3QFEA

Crystal structures of a putative dihydrodipicolinate synthase family protein from coccidioides immitis
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
314
structure length
305
Chain Sequence
MVPRVPQPGIWCPAVTFFDSKTDTLDLASQERYYAYLARSGLTGLVILGTNAEAFLLTREERAQLIATARKAVGPDFPIMAGVGAHSTRQVLEHINDASVAGANYVLVLPPAYATTPPVIKSFFDDVSCQSPLPVVIYNFPGIDLDSDMITTIARKNPNVVGVKLTCASVGKITRLAATLPPAAFSVFGGQSDFLIGGLSVGSAGCIAAFANVFPKTVSKIYELYKAGKVDQAMELHRKAALAESPCGIATTKYAAAIFSAKAAGIEDAEEKLRPRKPYDPPSEAAKQEVRKVMAEVAAIEAGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a putative dihydrodipicolinate synthase family protein from Coccidioides immitis
rcsb
source organism Coccidioides immitis
molecule tags Lyase
molecule keywords Putative dihydrodipicolinate synthase family protein
total genus 113
structure length 305
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qfeA00
4L4MA 3VE7A 3G1FA 2NUYA 3NQ6A 3HGJA 3SI9A 3TXZA 3UNDA 1U5JA 4UNKA 1SO3A 3M6YA 3UYCA 1HL2A 3UWYA 1OJXA 1H51A 3H55A 1FDJA 5G2WA 2RDTA 1D3GA 3WJSA 2CZEA 4ADUA 3TNOA 4FHAA 1OF8A 1N55A 2NV2A 4XZ9A 5AOUA 3HPXA 3P8IA 3NM1A 3W7LA 2X1UA 1EEPA 4LV4A 1A5BA 4O8RA 3RLUA 1L6YA 1KM5A 3OVQA 1VGAA 3HB9A 1ME9A 3S0CA 1GPWA 2OJPA 4WQ6A 1KM4A 1I2QA 2A4AA 3DH7A 3TFXA 1TPDA 3L0KA 3OIXA 3LV6A 2BSLA 3B03A 4NJJA 1Q6LA 5AHMA 1AL7A 1TO3A 1H7RA 1BWLA 3QRHA 4DO5A 4UFMA 1KFCA 2VEIA 4LU0A 4OHQA 4JX5A 1S5TA 1SZEA 1XUUA 3B0PA 3LB0A 3JRKA 1XBYA 3S1XA 2B7QA 1R2TA 2NLIA 3CHVA 3N9RA 4Q33A 1VR6A 4RZ6A 4GUFA 3S5ZA 3BW3A 1Y0EA 3QSTA 1LRQA 1KFJA 4RCXA 1WAUA 4PC8A 1I2PA 2VFDA 4M6VA 6ALDA 1RD5A 4FNRA 3QMRA 3DFQA 5H91A 1A5AA 3PG9A 2VFFA 3B0VC 1VYSX 3PUEA 2WSQA 1LM1A 1DOSA 3PUDA 5AN7A 4GC4A 1QPOA 4PODA 1Q6QA 1S3HA 3W1XA 3I7QA 1FCUA 2ZA3A 1QFEA 2V2HA 1DJQA 3FA5A 1QOQA 1LBFA 4H6KA 3W70A 1TPFA 5AFDA 3G0XA 1OVDA 4DBDA 4I9AA 1TPH1 2AAMA 4JY9A 3BLFA 3DAQA 4M7SA 3NQFA 3FYOA 4UMCA 3P60A 2R94A 3MP5A 3G1XA 2A21A 2A2IA 2WNNA 3C56A 5IM51 5D02A 4I7WA 2ZFAA 5A8GA 1F76A 3LCGA 2YSWA 2ZRVA 4AF0B 2RHGA 1ALDA 3BG9A 4MZ1A 2GQAA 4K8HA 3EKZA 3M5ZA 4NXKA 5CSRA 3MI3A 3FJ6A 5I3GA 2ZDRA 3T7VA 2G96A 2TMDA 1SO4A 1VHNA 3CEPA 3GLCA 4HKPA 1I2OA 4CQ8A 5KSWA 1FXPA 3GX9A 3P7YA 3LI0A 3LOTA 4UTUA 4XKYB 2OMAA 1TQJA 2Z2UA 2V30A 2YYUA 3O06A 3EWZA 1X1ZA 1KBJA 4UTTA 4A2SA 3NQGA 5KMYA 1KW1A 3H54A 1H1YA 3TSDA 3TU9A 1R2SA 3W2JA 1W1ZA 4ONVA 1WA3A 1GEQA 3IGSA 3NM3A 4BF9A 3NQVA 1AL8A 5F4XA 4AEOA 5FF2A 1NAL1 1VYPX 1B4EA 3QYQA 1B9BA 1VCVA 3DHDA 1H1ZA 3GYEA 1NVMA 3M5VA 1XI3A 1F6PA 1FXQA 2WQPA 4FNUA 1TPEA 1QOPA 2GQ9A 2E5CA 3DI0A 5I3HA 3TSMA 3IRDA 5DN1A 2FIQA 4DQWA 2Q8ZA 4AXKA 3STGA 4O54A 1MXSA 3PS7A 3NDOA 4O11A 4XKYA 1RR2A 3WJZA 3N19B 4DPQA 3EEGA 2JKPA 1JUKA 3CWNA 1C29A 4AH7A 1RQEA 4R33A 3W1PA 5EKYA 2CZ5A 4AWUA 3GXPA 4XBKA 3C2FA 2PURA 3B4UA 1YTEA 1IXQA 4JTTA 5DCDA 1TPUA 3W23A 2RKXA 1O4UA 5I3FA 1VPXA 3G18A 5KTLA 2QDGA 3W7HA 4M7TA 4S2BA 1TV5A 3W1RA 1TB3A 5HJLA 4BWLA 3IEBA 3O63A 4HPXA 2GVGA 4LRTA 2VFEA 4AF0A 3MWAA 3HPSA 3S5YA 2I1OA 1VYRA 4NZJA 3NQMA 1KM2A 2PRHA 5KZMA 3PR2A 4XTDA 3EXTA 4ZQRA 4Z1DA 1H7OA 5D04C 3PB0A 4RX0A 3QW3A 3FIGA 4O18A 4X9SA 5C6MA 3PY2A 4EVZA 5DY3A 1BTMA 3TV8A 4KWWA 3O1NA 4UTIA 1T0OA 4U28A 3V75A 3U8GA 2DZPA 5CZ0A 4O17A 3DI1A 3GB6A 2QJHA 3DXIA 2NV1A 3PULA 3NXFA 2YXGA 3IIVA 1LOQA 4CCDA 1QO2A 3NG3A 4RLIA 3F4NA 3BG3A 4LW7A 1ZALA 1SR9A 2I9EA 2QUUA 2V9DA 3KFTA 3B05A 4UMAA 1OYCA 2JKAA 4NNAA 5LGZA 1W3TA 2NUXA 3EX6A 3W71A 3M9YA 4FNTA 3UPBA 4S2CA 2QUTA 4PEKA 5AYZA 1SZFA 2ISVA 3GDMA 2Z1BA 3BARA 2VFIA 4TR9A 3BPWA 3GAYA 2VFGA 2NX1A 3C2EA 3TA6A 5HQEA 2VKZG 1F6KA 4CQAA 2W0UA 4JDBA 4K8EA 4K37A 1OG0A 3RFAA 4DF1A 3DGRA 3DFNA 1SZNA 1O5KA 4NX5A 1WBHA 3O15A 1AW5A 1IXPA 3FLUA 1QPRA 3E96A 1FY6A 1YXCA 3LXBA 3BG5A 4FNPA 3TCEA 4JXCA 4MKNA 2YZRA 3W1AA 4FIRA 1PIIA 1EUAA 1H7XA 1JRBA 3QEZA 3TW6A 3W22A 3DKLA 3I68A 3S5OA 1K3UA 3KXQA 4O28A 1FWWA 5LGXA 1OX4A 2JGQA 4JYDA 1RPXA 4RZ5A 3EWBX 3L5AA 1OX6A 4O12A 4O10A 3OVPA 3CPRA 4JICA 1I2RA 2FDSA 3EX2A 1SZGA 1XXXA 4E2BA 3M1ZA 4O50A 4ORMA 1MZHA 3NVTA 1TRIA 3ATYA 1JUBA 3GDTA 4JR5A 3LHVA 4FX7A 1GVQA 3A9IA 1DKWA 3F03K 2CLOA 5GVJA 4UXDA 4Y90A 3ZFHA 3A21A 2B4GA 3G3DA 4HHPA 2NX9A 1ME8A 3LGEA 2ZZ3A 4CLMA 1O5XA 2B7NA 2CLEA 2UV8G 3U2OA 2Y63A 3E12A 1SSGA 1TPB1 1GOXA 2C3ZA 2DZUA 4O4WA 5AB3A 3M47A 2WSRA 1G4SA 1R2RA 3PG8A 5TIMA 1BWKA 3LM7A 5FI8A 1VCGA 3NPWA 5E93A 5HULA 3RU6A 3A24A 3O16A 2J24A 1SUXA 3CB8A 4OWGA 4WY0F 1A5SA 3LHUA 3IGUA 3OVRA 1MEIA 5EY5A 4S1FA 4C1LA 1YADA 5DELA 1EUNA 1TJPA 3HOJA 3MHFA 3LRMA 3NL6A 3L0GA 3W2KA 1G7VA 2XN2A 5LZLA 3PSWA 3Q37A 1MSSA 5J5DA 4OGZA 2A6LA 1QAPA 1TMHA 5G1TA 8TIMA 5BOOA 3IV3A 1LZOA 1F05A 1AK5A 4UTHA 4PL1A 2Y61A 3CWOX 1TTQA 1X6UA 2QF7A 4HNVA 5CPNA 1VQTA 1KFEA 3WJWA 4IMFA 4DXVA 3QQ1A 4KFPA 3CQ0A 4M6QA 4IX2A 4Z1BA 2YFNA 1VRDA 2VXNA 1Q45A 3LCXA 3LV5A 5HUPA 5AHIA 2GVLA 4MY1A 3UQNA 3MP4A 4JS3A 1IIHA 5AYXA 5SWUA 1NF0A 1K7FA 4M19A 1KLYA 4PFMA 3GXTA 3C52A 1ONRA 3M7WA 5K9XA 2V2DA 4JEQA 4OQVA 3SECA 4X3ZA 4BR1A 3B0UX 1XBXA 1QPNA 1QNVA 1YPIA 1XBZA 4IX0A 1P0NA 4ICNA 3W1UA 1SSDA 4MYXA 1Q6OA 5CPOA 1EA0A 3HG5A 2Y62A 3LTYA 3NPVA 4TO8A 1FWSA 3HG3A 3BW4A 2ZTJA 3T44A 3B04A 4RZ4A 3W7RA 