3QEOA

S74e-r104m-d133a dck variant in complex with l-deoxythymidine and udp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
242
structure length
234
Chain Sequence
TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVELTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSMIRAQLASLNGKLKDAEKPVLFFERSVYSARYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Post-translational phosphorylation of serine 74 of human deoxycytidine kinase favors the enzyme adopting the open conformation making it competent for nucleoside binding and release.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Deoxycytidine kinase
total genus 87
structure length 234
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qeoA00
2R65A 4D82A 3WYGA 1CRPA 1UBGA 3DKVA 1SXJC 1UBFA 2QM8A 3ADDA 1O3YA 1R0XA 1GILA 1U90A 2PH1A 2J41A 1M1YE 4EFNA 3K53A 1GKUB 2NOAA 4RKEA 5FR2A 3MWLA 1E6CA 1Z8FA 2QTFA 2OT3B 2V7QA 4HYYA 4O0MA 5H8WA 1TU4A 2QAGB 3UG7A 1G4AE 1VHTA 2NO9A 4F4IA 4JLAA 4Q66C 1N5JA 5GJVC 5AJVB 3LRPA 2YWGA 2WAYA 1P4SA 3OFNA 3THYB 4HUTA 2A78A 1WMSA 1Z22A 3KKNA 1IY1A 1N5LA 4OI2A 2QL6A 1OIVA 1E3MA 4KLNA 2ODWA 4RZUA 5TXGA 1D2MA 4C2UA 2HUPA 5E4FA 2VQSA 3IHLA 3VR5A 4IDOA 3BB4A 1AKYA 2YC4C 4DLZA 1Q0UA 2GCOA 4U7DA 4LV5B 4XWAA 4ZDJA 1FMLA 4OHWA 4OQMA 2ZVQX 1DAIA 5J5CA 1CKEA 2ZRAA 4GMXA 2ZS7A 1C1YA 4D0NA 4KVGA 1H8HA 2UZ3A 1OW3B 3FKSA 3HYTA 2QA5A 2CLCX 1QZXA 4PANA 4JBXA 4QRHA 1WRBA 2MMCA 3L0PA 4KBGA 4PPQA 1PLJA 3F8TA 1G7RA 4PSVA 4V0KA 4BLRA 3NEJA 1SZPA 1XRJA 2JLVA 4CEHB 3P4YA 1R0YA 3LBHA 4PO8A 1BYUA 5F98A 2LKCA 3NBXX 1ETUA 2CK3A 2R2AA 2FFQA 2EU8A 4EPYA 1E96A 2WPDD 3NHAA 2JLQA 2WV9A 3BH6A 1R0ZA 4MUBA 3U44A 3WMFA 2IT1A 1X1SA 4LGMA 2QAJA 1QG4A 2QG6A 2EFEB 1N2CE 4F7WA 1KK0A 4JYBA 4TYPA 4XOIA 3KB1A 3C4JA 5CM8B 4ZKEA 4CGZA 3L0SA 3LQRA 4NZYA 3D6TB 4ZCLA 4DCVA 1DS6A 2IYUA 4B74A 2VYFA 3THYA 1S9DA 3AVVA 2JA1A 1EFRA 1T3HA 2BIFA 2REOA 2D7DA 4LK2A 3SJCA 2WWIA 4LJAA 3BIFA 4RFSB 2O8DA 3VR1A 1G3UA 2CMKA 5HR5A 2ZRNA 2FZ4A 2PZGA 2ZR7A 4IW3B 1N5KA 4B2PA 3U2QA 2CJWB 4DZZA 3DZDA 5A4JA 4KITB 4C30A 1R7RA 1OJLA 2XJ9A 5CIQA 1C4OA 4E5UA 4I1UA 3MJRA 3UWOA 4P33A 1DAHA 2ERXA 2OV2A 1A4RA 2XOKD 3Q7QA 2XB4A 3QJYA 4UNSA 1S96A 4OKSA 1P73A 3LA6A 1AM4D 2QMEA 1NVXQ 1JPNA 4OI4A 1U2RA 5EJEA 1D6JA 1S2MA 2NO7A 3U4QA 3WXMA 3BH0A 3PUZA 4JIMA 4Q03A 2IYZA 2DPXA 4HLUA 4OYHA 1W36B 2GF0A 2OBNA 5IT5A 3NC1C 1PV4A 1FUKA 4V0MA 4M53A 2NZ8A 3ASZA 3S1AA 1NIPA 4M9QA 4UNPA 1OH6A 3KX2A 3ADKA 2CNWA 1OKKD 5JLJA 3NBZC 1N0WA 3K0AB 1KSJA 3SU8A 4RVCA 2YOHA 3NTUA 2R6FA 1YZUA 3L0IB 4PHGA 3T12A 3X2SA 4LRWA 4Q9HA 1I2MA 4ACAA 1BO6A 2FFAA 1HY3A 2WVJA 3PVSA 1E2LA 1XJCA 1HQYE 4BZPA 1ZNXA 2JATA 2ZJBA 3CZQA 2GF9A 1W4BA 1E9DA 2HYDA 3GLHB 4IXNA 1G8HA 4JLVA 5CJ2A 5AR1A 3AP3A 5DI3B 1N6RA 2AL7A 3SS8A 8OHMA 4MRSA 5JEEA 2ZRKA 4JSTA 3AP1A 3LW8A 2O8FB 2F1IA 2QU8A 2Q3HA 3KJEA 1TMKA 3TNFA 4PZZA 4TTRA 3RLFA 4D4LA 2ANCA 4AKEA 2ZR0A 2DFLA 3KXLA 2VP2A 4HAVA 1G8YA 1CTQA 1N0UA 5AJWA 1XJQA 3HR8A 1OE0A 5FOVA 3E70C 2BMFA 1MRSA 3Q7PA 4B6FA 2IK8A 3KUCA 4LHZA 3DO6A 3EPLA 3GJXC 1QHYA 1HTWA 1X1RA 3HDTA 4M1MA 5CB6A 2VP4A 1YRAA 4C7OB 1JB1A 3K09C 4HSEA 4N0DA 1BKDR 3CR7A 4DDUA 3K9LA 1KJYA 4LZZA 1VKJA 3W3AA 4PQYA 3SHWA 2ECKA 1AQYA 2D2FA 4Z1MA 5LPNA 1W44A 3PITA 2H18A 4WVFA 2J87A 3B78A 5KPJA 5KTYA 4W5JA 4BRWA 2JJ8A 1J99A 2FGKA 4Q4LA 3BRWD 2C96A 1YHNA 3REFA 4HEJA 3JVUA 1IN5A 4M9SA 1UEJA 3VX3A 3SZRA 4QBHA 4CEIA 4HUQA 1F2UB 1KYIA 2BHRA 3RC8A 5L3SB 4XSHA 4LC0A 4RKFA 4I4LA 2OILA 3LVRE 1FX0A 4DCTA 3PEWA 2G1JA 3VKGA 2FJUA 1E1QA 3FHCB 4Q4HA 3LVQE 1G18A 1XD8A 4NYIR 3H4MA 2WWGA 4TMKA 4O3MA 2J7PD 5CIWA 3QE0A 1ZIOA 3SJZA 1KHTA 4YQFA 1KKMA 3AB3A 3CM0A 5FBWB 1H8ED 4PPGA 2RAPA 5FI1B 1T91A 2OLJA 1L4UA 1P75A 1YR6A 4DBLC 3AF0A 4DDWA 1KO1A 3MSXA 2ZJYA 1G4UR 1ZD8A 5TMPA 3ASYA 4Q1AA 3LQQA 4QC2A 2XTNA 4TSFD 1Z29A 3U3OA 2F3RA 1KI3A 1Z6TA 2ATVA 2P0EA 1HT2E 2ZANA 1OV4A 2WZQA 3OIWA 3KKPA 1L2TA 1RRGA 2KE5A 2J0UB 1G16A 221PA 1IXRC 3I8SA 4OJQA 4JMPA 2KSQA 4FD2A 3T34A 3V4FA 5JS8A 1N3BA 3CF0A 5AUPB 3H86A 2AFIE 3BORA 1E79A 4I99A 2VO1A 3CUEF 3GCGA 3QEJA 5H70A 2I3BA 2Z43A 3EZFA 4N1AA 4ZV4A 2OCAA 1KO4A 2VP6A 1SVIA 4Y0AA 3B9QA 2B8TA 2HDNB 3H1TA 1Z6GA 2XNSA 3C5HA 3TSZA 1Z0AA 2W2VA 3SDZA 1GAJA 4A36A 3OIUA 1DARA 4ZDWA 1II8A 2FSGA 3KQHA 5KSPA 1NN3A 3K0CA 1YZQA 4XJXA 5LDDC 4QG7A 2XZPA 1TU3A 1I4DD 2XXAB 2WIAA 2AKYA 3ADBA 4QNRA 3I5YA 1KI9A 1R5BA 3F0TA 4URWR 3AUXA 4ACBA 1AS3A 1D2EA 3QXJA 5A0FA 3TSWA 3FKSD 1FZQA 3OE7A 3EAQA 1XMJA 4QJ4A 3UIEA 4PC1A 2FDCA 1KO8A 5KHOC 1I4TD 4C0LA 4DSTA 2O8FA 3FFBA 5C1BA 2VHCA 1KMHA 2VIIA 1KGDA 2VLIA 5E3HA 5K8LA 4LV8B 4DLRA 1BMFD 1U9IC 3U3KA 1NSFA 1X8LA 2HF9A 2QRNA 3QBVA 4NYJR 2J9RA 2P6RA 1GWNA 4DLSA 2VEDA 3CF6R 2RMKA 5JSZB 1W2GA 2ZAOA 3SYLA 3D31A 2A5FA 2TMKA 3DVLA 3TJZA 3KQKA 3LX5A 4ASUD 1T8UA 3VAAA 2DHRA 2Q9BA 3FTQA 1UKYA 3O8BA 4D4MA 4LC1A 4S35A 1XTKA 2F6RA 4L16A 1CJTC 2ASEA 3TGPA 1XX6A 1W2HA 3KKOA 1IXZA 2XNDA 1KJZA 4DDVA 2X1VA 5TARA 2G83A 2L0XA 3G5UA 4G3XA 3GLHE 1TX4B 2DWQA 1G9XA 5EXTA 4MGKR 3TVDA 2ZSFA 1YVDA 3QKRA 4TSFA 4DHEA 4GOXA 4RCYA 3I3SR 2HT6A 5EZ5A 4BFSA 2ZSAA 2J0QA 3X1XA 1N6NA 1FOEB 1N6IA 3W90A 