3QFEA

Crystal structures of a putative dihydrodipicolinate synthase family protein from coccidioides immitis
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
314
structure length
305
Chain Sequence
MVPRVPQPGIWCPAVTFFDSKTDTLDLASQERYYAYLARSGLTGLVILGTNAEAFLLTREERAQLIATARKAVGPDFPIMAGVGAHSTRQVLEHINDASVAGANYVLVLPPAYATTPPVIKSFFDDVSCQSPLPVVIYNFPGIDLDSDMITTIARKNPNVVGVKLTCASVGKITRLAATLPPAAFSVFGGQSDFLIGGLSVGSAGCIAAFANVFPKTVSKIYELYKAGKVDQAMELHRKAALAESPCGIATTKYAAAIFSAKAAGIEDAEEKLRPRKPYDPPSEAAKQEVRKVMAEVAAIEAGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dihydrodipicolinate synthase family protein
publication title Crystal structures of a putative dihydrodipicolinate synthase family protein from Coccidioides immitis
rcsb
source organism Coccidioides immitis
molecule tags Lyase
total genus 113
structure length 305
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qfeA00
3GYEA 3W2MA 1Z44A 1Z42A 4JTJA 1GVSA 1YTEA 3G1VA 4JIQA 1KFJA 1MEHA 1TYGA 3HQ1A 1ZALA 4WOZA 1TQXA 4CQ9A 3FYOA 1H7WA 4MLRA 5LSMA 3R12A 4LC8A 4JTUA 3STEA 3MMTA 1IXQA 2ZYFA 1NSJA 3NM1A 4BWLC 2CLEA 4KKXA 2FB2A 1LROA 3W1MA 2AAMA 2QR6A 3GAYA 3DFNA 3LDVA 3V75A 2A1YA 5IBXA 3QMRA 2ZZ4A 3QZEA 2VFIA 3IIZA 2PRMA 2YX0A 3W71A 4IPIA 1R2TA 4A2RA 2HTMA 3C2EA 1FWTA 3A9IA 2FDSA 4LT9A 5K4ZA 3SW6A 1TIMA 3NQAA 5CZSA 5F1VA 3STFA 4H3DA 3S8HA 2DU2A 2CZ5A 3NPVA 2CU0A 3GIYA 4AHOA 1QOQA 3MHFA 5K3VA 2FPYA 4FHAA 2EAWA 5FF7A 4BWLA 1YXCA 1MZHA 5D2TA 2C6QA 4MY1A 3HO8A 7TIMA 3A21A 3CIXA 4FXRA 1YLVA 3PWAA 1IGSA 5F2IA 1GT8A 3A22A 1B4EA 3LI0A 3HPZA 3LCIA 3DENA 4JIPA 2C16A 1OK6A 4DF0A 3THAA 2DJLA 2C13A 4WXZA 2ZFAA 2VFDA 4GWEA 3TFCA 1LBFA 4GRSA 4XTIA 5LNSA 1Z48A 3CEPA 4Y6GA 1P0NA 3MW7A 3TQKA 4EF9A 3S1XA 1LBMA 2DZSA 1GTEA 3W7DA 3BW2A 4K7VA 5HWNA 3M5ZA 1KM6A 1KFCA 1JUKA 4QSHA 1AW1A 4CNOA 1OFDA 5D30A 5FF2A 1TJRA 5AB3A 4K8HA 2WV8A 1XCFA 3M7WA 1BEUA 3H55A 1H62A 1JRBA 3HJZA 3MJYA 4B5NA 1TJPA 3TNOA 1OX4A 4UIOA 2F7FA 4LV9A 3O06A 4JY9A 1OFOA 1JJKA 3CEUA 2WSYA 1MSSA 1J4EA 1WAUA 4AHQA 3I65A 