4AAJA 3EX3A 1F2JA 1I2NA 1HFBA 1SQ7A 1LBLA 5DLCA 3F1QA 5DBTA 4LC8A 5AYYA 1HO1A 1Z48A 1QPQA 4JTSA 4OT7A 2V82A 3LCFA 1P5BA 4JDYA 2P1FA 2GVJA 2C6QA 1OYBA 5EL1A 2VFHA 4WD0A 1WX0A 4FXRA 1W5PA 3TQVA 4GWEA 4UCGA 3STEA 4Y6GA 4Y8FA 3GNNA 1YYAA 2NX3A 1TTIA 5IBXA 3G3MA 1KM6A 4CCEA 3G8EA 2A7RA 3BK0A 4O52A 4LVAA 1OX5A 1FDZA 1G7UA 3N9SA 2Q8LA 1KV5A 3TX9A 1TPC1 2E6DA 4MZYA 3S1UA 4C1KA 4ZVJA 2RDWA 2FPTA 2P10A 3QZEA 1T99A 2BXVA 1EB3A 2O7SA 3G1HA 4J9JA 1GYNA 1G4EA 3C2OA 5F2LA 2CWNA 3W75A 3W7KA 2BZNA 3GZ3A 3C2RA 2WPBA 3PWAA 5HINA 3FKRA 1ZFJA 2NUWA 4IGHA 2F7FA 4DPPA 4N2YA 1F5ZA 3D0CA 3CT7A 2A5HA 3P84A 4GBUA 3Q58A 3R5EA 3GDLA 1QR7A 1ZENA 3S5NA 1OFAA 3SFKA 1FUYA 3PSVA 3G24A 1G4TA 4NXSA 4IPIA 1WV2A 4MIMA 1K02A 2CLIA 4R53A 5D33A 1C9DA 1P4CA 4OV4A 1VS1A 3SR7A 2R91A 1Z42A 4YXGA 3UWVA 4O14A 3W1MA 2FFCA 1WOBA 1SW3A 2Z6IA 3LTPA 3TIMA 1NFBA 2QCDB 2X16A 3ELFA 4POCA 5LNSA 2EAWA 1PHWA 4BK9A 4NJHA 1ADOA 2ZZ2A 2W6RA 2ALDA 4JYEA 1Q3NA 1TTJA 3YPIA 1TRDA 2C0AA 1GZGA 2VC6A 4AWTA 3HG2A 4I7UA 1SU5A 5HR6A 2Y89A 4RXFA 1J5TA 1IXOA 4TMBA 4H4IA 2OCZA 4BI6A 3QM3A 1M6JA 1JCJA 2D73A 3W83A 1B57A 2E09A 2BTMA 4O57A 2QCMA 1XFBA 3DFOA 5DXYA 4IMDA 2ZZ5A 4BFAA 3BV4A 1ME7A 3L9CA 4MY9A 1CW2A 2ZQ0A 3HO8A 3KVMA 1KA9F 3R89A 3EXSA 3KAOA 1QDSA 3P5ZA 4JTUA 4JTJA 2EKCA 3W1LA 1XC4A 3L2IA 1TV7A 4NNBA 1FCBA 4GRSA 4Q4KA 2H8XA 3G8RA 3W7EA 1G67A 2DZSA 3S9YA 3NQCA 3O6CA 4EWND 4IUOA 1AW1A 4QITA 5L6UA 4JTEA 1LRNA 1JR1A 4JTLA 3DENA 4MJMA 3GDKA 3GKAA 3UXDA 4YCOA 3GK0A 3P61A 2GQ8A 2E5BA 3EWUA 2CLMA 5AHEA 4EIVA 2V8ZA 2ZRUA 2PCQA 1W3NA 4GUIA 1TPWA 4ADTA 5K9DA 4TIMA 4U4MA 3QJAA 4MY8A 3K30A 1XM3A 2C15A 1V7YA 1E51A 2QCNA 2X30A 5CKSA 3NQEA 4LOCA 1L6SA 1YDVA 3GDRA 2J88A 4WY0B 1GT8A 3E0IA 2RH9A 4IMGA 4TU1A 1TQXA 3O07A 5D05A 3RF9A 1FCVA 1K8YA 4N6EA 3OA3A 2ZZ7A 3W9ZA 3W1NA 4IWWA 1EP3A 4MVAA 4DO4A 2ZTKA 1RQHA 3W88A 1AG1O 1TV8A 1TYGA 1OFDA 4FIQA 1Z44A 4LS0A 4TX9A 4UMBA 5DCEA 3N14A 3WK3A 1FQ0A 4UR7A 4FEZA 3O05A 3HG4A 1L6WA 1R30A 4ALDA 4JTIA 4DBEA 1GWJA 1H61A 2P0OA 5C2XA 1KV8A 2I14A 2YFOA 3PBYA 4K39A 5LHEA 4MJZA 3JS3A 4FXSA 2DJLA 3NNTA 4Z0SA 3W7PA 2YDAA 4PL2A 4MYAA 1DQXA 4JTGA 1IXNA 2F84A 5MHBA 1LOLA 2J9XA 3RLVA 3DHFA 3MYOA 1VCFA 2WSYA 3UWZA 3LXCA 4E38A 5LHFA 4QQ3A 4K38A 4AMAA 1VH7A 3NOEA 3C8FA 2Y7FA 2CLKA 2ATSA 3S42A 4ORIA 1PHQA 1JCMP 4ZQCA 1NF7A 5CG7A 3R13A 3HQ1A 2Y7EA 3MI6A 4HIBA 3W72A 5D2TA 3ZWTA 3G1SA 1SW7A 5HNRA 5F2MA 3DZ1A 1W54A 1ZNNA 1WBJA 5E1QA 3FS2A 4HPJA 5F2IA 1EWDA 1OABA 3LXAA 3LDVA 1H62A 3MBDA 3L68A 3W7NA 1W56A 1BEUA 3QQ0A 4DELA 5F2GA 3M5XA 3STFA 2Y70A 4NNCA 3NQAA 3G1AA 2J27A 3R8RA 3B06A 3P5YA 3NL2A 3O6DA 4RV8A 2HS8A 4QSHA 2WKJA 3GR7A 4AHQA 3BW2A 4YWIA 3W7DA 3C3NA 2RFGA 1KTCA 1ZJIA 1W31A 1PV8A 5DCBA 3C4UA 4A2RA 1JCYA 2GUUA 5CZTA 1FWNA 4O16A 1OYAA 4WUIA 4OBTA 5HR7A 1A50A 5LKYA 2ZCGA 1K8XA 3NQ2A 2VOMA 1TCDA 1A53A 1TTPA 1UUOA 2ZRYA 5D2XA 4UIOA 5K2ZA 4UFIA 4W9TA 4K7VA 3MYPA 3STCA 4LVBA 3ABQA 3HJZA 2PC4A 1DORA 3W73A 4KFNA 3GVGA 3G1VA 3W7IA 3L5LA 1EPXA 1K8ZA 2EF9A 4R34A 1JCLA 3CIWA 4O1BA 3TR2A 3W7OA 3F4WA 1DL3A 5BRBA 4DF0A 3CEUA 2IQTA 3MHGA 5LNWA 1HO4A 2CU0A 2YW3A 4Q32A 2TPSA 3C2VA 1XBVA 3W84A 1JQXA 3W1QA 4UFHA 4O1CA 3UXAA 4ZMGA 1JVNA 1Z41A 1W5MA 3P67A 3I7RA 5G1YA 1RZMA 4UTLA 3EKLA 2CLHA 3G1YA 4DEFA 1GQNA 4HN4A 1JQVA 3KRZA 3NEVA 5BNKA 1R46A 1W3IA 4IPJA 2DZTA 2DJXA 4QAIA 3T40A 4QNWA 1K03A 4O19A 2ZBTA 2NXGA 3W2NA 4AB4A 2RDUA 2FPYA 2A7NA 3N3MA 1UUMA 3DFPA 3WK1A 3EWYA 4Y9AA 4PCFA 5HUOA 2C13A 5DBUA 5G2IA 1QCWA 3CM4A 3S1WA 5FEWA 3TK7A 3TE9A 2ABAA 3T78A 4ADSA 4O13A 3KVKA 3LCLA 4PTNA 1W5QA 5FEXA 4IQLA 3KVJA 1WXJA 2AGKA 1GYLA 5A5WA 1Q6RA 4UTJA 3LRLA 2E77A 4A22A 4DF2A 5F4SA 5AC6A 2QJIA 3MBFA 3W7JA 5BMWA 2X1TA 3ABOA 3BLEA 1W8SA 1LYXA 4L4LA 2A85A 3W85A 1WDWA 3W2LA 1FX6A 2DU2A 1GG0A 4NQ1A 1OK6A 1IGSA 3W07A 3NPUA 1THFD 2ABBA 1LROA 1FWTA 1EP1A 1J2WA 3HGOA 2OX1A 1LRTA 1LTDA 3N73A 7TIMA 4JIQA 3M43A 4LY8A 5D2YA 3NA8A 4GJ1A 3M5YA 4QISA 1CI1A 5EBUA 1S5VA 4CNPA 2HMCA 1JULA 3O6YX 1IIGA 2O7QA 3VCRA 2YW4A 4HNTA 2NWRA 4LVGA 4N9DA 2FPVA 4QNEA 4RR4A 3W3OA 3OBKA 2TYSA 4G1KA 1O60A 2Y7GA 6TIMA 1OF6A 4N02A 1VHCA 1F74A 1YXDA 4LTSA 3SY5A 3HIJA 2QJGA 5I3IA 1R47A 2R14A 3TW7A 2Z6JA 2ZZ4A 3W7CA 3DKJA 3LBCA 4E2DA 4CNNA 1ICPA 4QM1A 4K7YA 2GOUA 4O0ZA 4KKXA 3W7GA 1MEWA 1RQBA 2ZA1A 1DJNA 4QJ1A 4NU7A 1QO5A 3SSJA 4HT3A 3HBLA 3P80A 3RMJA 1W37A 4FX6M 2QCCA 3QPYA 1H7WA 1WQ5A 1KFBA 4N6FA 1M7OA 2C14A 2JK2A 2A7PA 3IVSA 5C55A 2JKEA 2ZRZA 1PS9A 4ZQOA 3MMTA 4UC5A 5HMSA 1GG1A 2ATMA 1SFJA 3VFLA 1M7PA 4QIUA 4JGDA 3KRSA 4AWSA 4NZFA 4E0CA 3L65A 4Z1CA 3UWUA 3NPXA 2ZZ6A 1DHPA 2BX7A 3EB2A 1HUVA 3PF3A 1KTNA 3LTSA 4LNYA 4RK8A 3S8HA 3H53A 1X1OA 3LHYA 2QUVA 3W1TA 4A29A 2H3BA 3KVLA 2CLLA 3P82A 2YGYA 1M5WA 3ANYA 3E49A 1YPFA 3TSBA 1I4NA 4AHOA 1F73A 2R8WA 2XN0A 4GUGA 4UTTC 2E1DA 2Y88A 2KZHA 5FESA 1RV8A 3TH6A 4K36A 4O1DA 3BGJA 3QW4B 1JRCA 2YPIA 1VJIA 4LT9A 2FQIA 3PBWA 4GFSA 3A22A 3IVUA 2G97A 3NL5A 4BI5A 4GXMA 3HPZA 3VE9A 3NZ1A 4JTKA 3GXNA 5LNRA 1OHLA 4N9EA 1HG3A 3UWWA 3P81A 3ABRA 2G5WA 5G4WA 1YDOA 4M5PA 3SGUA 3LCIA 1LCOA 1HTIA 2QR6A 2DP3A 2G95A 1DBTA 4O1AA 4X2RA 3L0NA 4WXZA 4N4QA 4XUGA 5I3KA 1D9EA 1N8FA 3M44A 5KINA 5KZEA 2A1YA 