4WXRA 3HJNA 3WMGA 2O8BA 3R8FA 1Z83A 3CWZA 4C0JA 1KNXA 3T5GA 3QI2A 4BLTA 3AVOA 4UNRA 4GMDA 4IDHA 2WJJA 4JT2A 4JLKA 1P9NA 1KK3A 1IQPA 1W5TA 4TLAA 4X8OA 4AIIA 5KDOA 2O8CB 1KIMA 4XD7A 1MT0A 2XEXA 3TAUA 4YXWD 1QF9A 4AKHA 4QXAA 1VIAA 2GKSA 4NCNA 2Z4SA 3UG6A 4DC9A 3BB3A 2XX3A 3GJ4A 4XVUA 1WQ1R 1E99A 1XBTA 5JRZA 5HCIA 4URUR 2AK3A 1UJ2A 2CVFA 4P4TA 3B1XA 2HEIA 1P62B 5CM9C 3BAFA 4CT5A 2WBLC 4IFEA 2YKGA 4MKFA 1SVOA 4MYHA 3KQUA 4PAOA 721PA 4DLWA 3Q5DA 1OHHA 2V7QD 4H1VA 2IL1A 1KDOA 3MAAC 1YR9A 5UKDA 2EFDB 2KBEA 2A5DA 2C5LA 3QKSA 4JJZA 2ZRPA 2XTMA 3AH8A 3EARA 4A0GA 1CJMA 4M4SA 4LBZA 5BXQC 2F1JA 4NBSA 5DI9A 2WKPA 3I5XA 2CDNA 4Q1EA 1KY2A 5TY0A 3AGQA 1ZRHA 1N5IA 1WF3A 3W3ZB 3RS2A 4LYJA 3GPLA 4RD4A 1HE1C 3W9YA 2QEQA 3LBNA 1OIXA 5EXSA 2QPTA 3OZXA 2B92A 3AF4A 1Z08A 2CLSA 1H8HD 3EC2A 2YNMA 5FPYA 1OB2A 3SQWA 3AM1A 4FCTA 1GSIA 3QKTA 4K81B 5FUWA 4C2TA 2QT0A 3ONWA 1WB9A 3RWOA 4IDPA 4TYNA 2DFNA 4A9AA 1NVVR 4PQRA 4ESHA 4ZKDA 1G3QA 4IKEA 2J3EA 2WSSD 1ZYUA 4M8NE 3MWKA 2EVWX 4Z8YA 2BJWA 4MH0R 2DWOA 5DNYB 1MO6A 4WW0A 1W4RA 1FMJA 1IAQA 621PA 1T3LA 5JI2E 3RVBA 4TZ6A 4II7A 3RC3A 2NPFA 4OK3A 2WPDA 3UKDA 1G7SA 3QXCA 5J47A 1NI3A 1S0UA 3HU1A 3CRW1 4P0TA 4DEXA 3UPUA 1LTQA 3GJ3A 2BWJA 1K5GA 2EWVA 3C14C 2ORVA 4XTRA 1IHUA 4EPXA 1MABB 2ZRFA 4MRVA 1MABA 3H2YA 1KOFA 2Q6TA 4F91B 1LFDB 3B60A 1SGWA 2AWNA 4M1TA 1CF4A 4DEYA 1JR6A 1G7CA 1V5WA 3OIVA 3T61A 1VYTA 2P65A 4QBGB 4X8MA 2CCJA 4L9SA 4Q9LA 3UATA 1U81A 4Q1CA 2Y8EA 1OXUA 3DMDA 4IOKA 4EPVA 4DDTA 4UXJA 4AI6A 1TF7A 4OHVA 2GDJA 1A5TA 5GJCA 5ANRB 4P3YA 2GETA 4C0QC 3DEFA 1CXZA 2QSZA 2JIZD 1F3OA 3ETLA 2I1VB 4BWYA 2FSIA 3CPEA 2GEDA 1CJUC 5BYKA 3WNCA 2OBMA 5EP1A 1UADA 4AKIA 1DELA 1KO7A 5TV2A 2XSZA 3QSYA 4NYMR 1G3IA 1VYUA 1XXHA 4YMWA 5FUYA 4ARZA 3QF4A 3TUJC 3CNNA 1P61B 1ZUNB 1XMSA 2JJ1D 2PL3A 1XEWX 4RCZA 2ZUDA 1N25A 4M21A 1RW4A 1KDTA 5IF9A 3SBEA 3EX7C 1YR8A 3I72A 3HPRA 4K8OA 1HYQA 1XF9A 2FWRA 2IHBA 2OM2A 3FMOB 4Q9IA 5EP4A 2SHKA 1UBEA 1Z2AA 3HR7A 3P27A 4BEBA 1OYYA 4CF7A 2KI5A 4PPFA 4IDNA 3B1VA 4TT3D 3ND8A 1GL9B 2WSMA 3ZZ0A 2XITA 4GP6A 1HH4A 3GJ0A 4IXMA 4B3CA 3NH6A 4BEJA 2J0SA 3IGFA 1IN7A 2IXFA 5EUQB 5L3VA 1CU1A 3BFXA 2BOVA 2ZQ5A 2JLUA 1JXMA 1YZGA 1XFAA 4JZKA 4MYCA 5K8UA 2JLRA 2ZJOA 4LHVA 2OSBA 2V6JA 4A0FA 5HZHA 1T0JB 1ZC4A 1SXJE 1VG8A 4LHWA 1Q1EA 4D81A 4Q4AB 3ND9A 1GL6A 4Q00A 2IWHA 1EXMA 1XEXA 2IYXA 1MO3A 1S4QA 1NSTA 1UF9A 1L7VC 1WXQA 2F43B 4L5BA 4LPKA 3TQFA 3RRZA 3QXHA 3L8YA 3QF4B 4B2IA 1E1RA 1R5NA 1IONA 2OUKA 1E9FA 1KAOA 3IEUA 4JL8A 4PSAA 1KI8A 1JI0A 2DFTA 2BC9A 2ZIAA 4EPRA 1SXJB 5K8TA 1JBKA 3DHWC 1N6HA 4HDQB 3TE6A 4NONA 4B6EA 2QQ0A 3LNCA 3H0KA 4KXFB 1BH2A 1FTSA 4OQXA 3AGPA 4PC6A 4DSOA 5KPDA 2KJQA 1M7HA 1XTIA 1CP2A 4L4UA 4B34A 4EAQA 3OHMA 5IRCD 1X8JA 2IS2A 1BOFA 2ZSBA 5SZKB 4G01B 4M9ZA 2JDIA 3TBKA 3K70B 1BMFA 1KI6B 3GJ8A 4BLQA 1XTSA 1AIPA 3L82B 2NPIA 2FG5A 3CX8A 2G3YA 4CEJA 5L3QA 2ZE6A 4CEJB 1I2DA 1KK2A 1Y3AA 4A82A 3GLFB 4PR0A 4LV6A 1LV7A 1OFHA 1ZINA 1ZM4A 5P21A 4GNKA 2FPLA 4RFSA 2O8DB 1RYHA 4PAQA 5B57C 5FPSA 1TF5A 3LXXA 1C9KA 4LYAA 4IVPA 2W83A 4XIGS 1QVRA 5KDLA 4RZXA 4URZR 5LD2B 2QP4A 2QPAA 4JKIA 3K70C 2IYWA 4I1VA 2PCJA 4QHYA 4B47A 4BECA 4YMUA 1KZ7B 1D9ZA 1YQTA 1DAEA 5KNBA 3HP1A 2YJTD 1Z07A 2WMOB 2ZRIA 3KXKA 1UEIA 4F4CA 3VR6A 4DKXA 1Z0IA 3NVAA 4Z8XA 2H17A 1YZTA 1EK0A 4HB4A 4LX0A 4Q5IA 3V4RA 4A15A 2QT1A 4DT1A 1E2KA 1CEEA 3NDPA 2OFXA 1XJ0A 1XZQA 3MWJA 3GLIB 1ZM2A 4KHZA 4MYUA 4RZ3A 4GPTA 4C0BA 2D7CA 1I4LD 3CH4B 3RS4A 4UNQA 2FPMA 4NYIQ 2GILA 3EW9A 3U6BA 2XGJA 1TEXA 3T15A 3G0HA 3KL4A 3PENA 1BS1A 4TLBA 5DGXA 1G21E 1ONBA 2JJ2D 2OFWA 3EG5A 1E1RD 4ZCMA 4ZI3A 4JSYA 1ODFA 3S1AB 2ZE5A 1JNYA 4W7SA 5EQTA 2WM9B 3JZMA 3THXB 3I1FA 3CRQA 1E9CA 4BFXA 1AGPA 4TN1A 4NKRA 4NH0A 1ZNYA 3RRYA 2OEPA 3W34A 4WZAE 4A2PA 1UFQA 4Q01A 2CHVA 4LJ5A 1E79D 1DO0A 1Z0JA 2ZI3A 1IM2A 3UANA 3B1YA 4LPSA 4JKYA 1F2TB 3GLHA 1VCIA 3L2OB 3VU9B 4P4SA 1RYFA 3ZS8A 2WWFA 4Q4JA 5HTKA 2QM7A 2AHOA 3L0OA 1MO5A 3EA5A 3I32A 3RWMB 1ZJ6A 3BB1A 4I1SA 1J70A 4ITRC 2Q9CA 4RFVA 1U94A 4KFSA 4AG5A 5C4MA 2FNAA 3GP8A 3ZZTA 3GQBA 5JSZA 4DB4A 4PFSA 2J46A 1G3RA 5EUMA 1P2TA 1S3GA 4HAYA 2JLSA 5GADl 3OEEA 2GJKA 1K5DA 3ZIAD 3IEVA 1Q1ZA 1OXSC 1VCOA 3BBPA 3RANA 4Y0VA 2IHYA 1EG7A 4GSYA 3QG5A 1AS0A 2ONJA 4KYUA 3WNDA 4PZYA 3CZPA 3DM9B 4WAUA 2LKDA 1XDBA 3IHWA 3TW4A 5JEDA 2NO1A 2RGEA 5EE3A 3RS5A 4BUJA 2FF7A 3OEHD 2ZXUA 3AKDA 3U61B 2UKDA 1ZMXA 3THOA 5IK2D 4EFLA 2CCKA 1HT1E 3KFXA 3SOPA 4TWZA 2XXAA 3VNUA 4A92A 4W5HA 1ZD9A 2WHXA 2XSZD 2ZRDA 3SJAA 4ARZB 4DLUA 3LH5A 1GIAA 2VHUA 4URVR 2WJHA 2VF7A 2GJSA 3GFOA 4C4PA 2GJAA 3VHXA 2YYZA 4CT4B 1DAGA 4PZLA 1COWD 3X1WA 521PA 2C95A 5GVSA 2WWHA 1OKKA 2ZAMA 3UK6A 4G5OA 2RGGA 2A7QA 1TPZA 3QENA 1GFIA 3OEED 4LUCA 1GVNB 1Z6AA 2DWPA 4GP7A 3MWYW 3K0CC 2PJZA 3MCAA 5A5GA 1RRFA 2EW1A 4B75A 1E32A 3CR8A 1DAMA 2VP0A 2V8OA 4OHZA 5JHHB 4JLPA 2BBTA 1KSHA 4HAZA 3ZJYA 3TKLA 3DM5A 1YKSA 2JJ1A 2QBYB 3QG1A 3OEHA 1HQCA 1W46A 2OAQ1 4GFDA 4Q7JB 1MH1A 5G41A 4WZ6A 1IY2A 1XCGB 3DDCA 3Q9LA 3U60B 4V0LA 2IYSA 4V0OA 3ZLJA 5HKKD 4LOAA 2ZI6A 1S3SA 3NXSA 3WY9A 2XZOA 1NMXA 2ZETA 3EZ7A 2A9KA 2VP9A 4TQAA 2RGNC 4Q4HB 2CJWA 1ZM7A 1Q22A 