3QEOA

S74e-r104m-d133a dck variant in complex with l-deoxythymidine and udp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
242
structure length
234
Chain Sequence
b'TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVELTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSMIRAQLASLNGKLKDAEKPVLFFERSVYSARYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Post-translational phosphorylation of serine 74 of human deoxycytidine kinase favors the enzyme adopting the open conformation making it competent for nucleoside binding and release.
pubmed doi rcsb
molecule keywords Deoxycytidine kinase
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 234
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qeoA00
3KUCA 4AYWA 1DAIA 1X8LA 4YMUA 1OV4A 4MGZR 2NOAA 2YWGA 2XITA 1NNEA 5E7IA 2NO1A 4LZZA 1KI7A 2IYVA 4FCWA 2GNOA 2FPLA 3CNOA 4IDNA 3L0SA 4GMXA 4GFDA 1E2GA 4B73A 2O52A 3BH0A 2RGBA 3B9PA 1TMKA 2RHMA 3VR4A 1JR3A 2FSHA 2R6CA 4ZKEA 4DKXA 4CF7A 2FZ4A 4QHYA 3GQBA 1U8ZA 3GJ3A 521PA 4BECA 3V00A 5KSOA 4C0BA 1OFTA 1NMYA 3CZQA 4TQUS 3THYA 1NP6A 4Q5IA 3A4MA 5E4FA 1KJWA 4C0QC 3EZ9A 2BBOA 4NKRA 4EFNA 5E7MA 1Y63A 2PH1A 1TF2A 1GL7A 2RAPA 3I8XA 3UWOA 2VSXA 3W34A 4C3ZA 3M6AA 2JDIA 2ZEJA 4A92A 4D0GA 3VR2A 1XD9A 3TE6A 1SXJB 4BFTA 3U4QA 4QHTA 3REFA 2JLXA 4HEJA 3R9WA 5C4GB 5AR1A 3PR1A 2VEDA 2GA8A 2XTMA 1G1MA 2G3YA 3SHWA 1K6MA 3E2IA 1OFIA 4PO1A 2BCJQ 2GAOA 5JWHA 4ZIRB 4MUBA 4BZXA 2W6JD 3C4JA 1E0JA 4WBSA 2XAUA 1P72A 3T1QA 3PCRB 2PT7A 3CW2A 4EKDA 5CK5A 1Z83A 4YC7A 2RGXA 1MT0A 4XOIA 2FFBA 4X8MA 1X6VA 2IYZA 2JLWA 1ESNA 1O87A 2QGNA 5EE3A 2EWWA 1MV5A 2AK3A 3OEEA 4BASA 1W5TA 3CBQA 1U98A 2ZPTX 3FMOB 1E9RA 2OFXA 4BZPA 4HLDA 1IY2A 3WXMA 4Q1FA 4B47A 3SFVA 2ZRKA 1UM8A 4M1SA 5ELXA 4FMCB 5H1YA 1KI6B 4AG6A 4RD0A 5LDDC 2A2ZA 2P6RA 2ODBA 2ORWA 3GLIB 2D3WA 3RRZA 3K0CC 2PZGA 5FOWA 3SYLA 3NKVA 2O0JA 3MRSA 2WMOB 4MGYR 2RGNC 1R6BX 2YZ2A 3B1YA 2X2EA 4WZ6A 5G3YA 2X19A 3AUXA 4NZYA 2CBZA 3CB4A 2FZLA 1QHYA 2ZRFA 3WHKA 2XZPA 4LWZA 3BB4A 2QPAA 3NHBA 2CLDX 1PLLA 4PR0A 4V0MA 2W83A 3PUZA 3HP1A 4CW7A 2DY1A 1EXMA 2W6IA 4LDJA 3K0CA 3H2YA 1HYQA 2ZRAA 1J90A 1NVVQ 3C14C 1QVRA 3T61A 4E07A 5BQ5A 4K46A 4TTQA 3QKSA 5AWFC 2EYUA 4RZ3A 2V6JA 4TLBA 2Z83A 2VF7A 3DKPA 3UPUA 1E96A 2I4IA 5AUOB 1DAHA 1T5IA 5JECA 5GJWC 3THWB 3U44B 4A2QA 3ETLA 4GZLA 4OBEA 1F48A 5FOVA 1NBME 2ZUCA 3GLGE 1HURA 2XSZD 3KKPA 2P0EA 4P0TA 1GM5A 1G17A 3KQHA 5JZVA 5DHFA 3OIUA 1UKZA 2CNWD 5FOTA 5JJLA 4A82A 1EFTA 5DN6A 1VIYA 2NIPA 4PZZA 2QMEA 2VSFA 4JKIA 4L5BA 1J8MF 3IBYA 4MYUA 1AKYA 3GJ5A 1R0ZA 2QENA 4TT3A 1OIVA 3P1JA 3GEIA 2AR7A 3RVBA 2FGJA 1P60A 1WXQA 4JBYA 3ZD7A 4MDEA 1Q57A 4MRPA 1C1YA 3W6OA 4JSYA 2CLSA 2CJWB 4QGAA 2I1QA 2UVQA 2YWHA 5J4YA 4D4KA 5DISB 2C03A 3AEZA 4JIMA 3W5JA 3W8RA 1RVDA 2QRNA 2YJTD 3CR8A 4D80A 2Z6VA 2WZQA 4DDUA 5EXSA 1KY2A 4BUJA 5SZJA 1SKQA 1BH2A 5HE8A 1TNDA 2ZE7A 1WQ1R 3EARA 1IAQA 1ZAKA 2BJWA 2C9OA 3ADDA 2FEOA 4XD7A 4JLVA 2GTPA 3QEOA 2JIZD 1UKEA 1U9IA 3WHLA 4ZDJA 3CRMA 2AD1A 2F43A 2ZRJA 1ETUA 3Q3JB 4LV6A 2GRJA 5FPYA 4DC9A 2CVFA 2FFHA 1P2TA 4LBYA 5CJPA 2W00A 2CL6X 3HYTA 2ZVPX 4OI1A 3THYB 2WWFA 3RS2A 2F9MA 2W58A 2XJ4A 2O8DA 3BERA 1SVMA 3CRVA 2V55B 3K0FA 3QY0A 3X1WA 2P6UA 2W0SA 3K53A 4GNKA 2DFTA 1E3MA 3GLFE 2KJQA 3J81k 1T9HA 5FPHA 4M8NE 1J7KA 1T0HB 4I1UA 2A5YB 1BOFA 2Q9CA 2RHDA 1K5GA 4G01B 3U4QB 2OE2A 1QDEA 4N1AA 4BFXA 2YNMA 4EDHA 5L3QA 3K0SA 2WV9A 1JXMA 4GP7A 3QVUA 5JS7A 3F0TA 4LYHA 4LGMA 2D7CA 1LS1A 1Q22A 1KDTA 5TVKA 1AS2A 2GXAA 5JFGA 1N6NA 4CEJB 5DI3A 5DNYB 2H92A 3K9GA 4JVMA 4TL8A 2RGAA 2QPOA 4YMVA 2C95A 1N6PA 1NMZA 4HAZA 4TL9A 1J8YF 5D3QA 4IJMA 1KI2A 5G40A 5TV2A 2ZJ2A 4BFSA 3EAQA 4M1WA 4MKIA 4XWAA 4B44A 2J46A 1F2TA 4Q4JB 2JA1A 3U6BA 3K9HA 2WM9B 1KZ7B 2V4ZA 1ZUIA 1KYIA 1E0SA 1VCNA 2CK3A 3CLVA 5FUWA 1U0HC 2ZETA 4OQFA 2AL7A 4ON9A 4A6PA 4DCVA 3ASYA 1COWD 4LHYA 2W2TA 3OFND 3LWNA 2EFHB 3VNUA 3ADCA 1VYUA 4KCGA 4PZLA 3U2QA 4U02A 3RWMB 4F4CA 4P4TA 4A36A 3FYHA 4KSCA 2DWOA 4KBGA 5B58C 1CR4A 5BW8A 1AJEA 2K5UA 1WMSA 2MSEB 4JZKA 3RWOA 5HZKA 4W9MC 2E9SA 3N70A 3THOA 2YV5A 3CRRA 3QKRA 1NSFA 4EPTA 2HYDA 3B60A 2W0MA 3HR7A 3LLUA 3ZVLA 3TIFA 3O8RA 1DE0A 2OT3B 4Z1MA 5AJWA 2JLSA 3QF4A 1QHSA 4LPSA 4JLAA 5DH9A 4A0GA 4EJSB 5KPDA 4X8LA 2GCOA 2QEQA 2ZI7A 4JVLA 5TDHA 1W49A 5JJIA 3QKSB 4URUR 1A2BA 4IDQA 1Z0KA 3EPLA 2FSIA 2ATXA 2IYTA 1W44A 1KDRA 3KDSE 2CDNA 4II7A 1XWIA 2ODNA 2FFQA 1JALA 4ACBA 3EC1A 4Q00A 3HPRA 5FBRB 4MKHA 4JBXA 3TAUA 4QJ4A 5DYIA 2GVDC 1SVLA 3GJ7A 3QG1A 3K9NA 4LJ7A 1Z29A 2PCJA 5SZHB 4D2IA 4DDTA 4K8OA 5CYPA 2HLDA 2ZYTX 3QBVA 1BYUA 2XEXA 1AZTA 4P4UA 4DXAA 2R6FA 4LJAA 4Q66C 1T3LA 3NBXX 1Z0JA 3GEHA 4RD6A 2QBYB 1X1SA 3PFIA 4D6PA 2CHQA 1GIAA 3LBHA 3SNHA 2FPMA 3VR3A 4A8JC 2D2FA 3DVLA 1CJMA 1N0WA 4KAXA 1LY1A 4L4UA 5EXTA 4B3FX 2D06A 4HB2A 1B23P 1R7RA 2H5EA 2QT1A 1CJTC 1GVNB 3GJ6A 3HJNA 5FFMA 3VMFA 3U61B 1XJQA 4GDFA 3PVSA 4Q7KA 1YZKA 2JJ2A 3A6PC 2B21A 3CX8A 3P4XA 3PUXA 1CJVC 1T5LA 3RAPR 1UBGA 1W5SA 2FMXA 2X77A 5JRZA 2ZXUA 2REBA 3WYAA 3AVOA 4B2LA 3KB2A 3NEYA 4I1OA 1J2JA 1SVIA 2O8EB 3VNVA 3X1XA 1GNRA 4B76A 1T8UA 3LVQE 1CBUA 2HXSA 4CEHA 2IK8A 1XD2B 3GCGA 