3QF3A

Crystal structure of espr transcription factor from mycobacterium tuberculosis
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
131
structure length
131
Chain Sequence
STTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRSGNRTNPSGATMAALANFFRIKAAYFTDDEYYEKLDKELQWLCTMRDDGVRRIAQRAHGLPSAAQQKVLDRIDELRRAEGIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atypical DNA recognition mechanism used by the EspR virulence regulator of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords ESX-1 secretion-associated regulator EspR
total genus 45
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3qf3A00
1ZZ7A 3IVPA 3CROL 1NERA 1PNRA 1RZSA 2OFYA 1WH6A 2LYPA 1Y7YA 1POUA 2PPXA 2WUSR 1PRVA 3FMYA 3RZZA 2WIUB 3PXPA 4X4HA 1HF0A 1AU7A 2ICTA 2XIUA 2LYJA 2AWIA 2LYRA 3QQ6A 2BJCA 3CLCA 2MEZA 4X4GA 3R1FA 2KEJA 1ZPQA 4IA8A 4Z5CA 3F51A 2MQKA 1ZZ6A 1QP4A 3KXAA 4PU4C 4Z5DA 2IVQA 1QP0A 3GN5B 2CSFA 2LYSA 2JCGA 2LYQA 4YG7B 1IC8A 1UXCA 3GN5A 2LYLA 2AXVA 3DNVB 1B0NA 1VPWA 1RZRD 2BNMA 3FYMA 3ZHIA 3OQNA 4X4EA 1BDHA 1WETA 1ZS4A 3SCHA 1PRAA 4Z58A 2KEIA 1Y9QA 2AW6A 2D5VA 2PUDA 4JQDA 2O38A 4PU7A 1ZZ8A 5A7LA 4Z59A 1JH9A 1LQCA 5K98B 1PERL 3SCFA 3OMTA 2IUOA 1DWKA 3U3WA 1GT0C 2PUCA 4X4FA 4Y42A 1WIZA 3LISA 1NEQA 4GHJA 2EBYA 2XJ3A 2IVBA 2XCJA 2EWTA 3MLFA 4X4DA 1ZZCA 2JVLA 2KEKA 2R63A 1X57A 1CQTA 4IVZA 3H5TA 4J1WA 3JXBC 4YG4A 3QWGA 2AXZA 4PU3C 1LMB3 1JFTA 4X4CA 1O4XA 2KZ8A 4FN3A 2HINA 1RIOA 1ZAYA 1E3OC 2CROA 3EUSA 3JXDL 1X2LA 2HSGA 3QYXA 2GRMA 2LCVA 3JXCL 2BNNA 1ZZBA 3CECA 2GRLA 3BS3A 3BDNA 3S8QA 1RPEL 1QQBA 1ZZ9A 1YSEA 4I6TA 3D1NI 2AXUA 1QQAA 2O49A 3TRBA 1L1MA 3KJXA 2IV1A 4J1XA 4MCXA 2LYKA 4O8BA 1OCTC 3QF3A 2O4AA 2ICPA 2R1JL 1R69A 2KPJA 1EFAA 4I8TA 1DW9A 3OP9A 4YBAA 2IU7A 4Z5HA 1R63A 2GZUA 2A6CA 4F8DA 2PUBA 3B7HA 3OQMA 1SQ8A 1QP7A 2OR1L 4I6UA 2PUFA 3LFPA 3ZKCA 1XWRA 4MCTA 4YARA 1UTXA 2FJRA 4GQMA 2BNOA 3OQOA 1RZRA 4JCYA 1UXDA 3KZ3A 4YG1A 2B5AA 3UFDA 4IWRA 4NDWA 2XI8A 3HZIB 2H8RA 3L1PA 2IVGA 2PUEA 4I6RA 2PIJA 1ZUGA 2PUAA 3BD1A 1BDIA 3ZHMA 1OSLA 3VK0A 2L8NA 1S7EA 4JCXA 4X4IA 4FBIA 1CJGA 2EF8A 1ADRA 1PRUA 3SCGA 2PE5A 3G5GA 2XSDC 1WH8A 1LLIA 4PU8A 2L49A 1JWLA 2AUWA 3FYAA 3O9XA 3F52A 1ZVVA 1JFSA 4OB4A 3G7DA 1LCCA 1LCDA 1QPZA 3GBFA 4X4BA 3F6WA 2PUGA
