0A 5J4YA 3RANA 1MH1A 2KSQA 4AKEA 4KLNA 2XAUA 5KPDA 2HYIC 1RFLA 4QHYA 4RFSA 2AN9A 1S9DA 1UF9A 3KJIA 1OYWA 5CB6A 1E3MA 4ZCMA 1UPTA 2ZR9A 4NP6A 2JJ1D 3CRW1 3IBGA 1E69A 1N0UA 3VR2A 5JLJA 1G8HA 2C04A 1U9IA 3NWJA 2VHTA 4JYBA 5CJPA 2NTYC 4OK3A 1D5CA 1LF5A 2CL7X 3PEVA 4XSHA 2DHRA 2A3RA 4R2HA 3LWNA 4PO9A 3GLGA 3R7WB 4MH0R 3AVTA 2BKUA 2WVJA 4KSCA 4LGMA 4PSAA 1GNQA 4OI1A 3FHCB 3AB3A 4A8JB 3GJXC 3DM5A 3PEYA 4YMUA 3RDPA 5FTJA 2ZJYA 2QMHA 5CJ2A 4AWXA 1PVOA 3EPJA 2CXXA 3X1ZA 2ZITA 1YJ5A 4PAOA 2R6AA 2NO0A 2O8CB 2KE5A 5SZKB 5FBVB 3TW8B 3HPRA 3AKCA 1TTTA 5FBRB 1LVGA 3AVUA 4US1R 1Z5ZA 2DPXA 4KFUA 1QRAA 2JASA 2E87A 3SOPA 3IO5A 2ZU6A 3L8ZA 4HI0E 2K5UA 3THYA 4Q1BA 2BV3A 2XOKD 2RAPA 4LOAA 3PG5A 2ZJ8A 4I1UA 2J7KA 4KBFA 3I8XA 4QHTA 3RC3A 3GJ0A 2VPPA 2WJJA 1MABA 4XIGS 2HLDA 2WOOA 3NH6A 3SBDA 1KYIA 2ODBA 4LWZA 1DAMA 1N5LA 1VECA 3RSOA 1R8QA 4DLTA 4LHWA 3KKNA 2JGNA 3R8CA 2O8FB 3ZLJA 1N3BA 4CEJA 1PZNA 2WPDA 4UQOA 4ZIRB 3BH0A 3P4XA 1G16A 3BIFA 4QGHA 1Z6XA 3K1JA 5HE9A 1MRSA 3B9QA 2D4HA 3PIRA 5FL7A 2FGKA 2WWIA 3W34A 1KI9A 2GHIA 3DZ8A 4C30A 3WBJA 3ADCA 1E1QD 2GEVA 4AD8A 1M2OB 3G0HA 5DLQC 4F7WA 2IWHA 3SQXA 3K0CA 4DZZA 3H1TA 3UG7A 4IXNA 1NSTA 4O25A 4DB4A 4ZDWA 2OFWA 3B6EA 4Q9JA 3AF2A 3ZIAD 2OFOA 5EE5B 1HTWA 2VTKA 3BORA 3C4JA 3QEOA 4DCSA 1OT3A 4YC7A 3U4QA 3Q7PA 4MRRA 4PQYA 1U8ZA 5CYPA 2HJVA 3AF0A 4TLBA 2F55A 5J4VA 2AXPA 1X86B 2JJ1A 2EFGA 4FW9A 4B44A 1HYQA 4IW3B 1OF1A 1ZUHA 4ZKEA 1NIJA 4NE2A 2QI9C 1E9FA 3Q85A 3VMFA 4LHXA 2JJ2D 4JL8A 2IWRA 3UPUA 4U7DA 1N5IA 1ZP6A 5HPYB 4RD1A 1IN7A 1Z6GA 3CKLA 2TMKA 2W6JD 1G6OA 1E2NA 5K8TA 1CULC 1I4LD 2ZROA 5G3ZA 1F6BA 1WCV1 1CJUC 3B2EA 4JKYA 4X8OA 2X2EA 5GJBA 2QMOA 2CL6X 2LWIA 3ZJYA 2AWOA 2JLYA 3A8TA 3NC1C 3LV8A 3HDTA 3OAAD 1U0HC 2VHJA 2OT3B 2BJVA 4NPHA 4BFSA 1OXVA 1NI3A 1NY6A 2ZI4A 4GOKA 4LX0A 2LCFA 4G0NA 3L0OA 3U44B 1N5JA 5C18A 4KFTA 5FOUA 3GMTA 2BBSA 4A9AA 4F4CA 2IYSA 4CYMA 5BYJA 4BLSA 4JSYA 1G4AE 4LV5B 1P75A 4U00A 3SYLA 4LCBA 1OHHA 5B58C 1OIWA 4LHYA 2FDCA 1UEIA 1Z28A 2B8WA 1Y3AA 3SI7A 1NMXA 1Z6TA 2ZSAA 4Q4LA 1E2EA 4IJMA 5J4KA 3KQHA 3GJ3A 3B1YA 4LPSA 4MRPA 5JCPA 3VR5A 3MWYW 3EX7C 1D2MA 4B75A 1QHIA 1NLYA 1G8GA 2PMDA 2ODNA 4G5GA 4LJ8A 2IXEA 5AJYA 4P4UA 4WZAE 1WB9A 5J5CA 3RHFA 2FSFA 1ZCBA 4C0JA 1VHTA 1M34E 5FPKA 1ZAKA 4QG7A 3O8CA 1HUQA 2F3RA 3WP1B 1ZYUA 1E9RA 5FTLA 3K0CC 2NG1A 2YOHA 1YRAA 1KI4A 4X8HA 3CNNA 4US0R 4FIDA 4NKRA 3CX6A 1E1QA 3PUVA 3HP1A 5H1YA 4US2R 1ELOA 2FJUA 2JAQA 1S3GA 4XD7D 4ZO4A 1KAGA 4Q7KA 4UNNA 3GJ7A 1F60A 2ZSFA 4MRVA 1T8TA 1HE1C 3R9XA 1ZM3A 3ZIAA 4FD2A 4L15A 3NKVA 2BCJQ 4TT3D 1JQLB 4GNKA 3D8BA 4R98A 4D0NA 1K6MA 2OEPA 1AKYA 4MKGA 4PX9A 1P7CA 1Z2AA 2IYQA 4TMKA 1A2KC 3QE0A 4W7SA 2NOAA 4H1VA 3SJAA 1RE0A 5FUYA 3O8RA 2QTVB 2GBLA 2GTPA 1OXTA 4URZR 2JJ2A 2BC9A 2YJTD 2WKPA 4V0LA 1S8FA 1ZM9A 4GP7A 4U02A 1GZSA 3AP2A 3RRMA 4EPWA 3THOA 1P6XA 2FMXA 1RRPA 3NXSA 1XTSA 2CHQA 3THWB 4A6XA 3K70D 2IA5A 2B8TA 4EFNA 3GP8A 3FOZA 5D3QA 1QF9A 1COWA 1ZU4A 5SZJA 4BFYA 4DCUA 3H86A 1E4YA 4XVUA 4M1TA 4B47A 3SHFA 4MKFA 4TYPA 4IVRA 1Q1QA 4LYAA 3IBYA 1JBKA 3U3JA 2ZUBA 3QF4B 5TB5A 2V6JA 4E07A 2CNWD 4ZV4A 1BIFA 2A7QA 1XTQA 5E7JA 5JI3E 1RIFA 2DFNA 1G7SA 5JECA 1G5TA 1HQYE 4URXR 1YRBA 1XCPA 2WWXA 2IUSA 3PQCA 1VG8A 4OQMA 4WZBE 1GWNA 3FPAA 2HJGA 5TY0A 4Q47A 3OHMA 5TXGA 2GAOA 2I3BA 2ZYTX 4JVNA 3RS0A 3AP1A 4CT4B 3FMOB 1ZD1A 2WSMA 3T1VA 3ZZ0A 1X6VA 4YXWD 2WV9A 5B30A 3UMRA 1DS6A 