4Q18A 5LD2C 4BPBA 2F43B 2FPKA 3C41J 3IUYA 3R7WA 5JMTA 3HWSA 2W2VA 2JJ1A 5AUQA 3UG6A 3OAAA 3T5GA 3K0AB 1BO6A 5P21A 1N3BA 3BJIC 2WIAA 4URVR 3KX2A 1G4AE 1LVGA 4PAMA 5CITA 2O8FA 1AGRA 5HZHA 3CPEA 3MWJA 3K0FB 1QG4A 4HLCA 3K70D 3K70C 3HU3A 4I81A 2IWRA 2RGEA 3OEHD 1G7CA 3FVQA 2ZI5A 3MD0A 3I61A 1G8HA 2QUZA 3M1IA 3BGWA 3BFVA 4TYQA 3DDCA 1DS6A 3BS4A 1P4SA 4RSGA 3PEUA 1RRFA 4HZIA 2V1UA 3D3QA 5FL7D 1MRSA 1RJ9A 2CL0X 4GRAA 4OI2A 1G6OA 1GTVA 4G5OA 5FTKA 5IHPA 3EPHA 1CULC 1L7VC 2EVWX 4WZBE 1M8PA 1ZIOA 5J40A 2OUKA 2QMOA 4TMTA 3L8ZA 3FKSD 2ORVA 1JR3E 2WWGA 5A0FA 3VKWA 3N5CA 2XNDA 4G5SA 2BWJA 5C1BA 2C96A 2F9LA 5KYKA 2FJUA 3EASA 3O8DA 5DE3A 3VR5A 2J1LA 1Q1EA 1BYIA 2L0XA 4IEEA 1PLJA 2J7KA 1OXSC 1XTQA 2DB3A 4YONB 2FSFA 4LHZA 2WAYA 1N6LA 1FL9A 3ZDQA 4OKSA 2IYLD 4MQBA 4NYMR 1ZD8A 1E9EA 1E9DA 4QNRA 5CIWA 2VP4A 5H8WA 3KKNA 2G83A 5JS8A 2B6HA 3UXMA 1Z6YA 4LYAA 3TUZC 3ZVMA 4D25A 4LHVA 1OKKA 2IW3A 1CLUA 5FL3A 3AKYA 5AJXA 3VQTA 3QIAA 1JQJC 4A0HA 2OAQ1 4UNPA 4HAWA 2HDNB 2YVUA 4I1VA 4UNQA 1H8EA 5FPSA 4YDSA 3LXRA 5FI0B 3GD7A 1HE8B 1RC8A 5E7JA 1GNPA 1L8QA 1PLKA 1U8AA 2FU5C 4IVPA 1Z47A 3QI2A 4PAOA 2JAQA 4KYUA 5EP2A 3BK7A 1FMJA 5FTJA 1P9NA 1QHIA 3KQNA 1Q1ZA 2CCGA 3BC1A 3VR1A 2IEZA 1OPXA 1WRBA 1RIFA 1IQPA 2IYSA 4JVSB 1UBEA 1D2EA 1DO2A 4P3YA 2ZS7A 4KITB 1BIFA 3W3AA 1Q1QA 2G88A 1JNYA 2WWXA 2B92A 3A1SA 3TRFA 2ZRMA 2GZDA 4G3XA 5FTLA 4X8OA 4LRWA 2WWIA 4POAA 4TSFA 3MSXA 3VHXA 2V8OA 4X8HA 1NG9A 3KUDA 2NQ2C 1IONA 4QJ5A 2QA5A 3CM0A 4TLAA 3CF0A 1ODFA 2H17A 3VX3A 2JGNA 2IX3A 1R0WA 4P4SB 5L3SB 4S35A 1DADA 2OM2A 5FUYA 3LFUA 4M1OA 3GJXC 1N2CE 4MGKR 1XTIA 1KMHB 2GZAA 4G5RA 4KFSA 5CB6A 2VO1A 1CS4C 1OSNA 4IKEA 3EIEA 4YMSA 4HATA 3RS0A 4DB4A 2OEPA 1CJUC 2AWNA 4QBFA 3NVAA 1SXJD 1SXJC 5KDDA 2F55A 4IOLA 2J7PA 1II8B 1OFHA 2D62A 3BE4A 3FWYA 4CIDA 4V0ME 4EIWA 1I4LD 1G7SA 4XTRA 1A7JA 4NYIQ 2O8CB 1ZC4A 3F5FA 3E5HA 1PUJA 4I4LA 2R9VA 3UMFA 2ZTSA 4M1TA 1MO5A 4Q9IA 1N0VC 4DLRA 2QM7A 1TUIA 1KTVA 3IBGA 3QOFA 4HLUC 3I4LA 5FTMA 5LB2A 1Z0IA 3LRPA 4V0NA 5JI2E 4KU4A 1Z5ZA 1S3SA 3ZZ0A 1XP8A 1R2QA 2RGDA 2BDTA 2C8VA 1VPLA 2CMKA 2WSSD 3D8BA 2QROA 1XEXB 4CEHB 3AVWA 3BIFA 4M21A 4MRVA 1LW7A 1KI1A 1TUEA 3IGFA 4LY6A 2QZ4A 3SBEA 2AD5A 2G1JA 1M2OB 4OJKA 1N25A 2CVHA 4TL6A 4BFUA 4B3BA 2ZYWX 3BD9A 2B8TA 5BWMA 3AV0B 1LTQA 2C04A 2WOJA 3IDQA 2IS2A 3GLGB 3RRYA 4NH0A 2D7DA 2O8FB 4HDQB 2OHFA 1FQKA 4TZ6A 5KO2A 1OH8A 1GRRA 3MWKA 2YHSA 3IO3A 5CK4A 4KSBA 3WP1B 3D31A 4OI0A 1A82A 1VCMA 4TTRA 1E6CA 1KAOA 1IHUA 3DKVA 1YZLA 4R98A 3SJAA 1U81A 4AY2A 1AKEA 1VCIA 2J0VA 4HZUA 4PQYA 2WICA 4IDPA 2GDJA 2R2AA 3UK6A 1SKYB 4YDHB 1GDDA 2C99A 1DVRA 3P32A 1XBTA 3LBIA 2QSZA 1YHNA 3LY5A 2P5TB 1TQDA 1F60A 2BJVA 3P20A 5F2EA 2WJVA 3U3JA 1YKSA 1US8A 2CXXA 5JSZA 4M9QA 3IIKA 2QAGA 3NH9A 3TSOA 4JYBA 4M4SA 2RH5A 1ESMA 5FBLB 2QNRA 2DWQA 5EUQB 2FA9A 5CLQA 3RRMA 2VPPA 2IEYA 4BFVA 2A5JA 1N6OA 1ZD9A 5TMPA 4RFVA 3DPUA 3W3ZB 3OIWA 2KBFA 3GMTA 4HI0E 4M53A 1T8TA 2ZM5A 4LBVA 1OF1A 4ESVA 4QFMA 3T1OA 2V7QA 4B2IA 4B3GA 3T34A 1LF0A 1E4VA 1U2RA 4XJXA 3A4NA 3L82B 4DDVA 3DEFA 3I3SR 3AH8A 3TMKA 4DCNA 3AVUA 1W46A 1T3HA 2QPTA 1T0JB 2LCFA 3NBYC 1GKIA 4RZ2A 4Q4HB 1U90A 3TK1A 4YMTA 1E0AA 4AKGA 2WWWA 1CRPA 8OHMA 3SR0A 1XTSA 1M7BA 4LJ6A 1E99A 2C2HA 1MO6A 1CIPA 2G77B 3ZH9B 4CGZA 1E2JA 3SFZA 2V54A 3BAFA 4KFUA 4E5UA 1AN0A 4QL3A 3UMRA 5DHAA 4D0NA 1CEEA 4NTZA 2PEYA 2WOOA 1Z6AA 4ILEA 1XEWY 3WNDA 2QE7D 4D82A 3EA5A 1CU1A 4HAUA 3C16C 4KLZA 4D0LB 3AVXA 1G6HA 4ZPXA 1JR3D 3FHTA 4RZUA 4Q4AA 3SJZA 3GFTA 4QGHA 4YLGA 4TQ9A 4US2R 3LXXA 3HPQA 3DM5A 3IIJA 3QPVA 2GVZC 1EFRD 2F3RA 3WYGA 1FNNA 3AKDA 3B1XA 3EX7C 3KKMA 3CR7A 2H18A 4RFSB 2J87A 2UZIR 1E79A 1D5CA 5AJVB 2JDID 2ONJA 1E2IA 3HU1A 3I73A 3MWLA 1L4YA 1ZUHA 3ZJYA 1MABB 4ABYA 4DLWA 1OT3A 3CRQA 5CJ2A 5M04A 4G0NA 5BYKA 4BLQA 1T4GA 1HQYE 4LC1A 1H8HD 2DBYA 4IFBA 5B57C 2HJVA 4LK2A 1JBKA 2F1HA 4OQMA 1JEEA 5J47A 4JT4A 5EXXA 5F9FA 1S1CA 2R6GA 1IN8A 1P3JA 2WKPA 5KU1A 4TMWA 2OLJA 1IM2A 3UG7A 1DAMA 1WDTA 1S8FA 4S2EA 1N5IA 3EG5A 3NDPA 1Z07A 2VH5R 5KTYA 5F98A 2W6JA 3RC3A 1OXXK 1GILA 4LV8B 4MRNA 3KXLA 4XSGA 3K0EA 4ZDIA 2GF0A 3RS3A 2NGRA 3ND9A 1JEDA 4NONA 5DSZA 3OE7D 3QE0A 4V0LA 1XDBA 4UNSA 1TEVA 4NYJR 4EPXA 1E0KA 2ZAOA 4D4LA 1D9ZA 2BBSA 1R8SA 4OHVA 2J41A 1KOFA 2MSCB 1WB9A 4AKIA 2D2EA 1NVWQ 1JR6A 4L15A 3B1WA 3NXSA 1UBCA 4PZYA 2VF8A 4FMBB 3U7GA 1TQ6A 2DCUA 4UXJA 1HH4A 3GLHA 4Q21A 2WBLC 1QG2A 1Z28A 2ZRPA 3ICQB 2MMGA 2W6ID 2Q3FA 1RPZA 1SVSA 3SE0A 4TL7A 2RGNA 3AF4A 2IYXA 3KJHA 3MLEA 4DCUA 3X2SA 1SVKA 2QAGB 4JT2A 1GKYA 2GBLC 3QXSA 3GPLA 4C7OA 4HAYA 2P3SA 2IYUA 2ZI3A 2QORA 1YZNA 3EWSA 4CVNA 1OYWA 2FEMA 2PCLA 1XEFA 4PC1A 2CEAA 4H1UA 1LFDB 3BWDD 5JRJA 3A1WA 5GVRA 2ORIA 3VHLB 1NVVR 4IOKA 1SQ5A 4LV5B 4OHZA 3FOZA 4RD1A 1G8YA 1YR8A 4JLDA 4DVGA 2ZSAA 3WBJA 2NPFA 4KLNA 2IUUA 2JLQA 1FX0A 5DN6D 4W5HA 2ZJZA 4CEIB 5JCZA 1RZ3A 1GL9B 4NCIA 3RSLA 4JLKA 2FE4A 3SHFA 2Z4RA 4NHOA 2AKYA 4QBHA 1KK0A 1BKDR 2GETA 5GJVC 1G41A 3KKOA 1SKYE 1ZUNB 1KO8A 1R0YA 2XSZA 1S2MA 4Q19A 1G4UR 2CHGA 2WIBA 5IK2A 4HDCA 2IBMA 1IOZA 1AGPA 4MUAA 1NY5A 1KAGA 1RFLA 1VTKA 1Q0UA 2X8AA 1P6XA 3U7HB 1Z06A 2HJGA 1MO4A 2YYZA 2B8WA 5LBIA 