3QFEA

Crystal structures of a putative dihydrodipicolinate synthase family protein from coccidioides immitis
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
314
structure length
305
Chain Sequence
MVPRVPQPGIWCPAVTFFDSKTDTLDLASQERYYAYLARSGLTGLVILGTNAEAFLLTREERAQLIATARKAVGPDFPIMAGVGAHSTRQVLEHINDASVAGANYVLVLPPAYATTPPVIKSFFDDVSCQSPLPVVIYNFPGIDLDSDMITTIARKNPNVVGVKLTCASVGKITRLAATLPPAAFSVFGGQSDFLIGGLSVGSAGCIAAFANVFPKTVSKIYELYKAGKVDQAMELHRKAALAESPCGIATTKYAAAIFSAKAAGIEDAEEKLRPRKPYDPPSEAAKQEVRKVMAEVAAIEAGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a putative dihydrodipicolinate synthase family protein from Coccidioides immitis
rcsb
source organism Coccidioides immitis
molecule tags Lyase
molecule keywords Putative dihydrodipicolinate synthase family protein
total genus 113
structure length 305
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qfeA00
2RDWA 3RK8A 3FA5A 1YXDA 3ABRA 1X1OA 3G1SA 3G24A 4UTJA 4XQ6A 3N9SA 4NNCA 4Q32A 4UNLA 2WNZA 1IXQA 3MHFA 5D05A 2B7PA 5C6MA 2Y7DA 1NFBA 1FWNA 4LT9A 3TQKA 4YWIA 1A5BA 5EMUA 3UWZA 1TRDA 1LBFA 3CM4A 4XKYA 1KM4A 2ZZ7A 3EB2A 4GFSA 3SW6A 1KM2A 3UY8A 4NJHA 3HJZA 2CLEA 1F05A 3W84A 3A23A 4O50A 4R53A 3CPRA 4RXFA 3S5OA 3N2MA 4I7WA 2B4GA 5LGXA 4BF9A 3W1NA 3W86A 1U5JA 3EWWA 4GJ1A 1NEYA 3L66A 2NZLA 2R94A 3HO8A 3LHVA 3GB6A 4MVAA 5C54A 3GKAA 1EX5A 2G95A 2QJGA 1H7NA 1S5VA 1X1ZA 5AC8A 3W9ZA 3ZS4A 2Y63A 1DKWA 5TQLA 1YDNA 1UB3A 1XKYA 1QPRA 1TPDA 3MYOA 1DBTA 4WY0A 4RLIA 3TDFA 3LTPA 2ZFAA 1NSJA 4ICNA 3TR2A 4FX7A 3S6DA 2QCLA 2E6DA 3I68A 3L21A 4WX2A 5HWJA 5I3IA 4UTTA 4LU0A 5KINA 2OJPA 5LSMA 3GR8A 1ZAHA 4JX4A 3ANYA 1H7RA 3W1RA 3TCEA 4BFAA 3B03A 3W73A 1W3NA 4FNRA 3NGJA 4QNEA 4TMCA 3L2IA 3IIXA 2EAWA 5F2MA 3GDKA 1RQBA 2BX7A 1PCKA 1EB3A 1L2UA 5D32A 2YPIA 3QEZA 4H3DA 2NUXA 1O94A 3HPSA 2QEZA 1B4KA 3ZR4A 2TPSA 3QFEA 3L5LA 4IPIA 3F1QA 2NXHA 2ZRUA 5HWMA 1QOQA 3DHDA 5LNRA 1TJRA 3LM7A 4FNQA 2WSRA 1K02A 1EIXA 3E49A 3WK2A 4YL2A 2ZDRA 1TTQA 3TA6A 4DBEA 4UR7A 2Z6JA 5HUOA 2GUUA 1S5TA 4AHQA 1YDVA 3LB0A 1H7WA 3LBMA 1N55A 2FPYA 4GBUA 3BGGA 1W0MA 4IXHA 5A5WA 5IBXC 2WSYA 4XBSA 1LLZA 5LHFA 1JUKA 1I2QA 2H8ZA 1J5TA 3R8RA 3C2OA 4LY8A 1WXJA 1I2PA 3NQMA 4L4MA 5DCBA 3LV6A 2G96A 3P60A 3NO5A 3OVQA 3Q37A 2RFGA 1H7XA 3GAYA 3PB0A 5DBUA 4UTHA 4CLMA 5KSWA 2OCZA 1ZHAA 4JD4A 1F6PA 2V0TA 2WNNA 1UUMA 4Z1CA 4I7VA 1VC4A 3RF9A 3GYEA 4UTTC 3MBFA 1YLVA 4IOTA 3GVGA 3W7KA 3WJWA 1LRNA 1PHWA 1R46A 4WJEA 3B05A 3NQ8A 2YFNA 1XUZA 5AHMA 4AWUA 3M5XA 3ATZA 4GXMA 4N2YA 3DFQA 1SW3A 1TTPA 1ZENA 5TBOA 4YCPA 4Z1DA 4ZQRA 1IGSA 2NLIA 1C29A 4UTWC 1KM0A 1HO4A 5G5IA 2QAPA 2XFWA 5FEZA 3GAKA 4UFHA 1LLWA 3NQ7A 4LTSA 3QSTA 1G69A 3TXVA 4NXKA 1I45A 4MZ8A 4NZFA 4Y8FA 4LUIA 3OA3A 1O5KA 2J6XA 4O10A 4C1KA 5HR6A 5LNWA 3W71A 4PL1A 1G6CA 2CZ5A 1TSIA 1SSGA 4PC8A 3LV5A 4OV9A 4CCEA 1HTIA 4EVZA 2EF9A 3T78A 4FHAA 3GXTA 1OYBA 2B7OA 4N9EA 2Y88A 5CPLA 3YPIA 1JQXA 1H1ZA 3H55A 3TC7A 1TV7A 1V7YA 3LCIA 3B0VC 3MO7A 3LCXA 1R47A 3QQ0A 4I7UA 3DFNA 4O12A 3SECA 1LTDA 2WQPA 3H54A 3LHZA 3CEUA 4I9AA 4JR5A 1QR7A 3W1UA 2GJLA 4ML9A 4WD0A 3GDTA 3NQEA 3W23A 4PEKA 4M19A 3R89A 3DGRA 2DJXA 3O6CA 1F6KA 3KHJA 2VFEA 2A1YA 1DQWA 2R14A 1JVNA 1OFBA 1AW2A 1GWJA 1OF8A 3HG3A 1F74A 4JTEA 2TYSA 1Q45A 3O05A 4CCCA 4O0ZA 3W87A 5AFDA 1I4NA 4UFIA 1TREA 1YTKA 1KFKA 5K7JA 4QITA 1XFBA 3UPBA 2QCCA 2ATMA 3JS3A 2NUWA 2C6QA 3W2NA 3IGSA 3QRHA 3G1DA 3R12A 2A6NA 1SUXA 2BTMA 3ELFA 3S0CA 3BG9A 3IIOA 4EIVA 5HNRA 5HULA 2Y6ZA 3KOFA 4DF2A 4LV9A 3W88A 3NR0A 4DXVA 2TMDA 3I7QA 3GDMA 4XKYB 6TIMA 4LVDA 3L0NA 3EWXA 1PS9A 3P74A 3LBCA 3UXAA 3LCLA 4MLRA 1Z44A 3IEBA 2J88A 2QCFA 3CLMA 1QFEA 2YW4A 3LHUA 5C55A 2V5BA 1WOAA 3N3MA 3STGA 4QQ3A 4S2CA 5K2ZA 2Y85A 3PWAA 3W07A 5KMYA 1KFEA 3KVJA 4M7TA 3EX6A 4O57A 3B4UA 1H1YA 1QWGA 3TAOA 2CLLA 4WY0F 5LNUA 1A5AA 3SY5A 3IGXA 2Y61A 2CWNA 4BK9A 2E1DA 3LHYA 2CLOA 3SGUA 1Z48A 2P1FA 2NXGA 1ICQA 1KFBA 5AHFA 1LRQA 1F76A 3W1XA 3RNDA 4GUGA 4K7YA 4E2BA 2X1SA 3MI2A 1OF6A 1MZHA 2I14A 4HN4A 4O4WA 3EWYA 1FUYA 1D3GA 2VXNA 4CQAA 3A24A 1W5PA 4UMAA 4YXGA 1VPXA 2YYUA 3MUXA 3M41A 4N6EA 3PS7A 1X8FA 3UWUA 3HGRA 3BGJA 4O11A 1GPWA 5L9FA 3RLVA 3FEMA 2I9EA 3LCWA 3LTSA 2HSAA 4PA8A 4MFEA 2Z0IA 4S1FA 3EX1A 3QMRA 2JKPA 3DI1A 4TMBA 5CKSA 3G0XA 5D38A 3LXAA 3UZJA 7TIMA 1X6UA 1MEHA 3MYPA 2PRHA 3PM6A 5FI8A 5LGZA 3G1AA 4ZL1A 2ZRXA 1ZAJA 1TTJA 1W31A 4RKAA 3EKLA 2WKJA 3W76A 3MWAA 3TQVA 4JDBA 1OK4A 2HS8A 4MY1A 3TUUA 4PODA 5F1VA 2QDGA 3C6CA 3TMLA 4M5PA 3DXIA 3NAVA 2GPTA 1NAL1 2Y62A 3G1YA 4NXSA 5CGQA 3EKZA 3WJXA 2LLEA 4EF8A 3G3DA 5BRBA 3S5ZA 1HG3A 1WYIA 1OFRA 3STCA 2ZQ0A 1H63A 3IIVA 2ZRZA 4AB4A 3KVMA 2H8XA 3E0IA 4DO4A 4UTUA 4QSHA 4A21A 5FEXA 1LOQA 1TPB1 3MI6A 1SO6A 3B06A 3U8GA 2ZBTA 3R13A 4TU1A 1THFD 3G0SA 5EBUA 4IMEA 3S5YA 3INPA 1UCWA 3PSVA 3NQVA 3S9YA 1TPUA 4NQ1A 1ZNNA 2V2HA 1OYAA 5D2VA 1VCFA 1M7OA 3IVSA 4DQWA 1KLYA 2RHGA 3EX3A 4LVAA 5D02A 4FXRA 4JDYA 4CQ9A 2E6AA 1VJIA 4AVFA 3JRKA 4N02A 3G18A 1UUOA 1VYSX 4TR9A 1QOPA 4QISA 3EEGA 4AWSA 4WXYA 3LGEA 1GOXA 2WPBA 2RH9A 1SO3A 4JTTA 5ABTA 5U4NA 3BLEA 2RDUA 2DZPA 2ISWA 3P62A 3VNDA 3NQFA 3GDLA 4DPQA 2WJZA 4MYAA 3W3OA 4OQVA 3CWNA 3H53A 2V81A 3W7OA 1Q6RA 