4YDSA 2YOFA 5JBQA 3U6KA 5GADl 1FP6A 1D9ZA 2W2VA 1VG9B 2O8EB 1Q1BA 4LJYA 3REGA 5AJVB 2JA1A 3HR7A 2GXAA 4CEIB 1MO6A 1P4SA 2VYFA 2WTUA 4XJXA 4HB4A 3EA5A 4C0QC 3NVAA 2ODEA 4DB2A 2VF7A 1EX7A 1JPJA 3QKSB 3FTQA 3RLFA 3GJ5A 3AKEA 1KO7A 3MAAC 3CF2A 1Q1ZA 1Q22A 1SVWA 2GK7A 3EARA 3I62A 4K81B 2PCLA 4G3XA 1XD8A 2OG2A 3BB4A 5C4GB 2GCOB 5EJEA 2J46A 4LY6A 3FKQA 3CX7A 1G9XA 4JT2A 2R9VA 5AWFC 5C46F 4P32A 1QBKC 4TT3A 5L3QA 1EESA 2QT1A 2GBLC 3AF4A 4S2EA 3KJEA 5CIWA 2QU8A 2FEOA 4DJTA 5KO2A 1BYIA 2FA9A 2NPFA 3W3ZB 1EFCA 4FMDB 2NO1A 4QM6A 1N6RA 4LBYA 2ATXA 5HKKD 1E6CA 4DCNA 2F43A 3W6PA 3DOEA 4B2PA 3ADBA 1XPOA 2D7CA 4BRUA 3CUEF 1RKBA 1E2HA 1U81A 1T6NA 3BH6A 1CLUA 5FBQB 2F7SA 1YZGA 1ESMA 2QUZA 3DEFA 4MGKR 3QKRA 3VNVA 3SN6A 2RH5A 1E2JA 1KSGA 5J4HA 1M7HA 4A2WA 2BEKA 1FP7A 3SS8A 2XJ4A 1G3MA 1LTQA 2F1IA 1ZIOA 2WKQA 5B2ZA 4EFLA 3C8UA 1TMKA 1Q44A 3K0EA 1ZNZA 5KNBA 3PUXA 4TWZA 2WMOB 5JS8A 5DO9A 4MYCA 5FOTA 2NZJA 1KJYA 2VHQA 4PFSA 4ZCIA 1M74A 1AKEA 3KFXA 1XCMA 4Q21A 3IO3A 1K5DA 2LKCA 1KDTA 2ZRBA 4KYIB 2ZE7A 1KJWA 1AQYA 2JDID 1SKYE 1GKYA 4XH9B 2JLWA 2WWWA 2CMKA 3RS5A 3GLHE 5H68A 3V9PA 1G17A 1II8B 4IVQA 3LQQA 4IOKA 4D4KA 5F98A 3P20A 3P4YA 2Z6VA 1VTKA 3FDIA 4BE7B 4QBIA 2A5JA 3PR1A 4LHZA 4PAMA 5J40A 3N2EA 4Q7JB 4B35A 4Q9HA 4I1SA 4M1KA 2ANCA 2QPOA 3TK1A 3AGPA 1VCOA 1E2PA 1HV8A 1EK0A 2AK2A 2ORVA 2ZETA 2EFEB 1G19A 4W5JA 3ZD6A 1KI7A 2OILA 1WMSA 2HT6A 2R2AA 2WHXA 3ZZTA 1JJVA 4FN5A 1G7TA 3QXJA 4UXJA 5FUWA 2A9KA 2EYQA 5LD2C 1YKSA 3TR0A 2ZYWX 4QHSA 3GJ4A 4L5BA 1YVDA 5EXXA 3U61B 4FMCF 1KK0A 4LC0A 3AV0B 2BMEA 2JLXA 3UANA 3GLFA 3LVQE 3I32A 4NCHA 1TQ4A 2YINC 4HSEA 2ZRPA 4EFMA 3L8YA 2GEDA 2UKDA 3AQ4A 2RGAA 1BO6A 1HT2E 3EPHA 2Z83A 2W83A 3A6PC 1MO4A 5BQ5A 1TUEA 5KDOA 3K0SA 1T9HA 4BPBA 3ZVRA 1A2BA 1CRQA 2IC5A 1K8RA 3MWLA 5KUTA 2AX4A 1EGAA 1FTNA 2VLIA 4PC3A 3ZVLA 4B3DA 1IN5A 4PR0A 2WZQA 4HZIA 3MMPA 3N5CA 2PX0A 2QAGB 3P26A 4PC1A 4B3FX 5HZHA 2F6RA 2ZUCA 1G6HA 4ZPXA 1T4GA 2PT7A 3T61A 1ZRHA 5HKKA 4B48A 4LZZA 2DFLA 1U8AA 2IBMA 4OHXA 1VG0B 4F92B 3K70C 1UBEA 4EPVA 3SYKA 1NN3A 2FFAA 2FU5C 2OAQ1 1YQTA 4QFMA 5DHAA 2HXYA 3MJHA 4LC1A 3KZ1E 1W0JD 3FMFA 1NF3A 4DLUA 3W6NA 4IKEA 1CBUA 2O0KA 2ZI5A 4X8LA 1Z0AA 4Q66C 2H1LA 2MSDB 4C0SA 3ND8A 1GG2A 4BECA 3D6TB 5JEEA 4ITRC 1ZNYA 4NYIR 2ZJ2A 3EIQA 3KKOA 3OEHD 3G82C 1ZW6A 4LJ7A 2D2EA 4LYFA 5GVRA 1G18A 2HDNB 3GEIA 2QAJA 721PA 5E95A 1KJZA 3W8RA 3TLXA 1XXHB 2Y8EA 3LO5A 3WHLA 3TKLA 3E1SA 4M8NE 1IY1A 2JDIA 4D4LA 1CR4A 3ND9A 2Q9CA 3SDZA 3CF6R 1MV5A 2G9NA 2W00A 4BZQA 1CRPA 3I1FA 1ESNA 3IUYA 4L9WA 5G53C 1R10A 1KI6A 3FGNA 4BLPA 4TLCA 1JPNA 4LV8B 3T1OA 4M53A 4EPYA 3W3AA 3KXIA 3QY0A 4D4JA 5BN3A 2PMKA 2FOLA 4PC6A 2QMEA 3CRRA 3AVWA 3S1AB 1X1SA 4Q01A 3IIMA 3QVUA 4DC9A 1EFRD 4QGAA 2YVUA 3SC3A 4DUGD 1N2CE 2B7BA 4A6PA 4TZ0A 2VHUA 4JLOA 5GVSA 1OXXK 3QXSA 4P4SA 1E9AA 1KI2A 2V7QA 3VQTA 1W36D 4E5UA 1VG1A 5D3MA 4RKFA 1KSJA 1G4UR 2FPKA 2ZI7A 3OZXA 5TDHA 1N6HA 2XXAB 1HT1E 3ZDQA 1ZM7A 2KBFA 1XNJA 1KIMA 5FPSA 3CWQA 3RS2A 3SYNA 2SHKA 1PUIA 1XZPA 1NRJB 3IQXA 4URYR 4Q1CA 3C14C 2C5LA 4MQBA 2LKDA 3VX3A 1CTQA 2A5GA 3GLFB 3PUZA 1JR6A 4W5WA 5AJXA 1ZD8A 2EWVA 3PENA 4M2LA 4B3CA 5JWRA 3SFVA 4TMVA 1SVMA 2IEYA 4TLDA 4HEJA 2JCSA 3KTAB 4UNQA 3I5YA 4OK6A 5BXQC 2ZREA 1NMYA 2WAYA 4PQRA 2N1BA 2A78A 1DEKA 1R4AA 3G5UA 1GIAA 4IEIA 1IN4A 4OK5A 2IYZA 1M6NA 2J5XA 1RJ9B 4PSKA 2ZVQX 1GM5A 1RRFA 2IXFA 2FSIA 1SXJE 2RGBA 4UXHA 