chains in the Genus database with same CATH superfamily
3CROL 3DM5A 3FMYA 1PRVA 4ER5A 2LYJA 2ODRD 3QQ6A 3CLCA 2BJCA 2MEZA 1ZPQA 4Z5CA 2MQKA 4PU4C 2IVQA 2LYSA 1VPWA 3GN5A 2BNMA 1WETA 2J7WA 1JH9A 1LQCA 3ME5A 1HQ1A 3NROA 3U3WA 4X4FA 2LLWA 4GHJA 2EBYA 2EWTA 4X4DA 2KEKA 1X57A 1CQTA 4J1WA 3QWGA 4HRAA 3QOXA 2KZ8A 1RIOA 1E3OC 3QYXA 3GUUA 1RPEL 2LCVA 3BS3A 2PXDA 2PXQA 3D1NI 1QQAA 3A9XA 1OCTC 2O4AA 1R69A 2KPJA 1DW9A 2IU7A 2GZUA 3PE5A 3ZPXA 1XWRA 2BNOA 4JCYA 1UXDA 3UFDA 1QB2A 2XI8A 1ZUGA 2HCSA 1OSLA 3VK0A 4FBIA 2PE5A 3G5GA 3TELA 2AUWA 3FYAA 5GAGi 5DRYA 1NW3A 2LLVA 1NERA 1HF0A 2WIUB 2ICTA 2LYRA 3MEJA 3F51A 1ZZ6A 1QP4A 4Z5DA 3GN5B 4DE8A 3FYMA 5JUWA 3NZLA 1ZS4A 1PRAA 4Z58A 2KEIA 1Y9QA 2D5VA 4JQDA 4EQZA 1ZZ8A 1PERL 3SCFA 3GZCA 4EZIA 4Y42A 3LISA 2XJ3A 2MXDA 2JVLA 2R63A 4IVZA 2FFHA 4PU3C 4DE9A 2LNMA 3SR4A 4FN3A 2HINA 1ZAYA 2PXBA 2CROA 5DTQA 2J7UA 2M4HA 3OWQA 2O49A 1L1MA 3KJXA 2YBDA 2PXLA 4ER6A 4O8BA 2HCNA 2R1JL 3R09A 3OP9A 4YBAA 1R63A 3GZDA 3OQMA 5GAHi 4I6UA 3LFPA 3OQOA 1RZRA 4YG1A 1DULA 5DT2A 4IWRA 3HZIB 3L1PA 2IVGA 4I6RA 2PXKA 2PUAA 3BD1A 1S7EA 4JCXA 4ER7A 2XSDC 1WH8A 1LLIA 3O9XA 3LQXA 3F52A 1ZVVA 1LCDA 4X4BA 3OKZA 1RZSA 2OFYA 1Y7YA 2WUSR 4X4HA 3PXPA 1AU7A 2XIUA 4EKIA 4X4GA 2KEJA 4IA8A 3KXAA 4OBMA 4EK9A 4YG7B 2LYQA 2JCGA 1IC8A 1UXCA 2AXVA 1B0NA 3A9ZA 3QFIA 3OQNA 1BDHA 4X4EA 3NDBB 4ER0A 2PXEA 3GZDC 1QZXA 2O38A 4PU7A 4Z59A 5K98B 3OMTA 1DWKA 2PUCA 2V3CC 2XXPA 1U2ZA 2IVBA 3MLFA 1ZZCA 3F6WA 4YG4A 3QOWA 1LMB3 4X4CA 2BNNA 1ZZBA 3CECA 3S8QA 1QQBA 3SX0A 1YSEA 3UWPA 4ER3A 2PXUA 2XXQA 3TRBA 1MFQC 2IV1A 4MCXA 2LYKA 3QF3A 2ICPA 4I8TA 4Z5HA 2PXTA 3B7HA 1QP7A 2OR1L 2PUFA 1SQ8A 3ZKCA 4MCTA 4YARA 1UTXA 4GQMA 3KL4A 2B5AA 2JQEA 2H8RA 1BDIA 3ZHMA 2L8NA 4X4IA 2EF8A 1PRUA 3SCGA 4Q2JA 2PXFA 4OB4A 1LCCA 3GBFA 1ZZ7A 3IVPA 1PNRA 1WH6A 2LYPA 2PPXA 1POUA 3RZZA 3VWSA 2AWIA 3R1FA 1QP0A 3TEPA 2CSFA 2PUDA 3M9LA 5DTRA 2LYLA 3DNVB 1RZRD 