5E1QA 4GNJA 3LI1A 3UWYA 5D33A 4UXDA 4B5NA 4ADTA 1TB3A 4M6QA 1A50A 4FXSA 3PG9A 2ZZ1A 1KBJA 4O16A 1YPFA 1PE1A 2CFFA 2ZA3A 4QM1A 4MY8A 3HGJA 1WV2A 5DCEA 1D3HA 1P4CA 3CIWA 3C2FA 3USBA 2V82A 1OX4B 4JYDA 4FNSA 3U2OA 1O5XA 1G7UA 1PVNA 3M43A 1EP3A 1PIIA 3PSWA 3FJ6A 2FFCA 3TU9A 1ZAIA 3G1XA 3EXRA 3HF3A 1PCWA 1ZCOA 3QF0A 1SFJA 2KZHA 3W75A 4DEFA 3WFAA 3W2LA 5FF0A 4FX6M 3EXSA 1BTMA 2VFFA 1H61A 2XN1A 1YDOA 3DKJA 1OYCA 2AAMA 1LBLA 3W85A 3NPVA 1IIGA 3TSBA 2X1RA 4N9BA 4OU1A 2WOQA 5L6UA 2VFDA 4LNYA 1IF2A 2X1UA 4XBKA 1MEWA 4O19A 5DLCA 1K03A 2GQ9A 4O1CA 2GQ8A 3AO0A 3RLUA 1QPQA 5EY5A 1OFAA 2J24A 1ME8A 4Z08A 1P1XA 2GQAA 1ALDA 5HWNA 3P82A 3BARA 3DAQA 1JCLA 3JR2A 5EKYA 3I7SA 3O1NA 1KFJA 1ICSA 3TE9A 1KLZA 3WJZA 4Y90A 5F1UA 1JCNA 3HQ1A 1ZFJA 1TCDA 3OIXA 4IMDA 4MZ1A 5LKYA 3W2JA 2PC4A 1KM5A 1Q3NA 2P10A 1KM1A 4POCA 4CQ8A 2FJKA 3F03K 1KW1A 4JICA 3WK1A 2W0UA 1J2WA 4AWTA 2FLIA 2XN0A 2OZ0A 3W7EA 3HPXA 1ADOA 1KBIA 3DI0A 4UMCA 1S3HA 3T40A 3PAJA 3W7HA 1J4EA 3W6YA 2A4AA 3LHTA 3NEVA 5DBTA 1NF7A 1TPWA 2JKEA 1NF0A 1VYPX 3LHWA 3DHFA 3TKFA 1AG1O 4O1DA 5CPNA 4PTNA 1G67A 2ABBA 1XXXA 3U6WA 3TJLA 4HSOA 1JCJA 4W9TA 2FDSA 4EOUA 3L67A 1GJPA 3QMTA 4BWLC 4ZZ9A 3UWWA 1BKSA 1CI1A 4Y9AA 1ZALA 1GZGA 2D73A 3I7RA 1FDYA 1RV8A 1OG0A 1SW7A 3W1PA 1GVSA 5EPDA 3P67A 3IIZA 2YX0A 2Y89A 3LXBA 1IXNA 4LV4A 4CCDA 3BV4A 4NNAA 4ADUA 2H6RA 1MEIA 1L6YA 3GK0A 4IMFA 2YSWA 2VOMA 3V75A 5CZJA 2NX1A 2RDTA 3M9YA 1D9EA 1XBVA 4XZ9A 1GQNA 4K8HA 1NVMA 1WA3A 1ME9A 3DFTA 1EUAA 2DU2A 4HNNA 4UFKA 2C16A 4OBTA 2O7SA 3M7WA 3LX9A 1MSSA 4LVFA 1IXOA 1GTHA 2NX9A 1FBAA 1SZEA 5D2TA 2R91A 2WNQA 3HG2A 4WOQA 4YLWA 6ALDA 3MP3A 4GE8A 4DF1A 3AJXA 4JTHA 4RV8A 3NZRA 4AEOA 2QF7A 3PF3A 3UWVA 3M0ZA 3MHUA 2F84A 4ZQOA 2CLKA 3W7DA 4TX9A 1YTEA 3VKJA 4IX0A 1T8XA 4R33A 4BI6A 1XBYA 5F2GA 2C18A 4JXCA 3N14A 3DFSA 4CNOA 3I65A 1SPQA 2V8ZA 5FF2A 3A9IA 4NJGA 5D30A 4NX5A 1P0NA 3UD6A 3EX4A 3IIPA 4UTMA 4E2DA 5DY2A 3M5ZA 1W5OA 2Y7GA 3O07A 1HUVA 4JEQA 2YCEA 1O95A 1QNVA 1W3IA 1JJKA 4UC5A 4KWWA 1QCWA 3W7RA 2FPTA 3IV3A 2Q3OA 4LW7A 1AW5A 1RD5A 5CG7A 2E5BA 2ZZ6A 3NDOA 5DCDA 3R5EA 1JUEA 4WZHA 3S1VA 2JBMA 3M47A 3DFPA 5HUPA 4FX8A 1K7XA 2Z1BA 1VCGA 3LTYA 2EGZA 3NQCA 3SJ3A 3HGSA 4K6AA 5CPOA 3PBWA 4HIBA 4OV4A 1GVOA 3M5YA 4WXZA 4JN6A 3L9CA 4M6PA 3PC0A 4NVTA 3LI0A 1RVGA 1EPXA 1N7KA 3RMJA 4JX5A 3W2KA 3BLIA 5BOOA 3EWUA 2NWRA 3O6DA 4OT7A 3L68A 4K36A 5FF3A 4K39A 4MFDA 4LC8A 2YZRA 4DPPA 1Q6OA 4JYEA 1W5MA 4O13A 3LCGA 4ORIA 4A3UA 1OX6A 2A7NA 1GG0A 4A2SA 1A5SA 4NZJA 3EWBX 3IVUA 2E5DA 3KRSA 3ABSA 2ZCGA 3BW2A 2ZZ5A 3OBKA 3W1MA 2IQTA 4IPJA 1QMLA 5DN1A 2H90A 2ATSA 3NM3A 4IMCA 5AB3A 3B0PA 2AGKA 3CHVA 5FEPA 4R34A 3LCFA 2ZZ2A 4LRSA 1W1ZA 1K8XA 3STFA 1AMKA 4CNPA 3QM3A 3C0JA 3SR7A 2UV8G 1GYLA 3I6RA 4P2VA 1VGAA 1GYNA 1K7EA 1UJPA 4FNTA 1OVDA 2ZRVA 1WOBA 2E6FA 3HG4A 1GG1A 3VE9A 1F2JA 1OX5A 2Y7EA 1FY6A 4UMBA 2ZZ4A 3TXZA 1LOLA 4E38A 4Z1AA 4BI7A 4KFPA 1SSDA 4O18A 1DQXA 3BK0A 2QKFA 4OWGA 4DF0A 5G2WA 2CLHA 4N9DA 3PULA 3HG5A 4CNNA 3TSMA 2VFGA 1TO3A 3MBDA 3CT7A 1UBSA 1IXPA 2J9ZA 4Q33A 5SWUA 5H91A 4K7VA 3TX9A 1DL3A 2Y7FA 3OVRA 2DZXA 3QC3A 5BW6A 5CSSA 3NYZA 5BMXA 1G4SA 2X16A 1GVFA 4UTKA 1I2RA 2QCEA 1R2TA 3FJLA 1AK5A 3L5MA 2X1TA 4UFLA 2BXVA 5F4WA 4MY9A 1I2NA 3LLDA 1WBJA 4H6KA 3P61A 3N34A 1TTIA 1CW2A 3MMTA 3O63A 3G1FA 2PE4A 3KVKA 3TW6A 4NNBA 1H60A 3NNTA 4YMZA 3A5VA 5G1YA 5HQEA 5G4WA 1YADA 3E12A 1MO0A 1VS1A 1GT8A 3C8FA 1YTDA 4JIPA 4O0KA 3R2GA 5E93A 1QDSA 5HR7A 1FWSA 4O4VA 4ZQNA 5F4XA 5F2IA 3TNOA 3G8RA 3MW7A 2W6RA 3FS2A 5AYYA 2NX3A 2CLMA 5H2ZA 2CU0A 3LDVA 1G4EA 1BEUA 1VR6A 5HMSA 3W7GA 3PBUA 1SO4A 2YFOA 3LLFA 1SZFA 3VFLA 2QJIA 2P0OA 4JTSA 4K37A 2JK2A 4LUJA 4IQLA 1OFQA 1K3UA 2ISSA 1JCYA 2WO5A 2ZA2A 1S5WA 3W2MA 1YXYA 4JIQA 1H51A 2VEPA 5LZLA 4LOCA 1V5XA 3KX6A 3PUEA 3W83A 4O53A 2C14A 3BG5A 2QCGA 3HB9A 4RK8A 5AHNA 3UYCA 3P84A 4DO6A 2ZA1A 4ZQMA 1TIMA 1W3TA 3Q58A 4O14A 2A85A 4WOZA 5U7SA 3G3MA 4Y6GA 3QYQA 1FDZA 3QH2A 4UIOA 2C0AA 2A21A 1KV5A 1OFEA 4LVGA 1FQ0A 2CLFA 2Q8LA 3GR7A 1L6SA 4UCGA 4AF0B 1JCMP 2QUUA 5FF4A 3V1PA 2GVJA 2QAFA 3QPZA 1H50A 3GNDA 4HPJA 3L0KA 1FWWA 4RR4A 3M6YA 4X9SA 4AAJA 4O1AA 1XBZA 3BVJA 1A5CA 3OG3A 1M6JA 1R2RA 3S5NA 1LZOA 2V2DA 4XTIA 1H7PA 1C8VA 4ALDA 4LC6A 4UTLA 3GLCA 4BR1A 3O8AA 3TQ0A 5DY3A 1PL9A 1O60A 1LORA 4K38A 4MJZA 1A53A 3TAKA 4UUIA 5KITA 4FIRA 4Z0JA 3W74A 3W7MA 3MP5A 1AL8A 4JTUA 5E0KA 1FCQA 2C1HA 2C15A 3W1QA 1FCBA 1VLIA 3BO9A 4AF0A 3CTLA 3C2VA 5C5YA 3N9RA 2OT0A 4Y96A 5MHBA 3F4WA 3GDRA 3S1UA 4NUWA 1AL7A 3G8EA 1VQTA 3Q2DA 3C4UA 4QIUA 1TQJA 2FB3A 3HOJA 5DELA 5TIMA 4FIQA 4QAIA 1K7FA 1LBMA 4C1LA 3UQNA 4Z0SA 3D0CA 3KVLA 3HMJG 3N73A 4IMGA 3P8JA 3NPWA 1JR1A 3NZ1A 1QPNA 2NWSA 4XUGA 2J27A 4IX2A 2NV1A 4RCXA 3TW7A 5DXXA 4IXXA 3W2UA 1XDLA 2JGQA 5K4XA 5D03A 3WJYA 2XN2A 4AH7A 3QZEA 4H4IA 1EP1A 3KAOA 4PFMA 3NQAA 5LHEA 3O16A 3VCRA 1OHLA 4LS0A 5D2YA 3PR2A 3PBVA 1JQVA 2VFHA 4KFNA 3LERA 4NU7A 4U28A 3N2XA 4P61A 3GIYA 4GUJA 2PCQA 3RFAA 3A22A 4O8RA 2VC6A 5HINA 4JNMA 4MOZA 4NJKA 3W7PA 1H5YA 4LS2A 3W7IA 1SQ7A 2GVLA 3TC6A 1DJQA 2I1OA 3PUDA 4N9CA 3W1AA 1JRBA 1TPH1 3G1HA 4PH6A 4O15A 5J5RA 1XL9A 2BZNA 3SGZA 1PHQA 1O4UA 5AHEA 5D37A 1Z41A 3ZWSA 1SU5A 4GC4A 