3LW8A 5EXTA 4DSUA 1DO2A 1MO5A 3OIWA 1GTVA 2Z43A 2ZM5A 4JBXA 1R8SA 2OXRA 4YONB 1W0JA 4BLQA 1AA9A 3EG5A 1TU3A 2ANBA 2EWWA 1GL9B 2IYYA 2CCJA 4OHVA 5DN6A 2WWGA 5FPYA 4B3BA 3VAAA 5H8WA 1CF4A 2HLDD 4NZYA 1DELA 1PV4A 1FTSA 1NP6A 1P2TA 1KI3A 1W5TA 2WIBA 5DI3A 4JSTA 3OEHA 2QROA 3W90A 2WPDD 1RZ3A 1I4TD 1UEJA 1XJQA 2GCNA 4HAUA 5FI1B 1QG2A 3NIBA 3F5FA 3VU9B 1OFUX 1YR7A 4TZ6A 4WXPA 5EE3A 4I1OA 5CM8B 3U5ZB 1G3RA 1DO0A 1OIXA 4TL8A 1TF2A 4NHOA 2W58A 5FL7D 1CR1A 2OLJA 2RGNC 5EQTA 1SXJA 3C41J 3M0EA 3U6BA 4MUBA 3K9LA 5JRZA 2G3YA 5EZ5A 4B73A 3DKPA 5DYIA 2R6GA 1WBDA 2V8OA 1YR8A 4PO8A 4EJSB 4GMXA 2W6IA 4PHHA 1US8A 1XMJA 2GK6A 2GJ8A 3PFIA 4DCTA 4DDVA 1QDEA 4YQFA 5DNYB 3JVUA 4C0BA 1ZM4A 3UIEA 5KSZA 2XZOA 3GD7A 3NC0C 1EFRA 2QN6A 4DUGA 1Q0UA 5H70A 3U3KA 4NCIA 1A1VA 2IF0A 2EW1A 5KOYA 3R8FA 2W2TA 3AVYA 2O8DB 4O2LA 5FH9A 2XSZA 3VHXA 3KXLA 121PA 4A82A 1FUUA 2ZYUX 4ESVA 3ZD7A 3KX2A 5EE0A 2D74A 3EIEA 4RFSB 1IN6A 1XMVA 4DWJA 3ICQB 4CIDA 1IONA 1IHUA 4B2LA 3B1XA 1D2NA 4TYYA 2HF8A 2ZQ5A 1P62B 1TAGA 3K9HA 1HY3A 1L4YA 2IYLD 2P2LA 4D26A 2J45A 3GLGB 1XDBA 5TV2A 2C03A 4JLVA 2VO1A 2QEQA 2WICA 3K8YA 2AXNA 1TQ6A 1A4RA 1FZQA 2OZEA 1L8QA 4JBYA 5FBLB 2R44A 2OV2A 1VIYA 3VR4A 2REOA 4ARZA 3PVSA 1P5ZB 3EC1A 4A0HA 1XTJA 2ZRKA 1OHHD 2H8KA 2VBCA 1OH7A 2FZLA 2QG6A 3OE7A 4CVNA 1JI0A 3I73A 2P6RA 1WXQA 1QG4A 2I1QA 2CVFA 4GBMA 2ZXUA 4IDHA 1KDRA 3B13B 3BC1A 3CWZA 4QBHA 3L0SA 1EFTA 2QTHA 1GL7A 1KTVA 1OE0A 3VKGA 4M1SA 1JXMA 5KYKA 4HB3A 2WMNB 1NIPA 3K09C 3OESA 5DYGA 2ZE8A 1TX4B 3LX5A 3THYB 4Q18A 2PLFA 4WBSA 2IL1A 3V00A 4XVRA 1DAGA 4ZI2A 5E3HA 4CF7A 4F91B 4V0KA 2O8FA 4D4MA 3LLMA 4ON9A 4B76A 1AN0A 3MG9A 1ZUIA 1MABB 4B33A 3I4LA 5CM9C 2VRWA 4FMBB 1XD9A 2XZPA 1S1MA 2OLKA 3MJRA 3QI2A 5GJWC 4A15A 2GVDC 3U7GA 4EPTA 3KJHA 2O5VA 3KUDA 1GUAA 2GJKA 3MWJA 4DLSA 1G291 1DAIA 3QOFA 4TYNA 3KQLA 4JBWA 1Z6YA 3IIKA 1J90A 4BZPA 4DKXA 1ZMXA 3DKVA 4V0OA 4KI0A 4RZ2A 2ZSEA 4IXMA 5KDLA 1W36C 3CZPA 3P32A 1UKYA 1U9IC 4II7A 1G8FA 1E2DA 5L3VA 1W48A 3FMIA 3PEWA 2ZSDA 4JLAA 1GKIA 1DARA 1AGRA 1XMIA 1JEEA 4C0KA 3AKYA 1RRCA 4IRUB 1SHKA 1NVVQ 1E99A 2DWPA 4C7OA 1HURA 1DOAA 1Z0JA 1OPXA 3WY9A 4Q4JB 2GJ9A 3CH4B 1W2GA 4LV6A 4A0RA 3CR8A 2J1LA 2ZI9A 1NBME 1G3IA 3ETLA 4KVGA 4TQ9A 3NHAA 4Q9LA 4AURA 3U4QB 4L8GA 2Z4RA 4JS0A 3U2QA 3UWKA 4TQUS 1Z6AA 4HZUB 1HH4A 3KDSE 1AS0A 4TSFA 1KO1A 1MR3F 1W49A 4PO1A 2FE4A 5EP1A 1COWD 2ASEA 1W4CA 4PHGA 4MDFA 621PA 1JAHA 1Q21A 4ZDJA 4HLDA 5FR2A 1N25A 4OI2A 3CB4A 4OJKA 4NYMQ 4XSGA 4EKDA 4KFSA 1YR6A
chains in the Genus database with same CATH superfamily
2AIRA 1HKUA 4LE1A 1H2YA 4JFRA 2FPWA 2Z1MA 2DBYA 2K7FA 3L40A 1W5SA 4DCJA 1FYFA 1TKCA 1Y34E 3NLLA 1G3UA 1S0UA 1JHRA 1P77A 1XAIA 2EBFX 2G25A 2IIBA 4HRAA 4UULA 3RPEA 4DQDA 4EB0A 5HG0A 3WX0A 2XVAA 1T34A 1KJ8A 1O1YA 2XQIA 1FFHA 1WXEA 3BOSA 3MRTA 3ONEA 1Z6QA 2JA2A 2QUAA 4F2WA 1YHNA 2ZIVB 1PNTA 4IO1A 4OP2A 1JHQA 3WMFA 4MRNA 5K99A 1H5NA 4N9WA 5CT4A 1XCLA 1SOAA 2HPHA 2PUGA 4N0EA 4Z53A 1GQFA 2IYTA 3NDJA 2HMUA 5AM5A 3FUVA 3S2ZA 1A8QA 1GFWA 1W2HA 4X7RA 2VUSA 5J4LA 1G38A 4MJXA 2CV2A 2ONYA 3A9TA 1UMKA 5HIKA 1DPGA 2HEIA 4GPIB 3H3JA 4H4CA 3Q7RA 3LPLA 4Q1VA 5IFKA 2ZZMA 3EDQA 3JYHA 4E2WA 2IXDA 4IZHA 2X0FA 2PUCA 1D2CA 1FX0B 5BO5A 1V1RB 3L7AA 3ND5A 2YJ6A 2Y3IA 3L06A 5E2AA 4B6EA 1SUIA 5HEKA 5LLDA 1NFRA 2CL0X 2D3WA 5ADUS 3HKDB 2C2KA 5EP4A 3DXFA 3DE3X 4V0MA 1KRXA 3BL6A 3IEUA 4CF5A 4X60A 3MTIA 2ZRQA 2B20A 