3ZHIA 3SCHA 2AW6A 2L1PA 5A7LA 3A9YA 2IUOA 1GT0C 2HFZA 1WIZA 1NEQA 2PXPA 2XCJA 3H5TA 3JXBC 5DRTA 2AXZA 1JFTA 1O4XA 3JXDL 3EUSA 1X2LA 2HSGA 2GRMA 3JXCL 3G0TA 3BDNA 2GRLA 1ZZ9A 4I6TA 2AXUA 2XXAA 5DTMA 4J1XA 2VEOA 1EFAA 5DSXA 2A6CA 4F8DA 2PUBA 2FJRA 3KZ3A 4EKGA 2PXVA 4NDWA 2PUEA 2PIJA 3TFLA 4WVLA 1CJGA 1ADRA 4PU8A 2L49A 1JWLA 1JFSA 3G7DA 3NXHA 1QPZA 2PUGA
chains in the Genus database with same CATH topology
1ZZ7A 3IVPA 3CROL 1NERA 1PNRA 1RZSA 2OFYA 1WH6A 2LYPA 1Y7YA 1POUA 2PPXA 2WUSR 1PRVA 3FMYA 3RZZA 2WIUB 3PXPA 4X4HA 1HF0A 1AU7A 2ICTA 2XIUA 2LYJA 2AWIA 2LYRA 3QQ6A 2BJCA 3CLCA 2MEZA 4X4GA 3R1FA 2KEJA 1ZPQA 4IA8A 4Z5CA 3F51A 2MQKA 1ZZ6A 1QP4A 3KXAA 4PU4C 4Z5DA 2IVQA 1QP0A 3GN5B 2CSFA 2LYSA 2JCGA 2LYQA 4YG7B 1IC8A 1UXCA 3GN5A 2LYLA 2AXVA 3DNVB 1B0NA 1VPWA 1RZRD 2BNMA 3FYMA 3ZHIA 3OQNA 4X4EA 1BDHA 1WETA 1ZS4A 3SCHA 1PRAA 4Z58A 2KEIA 1Y9QA 2AW6A 2D5VA 2PUDA 4JQDA 2O38A 4PU7A 1ZZ8A 5A7LA 4Z59A 1JH9A 1LQCA 5K98B 1PERL 3SCFA 3OMTA 2IUOA 1DWKA 3U3WA 1GT0C 2PUCA 4X4FA 4Y42A 1WIZA 3LISA 1NEQA 4GHJA 2EBYA 2XJ3A 2IVBA 2XCJA 2EWTA 3MLFA 4X4DA 1ZZCA 2JVLA 2KEKA 2R63A 1X57A 1CQTA 4IVZA 3H5TA 4J1WA 3JXBC 4YG4A 3QWGA 2AXZA 4PU3C 1LMB3 1JFTA 4X4CA 1O4XA 2KZ8A 4FN3A 2HINA 1RIOA 1ZAYA 1E3OC 2CROA 3EUSA 3JXDL 1X2LA 2HSGA 3QYXA 2GRMA 2LCVA 3JXCL 2BNNA 1ZZBA 3CECA 2GRLA 3BS3A 3BDNA 3S8QA 1RPEL 1QQBA 1ZZ9A 1YSEA 4I6TA 3D1NI 2AXUA 1QQAA 2O49A 3TRBA 1L1MA 3KJXA 2IV1A 4J1XA 4MCXA 2LYKA 4O8BA 1OCTC 3QF3A 2O4AA 2ICPA 2R1JL 1R69A 2KPJA 1EFAA 4I8TA 1DW9A 3OP9A 4YBAA 2IU7A 4Z5HA 1R63A 2GZUA 2A6CA 4F8DA 2PUBA 3B7HA 3OQMA 1SQ8A 1QP7A 2OR1L 4I6UA 2PUFA 3LFPA 3ZKCA 1XWRA 4MCTA 4YARA 1UTXA 2FJRA 4GQMA 2BNOA 3OQOA 1RZRA 4JCYA 1UXDA 3KZ3A 4YG1A 2B5AA 3UFDA 4IWRA 4NDWA 2XI8A 3HZIB 2H8RA 3L1PA 2IVGA 2PUEA 4I6RA 2PIJA 1ZUGA 2PUAA 3BD1A 1BDIA 3ZHMA 1OSLA 3VK0A 2L8NA 1S7EA 4JCXA 4X4IA 4FBIA 1CJGA 2EF8A 1ADRA 1PRUA 3SCGA 2PE5A 3G5GA 2XSDC 1WH8A 1LLIA 4PU8A 2L49A 1JWLA 2AUWA 3FYAA 3O9XA 3F52A 1ZVVA 1JFSA 4OB4A 3G7DA 1LCCA 1LCDA 1QPZA 3GBFA 4X4BA 3F6WA 2PUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZZ7 