3FFSA 5AN7A 4UTWA 5BNKA 1E51A 1RZMA 1EWEA 3DKLA 2F7FA 4L4LA 4JTKA 2PRMA 1R30A 3UPWA 4HT3A 1WAUA 2YR1A 4FB7A 4GRSA 3IGUA 1KA9F 2PRLA 3NL2A 2C19A 1SZNA 4WUIA 1WX0A 3NVTA 4WY0B 1EEPA 2FPVA 2C3ZA 2ZTJA 1YPIA 4YCOA 3C61A 3PUOA 1PV8A 2Y70A 4JY9A 3WK0A 2E6YA 1CX9A 1DJNA 1XUUA 1EP2A 2YW3A 3FKKA 3O06A 4AHOA 1TMHA 2GOUA 4GUIA 3S8HA 3HGOA 1C9DA 4RZ5A 4X22A 1RQEA 4JTGA 5FF7A 3W7LA 2OT1A 4IJBA 3C2EA 4GUFA 1VZWA 1VYRA 1GEQA 1BWKA 2DORA 2V5LA 4U4MA 1EUNA 1TQXA 3M1ZA 3BLFA 3M16A 4UR8A 1KTCA 1W5NA 2Q3RA 3PVFA 3SI9A 4A2RA 3PG8A 2OMAA 3KXQA 1OFDA 2JGYA 3M5VA 1OFPA 3EWZA 1OX4A 1DOSA 3LRKA 2H3BA 1TJPA 5AYZA 3NQ2A 1SFLA 3GXNA 5I3GA 2DZTA 2TRSA 3SZ8A 3ZWTA 5KZDA 3SIZA 2O7QA 4ZQPA 1OK6A 2ZRYA 1GTEA 4MLJA 1FWRA 4KKXA 3N19B 1KTBA 2OX1A 3W7CA 5D2XA 3E96A 2EHHA 3C3NA 5D2WA 1L9WA 3VI2A 3T44A 1W56A 4AMAA 4AXKA 3C52A 4UNKA 2VELA 1T96A 1Q6QA 4O17A 3BG3A 1Z42A 1LROA 3CB8A 1KFLA 3QW3A 4IGHA 1ME7A 3DU0A 3UXDA 2A7PA 1QO5A 4HNVA 5AC7A 2FB2A 5IBXA 1SO5A 3T7VA 5AOUA 1TPVA 2A5HA 2FTPA 1TV5A 2QCNA 1VRDA 4JY8A 3P8IA 2ZTKA 3P81A 4MIMA 5HJLA 2RKXA 3LRLA 1TRIA 5LNSA 1XC4A 4FF7A 4DBDA 3W72A 2J9YA 1DORA 1B3OA 3MI3A 3UY7A 1H7OA 3B04A 4JGDA 3ABQA 4HHPA 3TFXA 1HFBA 5CZSA 3DENA 5F4SA 3W70A 3C2RA 2E5CA 4ADSA 3G22A 2VFIA 1Y0EA 1RPXA 1HO1A 4QJ1A 2AQWA 4WQ6A 1DVJA 3G1VA 1QAPA 4HPXA 1LYXA 3E9AA 4M7SA 1TPFA 4BI5A 4O1BA 3LRMA 3MP4A 1WDWA 3QJAA 3NL6A 3OEXA 2JKAA 5AYXA 2HTMA 5AHLA 2A6LA 1VCVA 5D04C 4Z1BA 5I3KA 3UZ5A 3BW4A 3TH6A 1FWTA 5LNVA 3FOKA 2R8WA 4JTFA 4MKNA 4Q4KA 1KFCA 3A21A 3ATYA 2V30A 1I8JA 1JULA 3MHGA 4PCFA 3LCHA 4JTLA 5G2HA 3FKRA 2QUVA 3NA8A 4EWND 3GKFA 2NUYA 3FYPA 2B0MA 2HMCA 1XM3A 3ABOA 3TROA 3DFOA 3EXTA 2VENA 4RZ6A 4XWUA 4NT0A 1F5ZA 3NL5A 3S42A 1JRCA 4X3ZA 3CWOX 1LM1A 1XCFA 3QSRA 1LOSA 2DP3A 3PY2A 1M5WA 4LWWA 5CPMA 3T4CA 4NJJA 3RU6A 5K9XA 2Z6IA 4GWEA 5D09A 1QO2A 4AHPA 1TYGA 2ABAA 1K8ZA 3KFTA 5C2XA 3LOTA 2ALDA 4J9JA 1WQ5A 4HNUA 1FXQA 4X2RA 3W7NA 2FIQA 1XBXA 3GNNA 1TV8A 1RR2A 4FEZA 1KTNA 3DBPA 1F73A 1GVRA 4RX0A 5FESA 5EA9A 3TV8A 1AW1A 2BWGA 3O15A 1YXCA 4MJMA 3ZFHA 5KZMA 3NQDA 3CU2A 2TSYA 5AC6A 1ICPA 1I2OA 4GUHA 4M6VA 1KV8A 1UASA 2QUTA 5G4EA 5KTLA 1Q6LA 3CIXA 2QCHA 3THQA 3NQ6A 4N6FA 1FCVA 4HSNA 4ORMA 2EPHA 3W1LA 5KZEA 5CSRA 5T26A 2X2GA 4BWLA 1KM6A 2ZRWA 3NL3A 3GZ3A 4TIMA 3HIJA 2E09A 3IVTA 2C13A 1U83A 5BMWA 4IWWA 3NPXA 3P7YA 3W7QA 2CLIA 3B8DA 3E02A 3W22A 3Q94A 2A7RA 2VEIA 1W5QA 3EX2A 2WV8A 5I3FA 1JUBA 4E0CA 4RXGA 2A0NA 2V2CA 3LXCA 1K8YA 4K8EA 3TSDA 4N4QA 4UTIA 2DJLA 1WBHA 1DHPA 3CEPA 5AHIA 4OHQA 4LS1A 3VE7A 2Q8ZA 4DELA 1L6WA 4A22A 2YXGA 3S1WA 3BPWA 4JTJA 2GVGA 1OABA 3KRUA 1OFOA 4JYFA 1BWLA 1VHCA 3OHIA 4FO4A 4R7JA 4DO5A 3TFCA 3QW4B 1ZJIA 1B4EA 4KWVA 3QMSA 1LCOA 1QPOA 3P5YA 3FIGA 3WJSA 4S2BA 1MXSA 2DZVA 2H3DA 2HS6A 3UNDA 1R2SA 1TPEA 3CC1A 1SZGA 4O28A 4HNTA 1G7VA 3OVPA 3FYOA 1EA0A 5K3VA 5A8GA 4NJIA 1IIHA 3M44A 1W54A 2EKCA 2YYTA 4A29A 3IRDA 3DZ1A 4RJEA 1FDJA 2BLEA 3L65A 2G97A 3HPZA 2G5WA 4OGZA 2YGYA 4D2JA 3CQ0A 1F7BA 5EL1A 1P0KA 4UFJA 4XTDA 4QNWA 2E68A 3L5AA 4KFOA 1T99A 1XI3A 3NM1A 2QJHA 2Z2UA 4JTIA 4FNPA 2FQIA 3GX9A 5J5DA 3TIMA 2A2IA 1OJXA 2X30A 1H62A 4MYXA 4RZ4A 2ISVA 3STEA 4UFMA 4MPQA 1KM3A 3P5ZA 1FCUA 2B7NA 1FXPA 2GJNA 3GXPA 1T0OA 1LP6A 3HBLA 3T55A 3L0GA 3C56A 4O54A 1VHNA 2CZEA 2ZZ3A 1W8SA 5CZ0A 4G1KA 1B57A 1XDMA 2DZWA 3W7JA 1SR9A 3PB2A 1W37A 5DXYA 2QDHA 2VEKA 1YYAA 2YDAA 4N4PA 2BSLA 2W79A 1EWDA 2J9XA 2QCMA 4LVBA 3WK3A 1JCXA 1ML1A 3QQ1A 5F2LA 5K4ZA 4MUZA 1GVQA 5G2IA 5I3JA 4O52A 3A5FA 3K30A 3F4NA 3MJYA 4OE7A 4HKPA 4LRTA 2NV2A 2V9DA 4IUOA 1ZY9A 1RQHA 1SW0A 1LDCA 3THAA 4TO8A 5IM51 3NQGA 3TJXA 4ONVA 1X7FA 2CW6A 8TIMA 3B0UX 2DZUA 2CZFA 3SFKA 5I3HA 1DV7A 1M7PA 3UWQA 2PURA 1B9BA 4ZMGA 2QCDA 3S1XA 3PBYA 2VKZG 2E77A 1VH7A 1N8FA 5K9CA 3P80A 4PL2A 2B7QA 5CZTA 4MZYA 3FLUA 2WSQA 3TK7A 4FNUA 3NG3A 5FEWA 3NOEA 3O6YX 5EYWA 2VEMA 4EF9A 3DH7A 4NX0A 3W1TA 2ZYFA 1HL2A 5GVJA 5K9DA 4ZVJA 1TPC1 1G4TA 2DZSA 3NPUA 3QPYA 4ZQCA 4JX6A 3TMQA 5G1TA 1P5BA 3SSJA 1VLWA 2NXIA 4JS3A 3BW3A 2CZDA 2QCDB 1FX6A 1LRTA 3G0UA 3NXFA 2QR6A 1ONRA 1G4PA 3KRZA
chains in the Genus database with same CATH superfamily
3RK8A 1K1DA 2XVLA 3G1SA 1ODZA 3ARRA 4UNLA 2WNZA 5D05A 2NT1A 1NFBA 3UP8A 3VD5A 1LJYA 3LNPA 1A5BA 6A3HA 5EMUA 2PI6A 3UWZA 2OOFA 3MCMA 6REQB 1TRDA 1LBFA 2O56A 2ZZ7A 3UY8A 1BSLA 3UG4A 2CLEA 3ID7A 2IKGA 3W84A 4O50A 2DT2A 4R53A 3S5OA 1DXFA 5BOFA 3N2MA 1HJVA 1E9YB 5LGXA 4BF9A 2PDLA 3W86A 4D6IA 1EGZA 4YHGA 1OEPA 3PZNA 2PP3A 3MSDA 3MS8A 1RJRA 2HVOA 1XD0A 4ZO8A 1UG6A 1W1A1 3QLLA 3ZS4A 2A3AA 1B90A 2C91A 3W0KA 2FGZA 2WJDA 2VC7A 5TQLA 1XKYA 3PJTA 2Q71A 2VVNA 3O9NA 2JEPA 4K1WA 4ICNA 2VMFA 3L4WA 4FX7A 3S6DA 5E9XA 2BXYA 1BGGA 5LA0A 4Z1YA 3DECA 4GVFA 3I68A 3L21A 3QY8A 5HWJA 4DRSA 4UTTA 5KINA 1Q4WA 5LSMA 2WSKA 1W1B1 4MF4A 1FWHC 3SUUA 3MSGA 3SM0A 1EJSC 2EAWA 5F2MA 3GDKA 2ZKMX 3GU9A 2O4QA 3H2EA 2QDEA 2VL4A 1R6WA 5GPRA 2GYIA 5I78A 1V6XA 4EPEC 2IPWA 2X0YA 2PDNA 3VUSA 3RU8X 1DYSA 5HWMA 1QOQA 3DHDA 1M03A 3M64A 1K02A 1EIXA 1GVIA 5EFFA 1JFXA 4H19A 1TTQA 3TA6A 2Z6JA 3NFUA 3U4FA 2G3MA 1XRFA 1JAKA 1DIKA 4AHQA 2YL5A 2Y0FA 1N55A 1UPPA 3NDYA 3SFWA 5AC5A 5IBXC 1EC8A 3MVTA 3GD6A 3VOIA 1JUKA 