1U7DA 4ZC8A 1E32A 2VPZA 3PQ2A 2VT2A 1GPKA 3DZBA 3SICE 5K8IA 3CRQA 3S2SA 1C2YA 4Q1FA 4C2TA 2C5BA 4AJHA 3KFVA 4KQEA 3CNBA 1G8SA 3QWBA 1NBOA 5C5IA 5F5LA 2JIRA 2GGSA 1DL5A 3I0NA 2BVNA 1AO3A 1E9BA 1FVOA 2BEWB 1RTTA 3RNLA 1NYTA 1NNEA 1YR2A 4ZAYA 1IJFA 3A6KA 4G0YA 1WP9A 2DFPA 2ZRCA 3MPOA 4M0PA 4UREA 4LVUA 3PQ8A 4DL9A 3TBKA 4DDTA 4CXMA 1J0XO 3JVDA 5ICSA 1DMSA 3EOBI 4NV1A 5JSQA 1NXWA 1EQUA 2H7YA 3X43A 4N01A 4MUJA 3OZ7A 2QXTA 3TH5A 4B3HA 4YP6A 3FOFC 1JIXA 3ZDFA 1WV0A 2PMFA 4NE9A 1EHIA 2WHYA 4X7PA 4AIIA 4ZOAA 5KYTA 3B51X 2RGCA 3R9IA 3HYCA 3QEMA 4R1OA 1AQJA 1J0CA 3QVVA 2H4ZA 1VSUA 5DLEA 3F4LA 4MS3A 4MRMB 4EY4A 3AB7A 4G1FA 4TYWA 3EC7A 4D2IA 5K4GA 3I42A 3NNSA 1OT5A 4GMHA 1AUPA 1MA3A 3F7MA 3KZNA 4HZGA 1H8ED 2H8GA 3T06B 4A2QA 4DEVA 1J25A 4LZPA 3ZE0B 2VIIA 3PCRB 4IINA 1SA0B 3THXA 2EFCB 1BOFA 4R8SA 3DFMA 5KHLB 4PG4A 1C2TA 3QF4A 2FK8A 3HABA 1M2GA 3CONA 3K2QA 4HLUC 1BU5A 1KZGB 1UMDB 3HFJA 4RD0A 2ZJBA 4D6YA 4DJJA 4OUDB 4Z4QA 1M5RA 1GAJA 3KLMX 5C32A 3KAPA 1H69A 1G2IA 2R60A 4OHKA 2QRVA 2GFQA 2YMPA 1UINA 1J0BA 3FTFA 2QE7D 2WZDA 4YO7A 5IJXA 3LQRA 4YJ2B 4D0GA 3UV7A 1XBTA 1MXFA 4ZYTA 2B35A 3OWOA 3TJZA 3K0FB 2QM0A 2XKBA 1ZNQO 2VRCD 1X3SA 5K0EA 2ZVJA 3NM6B 1DWPA 2Q1WA 1SEPA 4A4DA 3VYWA 3HRIA 1D04A 3LNTA 4ODIA 4UVDA 3WC4A 4UM9B 4EBFA 4RHFA 3G5LA 3J81k 2R7AA 2WIKA 5G02A 5JI2E 3HYNA 1VIDA 5IBPA 2K2QB 2TRSB 1SD2A 4MR9B 4QTYA 1OROA 1T3HA 2O5EA 3EOZA 1G5IA 3UWSA 4CEHA 5BWOA 1R6VA 1JF8A 2D5LA 3GH1A 5AD1A 5L3SB 2FPRA 3DR5A 5H02A 1I3CA 1ZDMA 3DF9A 4P6VF 3U9LA 4LDJA 1ZGCA 4RVUA 5B1SA 3TCXB 4DPLA 3O94A 4M4SA 1CKEA 1YL7A 2W6OA 2ZFUA 3ELBA 3GCWA 3IVAA 1V7CA 3DMDA 2A9JA 3OP4A 3QI7A 4TMYA 4MQFA 1KK1A 2CLSA 2ROQA 2GDZA 2DU8A 4M0UA 4E21A 1IZ8A 3QMPA 3KUXA 1ADYA 4OQXA 4PTLA 5C8VA 4AKGA 1TZJA 2GF9A 4DCMA 2W4IA 2AI3A 3GEHA 5JCJA 5DM60 5AM0A 3HBFA 4QBGB 3D6MA 3FYUA 4J1SA 4AJ2A 3OT1B 3NBKA 4FFBA 3ICOA 4I3GA 4WY5A 3SZUA 3A6FA 4Q00A 1XRSB 4MRAA 2CZQA 5LB4A 3EIHA 1W4RA 1GFZA 2AD5A 3TG8A 3GDWA 4CF6A 1KKLA 4KWIA 1R0YA 2HREA 1OGJA 1U5AA 4W9NC 3S3TA 1A7UA 3LZ6A 2JD0A 1EP2B 1AV6A 4E6PA 4FKZA 3IOCA 1NN5A 1ZN8A 2O8VA 5HUHA 5FX2A 3PGVA 4IAOA 4RIGA 3Q11A 2DHDA 4ZAVA 3QE4A 2PUEA 3RRJA 1HM5A 1P33A 5KJ6A 1N2JA 5CNKA 1J21A 4NJEB 3J7AC 4AKIA 3A3OA 4MA4A 2I1VB 3UNXA 1PJ3A 1F6WA 3FYSA 3JYLA 5CBPA 3H4MA 5B58T 3DC2A 3JPWA 1HZZA 3KZKA 4GPEA 4X63A 4EM6A 3ZDZB 1Y4ZA 2V7BA 4TZKA 1DBSA 3NKFA 3QKRB 4L0QA 3U7EB 5L6LB 4V1CI 3QLVA 1JLLA 1OBHA 3OPYB 5K4AA 3W06A 1GZ5A 3VTFA 2W2OA 2P6UA 1R5BA 4CRWB 2CXUA 2VOJA 2X8AA 3S0JA 1PP4A 1XEFA 2I7TA 1P29A 3SFTA 4DR4B 2YNMA 3K70B 4ABYA 2GN0A 1IQUA 1Y63A 3PQ3A 4S0XA 2ZSHA 3RS9A 4OB8A 4A7PA 2GXUA 2HQBA 2J0VA 3K1ZA 3B9PA 4KWCA 3I2HA 5KNCA 1EWRA 4I4TA 3CX8A 4I46A 1RT9A 4HDCA 4QTZA 1W5FA 1NOKA 4PNHA 5BVHA 1CQIA 1WZCA 2JLSA 5IT0A 4UM8B 1YDEA 1IOZA 1NJFA 3GVXA 2REXB 3HUDA 4JASB 3ZEAA 1U7PA 1FSSA 3R09A 4M22A 1TAHA 1C7RA 3KLNA 2XTAA 3HP4A 4RMHA 4CI0B 2X23A 3LRPA 2LTAA 1GFSA 3PGXA 4XVQA 2XDQB 3C6KA 3ISTA 4X0EA 4N3BA 5EIHA 2Q7DA 1Q0QA 1H0RA 3RRFA 3WNBA 1PNOA 2HLPA 2QZSA 3H4VA 4L85A 1NGSA 2QRGA 1E3EA 3DOOA 1S4MA 2H1OA 3DLPX 2DULA 4QPCA 3CM0A 10MHA 4NLLA 3OQIA 4K6GA 3ZU3A 4RHEA 4CE6A 2IPNA 1Z2CA 1UPUA 3VX4A 2YIJA 3BMOA 3G8YA 4MO2A 5E7IA 1YZNA 3THRA 4Q9KA 4YRTA 1H2FA 3EGWA 5CB4B 1U0RA 4OBEA 2H4WA 2O3TA 1XTPA 3KKZA 4FGUA 1II0A 2PXAA 3GF4A 3UY4A 2AF4C 5IK2A 4BNXA 4R8RA 1QUFA 1U7XA 2LW7A 3N6XA 4CKEA 1BA3A 