3QF2A

Crystal structure of nalp3 pyd
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
90
structure length
90
Chain Sequence
STRCKLARYLEDLEDVDLKKFKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of NALP3 Protein Pyrin Domain (PYD) and Its Implications in Inflammasome Assembly
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords NACHT, LRR and PYD domains-containing protein 3
total genus 32
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02758 PYRIN PAAD/DAPIN/Pyrin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 3qf2A00
2N1FA 2MB9A 2N83A 1D2ZA 2L6AA 2A9IA 3J6JA 3EZQA 1E3YA 4E9MA 2KN6A 2OF5A 3MOPG 2G7RA 2D96A 4F42A 1UCPA 1CY5A 4A2WA 2YGSA 2NAQA 4RHWE 2L9MA 4FH0A 4O6XA 4F44A 2GF5A 2MS7A 2OF5H 2N00A 4O9LA 4N1KA 4LWDA 4O7QA 2F1SA 2N7ZA 2MN4A 2BBRA 3T6PA 2YU0A 4JQWA 1D2ZB 2NZ7A 2O71A 4D8OA 1NGRA 4M9XA 2B1WA 2YVIA 2YQFA 3LQRA 3YGSC 2BBZA 1WMGA 1WH4A 4EWIA 1Z6TA 4QOBA 2VGQA 1A1ZA 4P4HA 3J63A 2A5YB 4A2QA 1N3KA 2HM2Q 2M5VA 3CL3A 1E41A 4IZAB 2MS8A 1DGNA 3EZQB 4DWNA 1ICHA 4UZ0A 2IB1A 2DO9A 2DBGA 1WXPA 3MOPK 4I16A 4M9SA 3MOPA 2N80A 1DDFA 4N1JA 1YGOA 2DBFA 2KM6A 2P1HA 4IZ7B 2N97A 2LWEA 2LWDA 4IZ5E 4RHWA 1CWWA 1C15A 3KATA 4P4HI 3QF2A 1A1WA 4JUPA 3CRDA 3LQQA 1PN5A 2MPCA 4NQKA 4O9FA 3YGSP 1FADA 4ZBWA 2LS7A 4N1LA 2NSNA 2DBHA 4M9ZA 2DBDA
chains in the Genus database with same CATH superfamily
2N1FA 2MB9A 2N83A 1D2ZA 2L6AA 2A9IA 3J6JA 3EZQA 1E3YA 4E9MA 2KN6A 2OF5A 3MOPG 2G7RA 2D96A 4F42A 1UCPA 1CY5A 4A2WA 2YGSA 2NAQA 4RHWE 2L9MA 4FH0A 4O6XA 2MJMA 4F44A 2GF5A 2MS7A 2OF5H 2N00A 4O9LA 4N1KA 4LWDA 4O7QA 2F1SA 2N7ZA 2MN4A 2BBRA 3T6PA 2YU0A 4JQWA 1D2ZB 2NZ7A 2O71A 4D8OA 1NGRA 4M9XA 2B1WA 2YVIA 2YQFA 3LQRA 3YGSC 2BBZA 1WMGA 1WH4A 4EWIA 1Z6TA 4QOBA 2VGQA 1A1ZA 4P4HA 3J63A 2A5YB 4A2QA 1N3KA 2HM2Q 2M5VA 3CL3A 1E41A 4IZAB 2MS8A 1DGNA 3EZQB 4DWNA 1ICHA 4UZ0A 2IB1A 2DO9A 2DBGA 1WXPA 3MOPK 4I16A 4M9SA 3MOPA 2N80A 1DDFA 4N1JA 1YGOA 2DBFA 2KM6A 2XV9A 2P1HA 4IZ7B 2N97A 2LWEA 2LWDA 4IZ5E 4RHWA 1CWWA 1C15A 3KATA 4P4HI 3QF2A 1A1WA 4JUPA 3CRDA 3LQQA 1PN5A 2MPCA 4NQKA 4O9FA 3YGSP 1FADA 4ZBWA 2LS7A 4N1LA 2NSNA 2DBHA 4M9ZA 2DBDA
chains in the Genus database with same CATH topology