5EZ6B 3HU3A 5EE1A 4EIWA 2IEZA 4U00A 3T1OA 4BPBA 4HUQB 3DOFA 4HLDA 2ZYTX 4R9UC 3VTKA 5C2JB 4QGGA 2FN4A 5BN3A 4FWTA 1IN4A 2D3WA 3PCRB 2CBZA 1KNQA 1DAKA 3NBFA 4JVSB 2B7CA 2ZU6A 3UWKA 2C9OA 4AYXA 1OF1A 3LX8A 4RD6A 1KJWA 3GEIA 4B2LA 4D4KA 5FI0B 1QDEA 4PTLA 1F6BA 2NIPA 2DFKB 1F2TA 4DLVA 3B9PA 3SR0A 4TL9A 2WKRA 2ZRBA 2Z5FA 1KI6A 1ZD1A 4PX9A 3FVQA 2PBRA 4MITA 3AQ4A 3EZ6A 1XTJA 4PHHA 5ELXA 3O8RA 4O2LA 2GXAA 1AQUA 2J7KA 1GKYA 2CK3D 1HUQA 1LF5A 3E1SA 1OFUX 4N3NA 2BMJA 1T8TA 1G8GA 3R7WA 4FCVA 4MRPA 1F5NA 3BE4A 4DLYA 4Q18A 3B6EA 2W6JD 1G8PA 2D4HA 3FWYA 3RNLA 3QIAA 4YONB 1NVVQ 4YMVA 1PLLA 3SJBA 4NMMA 2ONKA 2QI9C 3TH5A 4RD2A 2F9MA 2AN9A 1R10A 1TQ6A 3R8CA 2BDTA 1DO2A 1G20E 1XNJA 4PO9A 1SXJA 3A37A 1RZ3A 2ODNA 3DZ8A 4NU0A 5AJYA 2WSSA 2GBLC 1UM8A 1H65A 2J0UA 4Q7LA 2GA8A 3K0EA 2ANBA 2JLXA 1U8ZA 5FTJA 2ZPTX 5G3YA 5DN6D 3Q72A 3KQLA 5H1YA 4A8JB 4MDEA 1AKEA 2YHSA 3THWB 2D2EA 3LAWA 3BC1A 2OFOA 4BFZA 4MQBA 2JLYA 1KMHB 3UMRA 3ADCA 3T35A 1E9AA 2AWOA 2LCFA 1X3SA 2CVHA 3B2EA 4OI0A 3QBTA 4HATA 1XTQA 4JLOA 4U5XA 1XMIA 3LXRA 4AG6A 1ZIPA 4ESVA 2DY1A 5KSYA 4U02A 4XSGA 2ZJAA 5HZKA 3ZVRA 4R71A 2AFHE 1QHHB 4BLOA 1MKYA 1W47A 5G53C 4EJSC 2X2EA 3FE2A 1RC8A 1OH8A 3WYAA 4FIDA 1R8QA 2RHMA 4JVNA 3HU2A 5J4HA 5KOYA 1JALA 2KB0A 1W5SA 4UNNA 3J81k 1E9EA 1FQKA 1JECA 2CL7X 4MRRA 2IUUA 3KJGA 4DB2A 2DB3A 4LYFA 4B3DA 4LJ7A 1TTTA 1OLOA 1OYWA 2J7PA 3DKPA 2W58A 3WRYC 3MUFA 3AVXA 1J2JA 4UXHA 2XOKA 2ZRLA 3I8XA 2QORA 1Q44A 2RGBA 4HB2A 4R7ZA 5J4VA 4GL2A 4KJZA 1A1VA 2RH5A 4YMTA 3EWAA 1RE0A 2V6IA 3DMNA 4XVRA 4QL3A 4F92B 1IOZA 1GG2A 1YU9A 2H7VA 1ELOA 4IHQA 1Y63A 3GLFE 5L8VA 1X6VA 4HAUA 2GRJA 3WRXC 1IY0A 4HZUB 1NVUQ 4OBEA 1GNQA 2ERYA 2WMNB 4KFRA 5FPHA 2JASA 1OHHD 2BMDA 5EE9A 2P6NA 1VMAA 2QAGA 1N0VC 1W0KD 4DWJA 1F60A 1II9A 2FX3A 4PPNA 5G40A 4C9BA 4DUGA 4EFMA 4I1OA 1UKVY 4JT4A 3F5FA 5BWMA 4PQFA 3QKRB 3EIHA 1LB1B 3M4YA 1J90A 3LWNA 5J40A 5JHGB 2IW3A 2HF8A 4V03A 1G291 2VHTA 3B7GA 3CB4A 4AURA 2RHDA 3IUYA 1VCNA 2BKEA 4A2QA 1B0UA 4Z51A 1J8YF 5JCZA 1FP6A 2REXB 4DT1B 1KKLA 2YWFA 2H1LA 3OF5A 5D3QA 5IHPA 1TNDA 1Z63A 2R8RA 1MO4A 1WCV1 2VHJA 2JAQA 2YVUA 5JJIA 2R6DA 3VR2A 2HCBA 4EPTA 3C16C 4B3GA 1R8SA 2Q3MA 3B85A 5FH9A 2O8EB 1QRAA 1GRNA 4LI0A 2W00A 3ZDQA 3E5HA 4QOSA 4IOJA 4NTZA 2PEYA 3RYTC 3OAAA 1U8AA 2PZFA 3P1JA 4GZLA 5HKKA 4OK6A 3AF2A 1NY5A 2JGNA 1D8TA 4KSBA 3C41J 3QUSA 4M22A 1ZNWA 3QKUA 5AJZA 2FGJA 2AX4A 4KODA 4LBYA 2GZDA 1NLYA 3U7FB 3GEEA 1E0KA 1SQ5A 4QM6A 2FMXA 3EWSA 1GM5A 1GDDA 3BXZA 4M2LA 1XTRA 2QP3A 3K1JA 2ZI5A 2V1XA 4A6PA 2E87A 2GJ9A 2F7SA 5B64A 5KO2A 2ZREA 1GITA 4G5SA 5FUXA 2ZRGA 5C46F 5JWRA 2OCBA 121PA 5L3QB 2AD5A 4FMDB 4LHYA 1CJVC 5CDFA 5L3SA 1ZP6A 5DH9A 4QGFA 1F2UA 5BQ5A 3MG9A 5CLLA 3IIKA 5E7MA 2P6UA 1NRJB 2V4ZA 3PR1A 2WTUA 3A8TA 1HEIA 2IA5A 5C4GB 3IILA 1G3MA 4LBWA 2IYVA 5EE0A 2GNOA 2A5JA 1U99A 1SULA 3A1WA 4HDOB 4R2HA 4BRUA 1KAGA 4Q1FA 1XD9A 1KO5A 3PIRA 1RVDA 1NMZA 3W8RA 5LB2A 1SXJD 3JZAA 2WJIA 1TQ4A 5AK0A 1AZSC 3QPVA 1ESMA 1VYVA 5CYOA 1WA5A 3PG5A 3AUYA 5DSZA 3P20A 1BYIA 4KLZA 3A4LA 1T4GA 3ZVNA 2Z4RA 1M34E 4L8GA 1YJ5A 4NCHA 5J4LA 2JLWA 2WIBA 2ZTSA 2ZJ8A 2GESA 4N0EA 1QVAA 3SYNA 2PMKA 2Z6VA 3VNVA 4NE2A 3FOZA 1DE0A 2R44A 3P26A 2AXPA 5FBLB 2NQ2C 3K70D 4TMTA 3TAHA 2RGDA 2W2XA 3AVUA 3EZ2A 2QBYA 4P4UA 2C8VA 2O0HA 2XZLA 3X1ZA 1E2GA 3FKQA 4ON9A 3VKHA 1EWQA 3U7EB 4JL6A 1R5OA 5HE9A 4TMXA 1XB2A 4TTPA 3QXSA 5SZJA 2ZVPX 4GI7A 4CEIB 1SVMA 2MSCB 3OE7D 2IS1A 1COWA 1LNZA 1ZVQA 2GXSA 4NYJQ 3ICQB 3NC0C 1XPOA 3EASA 1K8RA 4C0SA 4POAA 4JBWA 2O5VA 3QKSB 1Q1BA 2IUSA 4BE7B 3D8BA 3REGA 3ECCA 3HPQA 1IJEA 3KDSE 5HPYB 1Q1QA 1G64A 4BASA 3ZQ6A 3QY0A 1NMYA 3ZVLA 5CK4A 2R6GA 4NPHA 4GRAA 1GRQA 1GTVA 2CHGA 2GXQA 4Q1BA 4TYYA 4CIDA 2Z0MA 1VHLA 4NP6A 4ZDKA 2A2ZA 4DSNA 3PJRA 3TW8B 2J5XA 1AN0A 3ZD6A 1E2FA 2W6ID 4M1SA 1M8PA 4HLQB 2XNDD 2EFCB 4DXAA 3IPXA 1EX6A 4YDSA 3WHKA 4QKQA 1BIFA 2GZHA 1NVWQ 2W2TA 1EFHA 1XXHE 4G5QA 4NDZA 4J0QA 4YMSA 2O8CA 5EP3A 4TLDA 4DUGD 3QF7A 4FMDF 2QN6A 4NCJA 4TQUS 1NBMD 4B3BA 4DJTA 1W36C 3N70A 1MR3F 1RJ9A 5F2EA 1ZU5A 3QOFA 4B44A 2O8EA 3RS3A 5JZVA 2P67A 2UZIR 2ZM5A 5C18A 4HAWA 1NLFA 2C9CA 2OCPA 2ZRCA 3LO5A 1IBRA 1G5TA 4KFUA 1P9WA 4PO1A 4FMCF 3BD9A 3VMFA 1YZNA 5DN6A 2D06A 3GFTA 3ZH9B 1ZCAA 3KZ1E 2R62A 5FL7A 1ZBDA 4DIDA 2YOFA 2JCSA 2EQBA 1G6HA 1T6NA 3A58B 2NO6A 2CLDX 1FP7A 5GVRA 1PVOA 1GKIA 1OFIA 3SYKA 3TR0A 2RGNA 3WBJA 4E03A 3UMFA 1E0JA 1OT3A 3I4LA 4FN5A 1PUIA 3LLUA 3LBIA 2ZS8A 3KB2A 2PEZA 3IQWA 2HLDD 3Q8XB 2J1LA 4XVQA 3WP1B 3VKWA 2ZEJA 2QUZA 2ORWA 2VRWA 3KTAB 4Q21A 4BFYA 1SKYE 1GRRA 4EJSA 3A1UA 5D3MA 1JXOA 2J45A 1XXHB 4RD1A 3MD0A 3L8ZA 2V54A 1NF3A 3RS0A 2ZR9A 4JLNA 3MGCA 3BK7A 2GEVA 2IXEA 5FL3A 3MFYA 3GD7A 3OIYA 1W36D 5FPKA 2A5YB 2A30A 2C98A 2G88A 3PEUA 1P5ZB 5DE3A 2KBFA 2QSYA 2FFBA 4FW9A 2VTKA 4ZDIA 3FFAA 5E95A 1FPMA 1EGAA 5KSZA 1EFTA 1Z6YA 5CDFE 4JBYA 2BV3A 4FMBB 1NL3A 1S8FA 1ZCBA 3QVUA 3IO3A 2ZJ2A 2HJVA 1T9HA 3K9GA 1W0KA 4KO8A 3SFZA 3NDBB 3ICEA 4GDFA 2O52A 1TUEA 4XWOA 1U9IA 4RD0A 3R7WB 4WIAA 2NO0A 1CR4A 2BJVA 2H16A 4Q4AA 4CW7A 2QROA 2ZUBA 4TYQA 5FOSA 3ZZUA 2N1BA 4A1FA 1ZUHA 2Q21A 3BOSA 1N6OA 2AKAB 1OB5A 3U3MA 1H8EA 4V0NA 1G1MA 