A;  3IVP A;  3CRO L;  1NER A;  1PNR A;  1RZS A;  2OFY A;  1WH6 A;  2LYP A;  1Y7Y A;  1POU A;  2PPX A;  2WUS R;  1PRV A;  3FMY A;  3RZZ A;  2WIU B;  3PXP A;  4X4H A;  1HF0 A;  1AU7 A;  2ICT A;  2XIU A;  2LYJ A;  2AWI A;  2LYR A;  3QQ6 A;  2BJC A;  3CLC A;  2MEZ A;  4X4G A;  3R1F A;  2KEJ A;  1ZPQ A;  4IA8 A;  4Z5C A;  3F51 A;  2MQK A;  1ZZ6 A;  1QP4 A;  3KXA A;  4PU4 C;  4Z5D A;  2IVQ A;  1QP0 A;  3GN5 B;  2CSF A;  2LYS A;  2JCG A;  2LYQ A;  4YG7 B;  1IC8 A;  1UXC A;  3GN5 A;  2LYL A;  2AXV A;  3DNV B;  1B0N A;  1VPW A;  1RZR D;  2BNM A;  3FYM A;  3ZHI A;  3OQN A;  4X4E A;  1BDH A;  1WET A;  1ZS4 A;  3SCH A;  1PRA A;  4Z58 A;  2KEI A;  1Y9Q A;  2AW6 A;  2D5V A;  2PUD A;  4JQD A;  2O38 A;  4PU7 A;  1ZZ8 A;  5A7L A;  4Z59 A;  1JH9 A;  1LQC A;  5K98 B;  1PER L;  3SCF A;  3OMT A;  2IUO A;  1DWK A;  3U3W A;  1GT0 C;  2PUC A;  4X4F A;  4Y42 A;  1WIZ A;  3LIS A;  1NEQ A;  4GHJ A;  2EBY A;  2XJ3 A;  2IVB A;  2XCJ A;  2EWT A;  3MLF A;  4X4D A;  1ZZC A;  2JVL A;  2KEK A;  2R63 A;  1X57 A;  1CQT A;  4IVZ A;  3H5T A;  4J1W A;  3JXB C;  4YG4 A;  3QWG A;  2AXZ A;  4PU3 C;  1LMB 3;  1JFT A;  4X4C A;  1O4X A;  2KZ8 A;  4FN3 A;  2HIN A;  1RIO A;  1ZAY A;  1E3O C;  2CRO A;  3EUS A;  3JXD L;  1X2L A;  2HSG A;  3QYX A;  2GRM A;  2LCV A;  3JXC L;  2BNN A;  1ZZB A;  3CEC A;  2GRL A;  3BS3 A;  3BDN A;  3S8Q A;  1RPE L;  1QQB A;  1ZZ9 A;  1YSE A;  4I6T A;  3D1N I;  2AXU A;  1QQA A;  2O49 A;  3TRB A;  1L1M A;  3KJX A;  2IV1 A;  4J1X A;  4MCX A;  2LYK A;  4O8B A;  1OCT C;  3QF3 A;  2O4A A;  2ICP A;  2R1J L;  1R69 A;  2KPJ A;  1EFA A;  4I8T A;  1DW9 A;  3OP9 A;  4YBA A;  2IU7 A;  4Z5H A;  1R63 A;  2GZU A;  2A6C A;  4F8D A;  2PUB A;  3B7H A;  3OQM A;  1SQ8 A;  1QP7 A;  2OR1 L;  4I6U A;  2PUF A;  3LFP A;  3ZKC A;  1XWR A;  4MCT A;  4YAR A;  1UTX A;  2FJR A;  4GQM A;  2BNO A;  3OQO A;  1RZR A;  4JCY A;  1UXD A;  3KZ3 A;  4YG1 A;  2B5A A;  3UFD A;  4IWR A;  4NDW A;  2XI8 A;  3HZI B;  2H8R A;  3L1P A;  2IVG A;  2PUE A;  4I6R A;  2PIJ A;  1ZUG A;  2PUA A;  3BD1 A;  1BDI A;  