2N1FA 2MB9A 2N83A 1D2ZA 2L6AA 2A9IA 3J6JA 3EZQA 1E3YA 4E9MA 2KN6A 2OF5A 3MOPG 2G7RA 2D96A 4F42A 1UCPA 1CY5A 4A2WA 2YGSA 2NAQA 4RHWE 2L9MA 4FH0A 4O6XA 2MJMA 4F44A 2GF5A 2MS7A 2OF5H 2N00A 4O9LA 4N1KA 4LWDA 4O7QA 2F1SA 2N7ZA 2MN4A 2BBRA 3T6PA 2YU0A 4JQWA 1D2ZB 2NZ7A 2O71A 4D8OA 1NGRA 4M9XA 2B1WA 2YVIA 2YQFA 3LQRA 3YGSC 2BBZA 1WMGA 1WH4A 4EWIA 1Z6TA 4QOBA 2VGQA 1A1ZA 4P4HA 3J63A 2A5YB 4A2QA 1N3KA 2HM2Q 2M5VA 3CL3A 1E41A 4IZAB 2MS8A 1DGNA 3EZQB 4DWNA 1ICHA 4UZ0A 2IB1A 2DO9A 2DBGA 1WXPA 3MOPK 4I16A 4M9SA 3MOPA 2N80A 1DDFA 4N1JA 1YGOA 2DBFA 2KM6A 2XV9A 2P1HA 4IZ7B 2N97A 2LWEA 2LWDA 4IZ5E 4RHWA 1CWWA 1C15A 3KATA 4P4HI 3QF2A 1A1WA 4JUPA 3CRDA 3LQQA 1PN5A 2MPCA 4NQKA 4O9FA 3YGSP 1FADA 4ZBWA 2LS7A 4N1LA 2NSNA 2DBHA 4M9ZA 2DBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1F A;  2MB9 A;  2N83 A;  1D2Z A;  2L6A A;  2A9I A;  3J6J A;  3EZQ A;  1E3Y A;  4E9M A;  2KN6 A;  2OF5 A;  3MOP G;  2G7R A;  2D96 A;  4F42 A;  1UCP A;  1CY5 A;  4A2W A;  2YGS A;  2NAQ A;  4RHW E;  2L9M A;  4FH0 A;  4O6X A;  4F44 A;  2GF5 A;  2MS7 A;  2OF5 H;  2N00 A;  4O9L A;  4N1K A;  4LWD A;  4O7Q A;  2F1S A;  2N7Z A;  2MN4 A;  2BBR A;  3T6P A;  2YU0 A;  4JQW A;  1D2Z B;  2NZ7 A;  2O71 A;  4D8O A;  1NGR A;  4M9X A;  2B1W A;  2YVI A;  2YQF A;  3LQR A;  3YGS C;  2BBZ A;  1WMG A;  1WH4 A;  4EWI A;  1Z6T A;  4QOB A;  2VGQ A;  1A1Z A;  4P4H A;  3J63 A;  2A5Y B;  4A2Q A;  1N3K A;  2HM2 Q;  2M5V A;  3CL3 A;  1E41 A;  4IZA B;  2MS8 A;  1DGN A;  3EZQ B;  4DWN A;  1ICH A;  4UZ0 A;  2IB1 A;  2DO9 A;  2DBG A;  1WXP A;  3MOP K;  4I16 A;  4M9S A;  3MOP A;  2N80 A;  1DDF A;  4N1J A;  1YGO A;  2DBF A;  2KM6 A;  2P1H A;  4IZ7 B;  2N97 A;  2LWE A;  2LWD A;  4IZ5 E;  4RHW A;  1CWW A;  1C15 A;  3KAT A;  4P4H I;  3QF2 A;  1A1W A;  4JUP A;  3CRD A;  3LQQ A;  1PN5 A;  2MPC A;  4NQK A;  4O9F A;  3YGS P;  1FAD A;  4ZBW A;  2LS7 A;  4N1L A;  2NSN A;  2DBH A;  4M9Z A;  2DBD A; 
#chains in the Genus database with same CATH topology