3V9PA 4FMDF 1QBKC 1Z2CA 3EIQA 5KHOC 2YOFA 4O0MA 1E2PA 3B6EA 5EE5B 3L0PA 3SEAA 3V4FA 4URWR 1SZPA 4NE2A 4F4IA 3D7MA 1GAJA 3B85A 1IN7A 4RCYA 4NCJA 4B33A 2ZSBA 4WXRA 4BRUA 4NL4H 2KSQA 1HA3A 3LX5A 4JS0A 3TH5A 621PA 3U60B 2J0UA 2OCBA 1MO3A 4KV9A 1ZU5A 3KTAA 1ZJ6A 1AZSC 3ECCA 4JBWA 3ICEA 5SZIA 1E9CA 1W0KD 3I5XA 2JLRA 3ADKA 4C9BA 2OESA 3Q8XB 1TU3A 1ZNYA 4UXHA 5DGXA 1FW6A 4AI6A 1GSIA 2P2LA 2EYQA 1D9XA 2JIZA 3EZFA 3SBDA 3TVDA 3AKEA 2OAP1 3KXKA 1ZM4A 2EU8A 3GJ0A 1RE0A 1RKBA 2WJJA 1ZM9A 4DHEA 1OJLA 2OBMA 2FDCA 3VU9A 4HUQA 3FMPB 3TW8B 1D2NA 2J0SA 4PPQA 3THXA 3I62A 1G3IA 1OE0A 2CLCX 4H1VA 4QNMA 2C9YA 2HXYA 5K8UA 3TGPA 1XMJA 4WOPA 1EFUA 1G20E 2HCJB 4EFMA 4FINA 2LKCA 3LH5A 5AJYA 2YC4C 4AYTA 1YU9A 2XXAA 1T91A 1XNJA 3NEJA 1CP2A 1XEWX 4QGGA 4L9SA 2MSDB 1N5KA 4FI3C 3I92A 1AIPA 2REOA 2OG2A 1YR9A 2FF7A 3U3RA 4B6FA 3SQWA 4L9WA 5KUTA 1T3SA 2SHKA 4Q1AA 5JLJA 1FQJA 1M6NA 4A2WA 2CL7X 1E2MA 2H7VA 3DZDA 5J5CA 5FBWB 4C0AC 4A4DA 1OXTA 2QG6A 2VHQA 3GFPA 4D4MA 3X1ZA 3BB3A 4N0DA 4MRRA 1VG8A 1YR7A 3C8UA 1E9FA 3TSWA 4G1UC 3CUEF 3R8FA 3FTQA 2O8BA 4AIIA 2V1XA 4OYHA 1ZP6A 2ANCA 1UDXA 2VLIA 2GF9A 4A15A 4QKQA 4AG5A 3FHOA 1AS3A 1EX7A 2KBEA 2R8RA 1TAGA 2VP9A 2KI5A 4RCZA 2CE2X 3L0IB 1GWNA 1X1RA 3QSYA 2ZJAA 1E1QD 2V6IA 1Q44A 1COWA 2JCSA 2ZU0C 3OFNA 1FPMA 1TQ2A 4HYYA 3IPYA 3SQXA 1A5TA 1YR6A 3WYFA 2GEDA 4JVNA 4ZI2A 4M2LA 4NMMA 5FUVA 5J4HA 1F2UA 1UKYA 1Z3IX 2GZHA 1GRQA 1ONBA 4C7OB 1PVOA 1W47A 3BH7A 1OH7A 1OXVA 2E87A 5JEEA 3ZVRA 1QRAA 2VP0A 1E9AA 4ZO4A 4AK9A 1R5OA 3MG9A 2WKRA 2FSGA 3R8CA 1IJFA 1OXUA 1CXZA 4IW3B 2XTZA 5GVSA 4DUGD 1S1MA 1ZU4A 1NN3A 2Q21A 4MA4A 3BB1A 4JL5A 5GADl 2AKAB 2QP4A 4BLPA 2BC9A 2JLYA 5KNBA 4GBMA 3NC1C 3TQCA 3A1VA 1PUIA 4KXFB 4PQFA 2FWRA 221PA 2XOKA 2ZI4A 4Q9KA 1E1RD 1JXOA 3A58B 1XPUA 2VL7A 3B9QA 2ZRCA 4K81B 3B1VA 4PPFA 3KB1A 3B8HA 1A1VA 3F8TA 5J4KA 3AF0A 2G9NA 1FMLA 4FN5A 4C30A 5B30A 4HLQB 1GUAA 2BHRA 1WE2A 5FH9A 2IWHA 2BCGY 1VMAA 1KJYA 4A8JA 1E9BA 3MGCA 2FOLA 4TLCA 4QM7A 3K1JA 4MYCA 3F3YA 1KDOA 3T5DA 5IT5A 4HB0A 3FDIA 3DO6A 4PC3A 1E2DA 3A1TA 3EPJA 1RRCA 1XTJA 4ZCLA 2GK6A 3RABA 3TUIC 1S96A 4U7DA 1ZBDA 5FBVB 4ZKDA 1EFHA 1VDZA 5E3HA 1CR1A 1YRBA 4GOJA 2RKOA 1G3RA 2F1IA 1JECA 1IN5A 5AUNB 1KI9A 4HAVA 1OHHD 1ZINA 5DO9A 2O8DB 4M1YA 3G0HA 1NBMD 3L43A 2HT1A 3B5JA 1E94E 3R20A 2IC5A 4Q7JB 1E69A 2FFAA 1JAIA 1S3GA 3GFOA 3DM9B 4RVCA 2HYIC 5CIQA 5HCIA 1PV4A 1NN0A 3JVVA 1JPNA 2AHOA 2OBNA 2YOGA 5KDLA 4PO9A 5K8TA 4URXR 2EFDB 3ZZUA 2OFOA 1KSGA 4PFSA 4OHWA 1E2KA 5L3QB 1E9SA 4MDFA 3H4MA 3QKTA 3SYNA 4W5JA 2CCJA 4Q1CA 1W1WA 3THXB 3WRYC 1L2TA 3NIBA 3NWJA 1PJRA 3NG1A 3MAAC 4EPVA 2NG1A 4FCTA 421PA 1A4RA 4KVGA 3S1AA 2OBLA 1QHHA 1MKYA 2D74A 2V9PA 2WMNB 1XF9A 3BXZA 3KL4A 1KY3A 4G5GA 5DI3B 1M74A 3AGPA 1UF9A 4M9XA 2XXAB 1XXHA 4WIAA 4HUTA 4DLXA 3PIRA 2XNDD 3IEUA 2XZLA 4Z51A 2ZR7A 4Q1EA 3KJIA 3TR5A 5FL7A 5IF9A 4RKEA 4RKFA 1PZNA 1NVXQ 1C4OA 5L3VA 4TWZA 2JASA 1F2TB 1P75A 2YWFA 2DFKB 5DIFA 3ND8A 4WW0A 5EXPA 4R7ZA 2ZU6A 4KFTA 1IN6A 3QUSA 4QXAA 3LAWA 2F3TA 4FXPA 4NYMQ 5BN5A 1WA5A 2EFGA 1KZGB 2A5FA 2DR3A 1OYYA 2PLRA 1I4TD 4EPYA 1OKKD 5FOXA 4LOAA 4LBZA 3VX4A 4Q7MB 1WF3A 4OL0A 2GJ8A 4FMCF 1NN5A 3AF2A 3VKGA 3FFAA 4KJZA 1ZM2A 1IN4A 1DBSA 3LW7A 5DLQC 1CR0A 2WPDD 3LDAA 4OQNA 2Y8EA 5HR5A 2BMFA 4OHXA 1AQUA 2IT1A 2ZRLA 3QKRB 4QRHA 3EZ6A 4UNRA 1OFUX 2QU8A 3Q72A 4OK6A 3P26A 5HKKD 3QF4B 1G9XA 1G291 3FB4A 2GCOB 1MOZA 2VIIA 3NHAA 4Q1DA 3LLMA 1XCMA 4A1FA 2R6DA 5TXGA 3UATA 2B7BA 4EQ6A 4JYCA 4ARZA 3T1TA 4CYMA 3TKLA 1GNQA 3LQRA 1KNQA 4MITA 3GLFA 3B13B 4LYFA 4JMPA 2GEVA 3RANA 4PPNA 2IS1A 4EUNA 4ZDWA 2QRZA 1YZUA 2BMDA 1DPFA 1VG0B 4OHYA 4AKHA 5JEDA 1HE1C 3R9XA 4PSKA 2X2FA 3AF3A 2QQEA 3DZ8A 1NSTA 4F38A 1YRAA 1AA9A 2VTKA 4F92B 2HEIA 3EWAA 4TLEA 4LJYA 4DCSA 3AB3A 4B2PA 5CDFA 3PJRA 5KOYA 2CE7A 4D26A 1W4AA 2VRWA 3HU2A 1W36B 3GLHE 1GG2A 3DMDA 1XD8A 3BORA 1DEKA 1NL3A 1IJEA 3ZIAD 1Z0FA 1RRPA 1ZRHA 1X8KA 3X1YA 1MR3F 2N1BA 2IYWA 2LKDA 3ZS8A 4KODA 2QL6A 3IQXA 1JI0A 4UXIA 5G3ZA 1G7TA 4LJ5A 2BV3A 1W4BA 4IXNA 2QP3A 1OLOA 3AVTA 3FKQA 2PZFA 1BMFD 3JZMA 3ZQ6A 4WVFA 3SU8A 3U5ZB 1SXJA 3UKDA 4QBGB 4PC7A 4DLUA 2YWEA 3CO5A 4M0LA 3WBKA 3W90A 5A4JA 2RGGA 1FUKA 2QM8A 3MUFA 4B43A 4ZIRA 2C78A 1NMXA 2IUSA 2GJKA 2ZRIA 3CF6R 3R7WB 4B74A 1L4UA 3I32A 4HLUA 4JL6A 3TNFA 2Q6TA 4BE7B 4BFWA 2QY9A 4E22A 2O5VA 3U3MA 5EZ6B 1OIXA 1S4QA 3K09C 1KJZA 1ZC3A 3PUWA 5FI1B 3FMFA 4US0R 2LWIA 3KJEA 1N6IA 5CM9C 2DPXA 1Z6TA 3I5YA 4NDZA 3N2EA 4GPTA 3WRXC 1EESA 4C2UA 2IF0A 5LD2B 4B32A 1JQLB 1Q12A 4JLJA 2QTVB 3RHFA 4F93B 2YOHA 3DOFA 4NCNA 4ERNA 5FOUA 2YC2C 1U0JA 2WSMA 4B48A 3K09A 4PSAA 4IVRA 3CX6A 5H68A 2YKGA 2QTFA 1G5TA 1RJ9B 2ZANA 1ZW6A 3DHWC 3PEWA 4CT5A 2JLZA 3GLIA 4JLOA 4PC6A 3NBFA 5FR1A 4DLSA 1NF3A 4M1MA 2ZROA 2HT6A 4YXWA 5F3WB 2B7CA 2GESA 4ITRC 4MRSA 4LX0A 2Z0MA 4B75A 1XXHB 3C7KA 2C98A 4ZV4A 4QM6A 1W0JD 1G7RA 1XTRA 4LJ8A 4UQOA 3CRW1 4HSEA 1P2VA 4AKEA 1I4DD 3U3OA 1CF4A 2GCNA 5JHHB 1XJCA 3REGA 1KGDA 2C77A 4PXAA 3WMGA 1KNXA 1FOEB 2F6RA 3CWZA 4ESHA 4B71A 1OW3B 3AP2A 1VECA 3NC0C 2OCPA 4B35A 1SHKA 4R9UC 4DSTA 2V7QD 3JVUA 2OILA 2OXRA 4B3DA 2FH5B 1YQTA 1MH1A 5HTKA 3O47A 2VA8A 1H65A 1VCOA 