1GQRA 4MV0A 4TTPA 3RFFA 3R20A 5FWXA 3RS7A 1R4ZA 3CS3A 3H9JA 4TN1A 4UPVA 2ZTSA 3V2IA 1CUBA 3PNOA 5DIFA 5AOBA 3SFZA 2CXQA 4OHZA 2BWJA 2AK3A 1XXHE 2Q45A 4UTVA 3Q40A 1AM4D 4Z4IA 1X7GA 4V2UA 2A5DA 1ECLA 3L49A 3E82A 1C9YA 2XGSA 1INLA 1IBLB 2DRIA 1SURA 2JHPA 2ZPAA 3VVLA 2CVQA 3I04A 1QYCA 3LLVA 3VPAA 3IVCA 3MJDA 4CODB 3GO4A 4IY1A 1UBSB 2C9YA 3QX9A 2BFEA 4PE5B 5HBGA 5JE8A 1XN1A 2MSLA 5KQPA 1DQPA 1WXHA 4AXBA 1Y3DE 2Z98A 2C5SA 6AT1A 1NW4A 1NVUQ 3AVQA 2OGUA 2IHUA 1ECFA 2JFPA 4QYMA 1WAMA 3I5AA 3LY5A 4AUNA 2C1EA 5F2OA 3MHTA 4IIJA 4LZOA 2C2BA 4Q19A 4D5GA 3K9FC 4TUYF 1NUHA 4P1ZA 4YDRA 3V6LA 2W2XA 2O3SA 1VLZA 4PR3A 1GSAA 4HYQA 4UUMA 3QU2A 3TLGA 2BJWA 3VBCA 4PPQA 4DJEC 3D7MA 4QATA 4G63A 4UTZA 5K6TA 1PR0A 1D6NA 2ODWA 2UUOA 4J1TA 1TC2A 4LYDA 2WTEA 2WIGA 4HFRA 4NV3A 1Z5GA 4O0LA 3GMSA 4P7GA 3V8QA 5JQGB 5IF9A 1KWKA 4M3NA 1IBKB 4KR3A 1R8JA 1SXJD 5JNTA 1E96A 2ZRLA 4K6MA 4DR2B 1MENA 2ZS7A 2VHXA 4V0RA 4HNRA 3REFA 3JV7A 2W0SA 1A71A 5FEMA 3C3EA 1TM5E 2Y1KA 5EJ8A 2VP4A 3QQPA 4MEBA 3CMCO 4KTTE 4RK5A 2IU0A 4AFNA 3V2UA 4M86A 4W9MC 4JGBA 3LG2A 3TOCA 3UXMA 4F3TA 4EEKA 2EBHX 4O2BB 5BOVA 2DBQA 1B7GO 3AEZA 1U0SY 4M9XA 5TMEA 3IIIA 4DBLC 2G9ZA 1C9KA 4WN9A 4Y0VA 4YCAA 4ZT7A 1Y6FA 5EMLA 1XTZA 1TVCA 5DYYA 3AEQA 3ODGA 3EMVA 4RFVA 3WRYA 4UPEA 3QLTA 3TWOA 3IDAA 3GJYA 4AG6A 5HDBB 1UXOA 2V54A 4BLOA 2D1YA 2VSFA 2GH1A 1SVOA 4LNAA 4RHXA 3WLHA 5BURA 3MSCA 3T3OA 2AMVA 1D09A 1NZFA 1TO6A 3HCFA 3HB9A 5LUBA 4BIMA 4G4SO 2H0AA 1WW3A 2HMVA 1T1RA 1XRQA 4R2WA 4EI2A 3ILVA 4PYKA 2QMYA 2ZUDA 1S01A 4ZVPA 1Y4AE 5AVXA 5ALHA 2J85A 1JG3A 2CJWA 1F4PA 1JDUA 2WD7A 3AR6A 3E5MA 2X1MA 3M5PA 4X1YB 4AZTA 3UK2A 1JSLA 5TMPA 4ILEA 4L5CA 3ROZA 5JSYA 1IVNA 2V1XA 3R7NA 1EA5A 4QJ4A 1JLKA 3K32A 1UWVA 3ZWQA 4CDGA 1OLSB 1EP3B 3FF1A 2QLMA 4PXAA 5A9TA 5CDFE 2XNCA 3C7KA 2JI8A 1VYTA 1L4UA 2BONA 3KEOA 3KTAA 1ZNWA 4R9NA 3QOWA 5AW1A 1H2WA 1E2FA 2BHLA 2ZVDA 2VAWA 3CF4G 3AZQA 4RELA 3WLLA 2H85A 4F93B 5JU6A 1Y7LA 2EVWX 4EKGA 2FFBA 1T0PA 4GGOA 4X9XA 2XMRA 2E1RA 2HT1A 2YZ7A 1S5PA 2N46A 1K7YA 4G0OA 4K3VA 1JKIA 3F6YA 5E3IA 3SI7A 2P9TA 4ZYVA 3DDCA 4TS1A 3NCHA 1TM4E 2NU6A 3EUEA 4Y6LA 2WLTA 5JO0A 1L6RA 1VJ5A 1H6DA 1P44A 3B36A 3W1VA 3WBBA 2CDNA 4K9SA 5CW1A 4INPA 1Y9JA 1SVKA 5CT8A 2CVHA 2XUZA 5FAKA 4TTSA 4OFBA 4TL9A 5E4FA 3U7FB 4LE0A 4MAAA 5AESA 4F72A 3OX2A 4FYPA 4L3OA 3A06A 4EQ6A 3B6KA 5BW6B 4Z51A 5JAHA 1E8MA 4BU0A 1XEXB 1XNHA 2ICAA 2IITA 3QEJA 3QWFA 3ZQUA 4NCAA 1IY2A 1J8MF 3AVVA 1OKKD 3E5RA 3EXIB 4PG7A 3N5KA 3RGWS 4KDEA 4KR2A 5DGIA 3WYAA 3PI7A 3T7IA 2VDLB 3CX3A 3JQAB 1TAQA 3F7OA 2K6GA 3BEOA 3MEQA 4JLKA 5EJGA 1JKXA 4EG7A 3DVSX 4HFNA 5B6PA 5B3AA 4DZTA 3ILXA 4HADA 2P0EA 3T4XA 3UC9A 2OCAA 2FQ1A 3H5WA 3PNKA 4WLFA 4XASA 4Q24A 4EGQA 1IAVA 3JAWB 1EAMA 4YRGA 4JY7A 4V03A 4U9HS 1Z36A 3M6UA 2WE8A 3K0AB 2W5UA 2ZB3A 3VOSA 3RAPR 1DQZA 2DUUA 5G41A 3H84A 2HUNA 1JA9A 1P74A 5DMHA 4C4TA 4EJSA 5KTMA 2P5TB 1NL3A 3AI3A 3NETA 4EGFA 1S3SA 4N54A 3HA3A 4QYXA 3EZXA 4C5AA 5DEOA 4YMVA 4G0UA 1B41A 1J0AA 1XWFA 4G2NA 1WABA 3V55A 4MW7A 2G4LA 1SXQA 5EXDA 4DIFA 4FMCB 2VH2A 3RRXA 1PGPA 1F2DA 1SXGA 5D7BA 5I7EA 1KEZA 1KWGA 2XNDA 2HF2A 1TVEA 3NATA 1F0NA 5TS3A 1IJEA 4JLMA 4MUMA 5A4DA 3PDWA 4U9IS 3EEFA 3QBTA 3X1XA 2FV8A 1JB1A 1QNFA 1QM5A 5K7SA 3UQYS 3LDUA 1C7ZA 3VNUA 4GECA 2AT1A 3A37A 4NTZA 5TIIA 1FZTA 3VJRA 4CQJA 2R7NA 1MZVA 3CISA 3PXEA 1M1ZA 1X1TA 1ZMBA 3G8BA 1WDLA 4Q3KA 1G55A 3WQSB 1T2FA 