1I2QA 4IPLA 1LG1A 4L4MA 5MF5A 1VFTA 4P8VA 3LV6A 3S2CA 3DG6A 4UZSA 4BY3A 3P60A 1MNZA 3JZUA 4B4HA 2E9MA 4US5D 2J13A 1FVPA 4JFWA 4YTRA 3VIHA 1WUFA 1WXZA 4J28A 4CLMA 4CNUA 1UPMB 2DZBA 1EJVC 1F6PA 2PLCA 4Z1CA 4I7VA 1AUSL 4WDTA 4DNHA 4LAUA 3MBFA 4URIA 5IDIA 3W7KA 1BHGA 1LRNA 3VUPA 4Q8UA 4BJHA 4HMNA 4UWMA 4AWUA 3PBGA 3U4AA 1GOQA 4IPPA 1YEYA 2OKOA 4EPDC 1UZHA 5TBOA 2OB3A 3RMEA 1IGSA 1MQRA 4PGLA 1Z89A 4UTWC 3KS6A 1X97A 3AYSA 4Q7BA 4NXKA 1OT1A 3N1AA 4LUIA 2OELA 4DLMA 1NOUA 2J6XA 4C1KA 2D23A 3AIWA 4RZBA 3W27A 5FOOA 3W71A 1G6CA 3OYZA 2X42A 3M0IA 2VR4A 4FXFA 2F6KA 4PC8A 3LV5A 4OV9A 3T78A 4FHAA 1EDTA 5I5RA 1ISXA 1B5TA 4EXAA 3MA8A 3CIVA 1R47A 3G5EA 4U10A 4I7UA 4O12A 1KB3A 1D7FA 5A6MA 3H54A 4I9AA 3W1UA 4WD0A 3NQEA 4M19A 3R89A 3I6EA 4JIEA 2DJXA 4HOZA 1E6NA 4Q4OA 5BXRA 3RN6A 4C6EA 2J79A 1ISVA 1HKVA 4GH3A 1VEMA 4JTEA 4LAOA 1X39A 4GIAA 5D9MA 3TYCA 4JNZA 1R87A 3WDJA 4F48A 4UFIA 1XKJA 2PCEA 3WQWA 1KFKA 3F2CA 2VRQA 1FOBA 2QCCA 3JS3A 4P7LA 5CGMA 2GWGA 1EZ2A 2CETA 1UD2A 2DSZA 1XYBA 2V3GA 3DYMA 4UQBA 5FL0A 3KUMA 3GG0A 3VGBA 3VOHA 4GQQA 3AS3A 2A6NA 1F07A 3T0CA 2BTMA 3S0CA 1S38A 2Z26A 2NLYA 3BG9A 1P48A 4E4PA 1IEWA 4PMQA 5HULA 4DJDC 4DF2A 3L4UA 2TMDA 3GDMA 4XKYB 3AYTA 3P74A 3LBCA 3UXAA 5A8QA 3T0AA 1JZ8A 2FMNA 3B8WA 1F3WA 1EFZA 5FKYA 2J88A 1WOAA 2J77A 2R1PA 4GKLA 4QQ3A 2PGEA 5A6JA 3PWAA 1EOKA 5C2GA 1HN1A 1V3JA 1QWGA 3TAOA 1I0BA 2CLLA 2WVTA 4WY0F 3ARVA 2A79A 3GH5A 3ARXA 1UQYA 3IGXA 3TYZA 3GH4A 3CUIA 4FR1A 5EFDA 3EB3A 4MTVA 2XZ9A 2CWNA 1ESWA 2IPFA 5FJTA 2E1DA 3LHYA 4G2DA 3SGUA 4DWSC 7PTDA 3EAUA 1ICQA 1F76A 4GUGA 4PMYA 2V68A 2MNRA 1SMAA 1EKOA 3D6NA 4F0SA 1XH1A 3BSGA 1MI3A 4H9VA 1W5PA 4YXGA 1TIWA 2ZUSA 3M41A 5HAOA 4MADA 4DYKA 4TTGA 4DBUA 3UWUA 1WDSA 4W8AA 3SUTA 2BP1A 3RLVA 4C6NA 3RPDA 2HSAA 4C6QA 2NQ5A 1H5VA 4PA8A 2YL6A 4S1FA 4PB5A 3QMRA 1X98A 1B30A 2ANUA 4W4QA 4ENLA 3G0XA 2PWDA 1MEHA 3SRKA 1W9UA 3G1AA 4DWSB 1ZAJA 2R24A 1W31A 2PZNA 3AIBA 3WO8A 4P8UA 4JDBA 2VWTA 1OK4A 2HS8A 2QDGA 4PRTA 4KEUA 4M3PA 1A0EA 3ZT5A 1WYIA 3THUA 4JZ5A 3AMKA 4LPCA 3IIVA 2ZRZA 3RLGA 4OZOA 4G5DA 3H70A 4UTUA 2CPUA 2POZA 2C1GA 1LOQA 1TPB1 3CZJA 1SO6A 4WVXA 3U8GA 4TU1A 1E0XA 3G0SA 4HA4A 4W5UA 1QBBA 4JHZA 2FHCA 1VCFA 3TTOA 1M7OA 2PGRA 1EGVA 2RHGA 2VDIA 4FXRA 1QNOA 1XF0A 2E6AA 2CHOA 4XZIA 4Y9NA 1JPHA 1V0NA 4DJEC 3G18A 1TX0A 1VEPA 1VYSX 3EDEA 3JZEA 3TN5A 1QOPA 1HJSA 2WPBA 3BOLA 2RH9A 3B8TA 5FJJA 1ITCA 4NSBA 4REQA 3SUVA 2DZPA 1Q8JA 3A3HA 1D7KA 1VFFA 3WLJA 1UWRA 4JQAA 2CITA 2WJZA 2VC9A 1REQA 2V81A 3CO4A 3WDPP 4ATWA 2PTYA 3OOQA 3LI1A 3BOFA 3UWYA 4EPKA 1HL9A 1XISA 3ARQA 4M6QA 4FXSA 3T1GA 3FGCB 1GKPA 3OG2A 4TVUA 1WV2A 5DCEA 3SIMA 4AZ5A 1CGVA 3USBA 2OLHA 4A4AA 4JYDA 1PVNA 1PIIA 4ZXOA 3PSWA 4XAZA 4XAGA 1GNXA 1TMQA 3TYBA 3HF3A 1CXEA 3QF0A 2KZHA 3ITTA 1XINA 1QASA 3P6LA 2XGBA 1BTMA 4HP5A 3E0VA 1H61A 1YDOA 1JYWA 3OHMB 3ES8A 2CBVA 3VD7A 3TSBA 4PUMA 5L6UA 3T08A 3ZYZA 1QNPA 2X1UA 5I24A 5E9AA 1MEWA 5EMKA 3RO6A 4PMNA 1T41A 1J93A 1A5MC 2QVHA 4W87A 2VQTA 1KXQA 3ZVHA 1ME8A 2PWHA 1LF1A 3F4CA 1ALDA 3JR2A 4HZ7A 3O1NA 1OM0A 4JAWA 4QE5A 1KLZA 3WJZA 5F1UA 3HQ1A 1ZFJA 4JHMA 1TCDA 3OGVA 3CGTA 4MZ1A 2YBVA 1E40A 2P10A 1KM1A 5CLTA 4CQ8A 1H1NA 3AIEA 4JICA 2W0UA 1QW8A 1J2WA 4AZ6A 4AWTA 3KBNA 2OZ0A 3DI0A 3QYSA 3T40A 4I6KA 1J4EA 2Q8XA 2A4AA 1MMFA 4XIAA 5DBTA 5M2FX 1KKRA 4MM1A 2VX5A 1WDPA 3E0LA 3LHWA 3QKZA 3VMOA 2GSEA 3U6WA 3VIPA 4MNKA 1JCJA 1MUWA 4BWLC 3H2NA 3FHAA 5CJ5A 4L4PA 3WMBA 2HISA 1ZALA 1QWKA 1GZGA 1FDYA 1RV8A 4UQCA 1QI4A 3IIZA 4E6MA 1UKSA 3LXBA 4HU3A 2ZIDA 1NU5A 2R9RA 5HPCA 3S2JA 5D4YA 3S47A 3V75A 3G2GA 7ODCA 1D9EA 2ACSA 3V5OA 2XH0A 3U2ZA 1WA3A 1ME9A 2XWEA 3OGSA 5GJMA 4HOXA 1TVLA 2Z1KA 3LX9A 2NX9A 1FBAA 2PDBA 4LCQA 2VJXA 3FDKA 4GE8A 3KWXA 1M04A 3ITXA 1BRLA 3QLDA 3TLQA 4W7VA 4PZVA 1YHTA 2NQ9A 3NZRA 1S2VA 1TUXA 3RCNA 2XU2A 3M0ZA 4W8LA 3B9AA 2F84A 4JPGA 5AECA 3DOPA 2CLKA 3GIPA 3AU2A 4Y9MA 3A3XA 1YTEA 3VKJA 3CUHA 3WYZA 3QV8A 4MGGA 5A6KA 1PKYA 5D9PA 4KETA 3A9IA 4R88A 4TXEA 3AALA 5A6SA 1Q63A 4JEQA 3WLMA 3CZLA 4YN5A 2J8TA 1RD5A 1CNVA 4WGHA 2JIEA 3S1VA 4BCEA 3MC5A 2VVSA 3DFPA 2AL2B 2EGZA 2W67A 3HGSA 4PMVA 4I9MA 3WDIA 2F38A 3VCCA 1GVOA 2NVAA 3RO8A 3M5YA 4FOUA 5HNTA 4M6PA 1XIIA 1XIJA 3PC0A 4NVTA 3SEPA 4A8IA 2Y2WA 1N7KA 4DJEA 3GRIA 3BLIA 3GTHA 5FF3A 3LCGA 1H0IA 3PZGA 1HJQA 4MJ2A 4G9PA 5FCZA 4HGXA 2ZCGA 3BW2A 3L12A 1YNQA 1V79A 2RAGA 5DN1A 4KCUA 4K8GA 3TP4A 2ATSA 3RG6A 4J3SA 4LRSA 1DIOA 1AMKA 3QR3A 3CQIA 3NZQA 1WKYA 3C0JA 1GYLA 1VGAA 1GYNA 3QY6A 1CTNA 3QV6A 1OX5A 2WMIA 2ZZ4A 3TXZA 3B3DA 4DIAA 4S38A 4BI7A 2ZE0A 4KFPA 2BVWA 4LCRA 3BH4A 4H04A 4M56A 1DQXA 2I17A 1YNPA 2QKFA 3QGAC 1AQFA 2YCLA 2CLHA 3RX3A 3SUSA 2F8QA 1OY0A 3ME3A 2OGJA 4FALA 4ZGYA 4KH2A 2J9ZA 4FS9A 1GHSA 4YIWA 3TX9A 2QYGA 3E2QA 4GO9A 2DZXA 5CSSA 3TYEA 3NYZA 5BMXA 2VD9A 1E9IA 1R85A 1W3KA 3TTYA 1GVFA 1I2RA 3ZSSA 3UZYA 1JPIA 4XZLX 5LXXA 1LT8A 1I2NA 2ZUMA 1WBJA 6XIAA 1BYAA 3P61A 4W85A 1GW1A 2QV4A 4S3KA 1CEOA 3MMTA 1E1FA 1FWDC 3BJSA 1Q5MA 1H60A 3V16A 1DWGM 3A5VA 3T9PA 3W02A 4CVWA 4WDWA 2QJJA 2PC8A 2PBGA 3C8FA 4H8HA 3WBXA 1S1RA 2ASHA 5F4XA 5F2IA 4AC1X 1RD6A 4KWUA 1J6PA 2PDFA 4NZ4A 5B80A 4RE0A 3H2CA 3IAQA 3RRAA 1GQLA 5HMSA 1H0GA 