2ZI6A 1ZCBA 2IHBA 1ZM7A 4B3CA 5IRCD 4ASUD 5EP4A 2F1JA 3ZD6A 2FGKA 5DI9A 1W2GA 4KFRA 1D2MA 1DAGA 2VP6A 2QQ0A 2YINC 4Q9JA 4PHTA 2OZEA 1UJ2A 1YJ5A 2DFNA 1QVAA 1U0LA 1YZGA 2A30A 1TF7A 4LSGA 4QHSA 3CKLA 3FFBA 3E1SA 4Q01A 2ZUDA 3KZ1E 1G64A 1TADA 3Q9LA 2CJWA 4EQ6B 2A9KA 2HUPA 1WBDA 4Q47A 2Q9AA 3OESA 5FBQB 3GP8A 3MWYW 3A37A 2GCPA 3UIEA 1GL6A 3VKHA 2R44A 2DYKA 4TYWA 2J0QA 3H0KA 3SZRA 4CDGA 4OQXA 2XJ9A 4EPRA 4JLPA 4MYHA 2H57A 1G3QA 3IHLA 2QE7A 1RRGA 3ZQJA 1GZSA 3H1TA 4D4JA 3VFDA 1E79D 5KSPA 1ANKA 1XCGB 4PHHA 2ZJYA 1G8GA 3EA0A 3NDBB 1CJKC 5TB5A 4JJKA 4W5WA 4G5QA 1KKMA 4V03A 2BBTA 2C9CA 4DT1A 3ONWA 5FOSA 2AWOA 5B2ZA 5BN3A 1EFRA 4RZXA 5C4MA 1P9RA 3LQQA 3Q5DA 3Q7QA 3LNCA 4R2HA 4GZMA 4Z8YA 3HYRA 3GJ8A 3CPJB 1TEXA 5JWOA 5D3MA 1G8PA 3FE2A 5AK0A 1XU4A 2REXB 1QHXA 2UKDA 1O3YA 5TARA 4F7WA 5AUPB 1H8HA 1XMIA 1CTQA 1XMSA 3RS4A 3OEED 2H1LA 2RMKA 1XMVA 1JAHA 1E32A 3JZAA 4RD2A 4NP6A 3A8TA 4XTCS 3L0OA 1KSJA 4NPHA 2BM0A 2IXGA 1V43A 2OFWA 4C0SA 4CEJA 1W4CA 1SGWA 4ZCMA 3MJHA 5C46F 4M9ZA 1P73A 4YMWA 1NLZA 1DOAA 2J45A 2VHUA 1U94A 2DWPA 1ELOA 2QMUA 4UNNA 2GWHA 4DB2A 5EE0A 3WMFA 4NYJQ 1NN1A 1P5ZB 4DEYA 2W2XA 1IBRA 3CNNA 2ONKA 3EZ7A 4GT1A 4LPKA 3U6KA 1FFHA 2BKUA 2VBCA 1Z63A 2CHVA 2GKSA 1G3MA 4Q4JA 2ECKA 4QG7A 5FR2A 2OCAA 4MH0R 4N0EA 3RRNA 2JATA 1VYTA 2GJ9A 2NTYC 1DARA 2ANBA 3OE7A 4GP6A 4HZUB 4AC9A 4OJQA 3AVYA 2BEJA 4JLMA 1HEIA 4DLZA 2NO0A 2H8KA 4NU0A 1AM4D 2XX3A 2Z43A 5CLLA 2JEOA 1A2KC 4URZR 1RW4A 3CONA 3AUYA 4U5XA 4ACAA 3IKJA 5DYGA 4TMKA 1US8B 4W7SA 1AK2A 5JSZB 4EJSC 3VTKA 1Q20A 3QF7A 1E4YA 4B3XA 5KNDA 1OB5A 4D81A 3CWQA 2IA5A 2HF8A 2PLFA 1OIWA 3PXGA 2FX3A 3CPHA 5E95A 4A2PA 4E03A 2ZUBA 4MKGA 3TW4A 1P9WA 3CH4B 1Y3AA 3C5CA 1Z2AA 2QTHA 3I1FA 4PANA 4ZCIA 1QZXA 3ZZTA 2ATVA 3Q5EA 1LS6A 3QPUA 3ASZA 2ZR0A 4JSTA 1KK1A 3QPWA 4C0JA 2EFEB 2ZRHA 2ODEA 3RNLA 1Z6GA 3PENA 4RY2A 4US1R 4EJSA 4BZQA 2GBLA 1ZIPA 4BLTA 4EAQA 1ZYUA 3BFXA 3K9LA 3NTUA 1XTKA 4XH9B 4DZZA 2ZRNA 4TT3D 5JCPA 1WP9A 1XPOA 1G18A 4AD8A 3TR0A 2IL1A 5C2JB 1CR2A 1R4AA 2MMCA 3QKUA 2QGZA 1Z6XA 3CF2A 3IIMA 2CNWA 4EPWA 3B78A 5IK2D 2IYQA 4KYIB 5FUXA 2GHIA 3RS5A 3WP0A 5K8IA 1KO4A 4GL2A 1G3UA 4XVQA 2QBYA 1XXHE 3DMNA 3PQCA 1U8YA 1KI8A 2QN6A 1KI3A 2XGJA 4FCVA 4XVRA 5AJZA 3EC2A 2QT0A 4GMDA 4XD7D 1VKJA 3KFVA 1XRJA 2BVNA 3PITA 4HDOB 2AFHE 1OH5A 5F9HA 2NO6A 2QAJA 4RD4A 1U9IC 2PT5A 1CKEA 2XB2A 3O8CA 4PC2A 4TMVA 3DOEA 1UEJA 4Q4AB 3LX8A 1G19A 4CT4B 1XPRA 3QXXA 2ZQ5A 5EQTA 3I72A 2G1KA 2VP5A 2O8EA 1XJ0A 2OXCA 1VYVA 3AP1A 1EWRA 1P62B 4A9AA 1RYHA 2O0KA 4Z54A 2IF2A 1Z0DA 4GSYA 4Q9LA 4A0RA 5B64A 1XD2A 4Z8XA 1ZD1A 2GAAA 1Z0AA 1N5JA 4C0KA 2ZRGA 3UWKA 2J59A 1DELA 2ZYVX 4R71A 4P32A 1Q3HA 2WHXA 1IXSB 2WVJA 1DO0A 3K0AA 4QJ3A 1E2NA 3T35A 2N42A 4IRUB 1W0KA 3KFXA 4PHGA 4DT1B 4TYNA 1TX4B 4LI0A 3QJYA 4PQRA 5K8LA 5JI3E 2AK2A 3SC3A 3I8SA 3KQLA 2A3RA 5JBQA 2A5GA 4C0LA 2ODWA 3QQ5A 4TYPA 2ZJ8A 1UFQA 2V3CC 3SS8A 3B2EA 3LBNA 3RDPA 2IS6A 5D3MB 2PL3A 3SN6A 2R65A 4LUCA 4ZDKA 3LW8A 2H16A 1E2EA 2E1RA 2ZSEA 4XWKA 3NBZC 1DAEA 1QHGA 2PMKA 3AVQA 3PUYA 1II0A 3SOPA 4IEIA 4P33A 2AN9A 1D8TA 2PZEA 1Z22A 1YZTA 4AWXA 3C5HA 1KSHA 3N2IA 1VHTA 3EIHA 5CDFE 4HAXA 2XZOA 3IPXA 1W7AA 4TN1A 3HR8A 1HY3A 2CK3D 4Q03A 2ZE5A 3ADBA 2WKQA 4PSVA 1UAAA 3B1ZA 1IXZA 1NY6A 4Q4LA 4C4PA 1FP6A 3PV0A 4JJZA 3BBPA 4JLNA 2EWVA 2FNAA 2WJYA 1W2HA 5L8VA 4WXPA 4YQFA 3W8NA 1XFAA 3TQFA 4TMXA 1SXJE 1SHZA 3GLHB 5A5GA 2FV8A 2VYFA 3PEVA 3EXAA 2ZAMA 3L8YA 2JLUA 3W9YA 5J4LA 1G16A 3QEJA 2BIFA 4IDOA 3V4RA 2F1RA 1EK0A 6Q21A 4Z1MD 2PJRA 1JJVA 2Q3MA 1G8FA 3CX7A 1DAFA 3W6NA 5KNCA 5JJKA 2AFIE 1HT1E 3ZGXA 1KO7A 4H9GA 4LCBA 1ZNWA 3P27A 4PPGA 4KBFA 2P5SA 5EZ5A 4C2TA 5G41A 3W5IA 1DAKA 3IHWA 1SVOA 1AS0A 1NG1A 4HB3A 5UKDA 1E1QA 3LA6A 4IVQA 4Q9HA 4LBWA 3RC8A 1TTTA 2GJSA 2IUTA 5BXQC 3O8BA 2PX0A 5GJCA 4LJ4A 4C0HA 3MFYA 1I2MA 2WJIA 1GOTA 3PG5A 2WWYA 1KKLA 2HLDD 1FX0B 3QXJA 1NRJB 3BH6A 2VHCA 4DSNA 1D6JA 2IYYA 5EJEA 5H70A 1SULA 3SI7A 2F7SA 4PO8A 4AYXA 3TVTA 1UKVY 4R2IA 2G0TA 4LHXA 1W36D 1W36C 1T6NA 4L8GA 3U3KA 2XOKD 1ZM3A 3B82A 4V02A 3GLIE 2NZJA 5ANRB 5SZKB 1LV7A 3AF1A 1FUUA 1XX6A 2Z4SA 3C15C 4FW9A 4DUGA 4P4SA 1DTSA 4DSOA 5L3SA 1C9KA 2JLVA 1KMHA 2KB0A 2JJ2D 4TLDA 1TU4A 4DSUA 1FTNA 2I3BA 1JPJA 1FZQA 1VG1A 1Q3TA 1X8JA 3PEYA 1II8A 4BLRA 4FWTA 1E1RA 1NVUQ 3BOSA 1E98A 2O8CA 2Q3HA 4KO8A 1N6RA 1QF9A 4V0OA 3IILA 3SDZA 2AXPA 4DJTA 4M1KA 4O25A 3U7EB 2HCBA 4JLBA 2J9RA 3RS7A 3Q85A 5KSZA 2J0UB 5TY0A 2JJ1D 3OAAD 3FMIA 2OLKA 3KTAB 2WTUA 1WCV1 3QVVA 2BMJA 2ZYUX 4BGDA 5BYJA 2ZRDA 2Q0HA 1S9HA 4F4JA 1Q21A 821PA 4TZ0A 2EQBA 1EX6A 2NO7A 2A78A 2R62A 2OCYC 4PAQA 4CRWB 2QI9C 3OF5A 4TYYA 2WWHA 4AURA 5FTNA 3TSZA 1XEXA 4Q7LA 721PA 1E2LA 4Q1BA 1S9DA 2EW1A 2PJZA 2ZR9A 1FTSA 4NBSA 4OK3A 3NH6A 2ZJBA 4Y0AA 3VU9B 1OB2A 2OO7A 4HUQB 4XIGS 1M1YE 1OHHA 4GI7A 2Q9BA 1Q1BA 2ZJOA 1NBMA 3B7GA 1TQ4A 4IXMA 3GLGA 2GJAA 2P6NA 1ZCAA 3MMPA 3WMEA 3M4YA 5J4VA 2HF9A 3OEHA 4MGIR 2GXUA 4N3NA 5EP3A 3TBKA 1BS1A 3ZS9A 3ZLJA 1AQYA 4JL8A 1V5WA 5BN4A 4DDWA 2BEKA 1F6BA 2UZ3A 2ZREA 2ERYA 3UMSA 1I2DA 1LB1B 1SVWA 2PEZA 3SYKA 1JB1A 4BWYA 1R10A 2IYRA 2WJHA 1UEIA 4O2RA 3TJZA 2GXQA 3FKSA 2JJ8A 4TTPA 3AVPA 4J0QA 4DLVA 