2FR1A 2DJIA 1T9BA 3NIFB 1VQ1A 2KM1A 1W6UA 3H17A 3WB9A 2ZSJA 3IHWA 3CNHA 4TSFD 3ASVA 3A3YA 2DHQA 3FFBA 5LLTA 3MZ0A 4N49A 4TKUA 2VOEA 1XTBA 3M6IA 3IDZA 3MMXA 5DWQA 3SIRA 3NYRA 1X1AA 2YYSA 1V37A 2JIQA 4DNOA 2PGXA 1K63A 4WK4B 2CD7A 1GPAA 5FUVA 5K3SA 4DLXA 2G7MC 3I2IA 3VUEA 5LJLA 4KSYA 2FZEA 5AK0A 4RAOA 1H93A 1ECPA 4MQEB 3RKUA 4GVLA 2OBYA 5BY2A 5JAOA 5LVAA 1CUZA 1U90A 2FWPA 2P4UA 4YK7A 1JTFA 2HDOA 2ORIA 4KOEC 1FFWA 3VUFA 1UKZA 1VHLA 3KVYA 3K8ZA 3MGBA 3MTEA 5KNDH 3E3MA 2WZCA 3T7CA 2VPQA 1AMNA 1LLCA 1CLEA 4G9BA 3U31A 2C5HA 2DQYA 2NYRA 3QKTA 4OMFG 4FEEA 5HS6A 1WOYA 1J06A 3IVXA 3RKSA 3K31A 3S2FA 3KV3O 1DKPA 2OO5A 5ICEA 1BWQA 1SCDA 4EHNA 3EW9A 2H7XA 1YB1A 2C5EA 4IZ6A 3EFHA 1RKQA 2JI7A 3PIIA 4AS3A 1RKUA 2SNIE 1CZHA 5I8PA 2XWBF 2XDYA 4I1PA 2ZRMA 2JKVA 5B1YA 5JYBA 2P2NA 1GZ4A 1X8KA 2VK8A 1MVOA 3WRVA 4DV7B 3V7FA 4F38A 4BTVA 4WESA 1SXJC 3I6QA 5AVJA 3FWPA 3KQWA 3A1EA 2WIDA 1TK2A 3I9JA 4HXGA 2CMFA 3L82B 4Q34A 4F1WA 4ZYLA 4K0RA 2DM6A 4TKVB 4C1BA 4Z4GA 2BCEA 3GY0A 2ISSD 3SLRA 1N6IA 3H1BA 3OEEA 4DCVA 4DREA 4ZIRA 2WFAA 4J43A 5H80A 1LV8A 2WT8A 3RBVA 3BEDA 1NXPA 3A14A 3BXOA 4N5NA 3E84A 2ZUEA 4KYTA 2O7NA 1DAFA 3C4VA 4JGIA 1SXPA 2Q9AA 5I7FA 1YJXA 1BD4A 1CUVA 3UJ7A 3PTZA 3X1DA 3BJEA 1HO3A 1J56A 1QQ6A 1TW3A 2IDKA 2IEZA 1QO7A 1KAOA 2R8OA 3CKKA 3GFOA 3E7WA 4YJ2F 5AI4A 2DYKA 3P9RA 4G84A 1ZC3A 1SY7A 3A36A 4NMMA 2QD3A 2OYCA 2PU7A 2RI6A 4G01B 1UM9A 2P67A 5FBZA 4L74A 1L4KA 3ONVA 4NPCA 5KNLA 4BVEA 3D6HA 4CG2A 1O3YA 5DGCA 3TIGA 3QU9A 4ZPJA 1VKNA 1DO8A 2RKBA 4U9UA 5JCXA 5HKLA 5JD4A 2QXUA 3IDQA 2BDTA 1TEVA 3T8YA 4DG9A 1DKLA 2QG9A 4G56A 2E21A 1ULAA 1ISJA 3T3EA 5AKEA 2H1SA 2NN3C 2OHOA 4HPJB 2XMPA 3WIVA 1ULUA 2C3MA 4WX2B 4B45A 1HLFA 2EBUA 3IDSA 3SHWA 3U3OA 2YWRA 2YN4A 1RHKA 2JJ8A 1Q0HA 2WAMA 2WFLB 1NXTA 3E70C 3OA2A 4JH0A 4MEAA 1QTNA 1OI4A 3X1JA 3IDOA 1G6KA 4LNHA 2IHNA 5K3FA 3FVTA 2JLRA 2SICE 1PYOA 5LCXA 2WVHA 3PI6A 1ZVQA 3U09A 2RH4A 3JQRA 3ZU6A 3PGKA 1BRTA 3W6ZA 2P9ZA 2BELA 4NBNA 2ZBGA 4WK6A 4G5YA 3OLQA 4V38A 3F4BA 2R0QC 3FJYA 4P35A 3WLRA 1L9KA 1TJ4A 2ZEJA 4U6SA 5KSPA 1UQRA 1S7CA 4Z4EA 5KSOA 3IPAA 2VI5A 3PUIA 3PFKA 5KHOC 4AYXA 3STVA 1TUBB 2PL3A 1ZA1A 1OCEA 2ZR8A 3L04A 4FSXA 4Q12A 4AJOA 2YW2A 4MV9A 3UKDA 1X14A 2BAGA 1NJ2A 2OAP1 3S40A 3WSTA 1TAUA 1PN3A 3JQEA 3TNFA 4TMTA 3L02A 4CHTA 3W8DA 2QT0A 4A27A 4F0JA 4I5DA 2OBLA 4IQ4A 4P5DA 3ZV6A 4F60A 3LGSA 5HNKA 4BEBA 3N53A 2FWAA 1CS4C 2PUFA 1Y0BA 3EULA 3JQ7B 1NF9A 1KVTA 2ZATA 3OT4A 3FWHA 5EZYB 1Z5WA 4EKNB 4OQFA 2X41A 1KZHA 1P2SA 4IOLA 2C2MA 4QXRA 2BFCB 5DYNA 3QWAA 1P73A 2XOKA 4EA9A 1M2JA 2Y67A 1MBZA 4CQMD 4HNQA 1TOAA 4X24A 4EG3A 5A4FS 4NQZA 4MGHA 2UXDB 4JJZA 3I01A 3EF0A 3LNCA 5LQAA 2E9SA 3JX9A 3G0BA 3TSOA 1EE9A 2MDTA 1DRWA 3SJBA 3NC4A 5ECDA 3V1KA 5C5DA 2I5PO 3K9CA 4RF5A 6LDHA 2O4CA 3DAOA 3GZJA 1D03A 1JYSA 3FBWA 4MVJE 3AINA 3IURA 1DADA 1J23A 2C8VA 1X94A 4V1CB 3AK4A 1QOQB 2B1GA 1FX0A 2IYUA 3H6KA 4RLHA 1V1RA 1VKRA 2HXSA 3DKRA 3LUHA 4HGOA 1O94D 3HCAA 5SYAA 1P60A 3C8DA 3HKDA 3N28A 1LBHA 2BGJA 1E2QA 2J3DA 1SKMA 4J0QA 4BATA 4NEGA 4MUEA 2QRHA 3HUEA 3RO7A 4OQNA 4HN2A 3RABA 1RJWA 3B89A 3HFSA 5C9ZA 5IMBA 5ALJA 2IXBA 1QF6A 1CZOA 4PSVA 4A6DA 1E5QA 2PX3A 4F97A 4CLXA 3W5CA 5CITA 1TPZA 3VR1A 3WRXC 1AD2A 4FZVA 1C9DB 1XPJA 4JR0A 3QU7A 2V7VA 3O8BA 3T4PA 2QN3A 3FB1A 3LPDA 4J3JA 2QX8A 5FLYA 2FPGB 3RYHB 1LK0A 4MPDA 3QM1A 4XVCA 3FLBA 1GTMA 4RVCA 4WZAB 1BWPA 3WLSA 3OMWA 3TTWA 