3G3DA 3G22A 3LHZA 2Y7GA 1RV8A 4TU1A 3IV3A 4XTDA 1VJIA 1RQHA 3T55A 3TSBA 4UCGA 2V9DA 4MIMA 1W0MA 2ZTJA 5KTLA 5BOOA 3NVTA 1QPRA 2E1DA 3NAVA 3BK0A 3KRZA 2XN2A 4LVBA 5TQLA 2YSWA 4I7WA 1I45A 4Y8FA 4O10A 3RK8A 4ZQCA 1F5ZA 3TSDA 5AHNA 2NXHA 3L66A 4ORMA 3W22A 1SO6A 4ML9A 3P80A 1KM4A 2XFWA 4IOTA 3W1PA 1ZAIA 5BRBA 1Q6OA 1ZY9A 2HS8A 2QCNA 2ATMA 4CNPA 4JD4A 2EHHA 5E1QA 1TTPA 1XL9A 3C6CA 3LRMA 1DQXA 4MKNA 5G4WA 2UV8G 2TPSA 1IXOA 1LM1A 2QCDA 3GKFA 2ZA1A 3WJZA 1H60A 2NUYA 4XZ9A 3RFAA 3TCEA 4IX0A 3LCXA 2RHGA 1PHWA 3L67A 1THFD 3R13A 4AF0A 2ZRVA 3P8IA 5K9DA 5I3IA 4ZVJA 1UCWA 2J88A 5TBOA 1JCLA 3N2MA 1LZOA 1GG1A 3GAKA 3G24A 4BR1A 5J5DA 4ONVA 3W7CA 1BWLA 3IVSA 1BKSA 1IIGA 3MUXA 1SPQA 2O7SA 3BLEA 2Z6IA 4TR9A 2YW3A 1XUUA 2WNNA 2A6NA 3W76A 3C8FA 1H61A 3EEGA 1W31A 2YW4A 3EWUA 4O15A 5FF4A 3W7OA 5BNKA 1QNVA 2R14A 3YPIA 3P7YA 3VE9A 2B0MA 3LLFA 4LUIA 2P1FA 3V1PA 2VXNA 1OX4B 3STCA 4O53A 4M7TA 2V81A 4RLIA 2A7NA 1XC4A 1SFJA 1TRIA 3QW4B 3C2FA 1P1XA 4NNCA 4HSOA 2H3DA 1K8YA 3T44A 3QM3A 3UWYA 4LWWA 5D2VA 3IEBA 1ICQA 3MBDA 1FWRA 4IGHA 1M6JA 2V30A 5D38A 5KZDA 4KFOA 3O05A 5KZMA 1KM2A 2YCEA 3W1RA 2C1HA 5DN1A 2RDWA 4Q4KA 1HFBA 3QH2A 5CSSA 3MI2A 1JQXA 4IMGA 3VI2A 3ZFHA 2J9ZA 3BW3A 2V2DA 1L6YA 1T0OA 3PG9A 1AL8A 1L9WA 4NZFA 2V8ZA 5EL1A 1TB3A 1HTIA 2CLFA 4YCPA 3O6DA 3KRSA 2C19A 4M7SA 4DBDA 3L5AA 1A5SA 1XBZA 1KV8A 1TTQA 4X9SA 1DHPA 2YFOA 4R33A 4IXHA 3SECA 4I7UA 1WDWA 4AF0B 3KVMA 1XI3A 3TR2A 3M5VA 5LNVA 4HNNA 1EP1A 4K38A 5HUPA 4RXFA 1DVJA 1TQJA 4QNEA 3N34A 2RH9A 4MUZA 3DGRA 3TUUA 2H8XA 2CLIA 3N9SA 2DZVA 4A22A 3LCLA 3VKJA 2GJNA 1KM1A 3L5LA 1ML1A 2DZTA 3DFPA 3GXTA 2WKJA 3WJXA 1PIIA 2JKEA 4IXXA 3NPXA 4KWVA 1EUNA 1W3NA 4LU0A 1FWWA 3W2KA 3NYZA 3L65A 3RNDA 3QPYA 4POCA 1TPEA 3LGEA 3UYCA 3W7IA 3O6CA 1O5KA 2NZLA 5I3GA 3EX2A 4M6QA 1KFLA 1ZNNA 2BTMA 2NWRA 4IJBA 4FX7A 3PULA 4NQ1A 1O5XA 5L9FA 1LLZA 2A6LA 4RKAA 3NA8A 4LVDA 4MVAA 5CPOA 1V7YA 2Z2UA 4LUJA 1B3OA 3TMQA 4AMAA 1ZCOA 3L0GA 1KM5A 4E38A 4M6VA 4PC8A 4BI7A 3GDMA 2CWNA 3Q94A 4L4LA 5CPMA 1Q6RA 3F1QA 1JULA 3GDKA 