3ZHM A;  1OSL A;  3VK0 A;  2L8N A;  1S7E A;  4JCX A;  4X4I A;  4FBI A;  1CJG A;  2EF8 A;  1ADR A;  1PRU A;  3SCG A;  2PE5 A;  3G5G A;  2XSD C;  1WH8 A;  1LLI A;  4PU8 A;  2L49 A;  1JWL A;  2AUW A;  3FYA A;  3O9X A;  3F52 A;  1ZVV A;  1JFS A;  4OB4 A;  3G7D A;  1LCC A;  1LCD A;  1QPZ A;  3GBF A;  4X4B A;  3F6W A;  2PUG A; 
#chains in the Genus database with same CATH topology
 3CRO L;  3DM5 A;  3FMY A;  1PRV A;  4ER5 A;  2LYJ A;  2ODR D;  3QQ6 A;  3CLC A;  2BJC A;  2MEZ A;  1ZPQ A;  4Z5C A;  2MQK A;  4PU4 C;  2IVQ A;  2LYS A;  1VPW A;  3GN5 A;  2BNM A;  1WET A;  2J7W A;  1JH9 A;  1LQC A;  3ME5 A;  1HQ1 A;  3NRO A;  3U3W A;  4X4F A;  2LLW A;  4GHJ A;  2EBY A;  2EWT A;  4X4D A;  2KEK A;  1X57 A;  1CQT A;  4J1W A;  3QWG A;  4HRA A;  3QOX A;  2KZ8 A;  1RIO A;  1E3O C;  3QYX A;  3GUU A;  1RPE L;  2LCV A;  3BS3 A;  2PXD A;  2PXQ A;  3D1N I;  1QQA A;  3A9X A;  1OCT C;  2O4A A;  1R69 A;  2KPJ A;  1DW9 A;  2IU7 A;  2GZU A;  3PE5 A;  3ZPX A;  1XWR A;  2BNO A;  4JCY A;  1UXD A;  3UFD A;  1QB2 A;  2XI8 A;  1ZUG A;  2HCS A;  1OSL A;  3VK0 A;  4FBI A;  2PE5 A;  3G5G A;  3TEL A;  2AUW A;  3FYA A;  5GAG i;  5DRY A;  1NW3 A;  2LLV A;  1NER A;  1HF0 A;  2WIU B;  2ICT A;  2LYR A;  3MEJ A;  3F51 A;  1ZZ6 A;  1QP4 A;  4Z5D A;  3GN5 B;  4DE8 A;  3FYM A;  5JUW A;  3NZL A;  1ZS4 A;  1PRA A;  4Z58 A;  2KEI A;  1Y9Q A;  2D5V A;  4JQD A;  4EQZ A;  1ZZ8 A;  1PER L;  3SCF A;  3GZC A;  4EZI A;  4Y42 A;  3LIS A;  2XJ3 A;  2MXD A;  2JVL A;  2R63 A;  4IVZ A;  2FFH A;  4PU3 C;  4DE9 A;  2LNM A;  3SR4 A;  4FN3 A;  2HIN A;  1ZAY A;  2PXB A;  2CRO A;  5DTQ A;  2J7U A;  2M4H A;  3OWQ A;  2O49 A;  1L1M A;  3KJX A;  2YBD A;  2PXL A;  4ER6 A;  4O8B A;  2HCN A;  2R1J L;  3R09 A;  3OP9 A;  4YBA A;  1R63 A;  3GZD A;  3OQM A;  5GAH i;  4I6U A;  3LFP A;  3OQO A;  1RZR A;  4YG1 A;  1DUL A;  5DT2 A;  4IWR A;  3HZI B;  3L1P A;  2IVG A;  4I6R A;  2PXK A;  2PUA A;  3BD1 A;  1S7E A;  4JCX A;  4ER7 A;  2XSD C;  1WH8 A;  1LLI A;  3O9X A;  3LQX A;  3F52 A;  1ZVV A;  1LCD A;  4X4B A;  3OKZ A;  1RZS A;  2OFY A;  