3GGOA 1N34B 3L4EA 3NDBB 4LHSA 1A88A 1IJKA 3T5CA 3VVBA 2IUTA 3ADDA 2FPOA 3NTUA 2PUWA 4GL2A 1HZJA 4ZEVA 2F17A 1JDZA 2XUIA 4TWIA 3THWA 4G4JA 3TZ6A 1Y1KE 3SHTA 2VYQA 3TBHA 2PJZA 3UYLA 1LEHA 4CIXA 2GJSA 3C1AA 2NZ8A 1YJQA 1MIOA 4G8CA 4YAUA 2B6HA 1XWIA 2PXXA 2EV9A 4LY0A 2LRHA 3OI7A 1FNNA 4GC5A 4R5MA 4RKQA 4QEDA 1L3IA 4EB6A 4GR4A 1KYVA 4Y30A 5K51A 2I2WA 1RWMA 4EGJA 3CRVA 1X80B 2Q5OA 4Q1DA 2YWFA 2C1XA 1T5LA 3OCYA 4H16A 4IDNA 3HS3A 4MARA 4U7WA 3WFZA 3ONWA 3HXPA 3L0DA 4QUBA 1BS1A 5FTWA 2QN7A 3G2QA 2JEYA 1BW9B 2EJVA 2IPLA 4PFKA 2BFWA 2JVKA 4R1MA 2HF9A 4ZAFA 5EINA 1T35A 4OUDA 4DCGA 1N2SA 1IZ0A 2UZ3A 5HRUA 2F8SA 1C9JA 1ZL0A 2WG0A 1A8SA 1RP7A 2FEXA 3GBVA 3MELA 5CDGA 4X95A 3ZH2A 1I3OA 2NTVA 2YFKA 4IMIB 3CZQA 4DA7A 4YJ2A 1MB2A 2PX8A 3OJWA 3HACA 1ODIA 3IOBA 2BSQA 4H4EA 5ALNA 4AXXA 4JEIA 3KNZA 4B84A 1WF6A 3W5HA 5L8VA 1MT0A 3K0FA 4Y2VA 5IDWA 3TUZC 1KQFA 5JWOA 4XRGA 1QWOA 1VCNA 1VIMA 1UJ6A 4FJ1A 4AJJA 4ARAA 4D9CA 3GZTB 4MR9A 4C2UA 4MUAA 4R1UA 1PS0A 2QPTA 3EF3A 4U7TB 3DKKA 4YCSA 4E5PA 4AKSA 5F77A 4NK4A 3B7GA 4EHFA 4CEIA 4M9UA 5L3SA 3U60B 2ZRIA 3VDQA 4CR7A 2PGJA 1T3LA 2GN1A 5ESXA 3T4UA 1FPQA 1V1JA 5DM70 1H8HA 1A77A 5EQDA 1VJTA 1VXRA 2GAAA 1PT5A 1M8PA 2GXQA 2YCLA 3IR7A 3RFXA 5BW4A 2RHCA 4GW3A 2F9LA 3FYHA 1QCYA 1UKCA 4A5OA 1OH5A 2CWWA 2PUHA 1T6ZA 2Z6QA 2AA3A 2XE8A 1HL7A 2AH5A 3Q2IA 4KN8A 5CVTA 4ZEXA 1NF8A 3V4RA 1XA4A 3DEYX 4ZRMA 1GL3A 1ECGA 1UWKA 1WL8A 3HKCA 3KEQA 2AJTA 4IF6A 3UAVA 1MPTA 1DHTA 1NJSA 3EJWA 2ZRHA 3BA1A 1UFVA 1WHSB 2WKRA 1F8XA 1ANKA 4DRYA 4H3SA 1XVAA 1JZSA 2X9QA 2H7CA 3LCRA 1XZLA 4QU9A 1PGQA 2X5XA 3WGQA 4C4YA 4RZIA 1QRTA 1QR6A 4GZLA 2WEKA 2XRFA 3ZY2A 1MO3A 4WCFB 3FCEA 1C7FA 5F3WB 4WV3A 2GBCA 2XVYA 3FKSA 1S9HA 1W581 2EAUA 3R5JA 1PEDA 4J3FA 3C8HA 5EIFA 5IF3A 3LOQA 3OEWA 4TTVA 1NR1A 4KQ2A 3GDFA 1PZGA 5DW3A 2YICA 3OZEA 1V41E 4AY4A 2Q8QA 1T1EA 4YWHA 3TZLA 4NJEA 1RHUA 3OZSA 1EVKA 2FN3A 1DSSG 4XYBA 1FBNA 5AHXA 3TLJA 4R1SA 1U8CB 3WYCA 1XF1A 5LUAA 4RDIA 1BEZA 2OOSA 4BMNA 3UMYA 1HDOA 3QENA 3OPYA 1TA4A 1GPWB 1CT9A 2I54A 2CK3A 5K8VA 1UK7A 4O4HB 2F8MA 4HWSA 3OZIA 1EKXA 1SQSA 2FUEA 1JDVA 3PUJA 4QUHA 3WNCA 4CGZA 1R6DA 1RQGA 2OCYC 3BWVA 1LBSA 1IZZA 1AX9A 1JB9A 1EDEA 2PZGA 4FZ3A 2RC5A 4O08A 4LXGA 2PSFA 1I6MA 4BEJA 1KEUA 2OWEA 4HATA 2CZGA 1FW6A 4L16A 4Y9TA 1XD2B 3K9NA 5CW2A 1XKXA 2DFVA 4MJLA 4NG5A 2FPIB 2A2ZA 3LVBA 3U13A 4BB6A 4HNVA 3NNNA 5M34A 1O6GA 5A9SB 3B9BA 4FUTA 1MC4A 3M1YA 4MI6A 3KAKA 3P7MA 4KXYA 4Z8XA 5T4HA 1GPUA 1Z4QA 5JRJA 1AT1A 3HCBA 2ATCA 2YWXA 4ERXA 3JRWA 1GXSB 4Q9DA 2IS4A 2PFKA 4RTJA 4IDGA 3AIOA 1IHXA 1FUYB 3GHHA 4JMPA 4BLRA 1CVLA 1W46A 2DWQA 1KR5A 1UBCA 1JVBA 1SCJA 2OORC 3B78A 3E5HA 3MT9A 1NF2A 2FKAA 2XDQA 3L07A 4WY8A 2AFIE 3RWMB 3ZDCA 2XBLA 1L7XA 4MYHA 3WLKX 3DLTA 2B92A 1V48A 1EFKA 1O94C 3LGXA 4OGWA 1OWMA 3DP9A 4YROA 3PXCX 4AG3A 1GY8A 2QP9X 1CR6A 4H6VA 1N6KA 3EN0A 2QA5A 3LT1A 5BQOA 1CUYA 2I1LA 2RGXA 5HE8A 1HNNA 2I71A 1UC9A 2Q1SA 1E5XA 2BH2A 5E6UB 5CIQA 4R9UC 1RAIA 5JISA 5CB4A 4WBNB 2A59A 4R2KA 4YAEA 4DCCA 2JFVA 3H9BA 3LPMA 4GT1A 1SU4A 4I36A 1YOBA 2AE1A 1DUIA 3TPFA 1OAOC 4BO8A 4P38A 1SKYB 2VJOA 1C29B 2PZEA 4OSEA 2BOVA 3H2BA 1PEYA 3QTBA 4C4PA 4B5LA 3G0CA 4KQKA 4FHDA 1BKDR 3LQ2A 1AZWA 3NHMA 3CJRA 4AM8A 4AN1A 1ZK3A 5HR5A 2QX6A 5K0FA 1SCUB 4GPZA 1FFDA 1I1OA 3B5JA 3E8SA 4RWZA 4C89A 1CY6A 4GU5A 1BXGA 3WQRA 4BAGA 3LRTA 5LJIA 3HGMA 1NSYA 1TIPA 2OSBA 4EUEA 3C3BA 1QHGA 