1SO4A 1VP5A 2OGYA 3LLFA 3N4EA 1MUMA 2ZE3A 2VX7A 1E73M 4LQ1A 1K3UA 2O0TA 2ISSA 5CLWA 2IXVA 4L9ZA 3GW0A 2ZUNA 3W2MA 4Y9OA 3ITVA 4PMJA 1BAGA 3KX6A 1HW6A 3TLLA 4GQGA 3SJNA 3BG5A 2QCGA 3HB9A 2IS7A 4D71A 1RALA 1RXOB 1W3TA 3RAOA 4W89A 4WOZA 2PWUA 3AS1A 3G3MA 3W25A 1FDZA 3R79A 3DIPA 2C0AA 1OADA 3VNZA 1OFEA 4O8AA 7REQA 3MB9A 3PFRA 4P7NA 5FF4A 3XIMA 3QPZA 4G7EA 1H50A 1BF2A 1QU4A 3MVIA 4JQ4A 3WQVA 4NRSA 3GQYA 3CT2A 1W1IE 3E6EA 1R2RA 2BHZA 4C6PA 4LUTA 1LZOA 2ACRA 4UTLA 3CZKA 5CJNA 3TQ0A 4V1XA 5H1WA 1LORA 1QT1A 3KBJA 1XYMA 4YVPA 4UUIA 3ALGA 5KITA 3W74A 5RUBA 1VFOA 1AL8A 3I6TA 2Y24A 3PWIA 5ABHA 2HBXA 3GDRA 3SBFA 2D2JA 1CXLA 1HQTA 1VQTA 3AIVA 1N82A 3SQLA 1TQJA 2O9OA 3BJTA 3NIYA 2PB1A 1GOIA 4FIQA 3TC3A 4QAIA 1C8YA 3RRXA 5A1AA 3HMJG 3NPWA 3NZ1A 5C9WA 2NV1A 5CAHA 3W2UA 1XDLA 3WQDA 1CGTA 2D2GA 2GSJA 1AZ1A 3BMVA 2HXUA 4P5UA 2J47A 3C0SA 3QKEA 1YE4A 1F3XA 3APYA 4J40A 3OQEA 6CGTA 4LS0A 5D2YA 3PBVA 3VC6A 3QV9A 2DDXA 4MWAC 3LERA 3LNMA 3N2XA 3GFXA 4GUJA 4O8RA 3MUAA 2VC6A 3VABA 1HKWA 1R8LA 3OLGA 2GQ3A 3E2SA 3TC6A 3M0HA 4QTGA 3LQLA 1A80A 4N9CA 1TPH1 4EANA 4PH6A 5J5RA 4XAFA 4X60A 2OU4A 3SGZA 1KGWA 1O4UA 5E0FA 2DFAA 3FAWA 1POJA 1JGIA 3ZWSA 3ANVA 3KP1A 1SU5A 2ZOXA 4GY0A 1MDLA 3PN8A 4L4LA 1DWFM 2PRMA 4M6UA 1PB0A 1W1PA 3UPWA 4HK7A 1Z32X 1IT8A 4XAYA 2WHKA 3AWNA 3IGUA 1CB2A 1TWSA 3NL2A 1E55A 2AAAA 4HMEA 1M65A 4XVDA 4QLJA 4WUIA 3EMQA 1WX0A 4IFOA 2FPVA 5JIPA 4YCOA 1E6SM 4H1ZA 2YA2A 3BCDA 4WDUA 2YW3A 1ISYA 1TELA 1XW8A 2AMGA 2OVLA 1Q2RA 4ILSA 1TMHA 4GD0A 3S8HA 5IFTA 2D2HA 4HA0A 1REQB 3R10A 4RZ5A 3V18A 1CLVA 4X22A 4NP7A 4I9JA 4JTGA 5FF7A 5HATA 1A4MA 2AL1A 3W7LA 2OT1A 1BKHA 1R3RA 1V08A 1VYRA 3ZZ1A 2V67A 3GS6A 1UYQA 3ZOAA 4MJ4A 1UWSA 3VNIA 3RUBL 3PG8A 2PS2A 2AOSA 2JGYA 5LIWX 2UZ9A 2ISFA 4GY1A 1UR1A 3LRKA 3SCVA 2CESA 2FHBA 3GHUA 1SFLA 2DZTA 2E40A 2TRSA 1EHNA 3BSMA 3ZWTA 5KZDA 2NQLA 4HTBA 4I8DA 5AZ1A 4MNMA 1FWRA 3GH7A 4KKXA 1DJGA 1I1XA 2C79A 5D2XA 4LY4A 3OO2A 4NKCA 4A8LA 5XINA 4AXKA 4Z42C 4UNKA 1OGSA 1EPVA 3BG3A 4XV0A 1LROA 1F9CA 2A7PA 5LA2A 1NOWA 5AOUA 2GK1A 2OFJA 3ARUA 3WIJA 5A6BA 4JY8A 3P81A 2YCKX 5HJLA 2RKXA 4MB5A 3H6OA 3W37A 1E15A 1UUQA 2J9YA 3W72A 5I09A 3W70A 3C2RA 3O3RA 4ADSA 1EJRC 3OP2A 2AQWA 5HNNA 4QJ5B 1QAPA 2A3LA 4HPXA 3E9AA 4M7SA 4O1BA 3UG8A 2BNJA 2HTMA 5AHLA 1MQPA 3TQPA 5REQA 1U2YA 2OZ3A 3D5HA 4GJJA 1HKJA 1NWTA 4DM1A 3A21A 1I8JA 1I6NA 3MHGA 1AVAA 2NV9A 1KRAC 5I77A 4ZB5A 1JI1A 3GKFA 2HMCA 4DJFD 3ABOA 2VENA 1ONXA 2WC4A 1ONEA 4V15A 3URQA 3BANA 4ZTYA 1XP3A 3CWOX 3GNXA 3ZJ7A 1A49A 3N4AA 4LYKA 1J0HA 4I90A 3GXDA 5CPMA 4HPNA 1LQ2A 5REQB 2WLYA 1HJXA 3DHPA 1QO2A 2F2KA 3UZZA 1OGBA 4QHRA 1JNEA 3KFTA 2HXTA 5C2XA 3LOTA 1WE5A 3CHDA 5FIPA 2Z7GA 2G50A 4M24A 4Z17A 3IANA 2CERA 3OB8A 3BSHA 5A69A 1KTNA 6TAAA 3G1RA 1UWQA 5EA9A 1W17A 4MWAD 1BTCA 3SCUA 3NQBA 3SCRA 2WMHA 1LUCB 3CU2A 2TSYA 4AZBA 1TV3A 4AEEA 4H9MA 1MFUA 1UASA 4TTUA 5KTLA 1Q6LA 3CIXA 2QCHA 1KQZA 4NAEB 3WQOA 2WC7A 3LMZA 1FCVA 4HSNA 3W1LA 3HMCA 5T26A 4BWLA 3WDQA 2H9AA 1M9HA 1U83A 4M80A 3F4VA 4DI8A 4DAFA 2WYSA 3E02A 1KBKA 1ZU8A 3Q94A 2WV8A 1JUBA 2WVVB 2EG8A 4RXGA 9XIMA 4K8EA 2VUYA 4EXQA 4OHQA 2Q8ZA 1L6WA 4ACZB 3UWEA 3R11A 2DEPA 3MMDA 1BWLA 1XS2A 4H9TA 1VHCA 3SCSA 4DO5A 1QW9A 3QW4B 2YCJA 1ELSA 1B4EA 1SJCA 4GLEA 3O2LA 4DX3A 4IG2A 3MSYA 1MXSA 3WZ0E 3UW6A 3HU7A 2CXGA 2HS6A 3UNDA 4BHYA 1R2SA 1TPEA 1ODUA 1P43A 5JUVA 1UR4A 5K3VA 3IAPA 4YU1A 3ONBA 3M44A 4N42A 5IXEA 2EKCA 2YYTA 4A29A 4CN4A 3B0YA 4IH3A 2BLEA 3L65A 5HBFA 3RITA 2IW0A 5M5DA 1B3ZA 2YGYA 4D2JA 5EL1A 1JF6A 2OZTA 3GHSA 3CK5A 4MDOA 4H00A 3ITOA 2E68A 2VTFA 4KFOA 1XWYA 1SGJA 4FNPA 4GIRA 3BV7A 1ENUA 1OJXA 2W91A 2VZOA 1GCYA 3GUWA 4GNKB 2Z28A 1FCUA 1TX2A 4BEQA 3W82A 2NQZA 3HBLA 1LWIA 2CZEA 3KHDA 4E5TA 2DY3A 3P0WA 4W93A 1W37A 1X8CA 3V5CA 1OGGA 3BLDA 3EA1A 2J6VA 5JU6A 2V5DA 3EPNA 1EWDA 3BCFA 3UJ2A 3VNYA 1JCXA 4S3AA 5C2CA 1TWZA 2O9RA 5G2IA 1EJWC 3GVVA 5I3JA 1XLJA 7XIMA 4LRTA 2NV2A 4DNMA 1FP9A 5I0DA 3S83A 3THAA 4TO8A 2ZX5A 2AQVA 5ABFA 3RXZA 3TJXA 8TIMA 2DZUA 3CPUA 1EF2A 1Q13A 2EPNA 3UWQA 1C92A 1LLOA 2YCLB 1PBGA 2VKZG 4XO6A 1J5SA 4YYFA 4JIHA 2WHJA 5FAGA 4PL2A 3WD1A 3NG3A 4B16A 5FEWA 3NOEA 5EYWA 1IEIA 1HL2A 5K9DA 1ZS2A 2OWCA 2QDDA 2PODA 4ZVJA 4OKDA 1PEZA 4R9XA 2CIPA 1NP2A 3BAYA 4HMDA 4AYGA 3GC5A 4U2ZA 1V02A 1IQ8A 4JCMA 8RUCA 3TMQA 5G1TA 4CD5A 4LBRA 4X61A 1VLWA 1PX8A 4JS3A 5FJRA 3MZ2A 3N6QA 3O7UA 1G4PA 4IISA 3FA5A 1YXDA 1BVNP 4UTJA 4XQ6A 3N9SA 7ENLA 1ZBVA 3NVDA 3S5SA 1IXQA 2Y7DA 3M4HA 1V51A 2WHMA 2VX4A 1UKTA 2PDUA 2O9TA 1L6FA 3CAKA 3N12A 1B0IA 1ZJHA 4Q4SA 4EP8C 2FTYA 2VI0A 2ZDSA 3IWPA 1OG6A 4YS1A 4XKYA 1KM4A 4QCFA 3SW6A 1KM2A 4NI8A 2Z2BA 3WH5A 2PDQA 2B4GA 3ENLA 4QSFA 2NZLA 4E3TA 2R94A 3FX4A 3GKAA 9CGTA 4RPQA 1DP0A 1H7NA 1X1ZA 3M0YA 5HOSA 3WH8A 1O5RA 3DYPA 4H7CA 4L6HA 4A3RA 1UB3A 1QPRA 1TPDA 3MYOA 1DBTA 4KERA 4RLIA 1AMYA 5TD4A 3TDFA 4QCEA 2ZFAA 5XIAA 2ZVRA 3TR2A 4DXXA 4F79A 2GZXA 1S2TA 3LUTA 1Z3NA 2QCLA 1F4AA 4B5UA 4Y7EA 5C9RA 1UBPC 4F2UA 2HDJA 1PTGA 3A4XA 2OJPA 5IHRA 3GR8A 4PN2A 5BXPA 5JBDA 2D3LA 4U3AA 4QE1A 3ANYA 1H7RA 3TCEA 3B03A 3M07A 2FTWA 2I9UA 4TMCA 3L2IA 3L7RA 3WUBA 2BFGA 2WWCA 1WKFA 4XZBA 1RQBA 4FF5A 1FHDA 1EB3A 1L2UA 1UWIA 