1KSFX 2ZIAA 4MKFA 2ZI9A 3E70C 5FPKA 3TLXA 2X1VA 3ZYCA 4OI4A 2P67A 3H84A 4IOJA 4DCTA 2O8BB 5LPNA 3X1DA 1R0XA 2RB4A 2PMDA 3K8YA 3OIYA 5C18A 2ZITA 1H8ED 4I1SA 1XZQA 1HTWA 2EFCB 3G5UA 1GKUB 1E2FA 2XNSA 4MYTA 4WA7A 3HDTA 5CB8A 2RCNA 3CZPA 4KVAA 4IDHA 2BM1A 1XCPA 2G0NA 3AKCA 3ZVNA 3KQKA 2RGCA 4E09A 1G5RA 1KI4A 1YE8A 1J99A 1VG9B 3AQ4A 1G5PA 1NIPA 2BOVA 3H86A 4O2LA 2KWIA 4QC2A 1X86B 2DFLA 2BKEA 1M7HA 3UANA 3AP3A 1TPZA 2KE5A 4DWJA 1E2QA 1F2UB 1W48A 2TMKA 4IFEA 4GOXA 4LC0A 4LYJA 1IY0A 2WPDA 4Q4HA 4DIDA 2AXNA 2QSYA 2HV8A 4FMDB 4XSHA 4ZI3A 1HQCA 4CZ2A 3QNUA 2NO9A 1TF5A 1XB2A 4TSFD 5HPYB 4L16A 4NCHA 2C5LA 2O0HA 2ZSDA 5HKKA 3KJGA 2VSOA 1MRNA 3WY9A 1R5NA 2BBWA 2D4HA 1GITA 1EGAA 2ZS8A 4RD3A 3WNCA 3QG5A 4UJ5A 3GJ4A 1FNMA 2VHJA 4Q02A 1NKTA 3FPAA 1K5DA 3T12A 1DG3A 4IOMA 4Y0VA 3T1VA 3VR6A 4DEXA 5EE1A 3T15A 2A7QA 2ZE8A 2J7PD 5JWRA 2P65A 4GOKA 3G82C 2ZS9A 1OH6A 2GEUA 1GRNA 3FHCB 4DIEA 1KK3A 5JHGB 2DHRA 3IO5A 2ZE6A 1N6HA 5G53C 2QMHA 3GEEA 1G21E 2NZ8A 5LB4A 1IY1A 3U7FB 1NLYA 1EWQA 1NJFA 1GFIA 1M34E 2G6BA 4KI0A 4RFSA 1EG7A 1FP7A 3BRWD 3KXIA 4URYR 4A8JB 1W4RA 121PA 3P4YA 4NYIR 2ZSFA 3QXCA 4TMZA 3LD9A 2Z5FA 1MABA 3ZIAA 4DBLC 4FD2A 4DRZA 5L3RA 1GP2A 2ZRBA 4F91B 4OQLA 2FG5A 5KSYA 4IHQA 4TQAA 3QXHA 4FWIB 4PX9A 4QGFA 4WAUA 1NKSA 5GJBA 5FPTA 4KHZA 5EUMA 1KO5A 1X3SA 3QBTA 4LHWA 3R9IA 1BMFA 1NLFA 4BEJA 4NCKA 4P31A 4UKDA 5IDVA 2N46A 2ASEA 1K8RA 2OV2A 2VHTA 2A5DA 3T06B 1HV8A 1U99A 2IXFA 2PX3A 4O3MA 1UADA 2OSBA 1HT2E 5HCNA 1P7CA 1J70A 2WSSA 5CM8B 1UBFA 1II9A 3TAHA 1ZVQA 2BMEA 1HUQA 1KDPA 1KHTA 4B6EA 2VQSA 1XZPA 5EP1A 2NPIA 3MCAA 1VHLA 2J3EA 3OHMA 1EFCA 3D6TB 3QENA 3SJBA 4M22A 1NJGA 1F5NA 4V0KA 3FGNA 2ERXA 2J5XA 2ZVQX 1KI6A 1P61B 3OIVA 2XB4A 4QOSA 1VIAA 1LNZA 2QP9X 3IQWA 4FIDA 3AVVA 4Q48A 3K70B 1Z08A 2ZJ5A 3MJRA 3RYTC 1UDWA 4XWOA 1N6KA 3Q7PA 3S1AB 3PUVA 1QHHB 1ZNXA 3DL0A 4DLTA 2QAGC 2XTNA 4YXWD 1LF5A 2FN4A 5CYOA 4JKYA 4XVUA 2CCKA 3LVRE 4QBIA 1DG1G 1CRQA 3A36A 2GILA 1WBBA 1R8QA 1KO1A 3WNBA 3CH5A 4HB4A 4BFYA 4DLYA 2I1VB 3A1UA 1ZMXA 3IEVA 1JJ7A 2VP2A 3LV8A 4BFZA 1UPTA 3KQUA 1IXRC 4OK5A 5EE9A 4EFLA 5KPJA 3AGQA 3A4LA 3KKQA 4BEBA 1R5BA 1N0UA 1P2SA 1S0UA 4I99A 2NMVA 3THWA 1W0JA 3U44A 1NIJA 4UJ3A 2R6AA 1Z8FA 3RLFA 2GK7A 1KMQA 1YVDA 4M9SA 2WAXA 3W6PA 4A6XA 1F3OA 3OZXA 4U00A 1P2UA 4PHFA 4BRWA 3AM1A 3EW9A 3L2OB 3BFKA 1NI3A 4CEIA 2PBRA 4BLOA 2WJGA 1B0UA 3TUJC 4WZAE 1E2HA 3LO5A 1ZNZA 2IHYA 4RJLA 3VAAA 4LJ9A 1KK2A 1RYFA 3SJCA 3M0EA 1KIMA 5KDOA 1M7GA 3CIOA 2IXEA 4BLSA 4BQSA 2AX4A 1TL7C 4ASUA 1QHNA 4ARZB 1N5LA 3RSOA 3EZ2A 2GXSA 3GLFB 4PTLA 4B34A 5HE9A 3CNLA 3EPKA 2IS4A 4A0FA 1YZQA
chains in the Genus database with same CATH superfamily
2C5SA 4DYVA 1X8LA 3ROMA 4YP1A 4XX1A 1C9NA 2BFDB 3IBSA 4MGZR 4BL5A 3REQA 2XITA 2O59A 3ENWA 1NNEA 1QH1B 3DL7A 2IYVA 3WAKA 2HNBA 4IDNA 4GMXA 3RH0A 4GFDA 2LPMA 3B9PA 4PSDA 2ZVDA 3A14A 2A86A 2PRIA 2VT7A 2C3MA 3WWYA 2DQZA 2FSHA 2FZ5A 2BKXA 4ZKEA 1ESZA 2FZ4A 4IEFB 3L6UA 1M33A 4QHYA 3GJ3A 4FP9A 2G08A 2Q5IA 521PA 3V00A 1NUTA 2Q5EA 1NMYA 3CZQA 3THYA 4IS2A 1NP6A 1QQ7A 6LDHA 4Q5IA 5ETJA 3B36A 1WG8A 3HCFA 3UFXB 1PNQA 5ITSA 1ZOOA 4NKRA 5AK6A 4EFNA 2ZPUA 2XZDA 4RIHA 2VSXA 4PICA 1AK9A 4ZTBA 4WBNF 4CMKA 2ZEJA 1EVKA 4A92A 1MIOA 1PWYE 3TE6A 4HY3A 1BHQ1 4BFTA 5CJJA 4QHTA 1Z75A 3H2GA 3R7NA 3R9WA 3TN7A 5AR1A 2EF0A 1AKQA 1F8XA 3FCYA 3PR1A 2XTMA 2GA8A 2NU7A 1YULA 2P1ZA 2FLWA 1OFIA 3HDYA 4R05A 2BCJQ 3NEAA 4JBLA 3TW8A 4R8KA 2BLLA 5JWHA 5C0OE 4MWZA 4DMMA 1GPNA 5CFOA 4RHEA 2H0AA 2W6JD 2A88A 3C4JA 3EGOA 2Q99A 1P72A 5K0CA 3T1QA 3OUUA 4JP8A 4DLAA 1GNLA 3JQAD 2XECA 5ALNA 1Z83A 4YC7A 2RGXA 3ONEA 3RFCA 2WNHA 3OUZA 2HQOA 4R2MA 3V4LA 4XOIA 4EMUA 5IMSA 2AMJA 4WFKA 5ESDA 1KEKA 4BXOB 2JLWA 1O87A 1L1RA 1MVLA 3ACBA 1RAHA 1MV5A 1S89A 4YUXA 5IUJC 3NU1A 2CV1A 2FVXA 5I6DA 2HW8A 4BQRA 4JP1A 1L5KA 1YDMA 2R1VB 2ZPTX 2A8YA 4C3UA 3UWMA 4EJ6A 5IT0A 1MAHA 4IL5A 4R0MA 1GN9A 2VUUA 1NUAA 4HLDA 1KQFA 3WXMA 4Q1FA 3BFPA 4FQ5A 3BTVA 4ARAA 3DUFB 5GONA 1UM8A 2QRQA 3HLKA 4BGIA 5ELXA 4UNSA 1SZCA 2BPOA 3SMVA 1REQA 2WHQA 4EYQA 4CKZA 3AHHA 5LDDC 4DV7B 2TYSB 2WUFA 1V7CA 2DTXA 2PRKA 5REQB 4J90A 3I0NA 4NQZA 4B6RA 3MRSA 3PXXA 1R6BX 4NZ9A 4WN9A 4F3KA 2R1TB 2R47A 2X2EA 4WZ6A 2QZSA 2X19A 3EGIA 3L07A 3SGLA 1ZUWA 2H4WA 4DR5B 4CV2A 4AJ2A 2XZPA 4LWZA 4UQPA 1FTWA 2A9FA 1USGA 4PR0A 1YU6A 4V0MA 2X0JA 1C50A 1AB5A 3PUZA 1YI1A 4K6OA 3OBBA 4IPTA 3AFOA 2AEJA 3H2YA 1NRXA 4ZO7A 1HYQA 3RBXA 1J90A 2EX0A 1LCIA 1NYTA 2RJOA 5BQ5A 3F98A 4FJ0A 3ODPA 1H85A 4ESOA 1RAAA 2Z2IA 1W4LA 1UWVA 3GRFA 3PC4A 4QU9A 4RZ3A 1YJXA 3BMOB 4C78A 3KR9A 5AXAA 2VF7A 3U39A 2IXBA 1E96A 3ZDFA 4RTOA 2I4IA 1GTMA 4MIKA 4HG2A 2TMGA 1MAVA 3IDOA 1T9CA 2J0EA 4GZLA 1FNBA 4F86A 3NR2A 5LVAA 1F48A 2A35A 3ESDA 3CLUD 1NBME 1QC5B 1UZMA 3HKDB 3S2GA 4C87A 1HURA 1UMDA 3KKPA 2P0EA 4QQKA 3GLGE 1G17A 5AQ1A 1XZJA 4E5PA 5DHFA 3R5KA 1UKZA 4X00A 3H3JA 1Z18A 5JPIA 5JJLA 4A82A 3JD2A 4TZKA 4WXEA 4Z0TA 1YDWA 1YQXA 4KC0A 2QMEA 4L5BA 4PZZA 3WSTA 5A0TA 1J8MF 2V9CA 3TLYA 4DRXA 5IEJA 1AKYA 2JFVA 2P90A 1ARZA 1RDFA 2C2XA 4JOCA 4TT3A 3ACDA 1DRVA 3RVBA 3SK0A 4LF7B 1M1YB 2VZEA 3M8KA 4EK9A 2Q3JA 3DZJA 3A7EA 4DRYA 4LYEA 4RTPA 