2NG1A 4EKDA 2PT5A 3BJIC 3MRSA 4CYMA 1LF0A 3CBQA 1Q12A 4WBSA 2RGAA 2IX3A 2ZSDA 1R4AA 1RRCA 2OE2A 3RDPA 1DAFA 3AP2A 5B2ZA 3EPJA 4XD7D 4FCWA 3QXXA 3ZQJA 4TQ9A 1P2VA 1TADA 3TMKA 4W5WA 1YRBA 2RGXA 2BCJQ 3B1WA 1XD2A 3U7HB 5AUQA 2Q3FA 3M6AA 1XP8A 2CHQA 2LWIA 4PSKA 3W6OA 3GLGB 1LW7A 1OH7A 1SHZA 4M9XA 3TRFA 1T0HB 4ZCIA 3KKQA 3CW2A 2C04A 2ZYWX 2EYUA 2FPKA 4Q7KA 4FINA 3GLFA 4P32A 1IN6A 5CLQA 1US8A 3PXGA 4D26A 2IWRA 3U4QB 4NYMQ 5HCNA 1SHKA 3K9NA 1ANKA 2ZRJA 1OPXA 1CBUA 5DLQC 2WAXA 3WHLA 4EUNA 1IXSB 1T5LA 2ZITA 3PFIA 1KY3A 2OG2A 2Q0HA 5JBQA 3PV0A 3RAPR 5L3RA 1E2MA 2EWWA 2P2LA 2YV5A 4LCBA 1PUJA 2HXYA 4X8HA 2PJRA 1QBKC 3K8YA 1UAAA 1Z6XA 3NIBA 4BFVA 2ZJ5A 3CX6A 1N6LA 5SZIA 1SVSA 4IEEA 3K9HA 2F55A 3CO5A 1RIFA 3BFKA 4G5RA 2OBLA 3DL0A 4HDCA 4HZUA 4LJ8A 3VQTA 4HLUC 3SI7A 1WE2A 5CB8A 2ZYUX 3X1DA 5CJPA 1XEWY 2WOOA 3LV8A 1XU4A 3AEZA 4PC2A 3SBDA 1NP6A 4YXWA 3WBKA 2IUTA 1XEXB 2QGZA 2NZJA 2G9NA 4QFMA 4G1UC 4HZIA 3SEAA 3GLIE 5JJKA 5BN5A 2O8BB 2IBMA 1FW6A 3THWA 1FNMA 2IS6A 3KTAA 1CR1A 2CL6X 5GJWC 2QAGC 4B32A 2OO7A 4F38A 2HT1A 4A0HA 3OESA 2OLKA 3GJ7A 3SQXA 2C78A 2IYLD 1UDXA 2BEKA 2BCGY 2AD1A 2J59A 2WJVA 3N2IA 2VL7A 3U6KA 3EPKA 4YDHB 2QP9X 2WKQA 1M6NA 4AC9A 1E2PA 2GVDC 3RSLA 1Z2CA 2JJ2A 3WP0A 3SNHA 1QHHA 3K09A 4HAXA 1W4CA 1AJEA 1CULC 4IEIA 2AXNA 1NNEA 2P3SA 2V55B 1JR3A 4DIEA 1W7AA 2JDID 1U0JA 4A4DA 3WNBA 3CF2A 4MKIA 2MMGA 3N5CA 1Z28A 4LJ9A 3IIJA 1X86B 1U98A 2ZI7A 3OFND 1CR2A 5BW8A 1JJ7A 5LB4A 4UJ5A 2Q9AA 5CK5A 1G19A 2B8WA 2ODEA 1LS6A 1P3JA 3D7MA 5FOXA 1DOAA 3FDIA 4G5GA 3MMPA 5JCPA 4RD3A 3KKMA 3K0AA 1T3SA 2HYIC 5J4KA 3BH7A 1S1CA 3U44B 1QHSA 1E4VA 1E98A 1VG0B 1M7GA 1WDTA 4FWIB 3QPWA 4QBIA 1VG9B 3AVQA 2IYTA 3T5DA 4JVLA 4KVAA 2ZUCA 3LFUA 1NKSA 3AKYA 4LWZA 4QHSA 4D6PA 4TT3A 4Q02A 5JJLA 3ZGXA 1M7BA 4D80A 5FOTA 1E2NA 4MGIR 4BFWA 2B21A 4QBFA 1XCPA 5LBIA 5FFMA 2HV8A 4DVGA 4BGDA 4B73A 3SHFA 3TUIC 3Q3JB 4ZI2A 2GK7A 1KI7A 1Q3TA 3I62A 3CX7A 5E7JA 2VP5A 3FYHA 2VSOA 3IIMA 1SVKA 1NLZA 2EFHB 4KFTA 1U0HC 2QY9A 4OQNA 5TVKA 2PLRA 3U3RA 3PUXA 2ZYVX 3A1TA 1NJGA 1Z3IX 5F9HA 5DYIA 1SVWA 3BFVA 4MUAA 5D3MB 2JIZA 1YE8A 3TR5A 1G5RA 3VR4A 3SN6A 4I81A 2YWHA 1VIYA 5J4YA 1CRQA 4XH9B 1E2EA 3PEYA 4DLTA 3Q85A 4TLEA 2O0JA 3GMTA 5G3ZA 4CZ2A 1UKZA 3M0EA 4BLPA 3B13B 2GCPA 2G77B 2BEJA 3CRMA 1G7TA 2RB4A 3EIEA 4KCGA 4TMZA 1KMQA 2GVZC 1AGRA 3AVYA 2NTYC 4P4SB 4QM7A 3FB4A 1EFRD 4O2RA 4BQSA 1EFUA 4TZ0A 3V9PA 4WXPA 4CRWB 4E07A 5M04A 2PLFA 3A4NA 1P7CA 1N6KA 1ZM9A 3CNOA 2VBCA 3HYRA 3RHFA 5TDHA 2H92A 4JLBA 1A2BA 3CONA 3E2IA 1FX0B 2FZLA 2FV8A 3EA0A 2CXXA 2IF2A 2MSEB 4AYWA 1JQLB 1ZM3A 4CVNA 1B23P 3NG1A 2ZE8A 4P31A 2FSHA 3TQCA 1AK2A 1VG1A 3M1IA 4HB0A 4DSUA 4EQ6B 2QE7D 4ZIRA 5E7IA 3R9XA 4LYHA 3RABA 2E9SA 2YZ2A 3GJ5A 1MRNA 1DBSA 4R98A 3W5JA 4Q7MB 1II8B 4MGZR 1W49A 4IOMA 5KUTA 2BBOA 2R6AA 3B8HA 2QTVB 4D2IA 2ZI9A 3RRNA 4CDGA 4ERNA 5FUVA 3ZVMA 1WBBA 1E2HA 4GOKA 4US1R 4A2WA 1TQ2A 3ZIAA 2D62A 2C2HA 2QMOA 2GHIA 6Q21A 5JI3E 3PUYA 1JAIA 1HE8B 4B48A 4DCNA 4C7OA 4M1KA 2ZS9A 3NH9A 5EXXA 3A6PC 1QHXA 4FXPA 4C3ZA 1JAHA 3QPUA 1JQJC 4JJKA 1NIJA 1LY1A 2IYYA 4HI0E 3P32A 4KYIB 4BZXA 1HV8A 3CH5A 5KU1A 1Z0DA 3KJIA 2PX3A 3BWDD 3I61A 3CWQA 3GEHA 2WOJA 5AUNB 2GAAA 1O87A 2GXUA 3EPHA 2C77A 1ESNA 3W6PA 2QGNA 5FTMA 1S9HA 4B3XA 1FNNA 1YZKA 4H9GA 3FMIA 2X19A 1GNPA 2W6IA 4US0R 3K0SA 2QE7A 2VH5R 2IS4A 3N2EA 2GAOA 1JR3E 1G6OA 1KDRA 2WWWA 1F48A 1G41A 1HA3A 2G1KA 1KK1A 2GBLA 3KJHA 4TTQA 3TSOA 3NKVA 1LS1A 2AK2A 3AKCA 5JS7A 1DG3A 4GZMA 2BVNA 4A8JA 2OAP1 4LDJA 4OK5A 2W6JA 2GZAA 1EFCA 1CLUA 5FTNA 4Q47A 3PQCA 2FFHA 3GLGA 3C8UA 2CE2X 3AF3A 5JWOA 2EYQA 4UJ3A 5KYKA 3X1YA 4EDHA 2YINC 2ZROA 4DRZA 5H68A 1XZPA 4ZPXA 5JRJA 2MSDB 2QRZA 5BN4A 5FBVB 4F93B 2FSFA 3O8CA 3EIQA 1E69A 2F1HA 1Q20A 2GCNA 2QTHA 1TUIA 1QHGA 2G0NA 2WWYA 1L8QA 4XTCS 1E9SA 3K0FB 3GLGE 4LHXA 3QNUA 4ZIRB 3DOEA 1A7JA 1TEVA 2OXCA 2PCLA 4PHFA 5FOWA 2O0KA 5DO9A 3I73A 2NGRA 2DYKA 1OXVA 1XCMA 2F43A 4D4JA 4JYCA 1P2UA 4Q19A 2WJYA 2N46A 5DHAA 1W0JA 4M1OA 3BERA 4QJ3A 3U5ZB 5FTLA 4NHOA 3IQXA 1E9BA 4OHYA 3AF1A 4HB3A 1M74A 4CEHA 4E22A 4IJMA 4S2EA 1JEDA 2ZJZA 4HLCA 2EFGA 4PHTA 1E2QA 1V43A 3A4MA 5BYJA 5K8IA 4BZQA 1XPUA 4B76A 1G8FA 3U7GA 5JWHA 4BFTA 2BM1A 2DR3A 4AK9A 3TUZC 1D9XA 2BMEA 4AD8A 4H1UA 4LJ6A 4KBFA 3TK1A 4TLCA 3LW7A 1RKBA 4M0LA 3B1ZA 3R9IA 1VDZA 2F3TA 4TL7A 3WMEA 1R0WA 1FFHA 4B3FX 2RGCA 4C0HA 2GTPA 2OXRA 4PC7A 2C99A 1KSFX 1QG2A 5FTKA 2ZI4A 3WYFA 4B35A 1W1WA 1E9RA 1WBDA 4TMWA 3RSOA 2DCUA 3UMSA 4OHXA 2J0VA 2I1QA 3SE0A 4YLGA 4EJSB 1X8KA 4XWKA 1J8MF 1FQJA 2FEOA 1A82A 3CRVA 1EX7A 4LY6A 4LJYA 2JLZA 1SVLA 4IOLA 4NCKA 4RSGA 2W0MA 5EXPA 1ZUIA 1P72A 1XWIA 3LY5A 1N6PA 1E2DA 4LJ4A 2VPPA 1CR0A 1YZLA 2REBA 3O8DA 1NJFA 1NBME 3B5JA 2IXGA 2PZEA 3MLEA 1GZSA 4X8LA 2ORIA 3T1QA 3BS4A 4GOJA 3KQNA 3VU9A 2CNWD 1SKYB 1E1QD 4RJLA 1ZU4A 5DIFA 2PMDA 2V9PA 4M1YA 1Q57A 4Z54A 3IBGA 3B82A 2ZRMA 2FU5C 3FGNA 1E2IA 4Q1DA 3L43A 2GEUA 2QMHA 4D0GA 5EE5B 1P9RA 4IDQA 4BLSA 1VTKA 1U0LA 3V00A 2QPOA 3T06B 2HLDA 2H5EA 4UQOA 3W8NA 4QGAA 1KI1A 2K5UA 1RRPA 5FPTA 2A5GA 3CIOA 4JS0A 4FI3C 4RZ2A 2FA9A 2XJ4A 2AR7A 2RCNA 3PUWA 4QHTA 1KI2A 1PZNA 4JLJA 1GP2A 1P6XA 5HE8A 5GJBA 