3NO5A 2ZBTA 2O7QA 3U8GA 1EUAA 1QFEA 1JCMP 4O0KA 3DBPA 1WBHA 3O16A 4CQAA 4W9TA 1WOAA 3VE7A 3G8EA 1DORA 3M5XA 4GXMA 1GVQA 1HL2A 2V5LA 3LRLA 5HR6A 4DO6A 4FNPA 3JR2A 4UFIA 3NPWA 3HGRA 3EWXA 4TO8A 1FX6A 4JYDA 4FIRA 1FDJA 2OZ0A 3FA5A 1SO5A 3CC1A 1QO5A 3KAOA 5K2ZA 2NX9A 1NVMA 1VCGA 4O16A 3HGJA 3LXCA 4K39A 1SSDA 3Q2DA 3SGUA 2A21A 1CW2A 2ISVA 4OWGA 4WY0A 1AL7A 1AW5A 3F4NA 2EPHA 2VEMA 3LERA 3PR2A 2J9XA 2JGYA 4GNJA 2Y85A 3R5EA 5CZ0A 2QCCA 2G5WA 1EWDA 2H8ZA 4FX8A 3UZJA 3W87A 3S5NA 1Q3NA 1TPDA 2B7PA 4GUFA 2BX7A 3GNNA 4O14A 2CLOA 4YWIA 2GUUA 2ZCGA 3LTSA 5FF3A 5I3FA 1FUYA 3DFQA 2QCMA 1H1ZA 4JR5A 1I2PA 3BV4A 3TSMA 3BW4A 3EKZA 2Z0IA 3I6RA 1MO0A 4HHPA 3UPWA 1F6PA 1OFPA 3TAOA 4DPQA 3OA3A 2ZQ0A 3UXAA 1GJPA 2PURA 3TW7A 1I2OA 4GFSA 5LZLA 3WJYA 4LRSA 1Y0EA 3BLIA 2ZZ1A 5HUOA 1SZGA 1X1OA 3EX6A 1LOSA 4GUGA 1EP2A 2QF7A 3K30A 3BLFA 3STGA 4NNBA 3S6DA 1NF0A 4FNUA 3WK1A 2F84A 3GVGA 4CCDA 1OX6A 5LKYA 2C18A 4FF7A 4TMBA 5G1YA 2GQAA 3EXSA 2W79A 1WBJA 4I7VA 1A50A 4MY8A 3TFXA 5HWJA 5GVJA 3B0UX 5CPNA 4GUJA 4GC4A 3PB2A 2WSRA 4M6PA 1PV8A 3SSJA 4G1KA 4FNSA 4O1BA 6TIMA 4AAJA 3C52A 3TE9A 4BI5A 3NG3A 3MP5A 2LLEA 3U2OA 4Z0JA 2JKPA 1QO2A 3KRUA 4QNWA 1LLWA 4O17A 4WD0A 4N9DA 1YDVA 4WY0B 2ISWA 3W3OA 3DHFA 1IXNA 3LCWA 1YDOA 3PM6A 5D2XA 1XFBA 5AYZA 2NUXA 3TKFA 4O4WA 3QSTA 4NT0A 3L0NA 1F7BA 3TJLA 2V0TA 2A7PA 3MWAA 5DCDA 4N2YA 4FXSA 2CZEA 2G96A 3P82A 3W7EA 2VFEA 4JYFA 1WX0A 3ABSA 4MPQA 1DL3A 1TTJA 5FEWA 3O07A 3C0JA 1OK4A 2WO5A 3W1TA 4J9JA 5HWMA 1DJNA 3UWUA 1G7UA 4A21A 3IRDA 3CT7A 3HOJA 3TXZA 3VNDA 4UFHA 1JVNA 2WPBA 1GVFA 1KA9F 4LW7A 4OV9A 3TIMA 1GPWA 1W3TA 4LVFA 3WK3A 1XUZA 4ZMGA 3WK2A 1MXSA 4NJKA 4E2BA 3MI6A 3SI9A 1B4KA 4UTLA 3G3MA 1F73A 1O60A 3LRKA 3MO7A 4M19A 1KFKA 3P74A 3P5YA 4JDBA 4UTTC 2Z1BA 1N8FA 3E0IA 1U83A 1F76A 4QAIA 4EWND 3Q37A 1K8ZA 1OYAA 2TSYA 4PL1A 3GXPA 3RU6A 2X1RA 3QPZA 3U6WA 4TX9A 1ONRA 1PL9A 1GG0A 2OMAA 3CM4A 3KVKA 3OHIA 4BF9A 1DV7A 3NM3A 3DXIA 2JKAA 1Z41A 3G1HA 1XBVA 4DELA 4IUOA 5G1TA 3W1AA 4FIQA 1S5WA 5DCEA 5C54A 3G8RA 3ZWSA 4PFMA 4N9EA 5AYXA 