4MDEA 3WIDA 3W6OA 5K0BA 2FR0A 2CJWB 2SKDA 5KNCA 5ARCA 1K0FA 4REQA 2ZYGA 1A7UA 4D4KA 1KP9A 4JIMA 1K9VF 1TM4E 2QQFA 2Q4DA 4LDAA 4K6MA 3GDHA 4MPRA 2IH5A 1QYXA 3KCNA 3ZE7A 2QRNA 4S05A 1X9GA 3CR8A 1UKCA 2Z6VA 2WTNA 2WZQA 1FXUA 1JKJB 1O0SA 3ZK9A 1HZZC 1DQSA 5EMHA 3W2GA 3IUMA 1TNDA 1ABEA 4QOFA 4W9RA 3WRWA 1L7PA 1PTKA 3S3TA 1Z15A 1PNTA 4N41A 2OKGA 5ESRA 1F0YA 4G0MA 1ZMOA 1Y3IA 1UKEA 1U9IA 1ZVMA 2G7MC 2NLOA 4E4YA 4ZMRA 4UD6A 5EHNA 2NUBA 2ZRJA 3MGKA 4N7RA 2A33A 4ZYUA 3T3IA 4GKAA 4FZ3A 2OKCA 2HUNA 2O3QA 5CDSA 5IBPA 4W5NA 2FKAA 5KQRA 4DC9A 2FFHA 4G0UA 2CL6X 2ZWAA 3J80A 2NSJA 3THYB 1JFTA 4N47A 1MNQA 2F9MA 2XJ4A 4NBNA 2JAUA 3BERA 2F8LA 3CRVA 1THGA 2V55B 3K0FA 3R5FA 2W0SA 2FLKA 3LPNA 2M6KA 1KIAA 4QJBA 1ZXBA 2AOUA 4QTUB 4IMRA 3PFNA 4YUWA 4ISCA 4QFCA 4M8NE 4I1UA 5FPHA 4E88A 1BOFA 4MPDA 2JIQA 2QDXA 4UHKA 2OE2A 2AB0A 3JQGB 4RWZA 2W6PA 5HF8A 1QDEA 1JQKA 3QU7A 2H51A 3C2QA 2FQXA 4XKJA 2ERCA 1WABA 1P3DA 4MUXA 2YNMA 3M3HA 3ZLUA 2VYVD 3EBPA 2INGX 4GP7A 3EPRA 4OP3A 4IQFA 1O94A 4W4TA 1JILA 2ZIFA 3HNPA 3CXUA 4LYHA 2XRYA 3W4KA 1LS1A 4WXMA 2O05A 2HJWA 2LZ0A 4OJMX 2OD2A 2P68A 1JTFA 4BGEA 4BO5A 4R9NA 1NVMB 1N6NA 3G59A 5JYEA 5DNYB 2H92A 4K28A 3E4DA 4JVMA 2Z56A 4CKCA 4TL8A 1D0SA 2Q1YA 2QTCA 5FD8A 3AZOA 1P4HA 1AN9A 2QD5A 2X5NA 3AI7A 3WADA 4YMVA 1Y8ZA 5I51A 3UHOA 3OMXA 4YAJA 4M0EA 3D64A 1E3WA 4HWPA 1IYZA 4PLFA 4X7BA 5IC4A 3QYAA 5A7GA 2A9QA 3IB6A 4WWHA 1PWXA 3P2EA 4M1WA 2I4MA 2LIPA 4IDGA 4MKIA 2VSYA 5CB4A 1QYWA 3LFTA 3Q2OA 1Z8HA 4Q4JB 3GCZA 1DEAA 3EAFA 3LLVA 1AHPA 2R5FA 4OMDA 2LTAA 1KYIA 2Z58A 1E0SA 3ZHUA 3B51X 3LU1A 5A4AA 5CVVA 1UR5A 5K0GA 5K6TA 1U0HC 2AL7A 1QGOA 4LHYA 5BRAA 3VNUA 4I55F 5J58A 1O97C 1YACA 3U2QA 5I7SA 4D1YA 2WWVD 4U02A 2OPHA 5A7FA 5JISA 4FM9A 1XYVA 2ZTHA 1KY4A 2Y6UA 1VGVA 4NV1A 1I36A 1LNQA 4P4TA 3FYHA 4KSCA 4E7OA 4KBGA 5B58C 5BNWA 5BW8A 3NOXA 3TB6A 1AJEA 1JIJA 3R9KA 2DX7A 2MSEB 2YZKA 3EVBA 5JD4A 3K5HA 3L41A 4PY2A 2NUAA 4DTIA 2YV5A 3OFSA 3F9RA 3MS2A 3WLHA 4Q3BA 4K9KA 1H1TA 2HYDA 2PVCA 1T8RA 1Y5IA 3B60A 2W0MA 3LLUA 3V8QA 2VTDA 3OECA 1H0SA 3QUTA 1PV2A 2QRKA 4RYDA 4QQFA 4Z1MA 5AJWA 5AK5A 2JLSA 3ELWA 1QHSA 3TVYA 5ENVA 1AQIA 2X8JA 4PZAA 4X8LA 4XGIA 2QEQA 1R4ZA 1ACMA 2ZI7A 3GNQA 4JVLA 4DLPA 1KPHA 4URUR 3THXA 4FS8A 2AVDA 2GLTA 3D3KA 3EPLA 1E1KA 2FSIA 3DEIA 1Z5PA 3RIMA 4MMXB 1KDRA 3K9CA 3KDSE 3M6IA 2J4FA 4NU6A 4ZJZA 1RTKA 2XYVA 3N7UA 1J5XA 2R00C 5KNBD 1IN1A 1CERA 3DV0A 4YVFA 3R6GA 1JG1A 1RXIA 3NTLA 2W4MA 3NDJA 4YPFA 3DFZA 5EOVA 1SVLA 3GJ7A 3LL4A 1AC5A 2P3OA 3N6RA 2H85A 4M7OA 3ZK8A 4EA9A 5IAKA 5CYPA 2F3UA 1RACA 2ZYTX 5BNTA 2AKEA 3GRZA 1HE3A 3DCJA 1SHTX 4P4UA 4D02A 2XOEA 2RGUA 2XVYA 5ALXA 2IXTA 2JZNA 1I5OA 1Z0JA 2WT9A 2YWBA 2QBYB 5KVCA 2CHQA 1ULUA 4F97A 2PO5A 2FPMA 1T8WA 4A8JC 1U3GA 2NQTA 1P6UA 2YRFA 3ELYA 3CNBA 1O57A 1L7BA 3DNPA 1CZOA 4FE3A 4DPMA 2CNNA 4XUCA 4E6PA 1B23P 3IV6A 3MXTA 1DAOA 2BFBA 3LY7A 3CJRA 1MD9A 1WXFA 1JUDA 2QT1A 5FFMA 3U9TA 3VMFA 2W8BA 1XRPA 4ZXPA 3RUEA 4WVLA 4Q7KA 1DBRA 1XO1A 3KU1A 1CUHA 1YZKA 2JJ2A 2WP0A 2X5OA 4YCSA 3CX8A 3CLSC 3T5TA 2P2GA 1T5LA 4GR5A 1W5SA 4X1YA 1PQYA 2Y0DA 4ZOQI 4YACA 3PC8A 4B2LA 1M66A 5EIFA 1X1AA 3NEYA 4K9MA 1J2JA 2B20A 3VNVA 4JC4A 1GNRA 4QQRA 4W6ZA 4WNCA 4IDBA 1QWSA 1T8UA 4BOYA 4M1ZA 4LRQA 3N76A 3VMMA 3ONVA 4BPBA 3OMLA 2IPNA 4YCBA 4LTNA 4MQEB 1TD9A 4ZODA 1XZDA 5JMTA 2IQ5A 2A0YA 2EW2A 1BH6A 1JHOA 5EGSA 2XCOA 1BO6A 2YMLA 5P21A 4YRNA 5HWSA 3MJSA 4KH0A 4X1KB 2FP4A 4URVR 2J48A 3DULA 1G4AE 5EEHA 1Z5OA 5TQ2A 4DA7A 3I12A 3FROA 2ZBFA 3CPEA 3NHMA 4Q34A 4DIMA 1JH8A 3K0FB 4JV5B 4WDQA 4UTNA 2DKFA 3K70D 4J0CA 2VXCA 1E3EA 1I3NA 1IM5A 2HHJA 2AOUB 4A0SA 1MAUA 4YQEA 5EFOA 1ENZA 1G7CA 3FVQA 1XZLA 3I61A 3UENA 3PDIA 3AHFA 4WZAB 1LI4A 3OOYA 5HIAA 2HH9A 3CR3C 1JMVA 4BNLA 1DTWB 2N3ZA 2WIKA 1IIBA 1XDZA 1P4SA 4ED9A 4DHWA 1DZ3A 1TVCA 3VO1A 3CVXA 1UKAA 5EGNA 1M6VA 3VO9A 1G5HA 1RJ9A 1N7IA 2UZAA 1GTVA 3F4LA 4G5OA 1N92A 5E1BA 1G2OA 3LKZA 3U49A 5BMVB 2G9UA 5IHPA 3V8RA 3EPHA 1CULC 2ZYSA 1V9CA 2PK3A 1U2QA 2C59A 4DG9A 3CEAA 3DLPX 3ZXXA 3L8ZA 2HR1A 2VC2B 2ZT6A 3VKWA 1TXGA 3N5CA 2AFRA 4IV0A 2BWJA 1IDN1 4JX8A 5KYKA 1HBJA 4BHTA 3HCBA 3EASA 1V1MA 1KJJA 1MC4A 4R8VA 5DE3A 3ZXSA 1NP3A 1BYIA 3EVCA 3EK2A 3GZNA 3PICA 1PLJA 1M2VA 1XTQA 3G5MA 3C1AA 5K05A 2Q5FA 1JFFB 2Z2JA 5DT9A 3ZDQA 5K3FB 5CB4B 4MQBA 2GUGA 4IYRA 2RG1A 2WFMA 3F6CA 5CLGA 1ZD8A 1E9EA 5D3ZA 1E9DA 4DGSA 1JQAA 4EY7A 2DETA 2YZ7A 3R3HA 2G4LA 2XLCA 4KQKA 1WY7A 2VP4A 3E5RA 5JCXA 5JS8A 2B6HA 4ZOLA 1IEQA 3D5TA 3TUZC 2CXNA 1SKMA 2BEUA 4D25A 2IW3A 5DBEX 1CLUA 1RLJA 3VDXA 3L8EA 3LNTA 3VQTA 3IV7A 3D2BA 3GGOA 2XB9A 3QY9A 1W73A 3G2IA 4DR1B 1MA3A 4UNPA 2A9OA 3USCS 1QO0A 1Z2OX 4IIEA 2WLTA 1OFUA 1CB7A 2F3SA 1XQ1A 2Q45A 2JCVA 4IZ6A 4QEZA 4TVOA 4CHGA 1H94A 4I08A 4RXUA 4YJDA 4MPTA 1KKUA 1SA0A 4CF3A 1HE8B 1NYRA 3B2NA 3L79A 4EARA 1GNPA 1U8AA 2PU5A 2AGVA 1RZRD 4OTZA 4V39A 2JAQA 4J75A 2I4TA 1T2UA 5DYWA 4F6RB 1FSSA 4EL0A 1FMJA 1L3CA 1P9NA 2DQ4A 4ER6A 1QHIA 1WZ2A 2JKYA 4KYTA 1C0LA 1JHUA 4A8PA 2DY0A 2C2KA 2OPBA 3PC2A 4J0DA 5E4TA 1FTQA 4F4DA 2P7HA 3EMKA 5HRUA 3DFIA 1IQPA 2DWUA 4NATA 2H2AA 1UBEA 3TOVA 1ZJYA 1USIA 2ZS7A 1U0GA 1T4BA 1BIFA 1DKLA 1PFUA 