2IYQA 1TQDA 3A36A 1AS2A 1KI4A 4AYTA 3THXA 2RKOA 1OFTA 3IO5A 1AA9A 2YC2C 4RY2A 1KDPA 1Z0KA 1KZGB 3C15C 3IKJA 3IBYA 4OL0A 3VR3A 3A1VA 4W9MC 3VX4A 2YOGA 3VHLB 3FHTA 4MRNA 3TIFA 4URYR 4L9WA 2X77A 1FL9A 2B6HA 2XTZA 2BM0A 1KSGA 5IDVA 2IC5A 1K6MA 4QNMA 5FBRB 1E0SA 1JPJA 4ASUA 3CPJB 1D5CA 3O47A 1XD2B 5TB5A 4TYWA 4UXIA 3IPYA 1JEEA 2PT7A 3F3YA 4KI0A 1ZC3A 3QEOA 1DVRA 5DISB 1YR7A 1Q3HA 2B7BA 2HXSA 5B30A 5JMTA 5KNCA 5JFGA 1OIWA 2G6BA 1IN8A 1P60A 4C0KA 2ODBA 1J7KA 1R6BX 2H8KA 3FPAA 4E09A 5JECA 1LVGA 3AKEA 3T1TA 4MA4A 4O25A 4IVRA 2X8AA 4JLMA 4ABYA 2OHFA 1U8YA 4ILEA 2W0SA 4B33A 3AVPA 1UKEA 1VCMA 3ZS9A 2A3RA 2P5SA 1WP9A 1KTVA 1OSNA 4A0RA 5EP2A 5DI3A 1E0AA 2BBWA 1UBCA 2VA8A 3KFVA 5AJXA 3PEVA 3NWJA 5AWFC 2IYRA 5DHFA 3QVVA 1RJ9B 3A1SA 2HCJB 5DYGA 1OXXK 1Q21A 1XMVA 4PXAA 4FMCB 4MKHA 5SZHB 2ATXA 1TL7C 1Z47A 4TL6A 1AZTA 3KXIA 4Q4JB 4V0ME 3G82C 3CNLA 4L15A 4TMVA 4MYTA 4URXR 4KV9A 1XEFA 2GK6A 1GNRA 1G5PA 3IDQA 821PA 4Q9KA 4A6XA 4AWXA 3U3JA 2V1UA 2XB2A 1HURA 1XPRA 4Q9JA 1CS4C 1TF2A 2OESA 3FMPB 2QQEA 3W5IA 3ZYCA 2N42A 1W48A 421PA 4K46A 2HJGA 4EPWA 3EZ9A 1R2QA 4OJKA 1W0JD 3DPUA 1E2JA 1NBMA 5LD2C 2NMVA 1IJFA 4PAMA 2R6CA 4ZO4A 4EQ6A 5KSOA 3CRRA 1ZW6A 2R9VA 1UDWA 2YWEA 3FMFA 4JVMA 1MV5A 4A8JC 1T5IA 4B71A 3ZD7A 2PX0A 5FR1A 2P5TB 3NHBA 5CITA 1EESA 2OCYC 4Z1MD 3RRMA 2C9YA 3H84A 2BBSA 4MDFA 5FL7D 4OQLA 2V3CC 2WWXA 3AV0B 3EXAA 1FTNA 4WZBE 3CKLA 4PC3A 5KNDA 4OI1A 4QJ5A 3RS7A 1UPTA 2GCOB 3JVVA 3R20A 1DEKA 2WICA 4QGHA 2C03A 4KAXA 2GJ8A 4DLXA 1FUUA 3D3QA 3CLVA 1VECA 3GLIA 2WJGA 2FE4A 2Z83A 1PJRA 3PUVA 1CJKC 1S1MA 2QZ4A 4UKDA 4D25A 2KWIA 2VHQA 1QHIA 3T1VA 4NCIA 5B58C 1NN1A 3TVTA 2QNRA 4YC7A 1OH5A 2I4IA 3NEYA 1NY6A 3AVTA 1NN5A 1A2KC 2D74A 2QMUA 4LSGA 1VPLA 4IRUB 2FEMA 2OZEA 2ZRHA 4MGYR 2VSFA 1PLKA 4GT1A 2CCGA 4BFUA 1QHNA 3FHOA 3SC3A 1JJVA 1GOTA 2IF0A 4OQFA 4Q48A 2F1RA 3KUDA 1DG1G 2DBYA 1D2NA 4AKGA 2CL0X 3R9WA 1L4YA 3GFPA 1CIPA 4M1WA 1ZAKA 3C5CA 3W6NA 1DADA 3TLXA 1GUAA 1RFLA 2E1RA 2ZU0C 5F9FA 2VSXA 3CPHA 5KDDA 4TL8A 5CYPA 2G0TA 4US2R 1EWRA 5FBQB 4C0AC 1RPZA 4MKGA 1NKTA 1Z5ZA 3BGWA 3UXMA 2XAUA 1NG1A 3NBYC 4DCUA 3QQ5A 4LBVA 1II0A 2X2FA 1JR3D 4GBMA 4IVQA 4WOPA 1DPFA 1M2OB 1NG9A 1US8B 2FH5B 1E94E 3K0FA 4F4JA 2QENA 3SFVA 3OAAD 5AUOB 2IEYA 2F9LA 1P2SA 4G0NA 3C7KA 4IFBA 3LDAA 1G17A 3AVWA 2VF8A 4AY2A 2CEAA 1ZNZA 3P4XA 4NL4H 4D0LB 4B43A 1MOZA 2ZE7A 5IK2A 1Z06A 3MJHA 1W4AA 4KSCA 1NN0A 3VFDA 3LD9A 2H57A 4V02A 1OXTA 2FOLA 3Q5EA 4WA7A 2ZSEA 3LLMA 1DTSA 1TAGA 3EC1A 3HWSA 3I92A 4R2IA 4DCSA 4JL5A 2GWHA 1Z0FA 3GJ6A 4JLDA 1GL7A 2JEOA 1E4YA 2UVQA 5FOUA 1SKQA 2BKUA 2CE7A 4KU4A 5F3WB
chains in the Genus database with same CATH superfamily
1JVSA 3RF6A 1PSDA 3WYGA 1YS2X 1LNQA 1X87A 4BQIA 4GRDA 3HCFA 3DKVA 1SOMA 1CY4A 5ABPA 2QM8A 2JCGA 1E5LA 5NULA 3FX2A 3DE6X 1H22A 1Z8DA 3LC0A 1WKBA 2O19A 3W1WA 1OQAA 9ATCA 2W2KB 4NAUA 1JTEA 5HUQA 1WMEA 1B16A 2ADFA 1JDBC 1YMQA 2Q6IA 3K53A 4PAGA 1GKUB 1VQ1A 3COPA 1J20A 4RKEA 1MU0A 2VDWB 1E6CA 1Q0ZA 1Z35A 2OT3B 1XAJA 1RXEA 1K0UA 4PO3X 1QONA 1HSOA 3SHTA 3LUDA 1G4AE 3K6RA 2Q0SA 5M3BA 4JLAA 4F4IA 3JWEA 4L50A 3KWFA 3M82A 2IHNA 1T8PA 1AG9A 2GPWA 1NBAA 3GG9A 3OFNA 4N6NA 3B9RA 3M81A 3PLAE 1IY1A 1N5LA 1OIVA 2QTVA 4RVSA 3Q6IA 4KLNA 4RZUA 3CIFA 5J59A 4C2UA 4R1NA 3IHLA 3HYCA 3MJSA 2G09A 1Z17A 5K8JB 2QQ5A 5BUCA 1NX9A 2GCOA 2WZBA 1WG8A 4MQFB 4PFJA 4XLLA 5DW0A 4ZDJA 3HJRA 3I0ZA 1NF8A 4FOLA 4A5OA 3CVJA 2ZRAA 4GMXA 1MW8X 3FTEA 1MQ8B 1ZS9A 1U8CB 3GJYA 3OQPA 1JLMA 2YV4A 3ANXA 4DIUA 1YE3A 3E9DA 3FKSA 2QA5A 2CLCX 3R3YA 3VAZA 5CCEA 1U31A 1E4OA 4O02B 2MMCA 1NONA 2DC1A 1R3DA 5FUQA 3W7VA 1U7OA 4V0KA 5CVJA 6ADHA 2PR7A 4IIYA 4OEHA 1SZPA 2YWRA 2JLVA 5EZYF 2OHOA 3P4YA 1R0YA 4PO8A 3UUGA 1NQXA 1SHJA 2R2AA 2EU8A 4IWXA 4ZGBA 1E96A 3F4KA 2JGRA 2D2XA 3NHAA 2WV9A 1BHSA 4DG8A 5A0TA 4AJ1A 3U44A 2VPQA 3GRAA 2PUWA 4ZK6A 1VMIA 4E21A 4GXNA 2AZDA 4CR7A 3L3BA 1QG4A 2R6JA 4BDSA 4F06A 1W30A 1QH8B 2ST1A 4FC6A 4TYPA 3S70A 3KB1A 3N7AA 4QTUB 4CGZA 2IHKA 4ZCLA 3TN7A 1S89A 4LGYA 4UUPA 1S9DA 2FX5A 4OQZA 5C31A 1T6ZA 5TGZA 5AESA 1Y6RA 1FJGB 3C7TA 3HTXA 2WE7A 2JA1A 4W9NA 2AYZA 1XZEA 5A62A 1DINA 2FPPA 3LUHA 2RSLA 1UM9B 2N0SA 2C92A 3I01A 3GJTA 4XDYA 1YMUA 4CM3A 5LVAA 3JQ7B 4EYEA 2WWIA 1VE7A 4ZVTA 3FG9A 4RFSB 2OQIA 2PM8A 3NRCA 2CMKA 4ZV9A 4NOJA 3WB9A 2PZGA 3EK2A 2CV2A 2O4CA 4IW3B 4B2PA 5BV7A 1QFXA 2GZ1A 1JHYA 1JVNA 3DZDA 1AQ6A 3N5KA 2J31A 4U5QA 5LZ8A 4HGNA 3WLTA 3ZDBA 1M0TA 4BATA 2JFBA 3OHPA 3PC6A 4W63A 5CIQA 3GMSA 4I55B 2VZ9A 1TQ8A 4LDZA 1XA4A 1DAHA 2O2CA 2EDCA 3BMQB 5DIZA 2VZEA 3Q7QA 1F0KA 4FZJA 3I34X 3HQ4O 4M60A 1P73A 2INGX 1V2HE 5K5EA 1XWWA 1HC7A 1EFPA 1HTBA 1VP9A 1NVXQ 3KK0A 3OQIA 3QELA 4RDIA 5HF9A 1O89A 3B3AA 4BNUA 1U2RA 3SF8A 3W5HA 1PJLA 3OPYB 1S2MA 5I47A 3U4QA 2DHDA 3PHLA 3WXMA 4JIMA 3K1TA 1C80A 1O96B 1Y3HA 2IYZA 5KSWB 2DPXA 1W36B 1XSEA 5CA1F 3NC1C 3PUHA 3F7NA 4IPTA 3U4AA 1IUNA 2C83A 4M53A 4NAHA 3CLRD 2ZAYA 1JHRA 3EXHC 4QREA 2BUBA 5DGHA 2VJPA 4S1TA 3SHQA 1WQ4A 3I09A 4M9QA 3OE1A 3DGEC 1MF7A 4NFSA 4O1HA 1OH6A 1FXUA 2CNWA 1OKKD 3QPCA 4NATA 8AT1A 4D98A 4DQXA 3IUEA 3ID6C 3A32A 3NBZC 2NU7B 2C4TA 3TRIA 3P0RA 2HMAA 4I8IA 1G2QA 4YR7A 2HA5A 