3QEZA 4UOZA 1H3GA 2NUXA 3HPSA 2QEZA 1AQHA 2EPOA 3L5LA 4RL3A 3TN3A 1I1WA 4C6OA 2PWFA 1NFPA 3DGBA 4FNQA 4ZE4A 3E49A 3WK2A 4JTRA 4NG3A 4ECLA 3P14A 2WLZA 4DBEA 4UR7A 2J7DA 4QDWA 5HUOA 4FZIA 2GUUA 3TZNA 2F6UA 1YDVA 3AOFA 4GBUA 5A6TC 1XGEA 5A5WA 2ACUA 1RK5A 4XBSA 3NSNA 4C65A 3WQEA 3R8RA 1R9YA 3BTNA 4HN8A 5FJPA 4WKHA 3WUEA 1CLKA 1JYNA 4GACA 5C8BB 2J66A 2REQA 3PB0A 3ZIZA 3WLRA 2O9PA 1DWHM 4KIRA 4F0KA 5CSUA 2OCZA 1ZHAA 1BLIA 4JD4A 2WNNA 1XPYA 3RF9A 5CGTA 3SY1A 1YLVA 2EKGA 1E6ZA 3WJWA 3AQUA 1R38A 1PHWA 4WJEA 1HX0A 3F2BA 2DZAA 3RLHA 1XUZA 3W01A 3WNNA 1V6TA 3TW9A 3DFQA 1K6WA 1SW3A 3DYOA 3ZXWA 2PBOA 4WJ8A 1HVXA 1P7TB 1C29A 1PJ9A 2QAPA 2XFWA 3Q65A 3BLLA 3GAKA 1LLWA 3NQ7A 3QSTA 3CQHA 4OOUA 5M3WA 1I45A 4Y8FA 4D1JA 4XK2A 1FHLA 1M7JA 4OTKA 3AMDA 2DIJA 4PL1A 1TSIA 4W8BA 4GQ0A 4UBPC 4CCEA 3VX1A 4EVZA 3GXTA 4N9EA 5CPLA 1H1ZA 4HNOA 1JAEA 1R9XA 1KQYA 3MO7A 2FZ9A 3DFNA 4AC7C 3SECA 4AMCA 4ZXLA 1DJWA 1LTDA 2PDJA 3PZ9A 4HYWA 3VXGA 1XG3A 3WLSA 1EXBA 3EOOA 1F6KA 2DSVA 2A1YA 2R14A 1JVNA 1XIBA 2PDHA 1P6WA 4EK7A 1F74A 4YJ5A 1Q45A 2XH2A 4XZWA 4C6LA 3GTNA 4O0ZA 1B9ZA 4HA1A 3W87A 3AICA 4GI9A 1RH9A 2WSPA 1TREA 5K7JA 1E4IA 4QITA 1XFBA 4MWAE 4BQ5A 2BS9A 2VUNA 3IGSA 4E4UA 1VD6A 3QRHA 2VO5A 3AHYA 5HA7A 3SRHA 1V0MA 4H8VA 3ZLGA 3GXMA 1MRQA 1GKQA 3VO0A 2QPXA 2E25A 1VIWA 3NR0A 3I7QA 2E9BA 4UOJA 2OYKA 1E3ZA 4RDVA 4LVDA 3EWXA 3GZAA 4RUBA 5IFPA 1UD5A 3WQ4A 1QUMA 3F2DA 3LCLA 3A3WA 3FVDA 2QCFA 1D8CA 4D9PA 2CKRA 2YW4A 4ZFCA 2V5BA 2AKMA 4OOZA 1SJBA 3AIQA 2Z1XA 4S2CA 3VPLA 3C5QA 4ACZA 1DWAM 5CH9A 4BF5A 4TVCA 2PPGA 1KFEA 3UT0A 3B4UA 1TVNA 4F0HA 3HV8A 1UP3A 3VZYA 4ZBCA 4IIHA 5BZAA 2PTXA 2W63A 4BK9A 4M1BA 2ZVIA 3A12A 4ASTA 2W4XA 3MMWA 2P1FA 3UG3A 3WQPA 4GBDA 1ECQA 1LRQA 3W1XA 3QOMA 4LYRA 3EZ4A 4GYKA 1Y7VA 4E2BA 2X1SA 1J79A 1MZHA 2I14A 2X7WA 3UERA 2CYGA 1FUYA 1BYCA 3CH0A 2INFA 2YKKA 4C6MA 3A24A 1WKDA 3WNPA 3ZLHA 4UMAA 1VPXA 2YYUA 3MUXA 2JE8A 3LPOA 4S3DA 4JKKA 5JXQA 4CU8A 1X8FA 4O11A 4DYJA 5L9FA 2FHFA 3N9KA 3TOYA 3AMCA 4WIWA 1TWWA 3BAXA 3VILA 3KOWA 3WUGA 4R7OA 1E72M 2BODX 3LBOA 3P3BA 1A0DA 1K9EA 1QHPA 4TMBA 3WDRA 2HE5A 5CKSA 4Q8PA 5D38A 3RDKA 3B8UA 7TIMA 3PTMA 5CAKA 3PM6A 3IGHX 3EA3A 3LENA 4OVXA 2XGIA 1TTJA 3T8LA 3WQ6A 2I16A 1RCXB 5F1VA 4AIUA 3SO7A 2XSBA 3UGRA 4JFUA 1NAL1 1JGMA 4NXSA 5CGQA 3WJXA 2LLEA 4EF8A 3G3DA 1SFSA 2CLPA 5BRBA 3S5ZA 1MZRA 3WMSA 3MDUA 2GJXA 4M0XA 1BPLB 2J62A 4GHRA 5LA1A 2H8XA 3R58A 4DO4A 4A21A 2QUNA 3ES7A 3H7UA 3GR4A 1THFD 5EBUA 4IMEA 1UCWA 3PSVA 3DG7A 3EWCA 4JFSA 1TPUA 1XYLA 1OYAA 5D2VA 1VFHA 1BQCA 2J7BA 4LVAA 3VA8A 3CL7A 4CQ9A 2E7FA 2HPIA 3C86A 1UR3M 5DMYA 1E5NA 3KW3A 4AVFA 3WLTA 2FZMA 1UUOA 4UQEA 4IIGA 1MNSA 4AVNA 3LQGA 4QISA 4HHHA 3UA4A 3LGEA 1GOXA 3N15A 2FZDA 1BFNA 2XYLA 5AZ0A 4C7DA 1AD1A 5BU6A 3P62A 2PU0A 3GDLA 2V5CA 5B7YA 3W3OA 3CWNA 3FXYA 2VRJA 3S2MA 3H53A 3W7OA 4DY1A 5E1QA 4GNJA 4UXDA 3RR4A 2HPMA 4CGTA 3UBPC 2C1IA 1KBJA 4IFRA 3LPFA 1AJZA 2ZA3A 3KDOA 4KF1A 5BROA 2JALA 1D3HA 1ITQA 3XISA 2V82A 1OX4B 4R5EA 3U2CA 1R86A 4FNSA 3U2OA 1NOFA 1PKNA 3PPFA 4Z2KA 1TR1A 2J7GA 1O7AA 1ZCOA 5F7UA 1JD9A 3W75A 4DEFA 3W2LA 2HEJA 2VGFA 4ZEPA 5DX7A 1IR2A 1B1YA 2XN1A 2W5FA 1OYCA 2UY4A 2XGZA 1LBLA 2QIIA 1IIGA 4EX4A 1Q8AA 1K9FA 4RNJA 4JTAA 4OU1A 1XLMA 3ARPA 1KWKA 2VFDA 3VGHA 3VYLA 1KR0A 1JYVA 4O1CA 2GQ8A 1ZUAX 4IQEA 4GI8A 4INFA 3N2TA 1PXGA 4Z08A 1P1XA 1GOWA 3ZM8A 4KT2A 3BARA 1JCLA 3I7SA 1GVEA 2OLSA 3R0UA 1IE7C 1JCNA 3E2RA 5HXMA 4KGLA 4ERGA 4RDWA 5LKYA 2PC4A 1GQKA 1Q3NA 1GPFA 5EMJA 1QNSA 3U3HA 3WK1A 4GI4A 5CC7A 3CAWA 1UJQA 2FLIA 4R27A 4ATLA 1ADOA 4CEXC 4KGJA 4S39A 4UMCA 3VDBA 3W6YA 1JDDA 1EJTC 3CNYA 1NF7A 3SDOA 3A9BA 1NF0A 2AGTA 2VP8A 1A3XA 3CTTA 3TKFA 3QQWA 1QI0A 4C6CA 3NSXA 1IWPA 2VCBA 1XXXA 2GFTA 3LA4A 4B91A 1W3HA 3W6MA 3L67A 4ZZ9A 3TWBA 3VM7A 2G37A 2TODA 1BKSA 3NZGA 3K4WA 2FDMA 4H7ZA 3I7RA 3CLWA 3II1A 5EPDA 2P76A 1JDFA 1MUCA 4LV4A 3VNLA 3B9OA 3AXXA 2YB4A 1L6YA 1XQLA 3WQCA 2YSWA 3VKDA 1VENA 2NX1A 4QLKA 1M1BA 5I02A 1YX1A 3M9YA 3ZVHB 2JF6A 4XZ9A 4K8HA 5HMFA 1N2VA 1FWGC 1W3JA 5HANA 3DFTA 1EUAA 2C16A 2O7SA 5BYWA 4LVFA 1POKA 1IXOA 1HP4A 4IQDA 4P8XA 5D2TA 1M7XA 3MP3A 3ZLFA 2WKGA 2YA1A 1Y5VA 2XH4A 1PSCA 4DF1A 8XIMA 4GCXA 4JL2A 4AEOA 1CWYA 5A8MA 4AWEA 3P2VA 3UWVA 4B2DD 4AG0A 1WZMA 4GVIA 3R94A 3W4RA 4ZQOA 3UVIA 3NGFA 1T8XA 4R33A 1XD1A 3TJ4A 4JXCA 4DZ5A 3E0WA 2ICSA 1RLDA 3A4WA 1P0NA 3UD6A 3IIPA 5J04A 2YCEA 4UC5A 1W3IA 4HQVA 2KX9A 2BG5A 3CYVA 5CG7A 3PFMA 1W32A 1NWSA 5DCDA 4FR6A 1RAKA 1ISZA 1JUEA 2VGBA 2XM2A 4W7WA 1A5NC 4U5IA 3H2OA 1XRVA 4AZGA 3C2YA 2Z7KA 3M47A 1P1MA 1VBRA 5HUPA 4FX8A 5AVHA 3LTYA 3GDBA 1MW1A 5CPOA 3PBWA 2J7FA 4HIBA 5HNUA 3PK7A 3UFYA 4OV4A 3SN0A 1JNDA 4JN6A 3L9CA 4KS0A 3N18A 1RVGA 1SYTA 1A0CA 1TG7A 4Q3MA 2JFEX 5BOOA 3EWUA 1UIPA 3O6DA 3L68A 2XPKA 2RGLA 4JYEA 4QFUA 4O13A 3RCMA 2L5HA 4A2SA 3LSCA 4NZJA 3E5BA 1J96A 3KRSA 4PR4A 1FA2A 1XLHA 2FFIA 3FXGA 1FH8A 1JZ5A 1NIUA 1V6YA 2DH3A 2H90A 3ZVIA 3CHVA 4R34A 3LCFA 1A47A 4CNPA 3QM3A 1V3IA 4IIBA 1UOKA 1LL7A 3TWAA 2HK1A 1XIMA 3WH9A 1OIFA 2CHNA 4HPGA 2E6FA 4L9YA 2GUYA 2PDGA 2GK1B 2Y7EA 5ECUA 1FY6A 1TFVA 2W27A 2V3EA 1SSDA 4O18A 4PE8A 2A3HA 2VZUA 3BK0A 3CXOA 5A95A 3BICA 3HG5A 5E6ZA 