 2N1F A;  2MB9 A;  2N83 A;  1D2Z A;  2L6A A;  2A9I A;  3J6J A;  3EZQ A;  1E3Y A;  4E9M A;  2KN6 A;  2OF5 A;  3MOP G;  2G7R A;  2D96 A;  4F42 A;  1UCP A;  1CY5 A;  4A2W A;  2YGS A;  2NAQ A;  4RHW E;  2L9M A;  4FH0 A;  4O6X A;  2MJM A;  4F44 A;  2GF5 A;  2MS7 A;  2OF5 H;  2N00 A;  4O9L A;  4N1K A;  4LWD A;  4O7Q A;  2F1S A;  2N7Z A;  2MN4 A;  2BBR A;  3T6P A;  2YU0 A;  4JQW A;  1D2Z B;  2NZ7 A;  2O71 A;  4D8O A;  1NGR A;  4M9X A;  2B1W A;  2YVI A;  2YQF A;  3LQR A;  3YGS C;  2BBZ A;  1WMG A;  1WH4 A;  4EWI A;  1Z6T A;  4QOB A;  2VGQ A;  1A1Z A;  4P4H A;  3J63 A;  2A5Y B;  4A2Q A;  1N3K A;  2HM2 Q;  2M5V A;  3CL3 A;  1E41 A;  4IZA B;  2MS8 A;  1DGN A;  3EZQ B;  4DWN A;  1ICH A;  4UZ0 A;  2IB1 A;  2DO9 A;  2DBG A;  1WXP A;  3MOP K;  4I16 A;  4M9S A;  3MOP A;  2N80 A;  1DDF A;  4N1J A;  1YGO A;  2DBF A;  2KM6 A;  2XV9 A;  2P1H A;  4IZ7 B;  2N97 A;  2LWE A;  2LWD A;  4IZ5 E;  4RHW A;  1CWW A;  1C15 A;  3KAT A;  4P4H I;  3QF2 A;  1A1W A;  4JUP A;  3CRD A;  3LQQ A;  1PN5 A;  2MPC A;  4NQK A;  4O9F A;  3YGS P;  1FAD A;  4ZBW A;  2LS7 A;  4N1L A;  2NSN A;  2DBH A;  4M9Z A;  2DBD A; 
#chains in the Genus database with same CATH homology
 2N1F A;  2MB9 A;  2N83 A;  1D2Z A;  2L6A A;  2A9I A;  3J6J A;  3EZQ A;  1E3Y A;  4E9M A;  2KN6 A;  2OF5 A;  3MOP G;  2G7R A;  2D96 A;  4F42 A;  1UCP A;  1CY5 A;  4A2W A;  2YGS A;  2NAQ A;  4RHW E;  2L9M A;  4FH0 A;  4O6X A;  2MJM A;  4F44 A;  2GF5 A;  2MS7 A;  2OF5 H;  2N00 A;  4O9L A;  4N1K A;  4LWD A;  4O7Q A;  2F1S A;  2N7Z A;  2MN4 A;  2BBR A;  3T6P A;  2YU0 A;  4JQW A;  1D2Z B;  2NZ7 A;  2O71 A;  4D8O A;  1NGR A;  4M9X A;  2B1W A;  2YVI A;  2YQF A;  3LQR A;  3YGS C;  2BBZ A;  1WMG A;  1WH4 A;  4EWI A;  1Z6T A;  4QOB A;  2VGQ A;  1A1Z A;  4P4H A;  3J63 A;  2A5Y B;  4A2Q A;  1N3K A;  2HM2 Q;  2M5V A;  3CL3 A;  1E41 A;  4IZA B;  2MS8 A;  1DGN A;  3EZQ B;  4DWN A;  1ICH A;  4UZ0 A;  2IB1 A;  2DO9 A;  2DBG A;  1WXP A;  3MOP K;  4I16 A;  4M9S A;  3MOP A;  2N80 A;  1DDF A;  4N1J A;  1YGO A;  2DBF A;  2KM6 A;  2XV9 A;  2P1H A;  4IZ7 B;  2N97 A;  2LWE A;  2LWD A;  4IZ5 E;  4RHW A;  1CWW A;  1C15 A;  3KAT A;  4P4H I;  3QF2 A;  1A1W A;  4JUP A;  3CRD A;  3LQQ A;  1PN5 A;  2MPC A;  4NQK A;  4O9F A;  3YGS P;  1FAD A;  4ZBW A;  2LS7 A;  4N1L A;  2NSN A;  2DBH A;  4M9Z A;  2DBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...