4RVCA 3AJRA 1C1DA 1Y1SA 4YRDA 1WZIA 3KTDA 5DMXA 2G8NA 3D8HA 4RENA 2XGOA 4Q9HA 3FJ1A 5U4XA 3SOZA 2FFAA 3OZDA 5EZQA 2XY4A 1B8PA 1E2LA 2R1VA 1HQYE 1SCUA 2Z04A 3NWPA 3KYIB 1AHHA 4KK3A 3RVLA 4BE9A 4J2TA 1YHZA 1W4BA 1A3CA 2TMYA 4I9HA 2VDJA 2HYDA 5AXDA 4ZCQA 3QVGA 1G8HA 2PDAA 4JLVA 2DAPA 3R9KA 3GFBA 5DX8A 5C81A 1TIKA 4TS1A 2AL7A 4BKRA 3RK1A 8OHMA 3ACDA 3ENVA 1BZYA 3R24A 4JJ8A 2ZRKA 4PVDA 1AUOA 5CX1B 4OXXA 1Y89A 3I6BA 4Q3CA 2O8FB 5IVIA 3G8CA 3ILXA 5LP1A 4ZYYA 3I5MA 1KIAA 4PZZA 1DJPA 4MR7B 3KQTA 3TZ6A 1IH8A 2WVGA 2W43A 5EUBA 1VPEA 3UO8B 4NJEA 2XODA 3RGWS 4BO1A 8ABPA 2AUMA 2G9VA 1XZMA 3GLRA 3KXLA 4KP7A 4QOEA 1S6YA 1DKUA 2W9XA 3NM4A 1L4HA 5AJWA 5I9TA 1XJQA 1HLPA 4OLBA 5E0KB 4CM8A 4JFAA 1H4SA 1Q74A 3E70C 1MRSA 5CIYA 3HJFA 1QV9A 1QUFA 1NPDA 4PM4A 2AXEA 1U65A 1YOVB 3EPLA 4S1VA 1I80A 1QOQB 4HQKA 4YPFA 3UB4A 2LV8A 3DBOB 4O4LF 1CY8A 1X1RA 5JARA 3HDTA 1CZUA 4M1MA 1ORHA 2V6GA 2OORC 5DCLA 1YQUA 4KKXB 1V6CA 1ZSYA 2COUA 3G2PA 5JS1A 2GMWA 1D2AA 3HRKA 3K9LA 5D6NA 5M04A 3W3AA 3VDQA 2R8YA 1ZGAA 1YCGA 3BDAA 4Z1MA 2GHTA 1JIIA 1NATA 5LPNA 1HETA 2HH9A 1DKRA 1X38A 2P40A 4INJA 3RJMA 3WNZA 4EOGA 2DRIA 5C52B 2IH2A 1O0BA 3C7DB 1HDEA 4UBJA 3QEKA 1RQNA 4W5JA 4EABA 5GY7A 5KTKA 3OLYA 3BTUA 4Q4LA 1HG1A 5A6SB 1YHNA 2D0OB 3REFA 4HEJA 2QN2A 4PGGA 5SV2A 2VWGA 3DNPA 3LQ4A 4LRYA 4M9SA 5L6MB 3MINA 2PS0A 1GUFA 3BSYA 4FHGA 4CQLA 5CFZA 1FS4A 1KYIA 3OQNA 3I64A 4XSHA 5I7OA 4I4LA 1QTRA 4DCTA 2Q9UA 3FUCA 5A4AA 1MA0A 3EGIA 1E1QA 1U7TA 1FDWA 2CN1A 3ESXA 4H17A 3RF7A 2LDBA 4CMIB 4IQ8A 4J7CA 1G18A 1XD8A 1MAVA 3H05A 3H4MA 4TMKA 4O3MA 1IWOA 2FPUA 2J7PD 2NVOA 1XRMA 3QE0A 3CF4G 1FYXA 4YQFA 3AB3A 3RJZA 3CM0A 3JQDA 1J4AA 4RHUA 4O8ZA 5FBWB 2YXDA 3BA6A 4PPGA 4ARBA 4LCEA 1T91A 1VE3A 4RTRA 1VIMA 2D1QA 4RH0A 4HEA6 4UCQA 1ZISA 4DDWA 1OZ0A 5E7QA 5I9MA 5KNCD 3Q5GA 3VDMA 2QIOA 3ASYA 2FKAA 4Q1AA 1M0SA 3TLMA 1ENYA 3RAJA 4MVJE 1UWKA 4IMRA 4BKMA 2ZTLA 1Z29A 3BUSA 1KI3A 2P0EA 1Y3DE 2AR9A 2HJRA 2ONZA 2ZANA 4RS4A 4WKBA 2XCRB 4E08A 2KE5A 3E9RA 4RL4A 1VE5A 2CLFB 4DDHA 4ETMA 1GG5A 2Y2UA 4KPGA 2BFOA 4EW6A 2GRUA 3STWA 1EVIA 5BVGB 2KSQA 5IXJA 2C84A 3F9RA 1EQAA 1N3BA 4UM7A 1W5AA 2HGZA 3A4YA 3H86A 3ZOKA 2ZUUA 3BORA 1JF8A 3HL4A 1E79A 4ZZ3A 3CUEF 1QQAA 3NTQA 1U3TA 4PGHA 1BWRA 2P77A 4IV5A 5FI5A 3RASA 4XJSA 2CZCA 5NLLA 1L7XA 1AB5A 2ARKA 4PCLA 4B9AA 2VP6A 4ZV4A 2J08A 2OWEA 4Y0AA 3UKOA 4ZI7B 2J4FA 3C5HA 4YT4A 1Z0AA 3ESRA 1E5DA 3T5AA 1WHSA 5ILQA 3OIUA 1CUYA 4R9NA 4CLHA 3E23A 1JR2A 3C3YA 2FZEA 3U81A 1Y6ZA 1YZQA 3LXUX 5EJ4A 5HUHA 1YQ9A 2XZPA 3A05A 3KDPA 4CM6A 4UPVA 1I4DD 2WNSA 3SM3A 2IQ5A 5D00A 4IQGA 3VH2A 2RHCA 4QNRA 1PR3A 1PZFA 1D2EA 1I4EB 2VZ0A 2YHAA 2EP5A 3H9EO 3QXJA 5B3AA 5A0FA 3OWHA 3E53A 1FZQA 2V7GA 3OE7A 4PC1A 2FDCA 3N2YA 1P5FA 2DJ5A 2WTAA 4QXMA 1FFGA 1OX4B 4MQUA 4CL2A 2X58A 1HYGA 1HYHA 2NZVG 3JARA 1GQOA 3DZGA 3RREA 3A04A 3GT3A 2VHCA 1ITZA 1KMHA 4IHJF 5C1BA 2VLIA 5K2MA 5BVHA 2QVZX 2A86A 1Z2EA 4CCSA 4D02A 1BMFD 4DLRA 2CVOA 4R41A 1U9IC 3KJFA 3M4XA 3NANA 1NSFA 2HF9A 2QRNA 1TKCA 4NYJR 1H1LA 1XRRA 2VXYA 5H5JA 4DNXA 5BNWA 4YQEA 4MZXA 3BWVA 3UAOA 4CG0A 4WJLA 2EP7A 4YP9A 1KL7A 1RCTE 2VEDA 3BK1A 3CF6R 2GN2A 1LZKA 2J30A 2WJWA 4DLLA 4DQUA 5JSZB 2L42A 1WDWB 1JH9A 4P08A 3REOA 3AK4A 4NOMA 4D9BA 3DVLA 3TJZA 1TFUA 4K7JA 4ZD6A 3GVXA 1BKYA 3AOEC 4LC1A 1NBIA 3EVAA 1MP0A 1BX1A 1GDTA 1SUBA 1TO1E 3KKOA 3ZBUA 4D8XA 2BFWA 2OCGA 2PYIA 3HCBA 1GKLA 1U7ZA 1EE2A 2X1VA 4Y2QA 5CNKA 1BGVA 1TAQA 5DGCA 5HNKA 4RTNA 2L0XA 2VI5A 3G5UA 5IDYA 3TX6A 3TGLA 4NAVA 4N18A 5EXTA 5BXYA 1GY8A 3JW8A 2Z30A 4JN6B 3R7LA 2IH5A 1MC5A 2E4WA 4WV3A 3ST7A 1RDFA 1PX0A 1ISPA 2HT6A 3NWBA 3X1XA 1N6NA 4CMKA 3T5MA 5HILA 5BSKA 1EB8A 1LK5A 1Z83A 3IVRA 5T64A 3A1CA 1X7XB 4P36A 3MCZA 3BXOA 1TCCA 3NVKI 1P9NA 3QMPA 2DBVO 1IQPA 1I01A 2XYGA 3FFXA 3R74A 4EATA 4R2WA 4TKVA 2O8CB 3PA6A 1DKQA 2PWYA 3JXEA 3L0BA 2HRZA 4FCCA 3P2YA 4XD7A 4XW2A 2E48A 3W8FA 5CDGA 1Z45A 2AJTA 1QF9A 4DL9A 5CXUA 4AKHA 2JK1A 4FBMA 4QXAA 4V38A 4L5CA 4DWVA 3C3PA 4ZRMA 1S2OA 4OHOA 4HRAA 3RUPA 3H75A 1FTYA 4U2GA 1Z7GA 4O4JF 1R0KA 4UM5A 1MORA 4MDHA 2PWPA 3GJ4A 3WZLA 2WHEA 2DWCA 3TW8A 4UBLA 4YCBA 5EJMA 5CLIA 1UJ2A 3HY3A 4P4TA 5DJ5A 3MOGA 5CM9C 3UT0A 4D9NA 1IMJA 4CT5A 2OZLB 3NP9A 1TXGA 3GFQA 4IFEA 4D9KA 4DMRA 4MQEA 1SVOA 4MYHA 3AIOA 5CR9A 3ULKA 3WLFA 1V1RA 5JBNA 1OHHA 4XYGA 1JDJA 1JPVA 2GPBA 1D1PA 1CUVA 3E8SA 3FCAA 4MS1A 5JPCA 3MAAC 3IAXA 1CD5A 1ORIA 3A0UA 4O2AB 2PSSA 3G9UA 4C4SA 1V11B 4MWOA 3QKSA 4CKEB 3UQZA 2ZRPA 3OZAA 4YV0A 2ADOA 1CJMA 1IATA 1N2HA 1CNFA 2AMFA 2F59A 4FHZA 4IH9A 4LBZA 3L4BA 4G8DA 4OFZA 4CLOA 4LS3A 4XWYA 4B9EA 4Z49A 2G7MC 2BH2A 4Q1EA 3ZK8A 2XUFA 4NFLA 3AGQA 1WF3A 2VNHA 3ZUGA 1YR1A 4U7GA 3U1BA 3JQ6A 3RS2A 2WP8J 1GU7A 4M49A 1HE1C 4KVZA 4RY0A 3W9YA 2V8BA 5IBCA 5LJIA 3GHYA 1A9YA 2C0PA 1QGOA 2I87A 2PVSA 3EOAI 3QWHA 4I1RA 4IJVA 2QB5A 5DP2A 4YYEA 1YZYA 5DK4A 1A7AA 2Q41A 2B92A 1F0PA 4GPZA 1YJCA 3PNOA 4QYIA 4UU7A 2CLSA 3BJRA 4XUCA 4PLZA 5ALJA 1WLSA 2R85A 5ESWA 5H3CA 3RUAA 1OB2A 2WTMA 3AM1A 4JJ6A 5TMBA 1I14A 2MYPA 3LUJA 3ONWA 3T7KA 4KQXA 2PZBA 2A5LA 1NVVR 4I5FA 3B3QA 4PQRA 4U0JA 1EJ2A 3VPDA 4ESHA 1BU8A 1O6ZA 1XALA 2JANA 1TPYA 4M8NE 2BFBA 