1Y7Y A;  2WUS R;  4X4H A;  3PXP A;  1AU7 A;  2XIU A;  4EKI A;  4X4G A;  2KEJ A;  4IA8 A;  3KXA A;  4OBM A;  4EK9 A;  4YG7 B;  2LYQ A;  2JCG A;  1IC8 A;  1UXC A;  2AXV A;  1B0N A;  3A9Z A;  3QFI A;  3OQN A;  1BDH A;  4X4E A;  3NDB B;  4ER0 A;  2PXE A;  3GZD C;  1QZX A;  2O38 A;  4PU7 A;  4Z59 A;  5K98 B;  3OMT A;  1DWK A;  2PUC A;  2V3C C;  2XXP A;  1U2Z A;  2IVB A;  3MLF A;  1ZZC A;  3F6W A;  4YG4 A;  3QOW A;  1LMB 3;  4X4C A;  2BNN A;  1ZZB A;  3CEC A;  3S8Q A;  1QQB A;  3SX0 A;  1YSE A;  3UWP A;  4ER3 A;  2PXU A;  2XXQ A;  3TRB A;  1MFQ C;  2IV1 A;  4MCX A;  2LYK A;  3QF3 A;  2ICP A;  4I8T A;  4Z5H A;  2PXT A;  3B7H A;  1QP7 A;  2OR1 L;  2PUF A;  1SQ8 A;  3ZKC A;  4MCT A;  4YAR A;  1UTX A;  4GQM A;  3KL4 A;  2B5A A;  2JQE A;  2H8R A;  1BDI A;  3ZHM A;  2L8N A;  4X4I A;  2EF8 A;  1PRU A;  3SCG A;  4Q2J A;  2PXF A;  4OB4 A;  1LCC A;  3GBF A;  1ZZ7 A;  3IVP A;  1PNR A;  1WH6 A;  2LYP A;  2PPX A;  1POU A;  3RZZ A;  3VWS A;  2AWI A;  3R1F A;  1QP0 A;  3TEP A;  2CSF A;  2PUD A;  3M9L A;  5DTR A;  2LYL A;  3DNV B;  1RZR D;  3ZHI A;  3SCH A;  2AW6 A;  2L1P A;  5A7L A;  3A9Y A;  2IUO A;  1GT0 C;  2HFZ A;  1WIZ A;  1NEQ A;  2PXP A;  2XCJ A;  3H5T A;  3JXB C;  5DRT A;  2AXZ A;  1JFT A;  1O4X A;  3JXD L;  3EUS A;  1X2L A;  2HSG A;  2GRM A;  3JXC L;  3G0T A;  3BDN A;  2GRL A;  1ZZ9 A;  4I6T A;  2AXU A;  2XXA A;  5DTM A;  4J1X A;  2VEO A;  1EFA A;  5DSX A;  2A6C A;  4F8D A;  2PUB A;  2FJR A;  3KZ3 A;  4EKG A;  2PXV A;  4NDW A;  2PUE A;  2PIJ A;  3TFL A;  4WVL A;  1CJG A;  1ADR A;  4PU8 A;  2L49 A;  1JWL A;  1JFS A;  3G7D A;  3NXH A;  1QPZ A;  2PUG A; 
#chains in the Genus database with same CATH homology
 1ZZ7 A;  3IVP A;  3CRO L;  1NER A;  1PNR A;  1RZS A;  2OFY A;  1WH6 A;  2LYP A;  1Y7Y A;  1POU A;  2PPX A;  2WUS R;  1PRV A;  3FMY A;  3RZZ A;  2WIU B;  3PXP A;  4X4H A;  1HF0 A;  1AU7 A;  2ICT A;  2XIU A;  2LYJ A;  2AWI A;  2LYR A;  3QQ6 A;  2BJC A;  3CLC A;  2MEZ A;  4X4G A;  3R1F A;  2KEJ A;  1ZPQ A;  4IA8 A;  4Z5C A;  3F51 A;  2MQK A;  1ZZ6 A;  1QP4 A;  3KXA