2CLFA 3L5MA 3C0JA 4LRSA 5DXXA 1UB3A 1ICQA 2CZFA 2HS6A 4N9CA 5LNUA 1MO0A 1H60A 4RJEA 1KLZA 4IMEA 2ISSA 2H90A 4ZQMA 1ZAJA 5FF0A 3G0UA 2YYTA 1ML1A 1A5CA 1U83A 3IIXA 3BLIA 4P61A 5G5IA 3QMSA 3W74A 2QCHA 5C54A 1O95A 4NJGA 1TREA 3IIPA 4NUWA 2OT1A 2WV8A 4MFDA 3PAJA 3EX1A 3LHWA 3NQ7A 3UZ5A 1XDLA 2WJZA 3FOKA 3UZJA 2CZDA 1ICSA 1ZAIA 2Y6ZA 1UCWA 2FB2A 1JUEA 2NWSA 1KFKA 5BW6A 1C8VA 5HWJA 5K9CA 3AJXA 4UTKA 2Y85A 1VC4A 3N34A 3U6WA 4HNUA 1FCQA 4LVDA 4MFEA 2BWGA 1KFLA 3W86A 2J6XA 3BGGA 3QSRA 2X1RA 3W2UA 1IF2A 4JTFA 2QCGA 1S5WA 1K7XA 4NJIA 1PCWA 4CNOA 3WJXA 4HSNA 5TQLA 2E6YA 4XTIA 3GIYA 5EYWA 1N7KA 5T26A 2CFFA 3E9AA 2VELA 1FWRA 4XWUA 5U7SA 3VNDA 2H6RA 3PM6A 4FO4A 2ZRXA 4AHPA 3TXVA 1W5NA 4Y96A 1T8XA 4YL2A 2V0TA 3R2GA 4RXGA 4MLJA 2A0NA 5BMXA 4NVTA 1P1XA 3IIZA 4OV9A 2JGYA 2GJLA 3E02A 1TSIA 2W79A 3L21A 3TQKA 1XUZA 1YTDA 4Z0JA 3I6RA 5E0KA 5KZDA 4WOZA 4GUHA 3TJLA 3CIXA 4PA8A 3TC7A 3WK2A 1LBMA 4KWVA 3VKJA 2H3DA 1XCFA 2X2GA 1B4KA 4JIPA 3TAKA 3NL3A 2TSYA 3DU0A 3WJYA 2Q3OA 1YLVA 5F1VA 5C5YA 2CW6A 4UFKA 4H3DA 1L2UA 2C19A 4M6PA 4LUIA 4YLWA 3A5VA 1GVRA 1K7EA 4CQ9A 1FBAA 3N2XA 1PE1A 4BWLC 2E68A 4UTWA 4LS1A 5G2HA 5D37A 1LDCA 1JCNA 3MW7A 4NT0A 4UFLA 5CZSA 2EHHA 4N9BA 4ZZ9A 1OK4A 1GVFA 1T96A 3S6DA 5AC8A 3NGJA 3CC1A 5D2VA 3AO0A 3DFSA 4JTHA 4TMCA 1KM3A 2DORA 1I45A 3THQA 5H2ZA 3PVFA 4IMCA 3IGXA 3DBPA 1SW0A 4LS2A 3DFTA 3NZRA 3QFEA 2AQWA 5HWNA 4LC6A 4ZQNA 4ZQPA 4IXHA 1QMLA 3PBUA 5D2WA 1ZCOA 3A23A 1O94A 2HTMA 2WOQA 3NAVA 1ZY9A 4EF9A 1WOAA 3FYPA 1H50A 3USBA 1KM0A 1GTEA 1XKYA 3W7QA 1LORA 3MHUA 3SJ3A 3UPWA 4LWWA 5D38A 1EX5A 5IBXC 1YXYA 3P74A 1H5YA 3I65A 4IJBA 4HSOA 4ZL1A 5F1UA 2V81A 2EGZA 3SZ8A 2B7PA 4LV9A 3NR0A 1W5OA 4IXXA 1I8JA 5J5RA 2VEKA 3PUOA 4MPQA 5DY2A 2PE4A 3ZS4A 3TAOA 1CX9A 4JYFA 1ZAHA 1P0KA 3OHIA 4FNSA 3PC0A 1SO5A 4IOTA 2YR1A 1FDYA 2E5DA 3WK0A 3ABSA 3LBMA 3NQ8A 4FNQA 1EWEA 1B3OA 2GJNA 3TKFA 5K7JA 2XFWA 2PRLA 1NSJA 3G0SA 2DZWA 3JR2A 3UD6A 3KOFA 2YX0A 5I3JA 2QCLA 1H7NA 2J9ZA 3QMTA 3TC6A 4MOZA 2VENA 3W2MA 1UJPA 1EP2A 4UFJA 3EXRA 3FKKA 2QCDA 3TFCA 3TUUA 3W76A 1DVJA 3RNDA 1G4PA 5G4EA 2ZZ1A 4WJEA 3TMLA 3LX9A 3BVJA 4JY8A 4O15A 4MLRA 5CPLA 2V5BA 3UY8A 3GKFA 2QAFA 1JJKA 4LUJA 2X1SA 3SGZA 1ZHAA 3FEMA 3IVTA 3QC3A 2QAPA 4XQ6A 3LHTA 5CPMA 3QF0A 3LRKA 2E6FA 3HMJG 3S1VA 3LERA 4BI7A 5AHNA 1OX4B 2J9YA 3B8DA 5CSSA 3W7MA 2JBMA 1D3HA 2PRMA 3OG3A 4OE7A 1LP6A 3HF3A 1RVGA 3LCWA 1L9WA 4P2VA 2FB3A 3V1PA 3ZWSA 1QWGA 2WNZA 3NQDA 4WXYA 3M41A 4MZ8A 5ABTA 3TROA 1X8FA 2C1HA 5EPDA 2QCEA 3LCHA 3MI2A 3TJXA 3PB2A 1SFLA 2GPTA 3A5FA 1EIXA 2OT0A 2DZVA 3EWWA 3KHJA 4NJKA 5D30A 4GNJA 2ZYFA 2EPHA 4K6AA 4X22A 2VEPA 1X7FA 2YCEA 4FB7A 2A6NA 4WY0A 1G6CA 4HNNA 2Y7DA 3T4CA 3THAA 1UBSA 3PBVA 1LOSA 2NZLA 1PL9A 3RK8A 4YMZA 5L9FA 2H8ZA 4JN6A 5EMUA 3MUXA 4R7JA 1GVOA 3EWXA 4WOQA 5HWMA 4WX2A 1PVNA 4FF7A 4O4VA 5AC7A 5LNVA 3R12A 1W0MA 3GR8A 3MJYA 1JCXA 1SO6A 3GNDA 2FLIA 4WZHA 1NEYA 2B0MA 2QEZA 3TMQA 1OFBA 3UWQA 2Z0IA 3G1DA 5FF4A 3P8JA 3O8AA 2FJKA 3MO7A 1AW2A 2VEMA 1H7PA 4A3UA 5D09A 4UNLA 5FEZA 1LLWA 3MP3A 2V5LA 5K4ZA 1AMKA 2OZ0A 4O0KA 2V2CA 4GUJA 3QPZA 1KBIA 5CZJA 3SIZA 3FFSA 4JD4A 3INPA 5CGQA 1OFRA 1KTBA 3Q2DA 3UY7A 1MEHA 3TDFA 1TJRA 3M0ZA 3M16A 4RKAA 1VLIA 3ATZA 5AHLA 1XL9A 3I7SA 4JX6A 1H63A 5FEPA 3W87A 4EF8A 2DZXA 3P62A 3NYZA 1G69A 5LSMA 2ZA2A 4PH6A 1KM1A 3ZR4A 1OFPA 5FF3A 4DO6A 1OFOA 1PCKA 3Q94A 1TPVA 3N2MA 1VLWA 2TRSA 3WFAA 3C61A 4CCCA 5D32A 2ISWA 1V5XA 3FJLA 4GE8A 3CLMA 1J4EA 5D03A 3BO9A 1F7BA 2NXHA 2C18A 5K3VA 2WO5A 3LHZA 2FTPA 2QCFA 3EX4A 4YCPA 3HGSA 4LVFA 2QDHA 1GTHA 5U4NA 2HSAA 1GJPA 3KX6A 2E6AA 1BKSA 4Z08A 3OEXA 1TIMA 3LLDA 3CU2A 4Z1AA 2XN1A 3QH2A 4A21A 4MUZA 1SPQA 1YDNA 4KFOA 4O53A 3C6CA 2BLEA 1OFEA 4UR8A 3L66A 2Q3RA 1UASA 1DV7A 3W6YA 5FF7A 4UTMA 3VI2A 3TQ0A 1OFQA 1GVSA 3T55A 4B5NA 2ZRWA 3LLFA 1WYIA 3KRUA 1XDMA 1YTKA 2C16A 5F4WA 3LI1A 3HGRA 4EOUA 2B7OA 2QKFA 2NXIA 4AVFA 1LLZA 5TBOA 3NO5A 4XBSA 5KITA 4NX0A 3L67A 1DQWA 4I7VA 4FX8A 2LLEA 2WNQA 4D2JA 5EA9A 4JX4A 4ML9A 1VZWA 3G22A 3GAKA 4JNMA 4N4PA 3SW6A 4UTWC 3IIOA 3CTLA 5K4XA 5AHFA 4OU1A 4UUIA
chains in the Genus database with same CATH superfamily
4L4MA 4ZSUA 2NUYA 3EPNA 4YU1A 1U5JA 1S2AA 1W1TA 1SO3A 1MW2A 3EGJA 4G7FA 3M6YA 1HL2A 1PIGA 3UWYA 4GJIA 1FDJA 1ZTVA 3JZEA 1UZ1A 4F3HA 4P8XA 1D3GA 1PIFA 3TNOA 4B16A 3QHOA 1J6PA 3AHXA 2NQJA 2GGJA 4ATDA 3HPXA 3P8IA 3PJWA 3B9AA 3VILA 4YYFA 2X1UA 3N04A 4LV4A 4GNVA 1TVNA 5IDZA 1L6YA 1KM5A 2WVVA 5EMJA 1Q66A 1ME9A 3LSBA 1GPWA 1OD0A 5T91A 4XZBA 3NSNA 1YE4A 1PYFA 4HBKA 5E5CA 3B8UA 1BWLA 4JAWA 4DO5A 2F6XA 4JX5A 1VD6A 5DO8A 4ATLA 1XUUA 2QUMA 1RA0A 3FXGA 2NLIA 3N9RA 4Q33A 3UJSA 2F6KA 3S5ZA 4TX8A 3PUGA 1Y0EA 1E0WA 1LRQA 5JBFA 1I2PA 2VFDA 4GH3A 3QMRA 2FJUB 2RDXA 3VKAA 4J3SA 1VYSX 1XJBA 3PUEA 2WSQA 1WB0A 5FJPA 4ZO9A 1FFQA 4LYQA 3PUDA 3VOJA 3MCOA 3ONBA 4GC4A 4GQGA 3FEQA 1H3GA 1XIBA 3AIVA 3AI0A 1S3HA 4FI4A 1XPGA 3ISIX 1T41A 1DJQA 2NLYA 1QOQA 2GJXA 4M6UA 5GPRA 2J7CA 4JTAA 1LQ2A 4KETA 1CLVA 1OVDA 2Y1HA 3K1GA 4B91A 4I3GA 2PWEA 4PFHA 2NQLA 1KRMA 3WIJA 4JY9A 3DAQA 3QY7A 3BAKA 4DJFD 3C0LA 1E0VA 1MQPA 2PDIA 3C56A 1YX1A 2HVNA 4ZE5A 5D02A 1QVBA 2R1MA 3LCGA 4FR1A 3QGKC 5DF0A 4FOJA 1J11A 