1ZZEA 5FI5A 3RARA 1QK5A 4CMIB 2B92A 2ECPA 3QPCA 1VLJA 3I6QA 4GGMX 4LRWA 3F5QA 3LCUA 1MB4A 1P44A 2AI2A 1J0XO 3DV0B 2V8OA 3BIJA 3C6XA 4GI3A 2NQ2C 1T0UA 4QJ5A 2WD7B 4DNOA 1T8YA 1TQHA 3CF0A 2WVAA 4QOGA 4QSHA 4PYRA 2H17A 1O6ZA 2FQ1A 1H22A 4PYNA 4EEZA 2IX3A 4KI7A 5A5FA 4G5FA 1N3IA 5BSHA 3CLRC 4S35A 2E49A 2COEA 2IOYA 3GEMA 3CEMA 3IMKA 1YFKA 4HGZA 4G5RA 2PA0A 3M6WA 4KFSA 4RTMA 4OGKA 1CS4C 3FZQA 3EIEA 2DG2A 3LM8A 4DB4A 1MQ8B 1EUZA 1BWRA 3DE5X 1LI5A 2I1LA 2J7PA 1OFHA 4IP0A 1CRLA 4GX0A 5LDGA 3WLMA 3EMDA 4ZAGA 5JJCA 1C7QA 4L22A 4XTRA 4LOIA 1BW9A 4R1MA 1ZRNA 3UGTA 1KPIA 2D4AA 5TS2A 1PUJA 1W1IA 2GN4A 3BL6A 4D44A 2O2YA 4YBZA 1NBAA 1N0VC 4QXRA 1BFKA 2QM7A 4X45A 4H4EA 5LOVF 1ODTC 4Y8VA 3KPJA 4ZRDA 1JKMA 4JGBA 4XB6B 4TXHA 2O2IA 3E81A 2P9CA 4WQMA 3TO5A 3O8NA 2ZZNA 4G5HA 4EO9A 2CLFB 3DZKA 1N9ZA 4V0NA 3ZD8A 3FNHA 3M4NA 4NS4A 5ENDA 1KZ6A 2Z2XA 4UMEA 4FFLA 1C30A 4LDQA 1LVUA 5FBZA 1ISJA 2E21A 1W75A 4NDNE 4R2WA 1QIGA 4PGFA 1VJ0A 3R09A 1GQFA 2OBBA 3IERA 4MWSA 2BDTA 5FQNA 5JH7F 4WI1A 1VPDA 2QROA 2VK8A 4I6EA 3WLAA 3AVWA 1JNXX 4GX1A 2OXTA 4C3OB 5IU6A 5I9TA 2WM3A 5LQDA 2Y2UA 1TUEA 5JSHA 2W2KA 2FEKA 3RFVA 3MEQA 5SY6A 2CJFA 2QZ4A 5B3KA 5CFMA 3NW9A 1WU7A 4PCAA 3SZMA 5J2TA 1D7AA 3BD9A 1KE1A 2FP4B 3UJPA 6ABPA 2IS2A 1K3FA 3GLGB 1U2DC 3A0UA 3MYYA 1CT9A 2BI4A 4HDQB 1FQKA 1P2FA 2LD4A 1CHDA 2DPHA 1OH8A 1GRRA 2DCMA 4MEJA 5IJXA 3L02A 5KTNA 4IUBS 1H05A 1MZVA 1UP6A 3TJMA 5HMLA 3HJCA 1IHUA 2J3QA 2AEEA 4R98A 3D6UA 1FDUA 3B7PA 2PIDA 3BWEA 3PXEA 1TQ8A 4G8CA 2QL5A 1QKIA 3SJAA 5JS2A 2ZUUA 3HDJA 5FP0A 4INPA 2WICA 1FNDA 4R1NA 1KERA 1SKYB 2F90A 1WPXA 1M6VB 3WK4A 3WLQA 1IK4A 3P32A 2IV7A 2CXHA 2QSZA 2CLKB 1KEEB 1WMFA 2DSTA 2WYIA 2BJVA 1FY2A 1GXSB 3U3JA 3UT6A 1YKSA 1CP3A 1ULSA 2OV6A 1MJ5A 2GTIA 2H31A 2I71A 4O4HF 2OXIA 2KMLA 4JYBA 4M4SA 1ESMA 1MJGA 1UM9A 2VNAA 2QNRA 3PNKA 3ULKA 4H6VA 3VA7A 4BV8A 2WU0A 4JU9A 1EX1A 2A4KA 2POQX 4R2LA 1V1MB 4AJOA 4MR7A 4YQZA 1JE1A 2C3UA 3TZQA 3DZGA 3RIHA 3WZ2A 3JAWB 1ADBA 1I2BA 2Q4BA 5CGZA 3FETA 3ZV5A 1W5EA 1WMBA 3H8SA 2YJGA 2SICE 4NEQA 2ENUA 1P0QA 5GAJA 3W3ZB 3O90A 4ZQGA 1T8TA 5ALFA 1FUYB 5EUCA 1EYZA 2BZSA 4LBVA 4QVGA 3RC7A 4FDVA 3T1OA 2V7QA 1N7JA 3OE1A 1BHO1 1CRZA 1BN6A 1KYZA 2ES4A 1EK1A 1LF0A 1PTJA 1E4VA 1U2RA 2BEUB 2H2WA 3A4NA 3WQSB 2CXPA 3BXEA 3VOTA 1IQUA 5A5EA 2V0CA 2PSFA 1J56A 3I3SR 2B78A 1E7QA 3AH8A 1SKBA 1ZN8A 3FWKA 3K4PA 3V2GA 2OO3A 1W46A 1T3HA 4JYMA 1VMIA 2YV1A 3OI7A 1T0JB 2LCFA 5LXTF 4I36A 3SXJA 4EW2A 4ZYZA 5ALSA 1M6WA 5DW3A 1SA0B 2C4HA 3L9XA 3PRYA 2PD3A 2QLMA 2XODA 4JJIA 2L19A 2ZJ7A 4Z4IA 3WKAA 4EB8A 1BXGB 1J22A 2X13A 1EBBA 1W88B 1A5AB 3K6SB 1IC6A 2GDZA 2B9VA 5JQGB 5ITVA 3D4IA 5CH3A 1E2JA 4C6TB 2GBPA 4Z53A 2V54A 3U9SA 1KZYC 2WAAA 1R00A 4KFUA 1QHFA 2R8EA 4QL3A 3T3NA 1R1DA 4MVJF 2PEYA 2ZKLA 1Z6AA 2GEKA 4ILEA 4YRCA 5PNTA 1I2ZA 2UYGA 2XCQA 3JRWA 4D5GA 3Q1KA 3IUPA 2RCYA 5KYGA 5LFAA 1TA9A 4DUYB 3UMVA 3Q2IA 4B3SB 2JARA 2UU9B 2H1CA 1J0CA 3VR4D 4BBJA 2QHXA 4ZPXA 2J08A 4UU0A 3FAZA 3EULA 3SJZA 4DMHA 4GM1A 1QJ4A 3OQHA 3VUEA 1I33A 2OD7A 3FAKA 4JLWA 4US2R 1VJTA 2BN4A 3IIJA 4DLKA 3M9WA 2GVZC 3QPVA 5FYQA 2EGUA 4Q7EA 4ANFA 4RTLA 3OQNA 2G25A 4MINA 3WYGA 1VB3A 3WB1A 2ZKIA 4WPGA 4IJ6A 3NCTA 3GGPA 1EFVB 2C57A 1DKRA 1GGJA 2J87A 4YX9A 2RKBA 4GKJB 1WV1A 2ONJA 1ZXLA 3AZQA 4W63A 3EOBI 2QIPA 3ITEA 2BTQA 1L4YA 4YRRA 4B3HA 1ENYA 1OT3A 2W2QA 3FN4A 2P9HA 2ZCVA 1BW9B 2ZBUA 1SBIA 2CFTA 2IOHA 3VPGA 3L8FA 4HRXA 4YRTA 2OQ2A 3IBTA 3OJWA 1N8KA 3P9IA 3AY3A 3ZXIA 4R5HA 5B57C 1G6KA 2VHEA 2HJVA 3SICE 1WZNA 1DQNA 2XCLA 1GPWB 3GFQA 2ZP1A 4LF4B 1F8GA 4NOMA 3IODA 4XIIA 5J47A 3LJKA 3DEAA 4HN2A 2PGLA 1S1CA 2R6GA 2WKPA 1I10A 3QBEA 4C4RA 3ODGA 3IOYA 3TJRA 5AH0A 1O95C 4BZZA 2DPYA 1PGJA 1RHJA 3S2FA 2QW8A 1WDTA 4QDOA 3ENKA 4U7JA 1S8FA 3KJZA 3VKFA 3LP5A 3ZGOA 1VIVA 4GO1A 5ELMA 2C7GA 3EG5A 1HDGO 5C35A 3L8CA 1Q0ZA 4DLLA 5KTYA 5F98A 1R9GA 1YHYA 2W6JA 1EGVB 1N2JA 3IAEA 3DOCA 1AF7A 3EH2A 1SXHA 4RSRA 1AO3A 2YWXA 2HN9A 3F7OA 4KXNA 4XSGA 4Y2YA 3RS3A 2PVSA 2X58A 3JQAA 3KPWA 5JSUA 4C5CA 1Z17A 2AXQA 4GYJA 5DSZA 5T6MA 3HBLA 3W8DA 3R3ZA 6NULA 5KWVA 1HKUA 1TEVA 2HO4A 16PKA 1U8TA 1XHFA 2R4QA 1VGRA 3CHYA 4OHRA 5EN4A 4EPXA 4B45A 1HLDA 4D4LA 1LK0A 1OYOA 1R8SA 4OHVA 5JC1A 1NVWQ 4M38A 4QTYA 2H0RA 3OJFA 2ZJ6A 5DHRA 3A27A 2UVPA 1C5KA 1W8DA 2HGSA 2YMPA 3RSQA 3ICCA 1JXAA 4L15A 5H4HA 3NXSA 2X5KO 4J3FA 5KNDD 3QYFA 4N49A 1GR1A 2Y0PA 5LUAA 3U7GA 1P8AA 2P2SA 2DCUA 3FCUB 5DIZA 5E1OA 3CUUA 3GLHA 3UW3A 2FN9A 5CYGA 5D1HA 5E6RB 1CIJA 4WKCA 2RG7A 3KSMA 3SIXA 4MVJD 5I7EA 2W6ID 4ERXA 4F46A 2HSEA 4PS1A 3Q1LA 1IBSA 1V5IA 2YHBA 5ALYA 4QWMA 3V1NA 2AC4A 2RGNA 1E1MA 4D98A 3INGA 2IYXA 1O4VA 3V7FA 2XA2A 3DBVO 4I46A 1UM9B 4C7OA 4HAYA 2P3SA 2GA9A 3UO8B 1YZNA 3EWSA 4I50A 4PNHA 1LWOA 4R16A 5JY6A 4I0WB 2FEMA 2OQRA 5JSQA 4LZJA 4Y0NA 1PSDA 4H1UA 4PLWA 5I7UA 5D86A 1EDOA 4GBGA 4IDEA 4BBPA 3A1WA 2HU2A 2ORIA 1R8JA 1NVVR 3C6QA 1SQ5A 3JW8A 4FI3F 5GVRA 4OHZA 1G8YA 3SDSA 3QPAA 4JLDA 2HK6A 3UAXA 3IHTA 1IMJA 1Z38A 4XLZA 2NPFA 5TJHA 4BCCA 1A9RA 4MNTA 1JDBC 1RXCA 3QU5A 4WCFA 3FUVA 4CEIB 3NS7A 4BMSA 4CG3A 2XRMA 2W2NA 3MT8A 4DL9A 4RQUA 1DXQA 3PHLA 1RZ3A 4F12A 2NWQA 1G0OA 3DDUA 