3TSMA 4CNNA 2VFGA 1TO3A 3CT7A 5SWUA 4IG2B 4GA8A 1PZ0A 2Y7FA 3ZQ9A 2IQ0A 2WZHA 5BW6A 4GZIA 4B2DA 3PZMA 3W6LA 1GQIA 1GOMA 3U7BA 3L5MA 1LWJA 5F4WA 2BXVA 1HXJA 3UYIA 1FHVA 3M46A 3LLDA 5M1TA 4C7GA 1VFUA 3ZJ8A 4EXBA 4ZO6A 3G1FA 1D2KA 1XJBA 2UWFA 4LUYA 4RE3A 4V28A 1PIGA 1V77A 3IJQA 4NNBA 3NNTA 1XLEA 2V3FA 5HQEA 1YADA 2GGHA 1H09A 2GSHA 3U0HA 1YTDA 4O0KA 4PMRA 5E93A 1QDSA 5HR7A 4O4VA 5IOBA 4ZQNA 3TNOA 1IWAA 2W6RA 3FS2A 4C90A 2NX3A 2CLMA 4FSAA 2PLMA 2X09A 2W92A 1G4EA 3WELA 1NP0A 1QHOA 4B9ZA 3W7GA 1QK2A 4GO8A 2D0GA 4X2PA 4QGCA 3MSRA 3WN6A 4JN7A 2ZWYA 4J3XA 4TUFA 1H51A 1NJJA 5LZLA 4LOCA 1DQUA 1SVDA 1PZ3A 3PUEA 5C70A 3W83A 3LLXA 4O53A 3JU2A 3T07A 4RK8A 4IHCA 3UYCA 4CD7A 4DO6A 4E3VA 1TIMA 4L56A 5U7SA 4Y6GA 3QYQA 4UIOA 1KV5A 2Q8LA 1OC7A 5KZ6A 3GR7A 3DFYA 2UY2A 1CGUA 1XQKA 1JCMP 4IJCA 1E6XM 1PKMA 3KL0A 3V1PA 1S2AA 4RR4A 5I00A 1Z7AA 4XX6A 4ZTXA 4RV3A 4O1AA 4MB1A 1XBZA 3BVJA 1A5CA 3OLEA 3POCA 1M6JA 3BZJA 2OR2A 4YTTA 1OCJA 2V2DA 1HJUA 2AQOA 2VCAA 1U33A 4Z2GA 4MJZA 4PMZA 1A53A 4HK5A 1R3TA 1KXVA 4FIRA 4Z0JA 2XM1A 2C1HA 1E0UA 4HK6A 3MZNA 1S46A 1VLIA 4LH8A 4AVOA 4C6KA 3CTLA 5ECVA 1QI2A 3L4VA 5GNXA 1XLKA 4PCTA 1V03A 4PUUA 3G8EA 3AMGA 4PBGA 4REQB 1MWOA 1KFWA 3C4UA 1IYXA 3IK4A 4HHLA 2FB3A 2VDGA 5HJYA 5DELA 5TIMA 4CEUC 3GFZA 1LBMA 4LCSA 1SJAA 3P8JA 1QPNA 1LQ0A 4IUGA 2MUCA 1XX1A 4GI6A 3I4KA 4GYPC 1DWIM 2JGQA 5K4XA 3GW3A 1BQGA 4PULA 2XN2A 1T40A 2OG9A 3QZEA 4H4IA 4I5XA 4PFMA 3NQAA 5LHEA 3O16A 3R0KA 1XIGA 1JDCA 3VCRA 1OHLA 4DUWA 2I5QA 4TVDA 1JQVA 1Q66A 3SY8A 4NU7A 2R1KA 1PWLA 3IACA 1F6YA 4JNMA 4NJKA 1H5YA 4LS2A 1SQ7A 3EBVA 2GVLA 4CN6A 5M17A 3W1AA 4GYFA 2BASA 3G1HA 3KOYA 3VTRA 2XH7A 5D37A 1Z41A 1WCGA 4GC4A 5AN7A 1E51A 1RZMA 1EWEA 3DKLA 2G41A 4GGHA 4JQ2A 3WLKX 3HA1A 2YR1A 4GRSA 4PCSA 1KA9F 2PRLA 1SZNA 4MDPA 5D9NA 3TZFA 2C3ZA 2ZTJA 4PCNA 2GL5A 3PNZA 4DZAA 4JY9A 3WK0A 3AYRA 1XUUA 2ZUTA 1KWGA 4AHOA 5HDRA 3HQOA 1R7OA 3N2BA 3BUVA 1E0VA 3GUGA 1VPQA 6PTDA 2V38A 3OLDA 4GUFA 1VZWA 1GEQA 3WKZA 1JZ2A 2V5LA 2PDYA 1PZ2A 1TQXA 3PWGA 1UIOA 4IZGA 3M1ZA 3BLFA 3R7MA 1KTCA 1W5NA 2Q3RA 3PVFA 3SI9A 5CBBA 2YB1A 3AZSA 1OFPA 1S2WA 2H3BA 1DOSA 2E67A 1PTAA 3IARA 4MNJA 3VOFA 5I3GA 1P0EA 3IJIA 3PHAA 3PPCA 3D46A 4F40A 4QG8A 5T8GA 1XLIA 4M29A 3IPWA 3THCA 1FWEC 4ZQPA 1OK6A 2ZRYA 1GTEA 4MLJA 1M53A 3SCWA 1PUDA 2XFRA 3J7HA 3PANA 3W7CA 4AY8A 2X05A 1Q6FA 2EHHA 3E96A 3C3NA 2W66A 1Q85A 1L9WA 4AMAA 2OO0A 4Q8QA 3BLOA 1W9DM 3VGFA 1QI5A 4O17A 3HM7A 2IMRA 1ME7A 1K70A 1QO5A 1F3EA 2WB5A 2FB2A 1UR8A 4MHBA 4OBRA 2FTPA 1TV5A 2QCNA 4KEZA 3EPMA 4GVHA 3HQNA 4L6DA 1U5HA 2OYLA 1XV8A 1H7OA 3KOZA 3ABQA 1IEQA 5CZSA 3DENA 1XYAA 4L7ZA 2AMXA 1S2UA 3G22A 3VC5A 1Y0EA 3LYEA 2GGIA 4PTVA 1DVJA 2O4MA 4BI5A 3M0KA 3U5YA 3OEXA 2JKAA 5AYXA 5EGRA 1VCVA 4Z1BA 5I3KA 4QDPA 2PMQA 5HPOA 1KRBC 3ZT6A 3FOKA 4MKNA 4Q4KA 1KFCA 3W53A 1E1EA 3CQKA 1G01A 4JTLA 5CJMA 3QHMA 5G2HA 1HKMA 1KGUA 4GYPA 3H26A 3FKRA 1NELA 4EWND 2VEGA 2NUYA 1XLGA 2PWGA 3FYPA 2B0MA 3FGCA 3DFOA 3EXTA 4XWUA 4QP0A 1F5ZA 3FN9A 1O1HA 3AHVA 2G3FA 5I23A 1M5WA 8A3HA 2XFYA 2F6XA 2EBNA 3EA2A 5I07A 2Z6IA 3WFLA 1HKIA 3URAA 1TYGA 4CD8A 3T81A 4KQNA 3OLIA 4JBRA 2ALDA 1KXHA 3KZSA 2FIQA 2NVCA 2DVXA 4S3EA 1TV8A 4DYEA 1RR2A 4RX0A 1F73A 3PZQA 3UPMA 1QHZA 3TV8A 1YXCA 3KLLA 1TWDA 3ZFHA 1GORA 4NAEA 5G4HC 5KZMA 3WH7A 4TV5A 1I2OA 4IGMA 4GUHA 1KV8A 4G1NA 3AJ7A 5LIXX 1IR1A 3GC4A 2UBPC 2CKSA 3K2GA 4DXKA 2YBUA 5KZEA 2EPHA 4KCTA 1TJ2A 3OW1A 4FA3A 2ZRWA 3IVTA 4WR3A 1L2QA 1YQ2A 1GUVA 3NPXA 2Q01A 1Q6GA 1M68A 3D47A 2A7RA 3EX2A 2V2CA 1KBLA 1K8YA 1I0DA 1H2JA 4N4QA 1U1JA 3BGAA 4K1GA 3MQTA 4DELA 3RM8A 6ENLA 4H6QA 9XIAA 1OABA 1B31A 4JYFA 1US2A 1VFLA 3OHIA 2OQLA 1ZCCA 4CN1A 3QMSA 4UTFA 3P5YA 1UZ4A 3WJSA 3E74A 4Z2LA 4K2SA 2QF8A 1X7IA 4L4OA 3WBEA 2DZVA 2H3DA 1KO0A 3O0FA 1IHIA 4O28A 2VZTA 1EEXA 3FYOA 4UNIA 3DESA 4NJIA 4MMWA 1IIHA 4S3JA 3PTDA 1W54A 1QATA 2XVNA 2GOKA 1OC6A 4W86A 2BY1A 3NWRA 3VOGA 1E4LA 2G97A 3HPZA 2G5WA 1EDQA 2EEXA 4JTCA 1NDVA 4GQBA 1M41A 1W6TA 5E5CA 4QNWA 1DJZA 4HZ6A 3MV11 3SAZA 2Z2UA 3GX9A 3K4AA 5J5DA 1X96A 3TIMA 4PB3A 3WLHA 1RBAA 3VCNA 1R7AA 3GTXA 1H62A 4MYXA 2ISVA 2YCIX 4Q8MA 4Y2WA 3P5ZA 2B7NA 3WFZA 2XJ7A 1LP6A 2YL9A 4O54A 1VHNA 2DT0A 2ZZ3A 4QX4A 2INZA 2CNCA 1R3YA 1W8SA 1B57A 1SR9A 5DXYA 2QDHA 2VEKA 1YYAA 2YDAA 3RM4A 1B3YA 3VIJA 4V1YA 3ARZA 2HRWA 2QCMA 4LVBA 1J0KA 1ML1A 4XZMX 1B3XA 3QQ1A 5K4ZA 4MUZA 1GVQA 4DZHA 4U33A 4AIEA 2OOGA 3K30A 1ZJAA 3F4NA 3MJYA 2V9DA 4IUOA 2P0IA 3RHGA 1ZY9A 2R1MA 4ROPA 2P3EA 2FZBA 4U31A 2Z29A 4B5TA 3EGJA 4B92A 3B0UX 3SFKA 2PDPA 2XZ7A 2ZUUA 1VKFA 5I3HA 1M7PA 1TWIA 2QW5A 3ABXA 1UC5A 1H49A 3NTYA 5A94A 2QCDA 1VH7A 1N8FA 5K9CA 3P80A 2B7QA 5CZTA 3FLUA 1DIEA 3TK7A 4FNUA 1DWJM 1JXJA 2GJPA 3EDKA 3K5XA 3PTQA 3DH7A 1NQKA 5GVJA 2D1ZA 1BXNA 5HMEA 4D6JA 1G4TA 1CYGA 4TOQA 1G94A 2GDQA 1E1CA 4AD0A 5DRIA 4AQLA 3CMFA 3VDAA 1OCBA 3TCSA 2B31A 3GSMA 3KTCA 3VIKA 2CZDA 1W9PA 1DE5A 1LRTA 4LAMA 3GO2A 2QR6A 2DUAA 4LUSA 3KRZA 3W38A 2WC3A 2QXWA 4AZCA 4EACA 3G24A 4NNCA 2C8NA 4Q32A 2VR2A 3MHFA 5C6MA 3DG3A 1FWNA 4RDYA 2JF7A 3R6IA 3TQKA 1C8QA 4Q22A 3URNA 4D6EA 3T05A 3V1HA 1W2PA 1XG4A 4DM2A 4LB3A 3BE7A 1UKQA 1L6GA 1RLCL 4MB3A 3BAJA 3CM4A 2Y5JA 3QZ6A 