1UIPA 1C90A 1HIZA 1BYDA 7TAAA 2GQAA 5H8UA 1XINA 3EDDA 1AFSA 1QK2A 1VHNA 3CEPA 4CQ8A 5KSWA 5BRQA 3GX9A 3LI0A 4DWSA 4HA0A 3LOTA 4UTUA 2Z2UA 1R7AA 2YYUA 5M17A 3UG8A 2O9OA 3N2BA 4UTTA 4H9VA 3NQGA 3WDHA 4H9TA 3VYLA 4BF9A 3NQVA 4I90A 5FIPA 3GTIA 3LPGA 4C6OA 4AEOA 3UPMA 1YRRA 1NAL1 1VYPX 4P7LA 3EB4A 1H1ZA 4DYKA 3M5VA 1VFSA 4IIFA 1XI3A 1F6PA 1FXQA 2I9UA 3WQ6A 1TPEA 5I3HA 3IRDA 5DN1A 4DQWA 1PKLA 3P2VA 1PZ1A 3WH8A 1J0IA 1RR2A 3GUWA 3WJZA 4R85A 3N19B 1JUKA 2NQ9A 2TAAA 4R33A 3R0KA 3MUCA 2ESCA 5EKYA 4DUWA 4XBKA 5HOSA 4J3VA 1G9HA 3SQLA 4XZMX 3B4UA 4AD1A 1IXQA 4JTTA 5DCDA 3W23A 4W5ZA 2ZXDA 4MMWA 3DECA 1VPXA 2OX4A 1FHDA 1EZ2A 5FL0A 3EYPA 1L2QA 3PZQA 1U1HA 1TB3A 5HJLA 3UG5A 3O63A 1GKRA 4LRTA 1JZ8A 2VFEA 2VRJA 2GUYA 4JTRA 3MWAA 2GGHA 3S5YA 1J9YA 4XD6A 1F4HA 2PRHA 4K1GA 4XTDA 2VGBA 4KPLA 4RX0A 3IANA 1QI2A 2PDJA 4AY7A 2YBVA 5FJIA 4EVZA 3VDCA 3R6IA 1M53A 3RPDA 3PAOA 1A5NC 2FHBA 2XHYA 1NDVA 2DZPA 1BD0A 4O17A 3ZZ1A 4JFWA 3VC5A 4G2DA 3GC4A 1OQFA 2AL1A 1OZQA 1Q6DA 4S3EA 1LOQA 1QO2A 2IUZA 4O1EA 1M04A 1ZALA 1SR9A 3W4RA 1RY0A 2V9DA 4WSJA 4HHMA 2CHNA 2BY2A 3B05A 1Y7VA 2HQAA 4ZSTA 1A0DA 1W3TA 3UJRA 4MF4A 1XD1A 2NUXA 4CU8A 3UPBA 3SY8A 4C6EA 3RITA 3BMXA 4S3DA 4PEKA 1VEPA 5FSDC 4H9MA 2ISVA 3GDMA 3BARA 1MI3A 5IFPA 2FVLA 2GWNA 2NX1A 2FHCA 4OKDA 1F6KA 3RCYA 1F8MA 2R1KA 4O8AA 4DF1A 3DGRA 4LH8A 1P0BA 1O5KA 3T9PA 1AW5A 1IXPA 3FLUA 1QPRA 3CH0A 3ZJ8A 5FL1A 3A3WA 3LXBA 1Z7AA 4CN4A 3ZLFA 4E8GA 4MPKA 4B4HA 1PIIA 5JBDA 1J01A 4PUMA 3S5OA 3RO8A 3VOGA 1K3UA 3KXQA 4M80A 1V3MA 5LGXA 1UZHA 1WDPA 3LLXA 2JGQA 3T8QA 1RPXA 5DRCA 3RAOA 1OX6A 3DX5A 4O12A 5EGRA 3CPRA 4GVGA 4JICA 3OQEA 2GJRA 1QNSA 1SZGA 4JHZA 2DVXA 2WHJA 4ORMA 3NVTA 1KFWA 1JUBA 3LHVA 9XIMA 2BVDA 4FX7A 3UZXA 4UXDA 5TNVA 4Z42C 1ZBCA 4AD3A 4H04A 2B4GA 2WCGA 1E9IA 2XM1A 1O5XA 2B7NA 2CLEA 1X96A 4HMEA 3RUBL 1J0KA 1H4PA 1K6AA 3E12A 2HBVA 2W5FA 2E4TA 3MV11 2DZUA 3VVGA 4IGNA 3M47A 1W3KA 3JW7A 4F9JA 3EOUA 1G4SA 1FHVA 2FZBA 3PG8A 5TIMA 5FI8A 3RG6A 1VCGA 1ZBWA 5A6TC 3A24A 3O16A 1NQ6A 4EKJA 2J24A 1SUXA 2KX9A 1L8PA 2XZ7A 4V1XA 4OWGA 1NWSA 1S46A 4PMDA 4PMRA 4QJ3B 1H09A 1MEIA 3WNLA 3K2GA 4HA1A 3KBSA 2WHKA 3HOJA 3NL6A 4HZMA 3W2KA 5LZLA 1MSSA 1BVZA 5A2CA 2A6LA 1XLBA 1XRSA 4L6HA 4QCFA 1TMHA 4C6QA 1HP5A 4BF5A 3OLDA 1AK5A 3CWOX 4PE8A 3U0HA 3MV01 5ABEA 2IKGA 1JNDA 4Z1BA 5CEWA 2XISA 6A3HA 3UGVA 1Q45A 4DM1A 4GKLA 1SMAA 2GVLA 4MY1A 1K9DA 2NW0A 3CH9A 5FACA 3AXMA 3WH5A 5BOEA 1NF0A 2EXOA 3GXTA 1WXYA 4MUPA 2IPWA 4OQVA 1JFXA 4X3ZA 3B0UX 2AAAA 1XBZA 4DWSD 1SSDA 4MYXA 3MA8A 3OLEA 4CU6A 3HG5A 2CZVA 2NQZA 3LTYA 4TO8A 3E0FA 2ZTJA 4RZ4A 1NY1A 1E70M 1XS2A 1W2PA 3BCDA 5M3WA 3G1RA 2PC8A 3F1QA 4JCMA 4JTSA 4OT7A 5BXTA 1TWDA 2DSUA 1P5BA 2P1FA 3GFZA 2GVJA 2HK1A 2C6QA 3NGFA 1M68A 4GWEA 3VO0A 3DCPA 3GNNA 3APGA 1TTIA 4RDZA 4LAKA 4W4QA 1XD0A 2PA6A 1ISWA 1FDZA 2WMKA 4L1WA 1ECEA 4C1KA 5CC7A 4JZ5A 2FPTA 2P10A 3KUMA 3QZEA 4W8LA 1TX2A 4J9JA 1JZ6A 1IWAA 3L4VA 4KT2A 4ACYA 3AIRA 3L2MA 3VIGA 3DEQA 1JD7A 1E4IA 3FKRA 1VFUA 4GI4A 4B5XA 5CC3A 5DMYA 3WEMA 1PKNA 5C7VA 3F5JA 2PDBA 4ICMA 1P43A 3AALA 3P3BA 2VDGA 3GDLA 4L64A 3U2CA 3TW9A 1P6CA 1WV2A 4WDUA 1K02A 2CLIA 2BOEX 1NP0A 3WBWA 2WMIB 3ZVIA 1XC6A 3SR7A 3EBVA 3UWVA 1LUCB 3UWEA 2FGBA 1A5KC 2Z1SA 3CMFA 2IW0A 3B9EA 3I3BA 4HK6A 4KIRA 1O5RA 3WD0A 3ELFA 2Q02A 4POCA 2BG5A 4EX4A 3ITVA 4NJHA 3TYBA 1AQFA 3N2CA 2ZZ2A 3VNZA 2W6RA 2P76A 1FHLA 3CHFA 2I7GA 1Q3NA 1CGXA 4GGBA 5CJ5A 4PUKA 2P88A 4AWTA 2P3EA 4RXFA 4TMBA 3II1A 1EFZA 3W83A 2D73A 1PWLA 2Y5JA 4S3FA 2YIHA 4O57A 3DFOA 5DXYA 1G5AA 3N3TA 4IMDA 1K9FA 2ZZ5A 5E9AA 4HU3A 3GC2A 1BRLB 1Q6FA 3KAOA 4JTUA 4B15A 3I4EA 1K1DA 3UCDA 3WBYA 1VFOA 1X6LA 4IG2A 2XFYA 3LY0A 4S3GA 3CMGA 3G8RA 2AL2B 2WJEA 2BS9A 4ERAA 2DZSA 3S9YA 1ZUAX 4AISA 4Q8OA 5L6UA 4ES4A 1JR1A 4E2OA 3DENA 4H7VA 4NAEA 4MJMA 5A8QA 3P61A 2D0FA 2GQ8A 2HPMA 2CLMA 5E9XA 4ATWA 3HMCA 4ADTA 4MY8A 1CXFA 1E51A 6TAAA 1E15A 3A64A 1IWBA 4ZODA 2PD9A 3GHUA 2OKOA 4JQ2A 3KDNA 3O07A 5D05A 3TYCA 1K8YA 3OA3A 4PBFA 3W9ZA 3B8SA 3EMZA 3WUGA 3DN5A 4JHOA 3WBAA 4DO4A 1RQHA 3WLQA 2OODA 1TV8A 1TYGA 2WW5A 5HQMA 3N14A 3WK3A 3AU2A 4JIHA 1V3LA 4JTIA 3JS3A 3H4WA 3EDEA 4UTFA 3CT2A 1JDFA 1DQXA 1BG4A 4NF7A 4XAZA 3RLVA 3DHFA 3ITCA 3B8IA 3UWZA 5GJPA 4E38A 5LHFA 1JEZA 3C8FA 3I3EA 1JZ3A 3S42A 5GNZA 1I60A 4GOAA 1MFVA 3GG0A 1LJYA 3MI6A 1LWJA 4HIBA 5F2MA 1OY0A 3KL3A 4KRTA 7XIMA 1UP2A 3QVQA 4YTSA 1XRVA 4QSFA 5F2IA 1EWDA 4GG9A 3LDVA 5DQPA 1XLGA 3L68A 2VURA 4C1NB 4P7QA 2ZUVA 3M5XA 3GHRA 4KERA 3E5PA 3POHA 4MTVA 1BXCA 3NL2A 4ERGA 3ITTA 3O6DA 1F6YA 3K4AA 4F48A 1KXTA 3BW2A 3EOEA 1KTCA 5DCBA 3C4UA 3CB3A 4KF1A 1B5TA 3FJNA 4HU0A 2GUUA 1FWNA 1J79A 1I6NA 1J0YA 2O4MA 3ZVHA 4AEFA 2DUAA 2J7DA 1A50A 4HSHA 2ZCGA 3W26A 1V51A 1TTPA 4UIOA 4CD6A 4DXKA 5A6SA 3GFYA 1K70A 1DORA 1A49A 4KFNA 3G1VA 2GZXA 3L5LA 1F3EA 1K8ZA 2YDQA 3VIKA 4HHHA 5BWFA 2FKPA 1TUXA 3MHGA 3RXZA 3LA4A 4GX8A 2YW3A 2TPSA 3C2VA 2ZWYA 4UFHA 3UXAA 1JIBA 1Z41A 5XIAA 3SRHA 2WLYA 3IPWA 2UWFA 4HN4A 3FJ4A 2VX6A 1DTNA 5CGTA 4HQVA 3T40A 4AZ7A 1GOWA 4OZOA 2RDUA 4PMQA 2A7NA 1CECA 1UUMA 3DFPA 3WK1A 4F2BA 1RK6A 4Y9AA 4Q4RA 5HUOA 1KRAC 3ANUA 3NSXA 5E6YA 3BLLA 1UQYA 4Q4OA 3CM4A 4Z1YA 3WNOA 3TK7A 1JYWA 