A;  4PU4 C;  4Z5D A;  2IVQ A;  1QP0 A;  3GN5 B;  2CSF A;  2LYS A;  2JCG A;  2LYQ A;  4YG7 B;  1IC8 A;  1UXC A;  3GN5 A;  2LYL A;  2AXV A;  3DNV B;  1B0N A;  1VPW A;  1RZR D;  2BNM A;  3FYM A;  3ZHI A;  3OQN A;  4X4E A;  1BDH A;  1WET A;  1ZS4 A;  3SCH A;  1PRA A;  4Z58 A;  2KEI A;  1Y9Q A;  2AW6 A;  2D5V A;  2PUD A;  4JQD A;  2O38 A;  4PU7 A;  1ZZ8 A;  5A7L A;  4Z59 A;  1JH9 A;  1LQC A;  5K98 B;  1PER L;  3SCF A;  3OMT A;  2IUO A;  1DWK A;  3U3W A;  1GT0 C;  2PUC A;  4X4F A;  4Y42 A;  1WIZ A;  3LIS A;  1NEQ A;  4GHJ A;  2EBY A;  2XJ3 A;  2IVB A;  2XCJ A;  2EWT A;  3MLF A;  4X4D A;  1ZZC A;  2JVL A;  2KEK A;  2R63 A;  1X57 A;  1CQT A;  4IVZ A;  3H5T A;  4J1W A;  3JXB C;  4YG4 A;  3QWG A;  2AXZ A;  4PU3 C;  1LMB 3;  1JFT A;  4X4C A;  1O4X A;  2KZ8 A;  4FN3 A;  2HIN A;  1RIO A;  1ZAY A;  1E3O C;  2CRO A;  3EUS A;  3JXD L;  1X2L A;  2HSG A;  3QYX A;  2GRM A;  2LCV A;  3JXC L;  2BNN A;  1ZZB A;  3CEC A;  2GRL A;  3BS3 A;  3BDN A;  3S8Q A;  1RPE L;  1QQB A;  1ZZ9 A;  1YSE A;  4I6T A;  3D1N I;  2AXU A;  1QQA A;  2O49 A;  3TRB A;  1L1M A;  3KJX A;  2IV1 A;  4J1X A;  4MCX A;  2LYK A;  4O8B A;  1OCT C;  3QF3 A;  2O4A A;  2ICP A;  2R1J L;  1R69 A;  2KPJ A;  1EFA A;  4I8T A;  1DW9 A;  3OP9 A;  4YBA A;  2IU7 A;  4Z5H A;  1R63 A;  2GZU A;  2A6C A;  4F8D A;  2PUB A;  3B7H A;  3OQM A;  1SQ8 A;  1QP7 A;  2OR1 L;  4I6U A;  2PUF A;  3LFP A;  3ZKC A;  1XWR A;  4MCT A;  4YAR A;  1UTX A;  2FJR A;  4GQM A;  2BNO A;  3OQO A;  1RZR A;  4JCY A;  1UXD A;  3KZ3 A;  4YG1 A;  2B5A A;  3UFD A;  4IWR A;  4NDW A;  2XI8 A;  3HZI B;  2H8R A;  3L1P A;  2IVG A;  2PUE A;  4I6R A;  2PIJ A;  1ZUG A;  2PUA A;  3BD1 A;  1BDI A;  3ZHM A;  1OSL A;  3VK0 A;  2L8N A;  1S7E A;  4JCX A;  4X4I A;  4FBI A;  1CJG A;  2EF8 A;  1ADR A;  1PRU A;  3SCG A;  2PE5 A;  3G5G A;  2XSD C;  1WH8 A;  1LLI A;  4PU8 A;  2L49 A;  1JWL A;  2AUW A;  3FYA A;  3O9X A;  3F52 A;  1ZVV A;  1JFS A;  4OB4 A;  3G7D A;  1LCC A;  1LCD A;  1QPZ A;  3GBF A;  4X4B A;  3F6W A;  2PUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...