5F73A 1CQIB 3ABZA 7MDHA 2AKYA 3CRNA 3FJYA 3ZG6A 1ZHHA 4F71A 1BKDR 5LWHA 1KWGA 1G41A 1MT3A 3BIWA 4O4IA 4XPIA 1J7JA 1STOA 1YOVA 3HP4A 3SYTA 5U9CA 4R41A 4ZQEA 4Q19A 5G1PA 2WIBA 1T9GR 2VHXA 1JDPA 3QEAZ 1AGPA 3COWA 3MTQA 5IDWA 3RVRA 5BUQA 1WP4A 4JFRA 1Z8NA 2PWAA 2VWHA 5HILA 1WQ4A 1MJNA 2HJGA 3WJAA 3WQQA 5LBIA 4AXBA 2AJLI 4HEA6 1QE3A 3V9PA 3ZJUA 1KS9A 3PD7A 3NRJA 1V1RA 4AMZA 1FFDA 4FMDF 1CUCA 1LXCA 3EIQA 5LUBA 2YOFA 2Z5LA 1T26A 4O0MA 5LLDA 3B6EA 3TSAA 1JAYA 4URWR 4NE2A 2XE8A 1QQ6A 3CG4A 4ZC8A 1GAJA 2VPYA 3ZBUA 2PH3A 1C29B 4RCYA 4X7MA 4E21A 3TFOA 4B33A 2DOKA 3V7WA 2ZSBA 2QTBA 2WK1A 1E64A 1XDWA 2FSPA 2V0NA 4TXLA 3ZI4A 1T5DX 2I67A 3BULA 4OB6A 3DEZA 3WMRA 3LX5A 4N5IX 2OCBA 4AQYB 3D8SA 4KV9A 1ZU5A 3PHGA 3KTAA 1ZJ6A 4PZCA 3A1NA 4JBWA 2XD9A 4QYSA 1W0KD 1EI9A 1L5YA 1PBNA 2JLRA 3ADKA 4OO3A 1ST2A 3F6PA 3L06A 4Y6PA 5FA5A 4C9BA 2X8BA 3JR3A 2OESA 4B4UA 3Q8XB 1D1SA 5DGXA 4XFDA 3H9GA 3EZFA 3TVDA 3AKEA 2ZBDA 4DN6A 2OAP1 4Y3UA 1YDEA 1YUNA 1PR5A 5B4UA 2JCXA 2EGHA 3HA3A 3RKSA 1ZM4A 2EU8A 3GJ0A 1RKBA 3UXHA 4D8WA 2X0EA 4EENA 3HG7A 2BTQB 2WJJA 2WKWA 4Y9DA 1ZM9A 1K9SA 1OJLA 4HNAB 4KUEA 4AROA 4BLWA 4ALJA 3W3AH 4HUQA 4EY3A 5J2UF 4UCWA 3TLAA 4N01A 3HS3A 2PX2A 5IH7A 2A67A 5GM2A 1S8OA 4OXXA 5A3SA 3H9BA 2MSWA 4QNMA 3KETA 5D6OA 3AR7A 1G38A 1XAIA 4EYKA 2HCJB 3OZDA 4BMPB 4MCAA 5EWJA 2WTAA 4JJFA 3LH5A 3Q9NA 1AB6A 3P0EA 4WESA 5KWSA 1HYEA 4N82A 2YC4C 4AYTA 3OZEA 1YU9A 3NEJA 3C3MA 3H18A 1PP4A 3JPWA 4JT9A 1M2FA 2MSDB 3U3RA 3I92A 4CG0A 3DL4A 1I51A 2VYVA 5KUTA 1TPYA 1R0SA 4KBYA 3N2LA 4UU8A 5CH5A 2FPIA 2ZIGA 1QIEA 3PNQA 5K1ZA 3WL8A 5JLJA 1KAHA 3TKAA 4A2WA 3V34A 2HM7A 3AHCA 5K4HA 3DZDA 3N2YA 1T1GA 3N2GA 1I80A 4UHDA 1JDVA 4C0AC 1OXTA 4IGAA 4ZP1A 2P9TA 3VM6A 1KR5A 4HPWA 4ZGBA 1Z4NA 3MGGA 3SSMA 1RWKA 3BB3A 4WK2B 5AKJA 3OJOA 3LVBA 4MRRA 2O23A 3OBIA 4H1HA 1JHAA 1H2BA 1DC8A 1E9FA 2HNKA 3C8UA 2MDTA 4G1UC 1EA7A 1JZQA 3FTQA 3PR3A 3SSAA 1UEXC 4R1LA 1T6XA 2ANCA 4X1OA 4B0PA 2HU7A 5KNCD 5HBRA 4X1IA 5JO9A 4QNNA 4DMKA 4NZPA 5TQ0A 5K03A 1QYIA 2F00A 3EF1A 2NVUA 4JCOA 3ES9A 3T6KA 3QM1A 4RCZA 3TLGA 1GWNA 3N2KA 4IFTA 4OXIA 4Q82A 4YAWA 5EWMA 3KZCA 3S7TA 4D9FA 1E1QD 3NWEA 3HL0A 3FCSB 4NBUA 3VC7A 3W5VA 3FLMA 2NP7A 2XD4A 4KE6A 5LQSA 3I58A 3T3HA 4F3TA 1I2AA 3WYFA 4IIJB 2GEDA 3M33A 1KBOA 5FUVA 3QTTA 1F2UA 2C5AA 1Z3IX 4HVCA 5IBRA 4U63A 5C34B 4C7OB 1PU2A 8MHTA 4J7AA 3A6ZA 3UTDA 1OH7A 1WCYA 1R74A 1U63A 4Z4FA 3QGMA 4AKTA 1XKLA 3NETA 1XZNA 2WVGA 4FYHA 4QBKA 1EUDA 5JROA 1GVHA 4MWEA 5ADUS 1W85B 3OCVA 4ALMA 3MT0A 1BDMA 2WKRA 2XQGA 4J1QA 1M6EX 3A1DA 2RAFA 1R3UA 3R8CA 1OXUA 1WHSA 2VDLB 3KEOA 4IW3B 5LBUA 4UVHA 4DDMA 2Z6UA 2CV2A 4WCFB 1S1MA 1LZKA 1RBQA 1WZUA 1ZU4A 5EJ6A 5JTUA 1UDBA 1JG4A 2GERA 1VL5A 2AKAB 2I6QA 5I7AA 4EFDA 3FLAA 4AULA 3DWGA 2BC9A 5KNBA 3I0MA 4O2BF 4KXFB 4Q9KA 2XOKA 3P94A 1BWSA 1TMOA 3GT4A 3AOEC 4BO2A 4C1BA 1XPUA 2L2QA 3B9QA 1VE9A 4WBNB 4YIKA 4ZYYA 3IKLA 4BMYA 3DCNA 5CA0F 3AF0A 4H3SA 4DXDA 4KMSA 1GEEA 3L5OA 3D4NA 4C30A 4HLQB 1GUAA 1DBVO 1M5UA 2E82A 2JIBA 4EI2A 1VMAA 1U28C 5IZCC 1KJYA 3JQPA 4L2IA 1GLVA 3VO2A 4MMYB 2PWPA 4MYCA 1KDOA 1DDIA 5IT5A 3W77A 1JMKC 4HB0A 4NY1A 1AKTA 3DO6A 4Q1VA 4CR7A 4DIUA 1W5FA 3H5LA 1RVV1 3A1TA 4DJFC 3DKKA 3BGDA 1DCKA 2PUJA 4WOKA 4BMDA 3CKYA 4ZCLA 1K68A 2GK6A 3WIUA 1S96A 4LHSA 1ZBDA 5JD5A 3IT2A 4WT7A 2HBYA 1VDZA 5E3HA 1ORWA 5CEEA 2IGBA 3H99A 5HW0A 3FRHA 3T1NA 1ESCA 2JFGA 1QF7A 1OREA 1EIWA 1R37A 1VJDA 3UGJA 3TW0A 4ER3A 4YRDA 4NESA 3G0HA 1C1XA 5FOQA 5CTJA 2IC5A 2FFAA 3A7DA 1S3GA 4NFYA 3DM9B 3ILXA 1DFIA 1X1EA 4RVCA 4Y2JA 4BB5A 4EG3A 5ILOA 4HD8A 3GA0A 5HCIA 3AJRA 1JPNA 4CMEA 2LCIA 3RYFA 1I1NA 2OBNA 3QVSA 2HMUA 2I2XB 3OCUA 4XEHA 4YJ2F 5KDLA 5K8TA 2YVAA 3ESAA 3O3OB 2EFDB 1QZ3A 2KYRA 4LNHA 1A8QA 4A2CA 2X7HA 2VJNA 4QFBA 4I55A 5L3QB 1X0XA 3AY7A 4U39A 5AYVA 3SIRA 3SYNA 4W5JA 5EINA 4I9HA 5E2AA 1FDSA 3O2NA 5LP1A 4U5QA 1RWQA 3NIBA 1Q19A 3NWJA 1PJRA 3LP6A 5CNKA 5BQ3A 3MAAC 1LPSA 4I3GA 4MS4B 2QV7A 1PF7E 1B1AA 1A4RA 4KVGA 5EJ7A 4QDKA 4H27A 2OBLA 5EWJB 1AA6A 4G5GA 1FU4A 1QMGA 4WESB 5T6BA 2PMEA 2MT9A 3PS9A 2YIVX 2FB9A 2WQ6A 1AUQA 4JA0A 4ZK6A 1IUOA 5AW8A 2PGXA 4PG4A 4D4GA 5C7OO 1GADO 3GFVA 4Z51A 2ZR7A 2DT5A 2X9VA 4Q1EA 4NAVA 3TR5A 4TTIA 1PZNA 1NVXQ 1C4OA 1H3FA 2VDQB 1FXWF 1Q83A 5L7YA 4K86A 1VE1A 2OORC 5LR6A 1F2TB 1P75A 2YWFA 3GAAA 3GR6A 3I4FA 3RFFA 3UB3A 1H0RA 2DGDA 4IF6A 1G42A 4QASA 4R7ZA 2FMTA 1IN6A 2GCGA 2I91A 5TMBA 3GVPA 3H5TA 2VBIA 4IDAA 1CEXA 1SCDA 2FZKA 3ZX5A 1K89A 1L6IA 3OPYI 1FW8A 4XIYA 5AM0A 5A7HA 2HDHA 2QYHA 1NN5A 2FE1A 4YAKA 2VCEA 4X1IB 3N9IA 1ZM2A 2DPGA 1BROA 3CB2A 3FDFA 4J3NA 1QVVA 5DLQC 1WMEA 2WPDD 1UMBA 4YNBA 4GPEA 3TRJA 5CVEA 2NVUB 1EFPA 1KF0A 5FNVF 2BMFA 3WL6A 5HR5A 1VJRA 1AQUA 1YZ3A 2ZRLA 4CKEA 5C81A 2PA3A 3EZ6A 3SJ7A 4Y2VA 5DTRA 3NYRA 1RI3A 4MUGA 2QU8A 1BJRE 3K8ZA 1U5AA 3P26A 2YMQA 1G9XA 3OOWA 1IUKA 4UCFA 1L4NA 1MOZA 4J4BA 3AFMA 1G2PA 5KTTA 4K9RA 5JRDS 3W5DA 3I83A 1XCMA 4JI4B 5E9AA 3T9CA 3UATA 4QUBA 4MKRA 1GNQA 3GLFA 3LXUX 3DBRA 4QBTA 1RZRA 2WP8J 3KJQA 1W59A 2MINA 2UUPA 3HI4A 2G63A 4JOSA 4R1PA 3DV2A 2IS1A 4IFIA 2QRZA 4KN6A 4L4YA 2J31A 3T7RA 3QMVA 3PF8A 3ZWVA 1WHSB 3OZUA 3KOZA 3O8QA 2A7XA 2O2SA