3EB2A 3EDJA 3HJZA 3CV1A 1CLXA 3KBMA 3CPRA 4RXFA 4ERIA 1T5AA 2JIWA 4BF7A 3W1NA 4B5XA 4B3KA 1U5JA 4RNIA 1B3WA 4GJ1A 4US6A 3L66A 3HO8A 3LHVA 5C7HA 3LZ3A 1OCQA 1DPMA 2G95A 2QJGA 4A3HA 4I8YA 5HQMA 5AC8A 1YDYA 3PUGA 2Y63A 4EPBC 3NURA 4GVGA 1DKWA 1WAWA 1YDNA 2XTKA 2CCRA 4WY0A 5BCAA 1NSJA 3UF9A 3ISIX 4G8TA 2DGAA 2E6DA 4WX2A 5I3IA 3F7JA 3Q4DA 1ZAHA 1EYEA 4JX4A 3W1RA 3S9IA 4BFAA 1C91A 3W73A 1EHAA 1O66A 4FNRA 3NGJA 3HV9A 3KCLA 1XHGA 4NI3A 1EYWA 2QLYA 4B3ZA 3LEPA 1B4KA 3ZR4A 1WZAA 3BL3A 2TPSA 1SJDA 1I75A 3F1QA 3RPMA 2ZRUA 5LNRA 1TJRA 4HJFA 2D24A 1FWJC 3UG5A 1CGYA 2OZ8A 4YL2A 3JVAA 5ABGA 4KW2A 4Q4QA 3H22A 4MKSA 4F2BA 3WLOA 3L4TA 2XIOA 2OSYA 3LB0A 1H7WA 1C90A 1NDYA 4WK9A 2FPYA 3BGGA 1QBAA 4IXHA 4OUEA 3UZWA 1AD4A 4LEFA 3COTA 1PX4A 5LHFA 2H8ZA 2DT3A 1J5TA 3C2OA 2WW5A 4W5ZA 2P53A 1I2PA 4UOQA 3QN3A 1CECA 2G96A 1E6QM 3EYPA 4M81A 3FJ4A 1H7XA 1Y5WA 3KDNA 3GAYA 4U3CA 1O12A 5DBUA 1RCOB 1U1UA 1GOOA 2VDHA 2V0TA 4DUOA 1U22A 1UUMA 4PBEA 3GYEA 4UTTC 4IOTA 4GINA 1OZMA 4P7OA 4KCWA 3RILA 3GG8A 3BZGA 2E28A 3B05A 2XG9A 2YLAA 2YFNA 5AHMA 2PDCA 2YXOA 3M5XA 3L4YA 2J8GA 2FZ8A 4GXMA 2VZSA 4HYVA 4N2YA 1U5VA 5AKQA 2J75A 3WY1A 4YCPA 5DANA 2PEVA 1TMLA 2NLIA 4XSMA 1KM0A 3FYYA 1HO4A 3CB3A 3AUOA 4NIRA 4CD6A 2QGYA 3DX5A 5FEZA 3F4DA 4UFHA 4ZFMA 3QY7A 1G69A 3TXVA 5AY7A 3VOCA 2XUCA 3POHA 3OA3A 1EXPA 1EDGA 5T9BG 1SMDA 1TZ7A 3B4YA 1EJUC 1Q7ZA 4F66A 1SSGA 3TA9A 2PFHA 1E1CB 1HTIA 1ADSA 1GKRA 4WLCA 2EF9A 1EC7A 1OYBA 4MWAA 1L0PA 3VNMA 2HVMA 4UQAA 4LANA 2PDMA 1TV7A 1V7YA 3LCXA 3QQ0A 1UH4A 4IGSA 2WQPA 2RJGA 3LHZA 1VJSA 4JR5A 4MNLA 2CXEA 3UXIA 2GJLA 1W2VA 3S3GA 2A3CA 1RBOB 3DGRA 3O6CA 4PBFA 4IIFA 1DQWA 1AW2A 1GWJA 1OF8A 3HG3A 3RGTA 2TYSA 1UQZA 3AAMA 4CCCA 3KS5A 5AFDA 1I4NA 1P0DA 1TVPA 1YTKA 3WL1A 3STPA 4DJFA 4QXIA 3R12A 2Y4SA 3ELFA 4GPNA 2OEJA 1GZ1A 2O92A 4AX6A 3IIOA 5HNRA 3MDWA 3KOFA 1K77A 4LV9A 4DXVA 6TIMA 1P7TA 5FSDC 1GW9A 1W9BM 4MLRA 2F61A 3ITYA 1Z44A 1YNYA 2SFPA 7CGTA 2EG7A 1QFEA 3LHUA 1UD4A 3CMJA 3N3MA 4YTSA 1QK0A 3VKCA 3QFWA 1OQFA 3W07A 2ZICA 4HCDA 3KVJA 4O57A 1SR0A 1C9WA 3U57A 1A5AA 1UP0A 3SY5A 3OJGA 1GOKA 1UZDA 3GG7A 2Y61A 1FKXA 4PUJA 4MWAB 2WZIA 1UWUA 2IKHA 2CLOA 4HB7A 5A6BD 1EO5A 3RNDA 4XISA 1CCWB 2G3IA 3TYAA 2XIQA 1IZCA 3MI2A 1ZP4A 2BDQA 4KESA 2Z00A 2VXNA 3OGRA 2X7VA 1FH7A 3PPGA 4L64A 1EF3A 1EH9A 4HNLA 3PZIA 2P5NA 2WAGA 3PS7A 4QBXA 3BGJA 3HTWA 1GPWA 3LGDA 3WSUA 3LCWA 3N3TA 4HD5A 3EEZA 4QDMA 1VPYA 2GLKA 2DSWA 3MPGA 4GCAA 1ZRQA 4MFEA 3T2QA 4ZSTA 1NTHA 3EX1A 4HJWA 3N25A 3BXWA 3VD9A 1XDJA 3SUWA 3MYPA 1YRRA 2DT1A 2FVKA 2P50A 5FI8A 2AL2A 1XLFA 3S2NA 2ZRXA 3EKLA 3W76A 4D6HA 2YOCA 3R43A 1XLCA 4PODA 3TMLA 4G56A 2GJXB 4MUPA 1OC5A 2Y62A 1BGAA 3ZR6A 1J01A 3AC0A 3Q45A 2D3NA 3UEQA 1HG3A 1TUFA 1OFRA 3STCA 2ZQ0A 1H63A 4LYPA 2DW6A 4H8UA 3QC0A 3KVMA 1WP6A 4PUKA 4QSHA 1JZ6A 1RP8A 5FEXA 2YXXA 4YTUA 1BXCA 2VRKA 2ZBTA 3R13A 1ZGDA 1D8WA 4D6GA 2J74A 1WDDA 2BBFA 1ITXA 4K68A 1JDAA 4DBSA 3S9YA 2ZUVA 4NQ1A 5AVNA 2V2HA 2PGWA 3IVSA 4DQWA 1ZQ5A 2DIKA 1BYBA 5D02A 4LF1A 2NQHA 3G6MA 3GC2A 4JDYA 1JIBA 5CCZA 3WF2A 4KWSA 1UD3A 1R3VA 4A8NA 4N02A 1NWRA 1XPGA 2BGQA 3OPSA 3GM8A 1O6IA 2PGFA 4PRWA 4JTTA 2VM8A 4PTXA 5ABTA 3ERPA 4GG9A 4S3FA 2RDUA 2PP1A 3NQFA 1W9XA 1J10A 1S5NA 4MYAA 3GBEA 4OQVA 1AH3A 5A3HA 2X41A 3KBWA 4GOAA 4ADTA 1TB3A 1A50A 3H24A 2MANA 9RUBA 4O16A 3H12A 3JW7A 3FDGA 3HGJA 4JQ3A 3UCCA 1P4CA 4Z2HA 3C2FA 3PJUA 4PMXA 2DSUA 1O5XA 1G7UA 4HHMA 2Y8UA 1EP3A 3VK5A 5CXPA 3FJ6A 1OSEA 3G1XA 1PCWA 4KPLA 3T4WA 4H8NA 3WFAA 1J8VA 3GXIA 4FX6M 3EXSA 2VFFA 5CBJA 3DKJA 4J2MA 2AAMA 4IP4A 1UMYA 1TE6A 3NPVA 3KL3A 4I3GA 4N9BA 1K8CA 4DJDA 2WOQA 3PZVA 3MV01 4DB7A 1IF2A 1XCWA 4QEHA 2Q09A 4XBKA 3IV8A 3GFYA 5DLCA 1K03A 2GQ9A 4BQ3A 2OO6A 5EY5A 3MCNA 3M6DA 2GQAA 4F0MA 5EKYA 5ABFB 2DIEA 1KFJA 3CPGA 2ACQA 3WD2A 1KD0A 4Y90A 2R6OA 4J1OA 3AMLA 5DEZA 2BY3A 3CZGA 4IMDA 2FZNA 3W2JA 2WMJA 2BVYA 4AY1A 4POCA 3F03K 3KP0A 2ISDA 3UXKA 2FVMA 1S39A 1JFHA 1SFTA 1E6RA 2I7GA 1S3HA 1JF5A 1J6OA 3K1DA 1OD8A 4GZEA 4C6JA 1NQ6A 3NEVA 3VGEA 3RIKA 5XIMA 1VYPX 3DHFA 3MUIA 1CT5A 1VRXA 2G4FA 2C71A 1RSCA 4O1DA 5CPNA 1T7LA 4CNTA 1G67A 1XSJA 3KRBA 1KNWA 4DWDA 3TJLA 1OINA 4HSOA 3WLLA 4PSRA 4QR6A 3T09A 1KKOA 3UXLA 2R82A 1OIMA 3FJNA 3S6TA 6XIMA 1HKKA 5J8LA 1SW7A 1UA7A 3P67A 4J5NA 5BXTA 1E5JA 3RPTA 3SN4A 2HE8A 3H7RA 1W8GA 1IXNA 3UCQA 4CCDA 3BV4A 4NNAA 4ADUA 2H6RA 1RPKA 1I9CB 2DQXA 1QW7A 1RP9A 1ZL1A 1MEIA 1BVWA 3TONA 3AUJA 2PDIA 4QQUA 3IS4A 1J0IA 2VOMA 1K6AA 3UESA 2Z1WA 1HL8A 1XBVA 3XINA 3WQ5A 3HFYA 1HGYA 4E8DA 1GQNA 4UZUA 1KCLA 3WBWA 1NVMA 2TAAA 3HPFA 1HGWA 2I57A 4HNNA 4UFKA 1I60A 4J3WA 1RJQA 1AH4A 1E71M 3A4AA 3UJSA 3MANA 1GTHA 3MCOA 4YLWA 4WOQA 3NO3A 3WF0A 1EC9A 1Q65A 1IWBA 3AJXA 4JTHA 4CD4A 2QF7A 5A8PA 2XVKA 1DJHA 3TYUA 4TX9A 4IX0A 1XBYA 4YWSA 5F2GA 5FJIA 2VQUA 3C3UA 4CNOA 4NJGA 5D30A 2Y5SA 1AODA 3KE0A 3EX4A 4UTMA 1JZ3A 4Q8WA 2Z1SA 4XD4A 1HUVA 1UOZA 1JJKA 1QCWA 5DQPA 2NSXA 2AKZA 4AY7A 3IV3A 4LW7A 2E5BA 3NDOA 2OKTA 3R5EA 1QRQA 5T91A 4XKMA 4WZHA 1JD7A 5MKGB 2JBMA 2ZXAA 4NHVA 1EQPA 1PPIA 1PKLA 3NQCA 3SJ3A 2PTZA 4K6AA 3P0XA 2YDRA 1RA5A 3WF3A 3GYCA 3VZZA 4WXZA 4H7VA 4PMDA 3LI0A 4D6DA 1EPXA 1L8NA 4PTDA 3RMJA 1GYMA 4JX5A