4LEFA 4IGMA 4ADSA 3KVKA 2IPGA 1W5QA 1AA1B 1ENUA 2HJPA 1EOMA 2WNWA 5C9RA 2E77A 1NDZA 4DN1A 2VUNA 1NP2A 3BLEA 1LYXA 5KETA 1GG0A 1IGSA 4HZ7A 3NPUA 1JGMA 1FWTA 3VGGA 3M0JA 4WVXA 2DGAA 4LY8A 3M43A 3NA8A 4GJ1A 4QISA 3F2BA 1A0EA 2XG9A 4CNPA 2HMCA 3QBUA 2O7QA 2DQXA 3AZTA 4HNTA 4WKFA 3ZR6A 3OBKA 4AZIA 1SR0A 2ZXAA 3WLOA 2QMKA 2P50A 3TW7A 4LBRA 3IJDA 3WELA 1JDCA 1PBGA 4K7YA 1Q7MA 1LF1A 2GOUA 3W24A 1RQBA 1PEZA 1FVPA 4AZGA 3AAMA 3SSJA 1EO7A 4C60A 3BICA 2QCCA 3QPYA 1WQ5A 4PMOA 4N6FA 2H9AB 2A7PA 3VMNA 2OZ3A 5A6LA 1U5HA 1PTAA 4AYGA 4KCWA 1REQA 4DI8A 1A47A 4AWSA 1AUSL 3NPXA 3CQIA 4L56A 2ZX5A 3H8AA 2VQTA 4PZVA 1R6WA 3PF3A 1BGAA 3AMDA 1X1OA 3LHYA 3W1TA 2H3BA 3LEPA 4DX3A 3CUXA 4Z2KA 4LYPA 3P82A 3F5KA 1JG9A 3SUVA 1FKXA 3TSBA 4AHOA 3R8HA 1F73A 1W1IE 3CZKA 2Y0FA 5HK4A 2XN0A 1WE5A 4WCJA 3NFUA 3WLRA 3STPA 5BXRA 4PUWA 5I7GA 5CC5A 3KL0A 4O1DA 1GZ1A 3QZAA 3QW4B 1JRCA 5EMKA 5A95A 2YPIA 3BWWA 3A22A 3IVUA 1HJSA 2G97A 1PX3A 3BJSA 4RDYA 2HEJA 4H41A 3VGDA 1KCZA 4GXMA 3M0MA 1W9UA 4KEMA 1JI1A 1V03A 1OHLA 1EJWC 4DWSC 5G4WA 2ASHA 2Z26A 1U2YA 4M8UA 4HA3A 2QR6A 3TJ4A 2DP3A 1DBTA 1F8IA 3KOXA 2PZNA 4KMQA 5A2BA 4JFSA 2C7FA 4XUGA 2OVLA 2PTDA 5I3KA 4EAYA 5KINA 2A1YA 2V5CA 5LNUA 4HJWA 1H60A 1KLZA 4CN1A 1KCXA 3SGGA 4FMVA 4ZQMA 5BU6A 3U2EA 2IQ0A 1RPKA 2YYTA 3WBXA 4GBDA 4JKMA 4GX9A 3QY8A 3TOYA 5C54A 3T4WA 1TELA 4NUWA 2OT1A 3V3WA 3PAJA 3NQ7A 5E0FA 4LANA 3FOKA 1RH9A 3CQKA 4DJDA 1ESWA 1JUEA 3VUSA 1GPFA 1M1BA 4C7FA 2Y85A 1FCQA 1KCKA 4LVDA 3GG8A 2J6XA 2X1RA 1IF2A 4Q8PA 4XB3A 4ACZA 1QNPA 1VJZA 1J8VA 1K7XA 3Q4DA 4C6LA 4F9DA 4PMZA 4XTIA 1N7KA 1Z3NA 1PX4A 4UCFA 2VELA 3AS3A 1L6FA 1FWRA 4XWUA 5U7SA 3VNDA 4DBSA 4QGCA 4FO4A 3G6LA 1TCMA 2WHLA 4Y96A 3BSMA 3OVGA 4NVTA 1P1XA 4OV9A 2JF7A 2JGYA 3E02A 1OEPA 1TSIA 1ONWA 2ZX7A 4Z0JA 2G3JA 5E0KA 4WOZA 3CIXA 3RO6A 3WK2A 4WK9A 3ZO9A 2J75A 2PBGA 4PRTA 3NL3A 5E09A 4ACZB 4X60A 5F1VA 5GJMA 4UFKA 4H3DA 1L2UA 2C79A 1E6ZA 1HN1A 4IPLA 3SUTA 2ZXQA 1K7EA 1FBAA 3N2XA 3APTA 2E8YA 1Y5VA 2DT3A 2ZXBA 5D37A 4NT0A 4HMNA 2UBPC 3VNMA 4N9BA 5FD0A 3ES8A 1MXDA 1T96A 2GVYA 2QJMA 3MZ2A 4AIEA 1H0IA 3CC1A 5D2VA 3SCTA 3DFSA 4JTHA 2WMFA 2YXXA 2C71A 1I45A 4UQCA 4V15A 3HN3A 2GVEA 1FKWA 4WGHA 1SW0A 3H22A 4LS2A 3AU6A 2AQWA 5HWNA 1P6WA 4LC6A 1KRCC 3DUGA 1FWCC 1KR1A 3VABA 1ZCOA 4TQTA 3A23A 1ZY9A 1ADDA 1JYXA 4Q7NA 1XWYA 2Z1KA 3FYPA 4AZCA 3USBA 3KTCA 5CPSA 4L7ZA 1WCGA 1GTEA 3UPWA 4LWWA 4NYUA 3KZPA 4HD5A 1H5YA 4HSOA 2ICSA 1JPMA 2HNEA 2B7PA 1EH9A 1NQKA 2XSXA 4LV9A 4IXXA 3KCLA 5J5RA 2QXWA 3TWAA 3VZXA 1MRAA 2W91A 1ZAHA 1P0KA 3PC0A 4GYPA 4IOTA 1FDYA 4HMCA 2E5DA 3KHDA 1GW1A 3WK0A 4P7RA 1C3FA 3W6MA 2J7FA 2XFWA 4NASA 3NOYA 1LQAA 4A35A 3JR2A 3DBNA 4C6CA 3KOFA 1UWSA 3QMTA 1Z69A 5BWAA 1M3UA 2E25A 1EP2A 1G94A 1T5AA 4UFJA 1DPMA 3FKKA 3QOKA 2QCDA 1EGMA 1TZ9A 3HQNA 4GQRA 4L6OA 2X09A 1TZ7A 3I10A 3NO1A 1G4PA 4PN2A 1P6BA 3LX9A 3GNRA 3V5FA 4JY8A 4JTCA 1V6XA 3UZYA 3TTEA 3VDGA 2EPLX 1MNZA 3GKFA 4PBGA 4AIBA 3LGGA 4MNMA 1JJKA 2X1SA 3CUHA 3QC3A 2QAPA 5DT5A 5CPMA 3NDZA 4U2ZA 3LERA 4GKTA 4BI7A 5AHNA 1OX4B 1JPHA 3FAXA 2JBMA 3HF3A 1RVGA 3ARYA 4HA4A 3THUA 4P2VA 2FB3A 3V1PA 2WNZA 1BWVA 3NQDA 5FJTA 4INFA 2GWGA 3LCHA 4OOUA 3PB2A 1UKOA 4H19A 2GSHA 2GPTA 2WMGA 1ISYA 3SAZA 3H2FA 3EWWA 2EG8A 4E4PA 5DEZA 3N11A 2ZYFA 4J2PA 2VEPA 4GVHA 7ODCA 2A6NA 2BY0A 2GDVA 4AZHA 2NZLA 5I24A 5EMUA 4QDWA 4R7JA 3IJ9A 1GVOA 3DERA 3GW0A 3HPFA 3SCRA 5TF0A 2PWUA 5CAKA 5LNVA 1JCXA 1SO6A 3GNDA 3FA3A 1NEYA 3H2OA 2B0MA 2QEZA 5TAOA 1KD0A 3MUAA 1R3SA 3O8AA 3P8JA 3MO7A 1IEIA 3W38A 4C5ZA 4D6DA 2WVSA 1YKWA 4X0NA 4W88A 1E4MM 1H7PA 1R5YA 5IOBA 4W8AA 4UNLA 1H5VA 3MP3A 5K4ZA 4DHGA 1XH0A 3FGCB 3QPZA 4JD4A 1XIHA 2HROA 1E0XA 3DG3A 4KBXA 3TYAA 3UY7A 3TDFA 3UT0A 2I16A 2J79A 2OEJA 3HFTA 2O92A 3ECQA 3I7SA 4ZENA 5FEPA 3NYZA 1RBLA 1G69A 5CSUA 1GORA 2ZA2A 1WKYA 1GVYA 1UP0A 3ZR4A 5BZAA 4OECA 1PCKA 3Q94A 1V08A 1XYFA 3R79A 1TG7A 1E3ZA 2TRSA 1SJBA 5D32A 1MW3A 5GNXA 2UY3A 4W7WA 2PDXA 1WZAA 3PPGA 3H7UA 2ANUA 3BAIA 3BO9A 4PTMA 2NXHA 5HA7A 3LHZA 3NEHA 2FTPA 3DYMA 1QK0A 3M6DA 4AIOA 2QDHA 4MJ2A 1HKVA 1UMLA 2HSAA 3RMEA 3OEXA 4TTGA 3H7RA 3MMDA 4P5UA 4A21A 2FTWA 4KFOA 4L9YA 1XISA 1OFEA 3N2TA 4NZ5A 4NP7A 4UR8A 3ZIZA 3MDWA 1DV7A 4UTMA 2P5NA 4AY1A 1GVSA 2VJXA 4HHLA 4B5NA 2ZRWA 5EFDA 2Y5SA 2YXOA 4WR3A 3OHMB 1POJA 1VPQA 3RRXA 2FZMA 1QW7A 2D1ZA 4RNHA 5F4WA 1TZZA 4MM1A 3LI1A 3LQLA 2XIIA 1Q6GA 3IJ7A 3RN6A 3LSCA 3VOIA 3N6QA 4HOWA 3KS5A 1IGWA 4LXFA 2OQLA 4P8UA 4RW3A 1UH2A 2WNQA 5GQBA 5EA9A 3SBFA 1BPLB 4N4PA 1V3IA 5AHFA 4HOXA 4R27A 1C7TA 3G1FA 3NQ6A 3SI9A 3HGJA 4H6RA 3UNDA 7A3HA 5C9UA 3NWRA 3H55A 3VIFA 2PU1A 6ENLA 3SCPA 3GYCA 4C6MA 1JPDX 4CNSA 1J0ZA 4XZ9A 3WUBA 3O9NA 3NM1A 3W7LA 4ZO6A 3QLLA 2YA0A 2FGZA 3RLUA 1VGAA 4PUDA 3R0UA 3S0CA 2OJPA 1I2QA 3AMLA 3DH7A 1DJZA 2DT2A 1ISVA 3DESA 3L0KA 3OIXA 1KXVA 4EWJA 4NJJA 5AHMA 1JF5A 1PTDA 1YW1A 3FN9A 5IHRA 4OHQA 5I06A 4ZB2A 1S5TA 5DRIA 2OR2A 3B0PA 4US5D 1R2TA 3KP1A 1HKWA 2YOCA 1VR6A 1RHCA 4GUFA 1WAUA 4M6VA 4S3BA 4YWSA 2AKMA 3VX1A 1A5AA 2BVTA 1XLLA 2VZSA 4PMVA 3NQBA 2OQHA 3B0VC 4IISA 4B3LA 2D3LA 3TWBA 3N6JA 2C8NA 5HPOA 3PPCA 1Q6QA 4C91A 4YTRA 2PSNA 2G3NA 1XYCA 4NZ3A 1UC4A 5AFDA 1DE5A 4LUTA 3G0XA 7CGTA 