1UFQA 3O4VA 3V7UA 4B6FA 2MYPA 3DHWC 1OTHA 4RMIA 1YJCA 4U5XA 5CK5A 2HIMA 3A6HA 1XKQA 3QYAA 5DNUA 1E1DA 1B74A 3TI7A 2AL7A 2WBLC 5EYPB 4HO1X 3CRMA 1WG8A 5TT0A 4BFZA 4WKCA 5IHPA 2GKSA 3RT9A 2O2XA 3TR6A 3IDFA 3SIPA 1X7DA 1V0JA 3CW8X 3KTFA 4ATNA 1JYFA 4PY2A 4XQ0A 3HM9A 2OESA 3WGMA 1LFAA 3VPFA 4EUHA 5MFZA 2QT9A 2RHDA 3AHGA 4GKAA 4ARVA 4BQSA 4L9AA 4LXIA 2Q6TA 1FDVA 4FOOA 4GSKA 3RK0A 5ED4A 1N78A 4L1KA 1G5RA 2AFRA 2ZAYA 2ZB8A 1JECA 1U0EA 2YV4A 3N6VA 3WG9A 4AJNA 1RCFA 3PNMA 1HE2A 2DH5A 5IT9A 1N2IA 3I5XA 5HZKA 4XR9A 2P8SA 5BWNA 4B3XA 3SBOA 2FHPA 4Q9IA 4R7ZA 2P9YA 5JDIC 4NYJR 5AKIA 3VDRA 2FPMA 3GLIB 1AB6A 3SZMA 2VQFB 1WS6A 5EE9A 2QV0A 3Q12A 1YGYA 1E2LA 1UH5A 1XZMA 2B4RO 4OKNA 5DP2A 1A4UA 4KN9S 3ZKAA 2EKDA 2QYHA 4P3PA 1RMTA 2XD9A 1HDGO 5JZVA 1H4QA 2VC2B 2HGZA 3QPCA 2Y0EA 4GKJB 2J9FB 3ME5A 3Q2OA 4QYTA 3FOBA 2NAFA 3OLWA 4XIIA 2IYEA 4G09A 2QM7A 3PC8C 4MHOA 3VNSA 3CUSA 3NHSA 4O2BA 2F1KA 3RU2A 4HWKA 4ZT5A 2XUDA 2BMDA 4ETWA 3TL6A 3MGCA 3GFPA 3N8DA 3AM1A 3NVKI 2E4XA 2QRNA 1LDEA 2AKYA 5H4GA 4ZODA 3AILA 2H9IA 5ES3A 1TCCA 4JV5B 3QTLA 3UXHA 4BMVA 1G2QA 3HU3A 5EWJB 1BU8A 1I0IA 2J9GA 3GEEA 4P53A 5C4MA 2O4UX 4BLTA 1IY8A 2ONKA 4QQKA 1VI5A 2NSJA 4QVKA 2O14A 4RV4A 4ISCA 3ZHRA 3EGDB 4N0DA 1Q83A 3T7TA 2XYHA 2JG3A 2KX7A 5HF9A 1XXLA 3D6NB 4Q1AA 5D3MB 2QAGC 5CDUA 3GLFA 4QRHA 1UBFA 1PSDA 3GAZA 4NC9A 3S7TA 4CMIB 1TU0A 4IOMA 1RMQA 1J6UA 1FJXA 4AF7A 3EIUA 1OA0A 3NVDA 1H42A 2FSVC 4FZRA 4PPGA 1NAHA 2GM3A 3LKDA 4KZKA 1OLSA 5SV2A 2GK3A 3ZNNA 1CW2B 1NPTO 5FOSA 5J47A 1NW9B 2NO5A 5THQA 4NCKA 2BBWA 3W7VA 2QVLA 4BJ6A 1H2HA 2C96A 1JMYA 1MOSA 1OZGA 3JU3A 1SR8A 2EX0A 4FDMA 4IUYA 5GJCA 3WYFA 1W85B 5EVJA 4PQFA 3G5AA 3PDUA 2DR2A 2ZPTX 3EXHC 1RYHA 2L19A 4KMOA 4M0MA 5KCMA 2A8YA 2W2LD 3CZAA 5JBIA 1W52X 1OD6A 2YQ5A 4JA2A 1IXZA 4M46A 1P3DA 2H18A 4MUGA 4Y2PA 1WZIA 4H18A 1Y89A 3EVCA 2VP9A 3T0IA 3VKFA 4XJTA 4F3CA 3Q7SA 1RLJA 3MSXA 4JOBA 3JQ8A 1SKAA 1CZKA 4EJ6A 3LDAA 3G7NA 4JENA 2AS0A 4BFTA 1YZUA 4BGDA 5F52A 4EYEA 1ETHA 5FBKA 2JB9A 3WKDA 2DG2A 1CRLA 4JUFA 4KITB 3U1BA 2H4JA 2XR1A 1WQ4A 3LFUA 5FHRA 1PWHA 1NMZA 2QYTA 3JRNA 1XEXA 4KG7A 4UC0A 3EQ8A 5FBWB 4D9BA 4EO7A 5KDDA 2OG1A 1VGRA 1DEOA 1XZGA 3EXIA 1MA0A 1XFDA 1N33B 3GB9A 1GGEA 4AO7A 1Z68A 2G70A 2VPXA 3R3JA 3JQAA 3ZWNA 4ABTA 3ZWWA 1DTWB 1I6WA 2NTEA 2P77A 3DUWA 3NHBA 2EKLA 3CVJA 1Z25A 2IZ6A 4XIYA 5DCUA 4Z2YA 5ADWA 1JFTA 3HB7A 1TYCA 3PXDA 2QR3A 1YKFA 3PJDA 4BO0A 5CCEA 5E7MA 1X8XA 4NENA 2QTGA 5FJIA 4B3JA 1K9SA 2BHRA 3UAXA 4MAFA 1GGKA 4BP8A 3SQXA 3GEBA 3K0AA 2NUAB 3TEMA 2R84A 4TMXA 3F3SA 5EZYF 4OHOA 1W94A 4BL5A 2G63A 4DLNA 2XE4A 3F2IA 2HM7A 2PXCA 3IEXA 2CN1A 1W8DA 3ITDA 4X62B 4N9QA 1J09A 4TMFA 2G5PA 5GM1A 5IJAA 4RIFA 4DJFC 1XHFA 2PL1A 1KZ1A 2VDVE 1N5KA 1WIWA 2AG8A 4QM7A 3GDGA 5BV8A 1A9SA 2PVPA 3AUYA 5G1PA 4UDNA 3RT1A 4P7FA 4NZOA 2HIAA 1F06A 4IJ6A 1DCMA 1J99A 1RZUA 5CVDA 3KL4A 5E8JA 1YCDA 2CHEA 3ENWA 3MD9A 2QVXX 2ZU0C 1CUSA 5FYQA 3TN7A 3VO1A 5J4YA 4H7JA 1MN6A 2JCXA 2Q5QA 2XAUA 1G8JA 3E4CA 1RFLA 5JAMA 4KFCA 4QHYA 3H9CA 4RFSA 2AN9A 5D1HA 2WWVD 1J5XA 4NZZA 4PZEA 3KJIA 2WU8A 1E3MA 1GRVA 1SEVA 3SLGA 1SHLA 1T5TA 1QQ5A 2ZR9A 2OWDA 4NP6A 1EB8A 3KJZA 1C30B 1E69A 2VWHA 1EHCA 4GWKA 1B0ZA 5CU7A 2C04A 4D97A 1TTHA 3PZBA 1U9IA 3NWJA 2O7SA 5F64A 2Y0PA 3K30A 2NTYC 4PLVA 5FA6A 5IVKA 2HIHA 2X5JO 1D5CA 4GDMA 3UA4A 1XVIA 3CLKA 3CLTD 4G5HA 3WHPA 4YRBA 3G2PA 5C53B 3GLGA 4FCCA 4QT4A 1FDSA 3S44A