1MEJA 1ZHFA 2BJWA 2H54A 5KC9A 5DNYB 3WDKA 2BFEA 1MO6A 4F2GA 3HXOA 1W4RA 1TVEA 3GZ4A 4NBRA 1T3LA 4RZHA 5BNFA 4IKOA 3BXHA 2IDZA 1XAGA 4WXYB 4OK3A 2E21A 3LIPA 5KYYA 2WPDA 1FMFA 1C8VB 2JC3A 2JKYA 2W6CX 4KXYA 5J47A 4P3XA 4PYOA 4P7KA 1XPJA 4X6UA 1JFFA 1PTJA 3OECA 1K97A 1LTQA 2W11A 2NUAA 5K2OA 4I1YA 2EWVA 2PT6A 2ORVA 1HF3A 1S8AA 2XQVA 4MQ6A 3R09A 4HS9A 2Z2ZA 1NUTA 1MABB 3SQOA 1OBCA 4JDUA 1MABA 1VPTA 1E3EA 1U3UA 1O94A 4IM7A 4BWVA 5EJ8A 5I7VA 5K0ZA 1ST2A 1SGWA 5LMZA 2XKJE 3DE7X 1CF4A 1FRFS 4DEYA 2IXDA 3EXEB 3OKFA 2VSYA 5EJ6A 5I5EA 2PT9A 2XNHA 3T1YB 4Y2RA 3T3IA 1V5WA 1DEOA 3O0TA 2P65A 3NYIA 4X8MA 4L9SA 4ZARA 1QO7A 4Q1CA 3EULA 1OXUA 3DMDA 2VBIA 2FZGA 4EPVA 3S2GA 3DDOA 2GN6A 4OHVA 1XLTC 1Y48E 2GDJA 2X40A 3BWBA 1RCFA 1JVBA 4AMZA 1Z63A 4P3YA 2GETA 3DEFA 1CXZA 1U2GC 1OWPA 2JIZD 1QLHA 3ETLA 4G23A 1DC3A 3KEMA 3UHPA 1OY1A 1AK1A 3WNCA 4BMYA 5K01A 4C5BA 5D5QA 4AX4A 2RK3A 4AKIA 1DELA 4OM7A 2XSZA 5JXJA 1E9VA 2G1UA 2FMHA 3CNNA 2WSYB 4LGVA 1P61B 2ZDHA 3VYVA 1XMSA 1TC2A 3AFHA 2OD2A 2PL3A 4BXOB 3O91A 5DNWA 5JZOA 1KDTA 1EUDA 4A8HA 4TX1A 2IHBA 2PMFA 2PAFA 1PG2A 3A25A 5EP4A 2AMLA 2C57A 3KSZO 3MBKA 2FEXA 1U4OA 3DONA 4BAZA 1NUUA 2QVBA 3JAWA 1EDBA 1I3KA 1Z6ZA 2B36A 4KE6A 1DCKA 3CZ4A 1MNAA 3HM2A 4PPFA 5EIBD 5EXEA 3NBAA 4F3YA 3GNQA 4CF7A 3OKCA 2FSSA 3ND8A 3OVMA 2WSMA 4EY7A 1QFMA 1XKTA 4MV1A 4X62B 1E58A 2XITA 2J09A 3GJ0A 4IXMA 4NULA 2XVMA 3NH6A 1VA5A 1OXBB 3GRPA 3IGFA 1IN7A 4OAOA 5EUQB 3OKAA 1CU1A 3PFNA 4BEJA 1EBUA 4JGIA 4AJJA 2V0NA 1ICEA 3E35A 5HTOA 1VJ5A 3IMGA 4MYCA 5JNRA 1L4KA 2JLRA 2O07A 3KFLA 3IOMA 2ZJOA 1WP4A 1Y9EA 3NJRA 5E1BA 4RTQA 5I4CA 1SAYA 2AZMA 2UYQA 3UWSA 4YRRA 6YASA 4H6PA 3CJTA 5GMOA 3SMQA 3VOTA 3FUXA 1X7GA 2BFNA 2PV7A 2E1PA 3T7JA 3UV7A 1MEOA 1Z37A 2H3EA 4G0XA 4KLAA 1B73A 4OG2A 2QRUA 2UZ3A 3CN9A 1UF9A 1WXQA 2ENUA 3Q7RA 1L7VC 3RWBA 4BV8A 3RRZA 3JD0A 4RSMA 2BEVA 3L8YA 4CCWA 4I50F 2AEMA 1OXMA 1R5NA 1TK3A 3PQEA 4FSXA 4PW0A 1ONSA 5F1YA 3V8MA 5LOVF 4M37A 3DDHA 3DTNA 4LRSB 3IODA 2VT6A 2FZWA 1NDQA 2XUQA 4YQYA 5ARDA 1JBKA 5K8TA 1ULAA 3LY7A 2FW8A 4BNDB 3X1JA 4S12A 4Z0NA 3WK4A 3MHTA 1KQOA 1X9GA 4NONA 4OHUA 5FHRA 1UMCA 3W9UA 4B6EA 4BZWA 2DECA 3LNCA 3H0KA 3NW9A 3CCCA 1Z73A 1BE6A 2VTBB 1L1RA 2O14A 5KPDA 4QX6A 3HXMA 4I9NA 1Y8CA 4C3VA 1CP2A 3D0KA 4EAQA 4Q3NA 5IRCD 3CR3C 4X95A 2B2CA 1ECJA 1LGYA 3A2NA 2JDIA 4C76A 1AKVA 3GJ8A 4BLQA 1YIAA 4BVGA 1XTSA 3BKXA 1FMCA 3QX7A 2PK3A 2NPIA 4JB8A 4LY0A 5JTUA 5CGQB 3TBFA 2EP8A 3CF4A 4CEJA 3RVJA 5F77A 5L3QA 3ZEIA 3RSSA 1MVOA 5KX5A 4E2ZA 4KX5A 5CVDA 5TQ0A 3IEMA 1OFHA 2GEJA 1JHQA 1YNSA 5JH7B 4RFSA 1U11A 4PAQA 1U6IA 5FPSA 2ZR8A 4DWWA 2EZ4A 4LYAA 4ZVPA 4JA2A 5GM2A 5TF4A 4AO8A 2W83A 4XIGS 4C22A 2HHAA 2YNMC 1QVRA 5KDLA 4M54A 4WOBA 5I4KA 1LWNA 5LD2B 4P0PB 1TYZA 2RAUA 3I30X 2IYWA 3MMXA 4P4NA 5DB4A 4B47A 4EKNB 1DAEA 3FW1A 1AHIA 4ISCA 3I01M 3QXGA 4HDNB 2E4YA 1Z0IA 4Z8XA 1N5OX 1YZTA 3MBOA 4HB4A 3IAUA 3FGPA 3W9SA 2YIJA 2C8JA 4A15A 1EG2A 1MD9A 1PR4A 3VOBA 4DA9A 1K7YA 2QL5A 1AO0A 2BF7A 2Q1WA 3EDQA 1VRVA 1ZM2A 4Z7OB 1Z4IA 4PBTA 4C0BA 2D7CA 3CH4B 3RHZA 3BWCA 3Q8WA 3WFJA 1ZA2A 4JXJA 3KL4A 4KO1S 3PENA 1BS1A 4Z2YA 5C80A 2XBMA 1M2WA 5EHXA 3CZMA 3EG5A 3Q8KA 2C5HA 4NJOA 4PPYA 1VCHA 5EJIA 3BMOA 1SCQA 3S1AB 1MC8A 5AJUA 1RHKA 2G28A 4W7SA 1DQPA 1WZCA 3WGMA 4CLXA 6CHYA 1K75A 1MQAA 1EXNA 1U1IA 3DB2A 3FSRA 4G6ZA 4BFXA 2Q5FA 4OBBA 2CB9A 4CQJA 1HDOA 2Y0EA 4NKRA 1TTHA 3HEAA 3RRYA 3W34A 2VT7A 1M0EA 1V3QE 3S7TA 3T4EA 1WVGA 3U4IA 1WHSB 2FWAA 3OLQA 4LJ5A 5DXFA 3ZDXB 3GT0A 3KEGA 4K05A 1X80B 4P93A 1KYQA 5CFMA 4YJGA 3Q7EA 4RKQA 4FDMA 2YCBA 3UANA 4O4IA 4ECAA 3B52X 1YTUA 5BV2P 1U7XA 3P71T 3AEXA 3FWPA 1Y4UA 1W87A 3IUBA 4YLEA 2D1YA 3E8XA 3RHTA 3T3NA 4OOEA 4MKZA 2VXOA 2FCRA 1SJ9A 2QM7A 3N8NA 5KQRA 1BXZA 3L0OA 3EA5A 4AB1A 3OC0A 1RJEA 1JDUA 4I1SA 5CA1A 4JR1A 2XKBA 3IMEA 1PFWA 3K6KA 3JX9A 5FXMA 5IH3A 4XYBA 1C4XA 1GTL1 2X9GA 5LC1A 3V34A 5JQWA 5K8VA 3ZZTA 3OQMA 1YRHA 1EFVB 3OBIA 4MJLA 1XL0A 1SELA 4PFSA 4DKJA 5ALYA 1PJ3A 1DRVA 4Q3AA 3LKVA 4IR7A 4HEA1 1PZXA 1TAHA 4HR7A 4MP3A 2GJKA 4KXXA 3RRFA 2JFQA 2D2IA 2OHHA 3DXXA 4IFTA 4K9NA 4MQMA 3ZWWA 5IU6A 3A1NA 1XDUA 3IKMB 1R15A 3N3BC 4Y0VA 2V7UA 2IHYA 3GK3A 3QG5A 3D6JA 1X15A 2PUFA 2GYUA 3H9BA 1CFJA 4R3UC 1I3LA 5KOIA 1M54A 3AR2A 3IHWA 3UJAA 1K88A 3TW4A 3LOQA 1I0ZA 4RAOA 4OJTA 5ECYA 2MR5A 1PDWA 3AB8A 1LTHR 1H1DA 5EE3A 3RS5A 2FF7A 3OEHD 1XZNA 1T3TA 1NOJA 2DJIA 3IKLA 2UKDA 3IX7A 3U61B 5IK2D 1HNWB 4EFLA 4B5LA 2JLCA 1QNLA 4UPDA 2CCKA 1B8UA 4HG2A 5AIAA 4GM4A 3BEOA 4IMJB 1OROA 4DR3B 2FLVA 3FYSA 3WAJA 4LHSA 2JB9A 2XXAA 1KZ6A 1U0FA 4W4TA 1ZD9A 1PW5A 1BHO1 1R9MA 2XMGA 3OZGA 4LEIA 3V2GA 1NF9A 1U0NA 2XI4A 1J5PA 2ZRDA 4NV0A 2JGDA 5JR3A 1KH1A 1GIAA 4QULA 5AKZA 4URVR 2H1VA 1NULA 1BS9A 2FZ5A 3DV2A 2GJSA 4NU6A 5JZ9A 4UEKA 2GJAA 1WJGA 3DZFA 4QAQA 2YYZA 5FQOA 4NICA 1RM3A 2KHZA 3LMKA 2D59A 1GGKA 4PNEA 3MWDB 5GVSA 3WLRA 1R8YA 1L5FA 2BTQB 2IZ6A 3IOYA 4ZOLA 1MAWA 5DGTA 4TQGA 3FF4A 3RVSA 3SKYA 3RFFA 1YJXA 4Q0MA 4ARUA 2VKTA 3EQ9A 4EKGA 4LUCA 5K0EA 4QNNA 1J9ZA 3DL4A 3RPEA 4G84A 3PX7A 1YJAA 2I2FA 2PJZA 1FS5A 3Q2KA 5FKJA 2PNFA 3P52A 1QM5A 2TECE 1RRFA 2BGTA 3M49A 2EW1A 4B75A 5DBIA 2WU0A 