2DIEA 2VVNA 3U48A 3GD6A 1VIWA 4KEUA 2AAMA 4IG2B 4DRSA 1BG9A 3KOZA 3NQFA 2OSWA 3D46A 4IJRA 4YPJA 2AQOA 4DNHA 4OBSA 3B8WA 2YLAA 4PUJA 1TWZA 2J8GA 2VWTA 2WNNA 7REQB 4J5NA 4I7WA 3HV9A 1XLKA 2HVMA 1KBKA 2W62A 1YBQA 1W91A 4AF0B 1UW9A 3MC5A 4P8VA 4CNUA 4MZ1A 2INFA 4NXKA 3WD3A 4A8NA 5CSRA 2ZDRA 3EA2A 3T7VA 4GACA 1QI4A 1SO4A 4PRRA 3GU9A 4C6FA 2WB5A 4IP5A 3SM0A 1OGBA 2UY4A 3K8LA 1I2OA 4YIWA 1QRQA 2PEVA 5LA2A 3WKZA 3HQOA 3AHYA 4XKYB 1TQJA 3LUTA 3V0SA 2O0TA 3EWZA 1X1ZA 4WSKA 3WLNA 3WH7A 5D9NA 5KMYA 4CNTA 1KW1A 3A47A 3H54A 1H1YA 1R2SA 4M1BA 1ZL1A 1DWHM 1T40A 2D2HA 1AL8A 3WF0A 5F4XA 1D7KA 4QJ4B 2UY5A 4GLEA 4OUEA 6REQA 2WK2A 1VCVA 2CKRA 4FNUA 1N2VA 4M82A 1OD8A 1QOPA 2XWDA 1RP9A 2PBOA 4CQBA 2Q8ZA 3AXXA 4AXKA 2JF6A 2WJDA 3NDOA 2XH4A 3GS6A 4O11A 4XKYA 1FHUA 3GY1A 4DPQA 3EEGA 5LIYX 2JKPA 3LBOA 3W1PA 3IJQA 2VHLA 3HV8A 1EO5A 1YTEA 1IWPA 1TPUA 1BVWA 3MO4A 5KTLA 1EJSC 4LPCA 3DGBA 4KCTA 3COTA 1TJ2A 1W32A 3IEBA 3KLLA 3MY9A 2WZTA 3LU2A 4BWLA 4HPXA 2GVGA 2WM0A 9CGTA 1E0UA 3NYDA 1VYRA 1DE6A 1C91A 3UR8A 1KM2A 3TN3A 5KZMA 4NZ1A 3Q65A 3EXTA 3GRIA 4GZ7A 1NOFA 3PB0A 3QW3A 3S2NA 3FIGA 4O18A 5C6MA 1F9CA 2WZMA 4JIEA 5DY3A 3TV8A 4KWWA 1TX0A 3O1NA 2XGBA 4NL1A 4Q8WA 3N13A 3R10A 3U8GA 4BEUA 1CGUA 2GJPA 3GB6A 2V69A 5DMNA 2NV1A 4IJCA 2BGQA 3PULA 4N7QA 3IIVA 4TVDA 4CCDA 3M0IA 4RLIA 3F4NA 3BG3A 4LW7A 1BF2A 1UKSA 3CBWA 1EL3A 1EXPA 3MUIA 4UMAA 1OYCA 2JKAA 1HKJA 2CHOA 3W28A 4QG8A 4KH2A 3EX6A 3W71A 4S2CA 1KB3A 3HQPA 1EJ7L 4AD5A 4PMYA 3XINA 1QU4A 1EBGA 4OUIA 1ODUA 3E1F1 4TR9A 2I57A 2BBFA 2VFGA 3C2EA 1W1B1 3TA6A 2PLKA 2VKZG 4J27A 3W6LA 3AC0A 1VB9A 1SZNA 3S6TA 4FALA 3MWCA 3O15A 2C1GA 1AJZA 1YXCA 1PKMA 2D0HA 3VM5A 3PZOA 3ARZA 2BHUA 1ECQA 3BG5A 3E74A 4FNPA 3SCNA 1EDQA 2YZRA 2CITA 3W1AA 4FXJA 1UUQA 1EJUC 1H7XA 3K13A 1DIEA 3GIQA 3DKLA 3I68A 1NWRA 3UJEA 4O28A 1FWWA 1EXBA 4JYDA 2Y5EA 4RZ5A 1ZCCA 3PBGA 4O10A 3OVPA 1EHNA 4J3XA 1VBGA 1OC6A 1XXXA 2L5HA 4O50A 4YTQA 1HL8A 3ATYA 3GDTA 3SCOA 4EPKA 2BXYA 1GVQA 1V3JA 5GVJA 4Y90A 1CXHA 1EJTC 3A21A 3WF4A 3VNIA 3QOMA 1G1YA 4XAFA 3LGEA 5M5DA 1M03A 4HNLA 1EPVA 4AVOA 2Y8KA 2PTWA 2UV8G 3IK2A 1QJWA 2Y63A 1FWAC 1SSGA 2B81A 3RHGA 1TE1A 3SUSA 1GOXA 2QUNA 4W89A 1A4LA 2QDEA 3GNPA 2WSRA 4E8DA 3LM7A 2EEXA 3EWCA 3PTMA 5CAHA 3NJ3A 3VC6A 2Z1XA 1D8WA 1BYCA 2OGJA 1R7OA 1W17A 5FJUA 4JQ4A 2G3IA 1GHRA 1C93A 4C1LA 2ADAA 1TJPA 3E0VA 2VO5A 1L6GA 3EA3A 4ILSA 2X05A 2I17A 2QPUA 5J8LA 1XIIA 1Z9AA 8TIMA 3IV3A 1S39A 4GQ0A 5HAOA 4UTHA 4F0HA 3QC0A 1C8XA 1UD6A 3PJUA 1FP9A 3UCQA 4IMFA 4DXVA 1B3VA 3QQ1A 3MKKA 4M6QA 4IX2A 1XH2A 2YFNA 3L4ZA 1VRDA 3MCMA 2VXNA 2NSOA 3VD4A 1ITUA 3U9IA 5B80A 3DHUA 4GMEA 4U5KA 5HUPA 5AHIA 1FWDC 1ZP4A 3WNNA 4JS3A 3T2PA 1IIHA 4Z2LA 5DMLA 4UQBA 2Q09A 4PFMA 1K7FA 2CERA 2ZICA 4M19A 1XIDA 3M7WA 5K9XA 2OEMA 3IUDA 3KL5A 4PEEA 2DH3A 4EPDC 1GQKA 3WFLA 2BOFX 4KESA 1QW9A 4B5UA 1QTWA 2KAUC 2Y2WA 4ICNA 3H24A 1Q6OA 4IH3A 5CPOA 3UCCA 2PODA 1IHIA 2D3NA 2Y62A 3GXIA 2AKZA 3HG3A 4TXEA 4XSMA 2EG7A 3W7RA 3B0YA 3CV7A 5DLCA 5DBTA 1RBOB 1QPQA 2SFPA 3FDGA 4G7EA 3C86A 4JDYA 4HPGA 2PDWA 5GJNA 3SFWA 4WD0A 1O68A 3GH4A 1UWQA 1W5PA 4EPBC 5HDRA 4UCGA 3B8VA 4Y6GA 4H8UA 1POKA 1UA7A 2FHFA 3QV6A 5CJMA 3AISA 4CCEA 3G8EA 4WSHA 3BK0A 4O52A 4IIEA 3TZFA 1G7UA 2Q8LA 1KV5A 1NU5A 3LPPA 1E6XM 2E6DA 4IUGA 3EMQA 4MZYA 1A4MA 2WC4A 4G7EB 1T7LA 3G1HA 1GYNA 1XLIA 2CWNA 3W75A 3LZ5A 3W7KA 2BZNA 2OSXA 3WQEA 3WMSA 3ARRA 3GZ3A 2EPNA 3C2RA 3IK4A 3SIMA 4F40A 3GR4A 4DPPA 1CXIA 4CD4A 3CT7A 4PR4A 3WDIA 1X97A 4RE3A 1W1VA 3SRDA 2WZHA 1ZENA 4XZLX 4Y8EA 3PSVA 3G24A 4NXSA 1GQIA 5I78A 4ENLA 4R53A 4V33A 1P4CA 3KTXA 2QHAA 4F8XA 1VS1A 2GFTA 3RDKA 2R91A 4YXGA 4O14A 3W1MA 5I00A 1DJYA 4TX6A 1T8QA 2Z6IA 3ARWA 3LTPA 4JNZA 2VUYA 4W93A 1NFBA 2ZVRA 3S6OA 5LNSA 2EAWA 2R9RA 3LK6A 4L9XA 2QGYA 1V0KA 1OINA 1PX8A 1TTJA 4UZUA 2PF0A 4E2VA 4MWAE 1EDTA 2VC6A 3HG2A 1IXOA 5A69A 3PZ9A 4BI6A 3ZT7A 3QM3A 1S3TC 8RUCA 4JIIX 1B57A 2X7VA 3OU8A 1HGWA 3BV4A 3CL8A 1IQ8A 2E0PA 3R89A 1SFTA 2HBXA 2YB4A 3P5ZA 3PTQA 4WLCA 4M24A 2GK1A 3ZSTA 3W1LA 4KGLA 4NNBA 4EE9A 1FCBA 2CBJA 5LA1A 2VI0A 1CGWA 3W7EA 1U33A 3WD4A 3BJFA 1K8CA 3O6CA 4GIRA 4EWND 1AW1A 4JTEA 1LRNA 8XIAA 4D6FA 4JTLA 4XKMA 4QS6A 2QNEA 4YCOA 3GDKA 3UXDA 2A79A 4K2SA 3P0WA 4AZCB 4GINA 1NARA 4D6EA 1IZJA 4GUIA 1TPWA 4DJFA 4XO7A 5K9DA 2RGLA 4U4MA 2PD5A 3K30A 1XM3A 2C15A 3C0QA 1V7YA 4DLMA 2VNCA 2QCNA 4YYCA 1ISXA 2X30A 4XAGA 4LOCA 2FDMA 1L6SA 1YDVA 2J88A 1V79A 1GT8A 3E0IA 1N82A 2RH9A 4IMGA 4TU1A 2CYGA 3FHAA 3CUZA 1E5JA 3BTNA 4N6EA 2QYGA 4MNLA 1FWHC 5LIWX 5CLTA 1AG1O 1US2A 1OFDA 4FIQA 2VYOA 4TX9A 2J74A 4UR7A 4FEZA 4HU8A 2XYLA 4Q8TA 1TFVA 1GWJA 1V6UA 1H61A 5AECA 5C2XA 2I14A 3PBYA 4K39A 4MSSA 5LHEA 4AXNA 3NNTA 4Z0SA 3R11A 1XIMA 4HPNA 1RCOB 4JTGA 1IXNA 2VRQA 2F84A 3T08A 1LOLA 2J9XA 1DJHA 4D6HA 4LBUA 1VCFA 2G37A 4QQ3A 4AMAA 3QV8A 4CU7A 2Y7FA 1MVYA 5REQB 1VBRA 4GZJA 2ATSA 2OYKA 2WBGA 1C7SA 1OZMA 3R13A 3HQ1A 4JTDA 2YCIX 3TONA 1W54A 2JE8A 5E1QA 3LXAA 3W82A 3WUFA 4WRHA 4FS9A 3H7VA 1PAMA 3U5YA 4QG9A 3QQ0A 2ZUMA 4DELA 5F2GA 3AS0A 3OOQA 3STFA 1HVQA 1JPIA 1UWUA 4A3QA 3P6LA 2J27A 4AU0A 4FSAA 1E40A 3R8RA 4NRSA 2HS8A 4Q8MA 4QSHA 4MG4A 4WEVX 4AHQA 3OGSA 4YWIA 4KWSA 