3QF0A 4QITA 4MYAA 2EGZA 2CFFA 3P8JA 3HG4A 4GJ1A 4IWWA 3W2NA 4AH7A 4XBKA 1W37A 1ZENA 1DBTA 1H7NA 1Q6QA 3W1XA 4L4MA 2GJLA 3M9YA 1DKWA 1HG3A 4IMEA 1TPC1 1TMHA 3QC3A 2VENA 4UTTA 5E0KA 3TK7A 2CLHA 3L5MA 4XUGA 5DBUA 4O4VA 1PHQA 1GZGA 4HKPA 2ALDA 6ALDA 1UUMA 1I2NA 2ZA2A 1SO3A 3HBLA 3EB2A 3KXQA 5G2IA 3GXNA 1A5BA 2PC4A 5K4XA 3NL6A 4Y90A 2QUVA 2E68A 1RR2A 2QJHA 3EXTA 2NX1A 2YDAA 2C15A 3LXBA 3GLCA 3PBUA 1C29A 4PL2A 3WFAA 3F03K 3B05A 2J24A 1K7EA 1HO1A 4UXDA 2DORA 4LY8A 1KV5A 4RV8A 4O12A 3I7RA 3W7KA 4C1KA 3SZ8A 4WZHA 3PAJA 4A3UA 1R30A 1OVDA 4O1DA 4NZJA 3M16A 3NNTA 4ZL1A 1FDYA 2V5BA 4AHPA 1ME7A 3HGSA 2C14A 4K7YA 5F4WA 1DJQA 4O28A 1GTHA 1GYNA 1G6CA 3TW6A 1ZAJA 3PBYA 3O63A 4JTIA 1I2RA 4X2RA 2IQTA 2HMCA 5AHLA 3QEZA 4MZ1A 3B0PA 2H6RA 2Y89A 3UZ5A 3T78A 1YXYA 3QRHA 3GDLA 4U4MA 1UUOA 2B7NA 3C2OA 3S5YA 2GVGA 3HG2A 5HJLA 3W7RA 1YPFA 4E2DA 1F6KA 1QR7A 4JEQA 2OT1A 1V5XA 2BSLA 4TMCA 1N7KA 4S1FA 3TQ0A 3BGGA 3B4UA 1TTIA 4DXVA 3HB9A 2Q8LA 3DKJA 1KFEA 5LHEA 5EPDA 1LCOA 3OVQA 3S1VA 2Q3RA 1NAL1 1VYPX 4AWUA 4O50A 2JK2A 1VC4A 1WQ5A 3IIVA 3LBCA 2FB3A 4Q33A 4WY0F 4P2VA 3T40A 2Y62A 1HO4A 1VS1A 2H90A 3NOEA 3QFEA 4UMAA 3OEXA 3I7QA 1RD5A 2KZHA 1U5JA 4QISA 1CI1A 4ORIA 5KSWA 3W88A 4MJMA 2R8WA 4C1LA 4UTJA 1UB3A 1FY6A 1W5NA 1VQTA 5CKSA 1JQVA 3GX9A 4JXCA 4WXYA 2WNQA 3NQMA 2GQ9A 3PSVA 4Y9AA 3QW3A 4JTKA 4UFMA 3NQ2A 1JCJA 5DCBA 4FNTA 5AHEA 3CHVA 3IGXA 1QPOA 1C9DA 1W5MA 1OYBA 1KBJA 1EWEA 1D3HA 4FX6M 5ABTA 4QJ1A 3VCRA 1VCVA 2E6FA 3G1DA 3GZ3A 4MFDA 3P81A 2YZRA 4ADTA 2VKZG 5CSRA 1TCDA 4JYEA 2C0AA 3M43A 4UFJA 3FYPA 4U28A 3PY2A 4RR4A 3WJWA 5EY5A 4O18A 3NXFA 3L21A 1YPIA 3M44A 3M6YA 3L2IA 2QCDB 5IM51 2VELA 2E6DA 3QJAA 3PB0A 4ZQRA 4N4PA 5C6MA 1KLZA 2NXIA 4EVZA 1P5BA 2FIQA 4FNRA 3DI1A 4Y96A 4HPXA 4ADSA 1QDSA 3SGZA 3LCHA 5FF0A 1EA0A 3IIPA 5TIMA 3F4WA 3KVJA 1LBLA 4KFPA 3W84A 3CLMA 3CWOX 2QCLA 4P61A 3R2GA 2WQPA 2ATSA 2Y6ZA 4QQ3A 2TMDA 2E5DA 4HSNA 4HPJA 1JRCA 1OHLA 5DLCA 5F4SA 1ICSA 1UBSA 4LS2A 1D9EA 2DP3A 2QJGA 3GDRA 3UWVA 1HUVA 4EOUA 2FLIA 4PODA 1TREA 1YXDA 3MHGA 