4CNQA 2G9UA 3CH7A 3P2EA 3F8SA 2VYND 2H00A 1XYGA 3PC8A 4U3JA 3ZDEA 4BQEA 1URPA 2G72A 5D51S 3U3DA 2F67A 1AHNA 4CODB 2A0XA 1U5BA 1NXPA 2I8AA 4HAZA 5TMDA 1H2YA 4HT3B 1PE0A 1P6UA 2IIPA 2XXJA 1M2JA 3CZAA 2VPTA 3ZGOA 1XHLA 3QG1A 1HQCA 3EDMA 2H07A 5HK8A 5I4IA 4XR4A 2B1RA 2OAQ1 4GFDA 4MUMA 1IBLB 4XFDA 3OTHA 4LXTA 1EX9A 4MW7A 4HTFB 2OQRA 3Q9LA 5EEGA 3SSMA 3U60B 4V0LA 2I6SA 1OMOA 5TVGA 1GEGA 4C6TA 4TGLA 2EKDA 4FE4A 1D8AA 3ZD8A 3QOXA 4KN6A 1QRRA 4J0JA 2QAIA 1WAMA 1XWFA 5E9AA 4OHFA 3KZKA 1UOEA 2CJWA 1P5HA 1E62A 4AJ9A 4C7BA 1YIOA 1YV9A 4J2HA 1ISRA 3O1LA 4ENUA 2B35A 3PF8A 5T6BA 3T1OA 2H1CA 3PRKE 5LMUB 4BPBA 3GNTA 3HO6A 4PQGA 5C2JB 1V6AA 4CHTA 1QQBA 4C05A 1Q91A 1PQ4A 1DAKA 2CBZA 3NBFA 2JBHA 3UA4A 5BV0A 3ET5A 4B2YA 2Q6VA 3IQIX 2CGEA 1OF1A 3F67A 1FVFA 2H2FA 3TI9A 1KJWA 4B2LA 4YUYA 5AVQA 4ZMBA 2ID9A 2HEGA 1KPGA 4LZNA 5HX7A 5CDSA 5K6AA 3O2QB 1F6BA 3I58A 3QITA 4CMIA 1NUQA 4N03A 4TS4A 2Z5FA 4QXOA 1ZD1A 5CUQA 5DKFA 1PL8A 3EZ6A 4JNCA 2V3WA 2O6LA 1CZOA 3NJ8A 3I23A 2ZPAA 3ZJVA 1AQUA 2J7KA 3VPGA 1USUA 2RARA 2XF2A 4YNBA 3TOXA 2XRFA 1H2RS 1OFUX 3SJUA 3L7KA 1H3EA 1Y5RA 3OU7A 1HKHA 4DLYA 4Q18A 1NLUA 3SHOA 2W6JD 5JYBA 1Q95A 2W8BB 2RB5A 2A59A 3NGMA 2V58A 2ATCA 1KS2A 3FWYA 1NQ5A 3PNMA 1UJ6A 1DRWA 1NRWA 2E18A 1ATZA 3HFGA 5DNEA 1JAYA 2NV2B 2ONKA 2QI9C 3TH5A 3V3TA 3VYSB 5KNCH 5FCDA 2ACWA 2AN9A 5KINB 1TQ6A 1R10A 3ZHRA 1PT5A 2PS9A 1PEKE 2PTHA 3C3KA 3IJPA 4K6FA 4PXSA 4WY8A 3W1VA 3GR6A 1SXJA 5AJYA 1RZ3A 2ODNA 3EXIA 3MQ2A 1FXWA 1A4UA 1FQWA 1U0OC 1A4IA 2BI7A 2QRKA 2WSSA 2J0UA 4Q7LA 3K0EA 5H3HA 3KOWA 3TIIA 5BN3B 2ZCUA 3N2GA 5KU7A 3IKVA 4QTXA 2ZPTX 5ER6A 3UV3A 4GEKA 3O7MA 1FUIA 3HY6A 1JSLA 2LE0A 2P9JA 5AKYA 1VGRA 2YXLA 2ZBFA 2XA2A 2XRMA 4ILKA 5H1YA 4A8JB 5BSVA 3KTOA 3L93A 5ADHA 1POWA 4HHEA 5IAKA 2D2EA 4RV5A 3LAWA 2ZYHA 1JKXA 3SZGA 3BC1A 5IULC 2MCFA 3I53A 4MQBA 1V96A 2I8CA 1RI2A 2YXBA 2IV3A 3T35A 1VLVA 4JP5A 4UUNA 4WXEA 3GF4A 1B8OA 4RETA 2EFJA 3UH0A 3WJ7A 3CH6A 3G8BA 4HVTA 5KOHA 4WRRA 3VSDA 1IXYA 3H5OA 4PBRA 2EJVA 2Q49A 1C0PA 1V5FA 1XZAA 2B2NA 5CH3A 2FKNA 1KYZA 2XDWA 2WD7B 1XTZA 3JPYA 3LU1A 3RG2A 1T0PA 4M9CA 5GTDA 4F8JA 2I6QA 1UT5A 3PPYA 3KSAC 2UZ1A 1EIWA 1JG7A 3KUXA 4KWIA 4B31A 4BLOA 5E3JA 3JQRA 1ORRA 1RC8A 1MB9A 5AP9A 3WYAA 4FIDA 3EZLA 1QU2A 2BSXA 3KCNA 2G70A 1WVMA 3L0ZA 3DD5A 2QRGA 3A1DA 5J4HA 2A1UA 4O2BF 3RTGA 3VPFA 1E66A 1W59A 5JQGA 1SC3A 2AQHA 3K1ZA 3IIEA 1T36A 4UU8A 3R76A 3RYFA 1DKNA 2VRNA 1W5SA 3O9VA 5CA0F 3J81k 3QE3A 4FW8A 2NUTB 3KJGA 1CY7A 4WFQA 3RC8A 2IYOA 2FRDA 2DQZA 5EEHA 1JU3A 2YUIA 1WXDA 2Q1TA 1FYWA 3F5DA 1TTTA 3PRJA 4BQRA 1SCAA 5BT9A 2HAEA 1WKVA 3GA7A 3PGVA 1ES9A 3PEFA 2XUGA 4JQSA 4F2WA 1AHPA 4X60A 3I8XA 3DH0A 2ZAGA 2RGBA 5T4HA 1PFQA 4CM9D 4EWLA 1IWPB 1Y4AE 4E1BA 2QTLA 3Q3GE 4TROA 3LHFA 4WESA 4Q7QA 1MOPA 3PE3A 4F92B 3QLTA 5CCXA 2PKYX 1T8WA 5LSAA 1ELOA 1M5TA 3F5MA 2Q7OE 2NSDA 5EI5A 3WRXC 2UVPA 1IY0A 3BJMA 4OBEA 4JWKA 4HD8A 4KFRA 2DQYA 2E5WA 2OO5C 2VDWA 3H11B 4URFA 5FIUA 1OHHD 3NR2A 1Q5PA 4JHXA 5EE9A 3SKVA 5IF3A 4N49A 5LYJA 5CVTA 1TMOA 1W0KD 3FCUB 5HG0A 3D2AA 1II9A 2DUJA 1OA0A 4K6HA 2JRCA 1TT7A 4Q82A 2XQGA 1GPWB 1YRWA 1ZZEA 4JB0A 4RSRA 5G40A 1AC5A 3PT9A 4TXHA 2IEDA 3NOXA 4HGZA 4PU0A 3CX4A 1FCJA 2P6MA 3EIHA 3QKRB 3VJMA 1LB1B 1HNZB 4HFNA 5J40A 2IW3A 1MUUA 1G291 3OFKA 3OA0A 1PHPA 3A3NA 1RXSA 3E03A 3FIJA 3K05A 3RARA 3IUYA 3S2ZA 1B0UA 5J23A 3IT1A 1RI4A 4OIFA 4P82A 5HFAA 3B7WA 1MQSA 2X9NA 4P58A 3T52A 2C8LA 5JMOA 4WCDA 3Q0EA 1I6MA 1D6MA 2XUAA 5H80A 1KKLA 2YWFA 1QFJA 3OF5A 3DXYA 3VBCA 1TNDA 2VJMB 4WNCA 3BHMA 5IHPA 3LHDA 4G5YA 1TQHA 2JAQA 2YY5A 1UBKS 3R3ZA 4EHAA 4RY9A 5JJIA 2WTEA 3QE9Y 2R6DA 4JODA 3WZ2A 5KREA 1QE3A 1V0JA 2HCBA 2DHEA 1T2FA 1M10A 2Q3MA 2QYHA 4L76A 1ECPA 2JIDA 2FQ1A 3NAZA 5DX1A 3RS8A 4C4XA 1NDUA 5E4TA 1QB8A 4ENVA 2JAPA 1WL8A 4RWZA 5DNVA 2VQFB 4X66B 1U8AA 2WP0A 2YZNA 3KAKA 4Y6LA 3ZHVA 4HY3A 4GZLA 5JSHA 2UU9B 5HKKA 4OK6A 1ZN8A 4G9BA 1WW8A 2C3PA 4JEHA 1B3RA 1D8TA 1MTZA 2J85A 7AT1A 1EXWA 4YRPA 3C41J 3M6MD 3QUSA 3CSSA 4O5OA 1PBTA 1WXFA 3CUTA 3DAOA 3QKUA 4H1TA 1BFDA 4K6KA 4LZLA 1NHGA 3LM8A 1TIPA 1PT7A 4KODA 1IJKA 4LBYA 5F7ZA 3TZEA 5B3LA 4TTVA 4UMEA 4AY4A 3BXZA 1PR0A 4OFBA 3AI2A 1H6DA 4NXMB 5KWEA 2HI0A 2IE8A 3QSGA 5GGYA 5ICEA 5KVVA 4IWNA 3AM3A 3U9SA 4A6PA 2E87A 4QELA 3M6FA 5KO2A 1DIOB 2ZREA 1GITA 5KNDH 4UFOA 3D6VA 4GBED 5U9CA 5JWRA 3MINB 4GIBA 2MDTA 4TTTS 2HJSA 3M1LA 4KZPA 2DEUA 1CUJA 4FFNA 2J6CA 5CDFA 4U8GA 1OFVA 2IUEA 3MG9A 2ABWA 2AG5A 1OTXA 5B7PA 4EMBA 3PR1A 1B0ZA 4MKXA 4ALKA 3A8TA 2WTUA 4YXFA 3ZV6A 4YT5A 4FT2A 1PGJA 3IILA 5DM4A 4LE1A 2CB0A 2OBYA 4BRUA 2A5JA 1SULA 3MA0A 4PGAA 1ZN7A 2DTXA 3IR7A 3Q3CA 1K8XB 4Q1FA 5B12A 3NMUF 1VL6A 5HDQA 1JN0A 1NMZA 5CLFA 4A23A 1X13A 3MWDA 4DQDA 5AK0A 4FQ8A 1ZD3A 1G8AA 4NBUA 4GPAA 4N47A 2D7JA 1FRNA 4OQEA 4BMXA 3CNEA 3R1IA 4Q3KA 1QS0B 2NSJA 4MIOA 4D97A 1BYIA 1RLOA 3GMDA 2Z95A 4TTSA 1ECFA 5CA0A 2YJ5A 4EEZA 1M34E 1NFRA 3D43A 5K0LA 2F8SA 3LBFA 2W48A 2JLWA 4RF4A 1R0BA 5TX7A 4HTFA 1QVAA 3T5TA 2Z6VA 5AW4A 3Q9NA 4AP6A 1FRVA 4ZGWA 1X3LA 1R5JA 1DE0A 1NPTO 1ESEA 2R44A 2AXPA 3KYDB 3PFFA 4KQIA 4BVJA 1VPWA 4NBKA 2C3MA 3EZ2A 4JI5B 1FLNA 3OZCA 4P4UA 2CD9A 2O0HA 3FCXA