4M56A 4REQB 1ZJIA 1W31A 1PV8A 3BLDA 3GVQA 2Z24A 1A5MC 4JL1A 2YBUA 2ZUWA 4D6CA 1OYAA 4XSLA 3QQWA 5AVHA 4WUIA 2W3ZA 3CZEA 3EOLA 3WEZA 3VIOA 5HR7A 2O9TA 3H2NA 1KR0A 2OGYA 4AC1X 3R0DA 2ZRYA 3R25A 4H2CA 2X7WA 5K2ZA 3UR5A 3PZVA 2DH2A 1B90A 4K7VA 2ZVIA 3MYPA 4ZOBA 3ABQA 3HJZA 2PC4A 3CPGA 3W7IA 4DZAA 1EPXA 3TZNA 1JCLA 3FSUA 3TR2A 2WVTA 4H8VA 3ABZA 1F4AA 1US0A 3F4WA 1DL3A 1UROA 7REQA 1AVAA 1TJ1A 1HO4A 1MWOA 1DWIM 4J7RA 4Q32A 3W84A 3OGRA 3W1QA 4O1CA 4ZMGA 1RZMA 3E2RA 4UTLA 2Z00A 4Q8NA 1YEYA 1GQNA 3PJTA 4NHVA 2Y8UA 3KRZA 3NEVA 4QRNA 5BNKA 2DZTA 4JHMA 4QAIA 2ZBTA 2W4XA 3UG3A 2FPYA 4D71A 5I0DA 2GSEA 1Q85A 4PCFA 3WMLA 1XV8A 3HFYA 4WHBA 5FEWA 3TE9A 2ABAA 3T78A 4B3ZA 1XFCA 4IQLA 2YCLA 3KVJA 1WXJA 2AGKA 4MADA 1WZLA 4UTJA 2DUZA 1P7TA 4DF2A 4C6BA 2VT0A 3MBFA 4W7VA 1ITCA 4L4LA 2A85A 2OQYA 1FX6A 3T0BA 2FGLA 3W07A 1YNPA 1THFD 2IKIA 2BY3A 1LROA 1GOQA 3K8KA 1BLIA 2OX1A 1WDDA 3C2YA 4QLKA 1LTDA 4YTUA 4JIQA 1QW8A 5E70A 3AQUA 3M5YA 4HYWA 4F0KA 1BF6A 1JULA 3O6YX 1IIGA 3UF9A 4DIAA 4Y9MA 2YW4A 2NWRA 3T2QA 3NIYA 2TYSA 2Y7GA 1E56A 4RDWA 3NZQA 1OF6A 3OYXA 4W87A 1WNOA 1F74A 4LTSA 3MUY1 4M29A 2ODOA 5HATA 1R47A 2R14A 3OZOA 3QYSA 2Z6JA 1WO2A 4XK2A 4IIGA 3GZAA 4LQ1A 3LBCA 1ICPA 1T6MA 4FXFA 1R3VA 4KKXA 1R3YA 1KBLA 1HT6A 3FAWA 1DJNA 1EIBA 3DG7A 1QO5A 3UA4A 1EOKA 1JZ7A 1SJAA 1KFBA 4J3UA 1M7OA 2JKEA 4O0QA 2ZRZA 5A8NA 2Z1VA 4ZQOA 1GOOA 3MMTA 4XZHA 5HMSA 3ICJA 1BYBA 4KWOA 1M7PA 5IDIA 4JGDA 5AYIA 3KE0A 4E0CA 3UXIA 2J4GA 3WLIA 4NYYA 5XINA 2OELA 4IF2A 4XVDA 4Z1CA 3UWUA 4M1RA 5E6ZA 1DHPA 2BX7A 5HMDA 2XIJA 1E43A 4MHBA 3EB2A 1QT1A 3GO2A 2PWFA 1KTNA 2ON3A 4RK8A 4XD3A 3TYUA 1SJDA 1UKTA 3ES7A 2QUVA 1QPKA 3KVLA 4B4FA 1JCTA 2VX7A 3AICA 2VZTA 4UOZA 2J66A 1YPFA 1I4NA 2G0WA 3WD2A 3PPFA 4BEQA 2Y88A 5EU9A 1YIXA 3GXMA 2WWDA 1HX0A 5FESA 1XYMA 5CSYA 1IEWA 4LT9A 4MB5A 3NL5A 3BQ5A 2W92A 4BI5A 3VE9A 4JTKA 5LNRA 3UWWA 4B5VA 3ABRA 2G5WA 4F0MA 1CENA 4H7ZA 3N15A 4JN7A 1QASA 4H8HA 2G95A 6CGTA 1GVEA 2Q71A 4WXZA 2AOSA 4N4QA 3OTRA 3ORWA 2O56A 1D9EA 4AX6A 4JBRA 1IV8A 2CLFA 3L5MA 3CL7A 1ICQA 2CZFA 4GO9A 4UQDA 4RJEA 5CPTA 4GIEA 4ZE4A 5FAGA 2H90A 5I6SA 2EG6A 5FF0A 4W5UA 1GKQA 1ML1A 1A5CA 4P61A 5G5IA 3QMSA 3VKDA 3MS8A 3IIPA 3CAWA 4B5TA 1AQ0A 3LHWA 2MUCA 5DFAA 5HJYA 3ZJ6A 1XDLA 2RGMA 3ZVHB 3IJ6A 3UZJA 2CZDA 2Y6ZA 1UCWA 2FB2A 3B9NA 2NWSA 1KFKA 2JEQA 5BW6A 1C8VA 2ZX6A 5K9CA 3AJXA 3ARPA 3U6WA 4HNUA 4KEZA 1EJXC 5MF5A 5A6KA 1KFLA 3W86A 1XDJA 3TCSA 4JTFA 2XUCA 4RNJA 2QCGA 1F3XA 3OBAA 4NJIA 3B9OA 4HSNA 3NO3A 5TQLA 3M46A 5EYWA 1M9HA 1Q13A 2D2OA 3GC5A 2V5DA 3TR9A 4Q7IA 2H6RA 3C5QA 1W5NA 4LGXA 1T8XA 4JIRA 3N17A 3Q67A 2A0NA 5BMXA 2V3DA 2GJLA 2W79A 3TQKA 3XISA 5KZDA 3BJTA 5ENLA 4KWVA 3VKJA 4F66A 3F7JA 2ZUTA 1XCFA 4EXAA 4RPPA 3D3AA 3TAKA 4IQEA 1WDQA 3DU0A 1QWKA 2CW6A 3E0WA 1XKJA 1O6IA 2C19A 3AYSA 4M6PA 4LUIA 1VRXA 1DXFA 4PB3A 4DBWA 2E68A 3JZUA 1W8GA 2V63A 4LS1A 5G2HA 2HRWA 4U33A 3GDBA 1JCNA 3MW7A 3HA1A 1ITXA 3S9ZA 1E1EA 5CZSA 4AFYA 3FGCA 2QS8A 4U3CA 1VPYA 4Z2JA 2ZC8A 3C0SA 1KM3A 3THQA 3DFYA 2C1IA 4EAMA 1V0NA 2DZAA 4JN8A 2VEFA 3QR0A 1UR9A 2BVWA 3VD7A 1HNYA 4IXHA 1MW0A 1EC9A 3RILA 1EQPA 4EF9A 2GOKA 5BXSA 1M65A 2ZX8A 2E40A 3SRFA 1MUWA 3CO8A 3PZNA 4BKNA 1LORA 2VX4A 4BF7A 4L1GA 1RLDA 4U3AA 5IBXC 4IJBA 4ZL1A 2FH6A 5F1UA 2I5QA 1S2CA 2EGZA 3V0UA 1KWKA 4GABA 2VEKA 3PUOA 4MPQA 2PE4A 3ZS4A 4KWUA 3WQCA 3M0KA 1FH8A 4BS0A 1U1JA 3ABSA 3VD9A 3S9IA 1RY8A 1OWQA 1EWEA 1B3OA 2GJNA 2G8ZA 2PRLA 3UXKA 1UMYA 4WDXA 3UD6A 2YX0A 3K5XA 4GD0A 2QCLA 2ACRA 2V68A 2FFIA 2PB1A 5BU9A 1R8LA 1S5NA 3IARA 3EXRA 3GTFA 1US3A 3RNDA 1UD2A 2YDSA 4Z2GA 3UY8A 4MAZA 1XP3A 2QAFA 2ZADA 4LUJA 3SGZA 1VBHA 5LIKX 1EC7A 4ZB5A 4DNMA 1DIOA 3QF0A 2ZKMX 4K3ZA 4IICA 1K4HA 2J9YA 3B8DA 1IT8A 6REQB 2D69A 4I9JA 4OE7A 4JFUA 1GOKA 1LP6A 4HZ6A 2D2GA 3KBNA 5I07A 1DEDA 1BHGA 1M7XA 3ZWSA 1JXJA 5ABTA 4MZ8A 4IIHA 3TROA 2C1HA 3T6CA 2QIWA 1AQMA 1UA3A 3TJXA 3MI2A 2GL5A 1KXHA 4JCLA 2OT0A 2DZVA 2ISFA 4AD2A 2PF8A 1V6VA 2OWCA 3KHJA 1MDRA 4NJKA 1OCNA 4K6AA 2EPHA 3EPOA 2PMQA 1OG6A 3CMJA 1X7FA 2YCEA 1W1A1 4WY0A 1DYSA 1G6CA 1ZJBA 2Y7DA 4QDMA 3THAA 4H9YA 3FK4A 1UBSA 4JFVA 1R38A 2D22A 3TJIA 3MUXA 3KW3A 4WX2A 2WSKA 3R12A 3E6EA 4AEEA 4LAUA 2WC3A 3S5SA 5B7ZA 1W9PA 3ARSA 1OFBA 5EB8A 1VIZA 2BFGA 2FJKA 1S2TA 2Q6ZA 2VEMA 3MPGA 4D8ZA 3N1AA 1B3ZA 3P0XA 4EXQA 5D09A 1CB7B 4HN8A 1HJQA 2V5LA 5G1MA 1AMKA 2G3MA 5CZJA 2VTFA 1KQYA 3GE7A 1TV3A 1OFRA 1KTBA 2E7FA 4MJ4A 3QTPA 1TJRA 3SCSA 4I8DA 3M16A 4MWAC 4RKAA 3ATZA 1V0MA 3QR1A 1H63A 3W87A 1E1CB 3GFXA 3P62A 3CS2A 3GH7A 2FVMA 5LSMA 3H23A 4PRWA 3IRSA 3R43A 1OFOA 1TPVA 3N2MA 1CDGA 1ZSXA 3BLOA 1VLWA 3WFAA 1LG2A 6PTDA 4C7GA 3S2LA 2X41A 3TEVA 3WZ0E 4YHEA 5M03A 1P0DA 1F7BA 1RLCL 2XGIA 2CETA 1HL9A 5K3VA 3SADA 3H2CA 2QDDA 2WC7A 1XW8A 3HGSA 4H7CA 3UFYA 3T05A 4W8BA 4GQQA 4H83A 1RSCA 3ZYZA 5U4NA 3N2OA 2E6AA 1UKQA 4KEVA 4BZYA 1TIMA 4Y9OA 3LLDA 2XN1A 2OYLA 1PWMA 3IUHA 2WMJA 3C6CA 2Q3RA 1UASA 3W6YA 3VI2A 3S1GA 1UWAA 4W86A 3CAQA 1V6TA 3I6EA 1WYIA 1PKYA 4LYRA 4REQA 1XDMA 1YTKA 1BTCA 3RCNA 4DJEA 5A94A 1PDYA 4CGTA 1C9WA 3ZSSA 2B7OA 2DT0A 4ZO7A 2REQA 3D3FA 4C6IA 1WKFA 4NX0A 4ZFMA 2PDHA 4J4KA 3GBDA 1PXGA 4I7VA 1B3YA 2LLEA 4D2JA 4JX4A 3G22A 4QLLA 4F0RA 3RR1A 4UTWC 3CTLA 1BAGA 4UUIA 1V7AA 4UNKA 3UBPC 3CQHA 3UYCA 3H4XA 1KXQA 1H51A 2VC7A 1O5QA 1I0DA 1E9LA 3WJSA 2CZEA 2VVSA 2D2JA 4FHAA 4ADUA 3G2GA 3BQ6A 1LWHA 2OO6A 3SCWA 1OF8A 5HANA 5A1AA 1N55A 3LPFA 4EK7A 3PTDA 2WJFA 3FNDA 3V16A 3T0DA 1EEPA 4I5XA 1A5BA 4O8RA 1RJRA 2XPKA 3OVQA 3HB9A 3JU2A 3BSHA 1KM4A 1U1UA 3TFXA 2DUXA 3AYVA 2XVNA 5JMUA 4CN6A 3B03A 1Q6LA 1BSIA 1PTGA 4G1NA 1AL7A 1TO3A 1H7RA 1IYXA 1BGGA 4H1ZA 1LLOA 5BRPA 1ITQA 1SZEA 3JRKA 1XBYA 3S1XA 5ECVA 1EA9C 3QSTA 5FAJA 4G6CA 4PC8A 1RD5A 1E6PA 3T0TA 3VGEA 5H91A 3OPSA 2VFFA 1UR1A 3A4XA 4S3CA 2P53A 1K4GA 2WSPA 5AN7A 1QPOA 4PODA 4GZIA 1XG3A 3W1XA 2VCCA 4J40A 5FA5A 1QFEA 4XV0A 4H9UA 4B3KA 4H6KA 2G50A 3W70A 1TPFA 1OC5A 1RAKA 3I6TA 4GQBA 1BVNP 4U5IA 4DBDA 2XSBA 3LGDA 4DO7A 3CUGA 1TPH1 2Z29A 4H8NA 5E0CA 1VFTA 4BQ2A 2HV5A 3N4FA 4A4AA 3MT1A 2VGGA 3FYOA 4UMCA 1ZZMA 2VZOA 3P60A 3ERPA 2IKJA 3G1XA 3OJGA 4UZSA 1FWIC 2A21A 5IM51 1NIUA 4YTTA 2F61A 5A8GA 2ZRVA 3VM7A 2NSXA 2IXVA 5LIXX 1X38A 5HJXA 3BG9A 4K8HA 3EKZA 2VC9A 4IFKB 3WQDA 3PANA 2E1WA 4PCTA 2HDJA 3FJ6A 5I3GA 1XICA 3RLGA 3TNBA 5C9ZA 2PLCA 4IL2A 4ECLA 2XVKA 4HKPA 4WF7A 2R24A 2GQ3A 3ARVA 4NG3A 1FXPA 1VKFA 4KGJA 3AZSA 4GY1A 3WLSA 3RPTA 2V30A 3HZ3A 4C65A 1Q6CA 3WQ5A 1KBJA 5DMMA 3BE7A 3TSDA 2VEGA 9RUBA 3W2JA 3VUPA 4GYFA 1W1ZA 3DC0A 4ONVA 4XBJA 2Q8XA 3AIWA 1UR0A 3IGSA 3NM3A 1TMQA 3ZR5A 1CXLA 2OWXA 1PZ3A 3OO2A 5CBIA 3N9KA 1B4EA 1UHVA 3QYQA 4RW5A 3LNMA 3MTWA 3CNYA 2WQPA 1OGGA 2VCAA 3V35A 1XSJA 4M0XA 3DI0A 3SURA 3TSMA 3UR7A 2ZOXA 3STGA 4O54A 3CLWA 3BMVA 1MXSA 4P7NA 3RPMA 2BP1A 9XIAA 3CYJA 3MKCA 2ALRA 5EMLA 1SGJA 3CWNA 1XPYA 5DX7A 2UZ9A 2VL4A 4FAMA 4BQ3A 2CZ5A 4D6GA 1GJWA 3AZRA 1DQUA 2PURA 4U31A 4DZHA 1PPIA 2Q01A 2RKXA 3CJPA 4GNKB 3M0LA 1UBPC 3G18A 2WMIA 2Z25A 4M7TA 1TV5A 1A5UA 3TTSA 4H2HA 3SB0A 3AYRA 3URAA 1HP4A 4ZOEA 3HPSA 1JF6A 2I1OA 4NZJA 3NQMA 3GUGA 3CV6A 4DZ5A 3PR2A 2BNJA 3A4AA 1TA3A 4ZQRA 4Z1DA 1H7OA 1NH6A 4X9SA 3PZTA 3N6HA 1ELSA 2VD9A 3PY2A 1JZ4A 4YJ5A 1Q7QA 3S2MA 3ARXA 3T07A 2QJHA 3DXIA 1GHSA 2OLAA 2VZUA 3LM3A 2YXGA 1S2WA 4PB5A 1WDRA 3NG3A 5A6MA 5C70A 2OSYA 3PHAA 4I5UA 2I9EA 2QUUA 5A6JA 1WUEA 1QBAA 1MZRA 3M0VA 5JVLA 1X7IA 3QN3A 3EKGA 1FWJC 4FNTA 4F4RA 2DIKA 1Q8JA 5AYZA 3LMZA 1Q2SA 1SZFA 3CZJA 2Z4GA 4V27A 4PCSA 2Z1BA 1FWBC 4LCSA 4ZOAA 3GAYA 1X1NA 3ONCA 2I5GA 4RDVA 5HQEA 4HJFA 3RX3A 2QVHA 1UR8A 2J47A 4K8EA 1E5NA 1OG0A 3RFAA 1OBAA 3DFNA 3KM8A 4JOMA 1DIDA 1AH3A 1ZP3A 4UNIA 2XVGA 2QLYA 2J7HA 2DPEA 3N18A 4GY0A 4JXCA 2A3LA 1Q2RA 4FLQA 3TP4A 4FIRA 1EUAA 4Q6JA 4JEJA 3QEZA 3TW6A 2PWGA 2VGFA 2OG9A 3CYVA 2O9RA 1XGDA 4R9OA 1OX4A 3BURA 3L5AA 3FY1A 1JNEA 3FSTA 1I2RA 2J78A 3EX2A 1W3LA 1XCWA 3M1ZA 1TRIA 4JR5A 3GTNA 3BOXA 3VGHA 4OFCA 3ZFHA 2NQHA 2QPSA 3MMUA 5I03A 2YCLB 3VFCA 5I77A 1F3TA 2NX9A 3MSGA 4L4OA 4E3VA 4CLMA 2V5JA 4FPSA 1IT7A 4KRUA 3U2OA 5IXEA 1J2BA 3CAKA 1Q6EA 1TPB1 3H12A 2C3ZA 5BROA 1GK8A 1CGTA 3VIPA 5MKGA 2Z28A 3WCZA 1BWKA 4PB4A 5E93A 3CZLA 7ENLA 1UR2A 3RU6A 1J5SA 3CB8A 4LEQA 3RRAA 5EBAA 3UG4A 1XLJA 4WY0F 1A5SA 3LHUA 3W0KA 3OVRA 1EX1A 5EY5A 4GK8A 4S1FA 1YADA 4QEEA 5DELA 1EUNA 3MHFA 3LRMA 3L0GA 1I0BA 2XN2A 1R9XA 3PSWA 3EDFA 5EMMA 3T81A 4OGZA 4XISA 3KCJA 3OZYA 1D2KA 1QAPA 5BOOA 1EYEA 1XF0A 1XLDA 3PP7A 1LZOA 1F05A 3UZWA 4PL1A 4QCEA 2BMBA 2Y61A 4LJ3A 3CQJA 3KOWA 4HGXA 1X6UA 2QF7A 3K4DA 5CPNA 1KFEA 4YS1A 4HTYA 4KFPA 3CQ0A 3KBWA 3V7PA 3LCXA 2VP8A 3LV5A 4CD5A 3UQNA 4A3YA 3CTTA 3VXGA 1OCJA 3WLKX 1E1CA 1QXLA 4I6VA 3VDAA 5KEZA 5SWUA 3W02A 2WANA 2V2DA 3F4CA 2AGTA 1TUFA 2PDKA 5D8ZA 3SECA 1XBXA 3TLLA 3AHTA 1QNVA 4L1XA 4ZEPA 1CPUA 4ZXLA 3UNTA 4IX0A 1P0NA 2WVVB 4URIA 1P1MA 3VD3A 1PSCA 3RM9A 1PYMA 2F2HA 2W9MA 1B54A 2E3ZA 3NPVA 4E3TA 4MAVA 2D23A 5G4HC 1XIFA 2DQWA 4DJFC 1JAKA 3BW4A 3T44A 3B04A 1VF8A 3H26A 4AAJA 4U10A 1TJ0A 2J7EA 1I2NA 2WCAA 1HFBA 1SQ7A 1LBLA 4LC8A 1HO1A 1W9XA 2V82A 3PPHA 2OO0A 3LCFA 5C2CA 5BCAA 4CD8A 2BHYA 3LQGA 2VFHA 1V02A 3N4EA 1FP8A 1FOBA 1WX0A 1G0CA 5M1TA 3RM4A 3TQVA 1REQB 3REQB 3STEA 1XLMA 1B9ZA 1YYAA 5REQA 2NX3A 1UG6A 1F61A 5XIMA 3TA9A 1S1RA 3G3MA 4XO6A 4QBXA 2A7RA 1K9EA 3N9SA 3SCQA 3REQA 5T9CE 4B2DA 1QHPA 3S1UA 2YBTA 1T99A 1A5LC 3C2OA 3DC8A 4TVCA 4NAFA 5I09A 3TN5A 2ZUSA 2WPBA 4H9XA 3PWAA 5HINA 5C8BB 2GGIA 1CEOA 2NUWA 4IGHA 4C6PA 5JUVA 4N2YA 1YMYA 2FMNA 3B97A 2XINA 2QVNA 2A5HA 3P84A 4GBUA 4HVXA 3R5EA 1QR7A 3SFKA 3P14A 1ZB5A 2DSKA 3PWGA 3GW3A 4MIMA 1C9DA 3VNKA 1XLFA 3VU2A 4B5WA 2E9MA 2FFCA 1XX1A 2BHZA 3TIMA 3F2DA 1E0TA 5IRPA 1YDYA 3BDKA 2PP3A 3MVTA 1MMFA 4CCZA 5AC4A 3V0TA 1PHWA 1ADOA 1R3RA 4YVXA 4L5ZA 1KBBA 2ALDA 1NELA 3QGAC 3YPIA 1TRDA 2C0AA 4AY8A 4HPHA 5JU6A 1SU5A 1CXEA 3POCA 1OC7A 4UWMA 2Y89A 1J5TA 2XIQA 3R4IA 1K77A 2OCZA 4I8YA 3SCVA 2OXNA 4YVPA 1JCJA 1OT1A 4UOJA 2E09A 2BTMA 2QCMA 3AMCA 4GPNA 5BXPA 3L9CA 2R1LA 1IEXA 4LAOA 5AC5A 3KVMA 1KA9F 2VWSA 4EACA 1QDSA 4JTJA 3U4FA 2R6OA 1XC4A 3L2IA 4GJJA 4F0LA 3EA1A 3A6OA 3BL3A 3M4HA 5FJJA 3A13A 5DANA 4GRSA 2WLZA 1KGUA 2BV9A 4NSBA 5I02A 4DWSB 4AWEA 2VDHA 3RJYA 3HPAA 1UPMB 3C3UA 3MKVA 4S38A 2E5BA 3TOPA 1WZKA 4LUSA 2V8ZA 3LZ3A 3UU0A 4TIMA 2GLKA 1H2JA 3GHTA 3BLKA 3N25A 3VZYA 2ACUA 3UERA 3KP0A 4WY0B 2P8CA 4A3HA 3VD5A 4IT1A 1FCVA 3QV9A 3W1NA