4TIMA 3N73A 3C61A 3P84A 3LOTA 4JY8A 2PRLA 5D2WA 1P4CA 3M47A 1AW2A 1XXXA 2JBMA 2ZRUA 3A23A 2AQWA 4JTLA 4UFKA 3O15A 1A5CA 2EF9A 2VFGA 3NDOA 4JDYA 3S5ZA 5KMYA 2YPIA 3THQA 2V82A 4OHQA 5LHFA 4O57A 2XN1A 2P0OA 3CIWA 4IPJA 3KVLA 2RFGA 3AJXA 1OF6A 5AOUA 2FTPA 2QJIA 1SZNA 4Z1AA 3UD6A 4OE7A 4LVGA 4MOZA 1YTDA 3IGSA 1CX9A 1OABA 1H7RA 4LV4A 3LV6A 1WYIA 4OQVA 2Y7EA 3MBFA 3NQEA 3W6YA 1IXPA 2J6XA 2V2CA 1T8XA 4I9AA 4NXKA 2J27A 3W1UA 2QCFA 2GVJA 3GKAA 2H3BA 5CZTA 1OX5A 3B06A 3INPA 1VHCA 3HPXA 2YR1A 1W54A 5EMUA 4QM1A 1EIXA 4ZQPA 4OU1A 2E6YA 3E49A 3NZ1A 2OJPA 5HR7A 1O94A 2WNZA 2Y7FA 4AWSA 4KFNA 3CWNA 5G2HA 5KZEA 3S0CA 3FFSA 3OVRA 3OG3A 3W72A 4IQLA 2NXGA 3IVUA 3MYOA 3NZRA 3E96A 3G1FA 3OVPA 3JRKA 3CB8A 1J5TA 1SSGA 4RXGA 3C2VA 3NQ6A 1K02A 4PEKA 1T96A 1M5WA 3W7LA 5F2LA 4XQ6A 1YYAA 4Q32A 4LVAA 3NQ8A 3EX1A 5F4XA 4JTGA 4AXKA 3UNDA 1SZFA 3I7SA 3E12A 1M7PA 1W5PA 1LRNA 1R2RA 1QAPA 4MZ8A 1H7OA 3W23A 2X2GA 1OFBA 3EWZA 3LXAA 3L68A 2B7OA 4JX6A 5DY3A 4RZ4A 3PG8A 1W1ZA 1KBIA 1VHNA 1WOBA 2CZDA 2V2HA 1SW7A 1KM0A 2PCQA 4X22A 4LNYA 1VLWA 3M41A 4DQWA 3H54A 2Y70A 1ALDA 3GDTA 5KITA 3N19B 1Q6LA 3ABRA 3MI3A 3O1NA 4X3ZA 4YLWA 4WUIA 1VH7A 3PVFA 4O19A 1ICPA 4YCOA 1FBAA 2QKFA 3FIGA 1VCFA 3KX6A 1PCKA 2QCHA 2VC6A 1AMKA 5HINA 3LHVA 3CPRA 1FCQA 3LTYA 2TRSA 4LOCA 2WOQA 3W74A 1X1ZA 1N55A 3LCGA 1K3UA 1H51A 1WXJA 3EX3A 5E93A 2RDUA 2X16A 2Z6JA 4JX4A 2YYUA 1JCYA 2ZZ3A 3BGJA 2ZRYA 2ZTKA 4JN6A 5U7SA 4EIVA 3I68A 4NJIA 1YDNA 5HULA 3P62A 3MP4A 3G0SA 3W9ZA 4N02A 1K7FA 3S1WA 3E02A 3EKLA 1C8VA 2ZRWA 1B9BA 1VYRA 3LV5A 1FCUA 4IX2A 5U4NA 4ZQNA 4N4QA 4O52A 2CLLA 2GQ8A 3FJ6A 4GE8A 2QDGA 2YGYA 1DOSA 4ALDA 2ZZ6A 1LYXA 8TIMA 5AFDA 1TO3A 3BVJA 5SWUA 3QSRA 5EBUA 3DZ1A 1F2JA 1LOLA 1W5OA 2NV1A 2VEKA 3W07A 5BW6A 2B4GA 2CLMA 1FQ0A 3NQCA 1FCVA 2NX3A 4O13A 3UY7A 2BXVA 1LTDA 4DF1A 4BFAA 2CLKA 1FDZA 3B03A 3P61A 4UTKA 3W7GA 5C2XA 1SW3A 1S5VA 5EA9A 2FPTA 2I1OA 1RZMA 3GR8A 3PSWA 2JGQA 5MHBA 2HSAA 3W2UA 2E6AA 1WV2A 1GEQA 1PS9A 1LRTA 5HMSA 1W3IA 4CQ8A 3TC7A 1S5TA 3W7JA 2CZFA 4UR7A 3FLUA 1SU5A 2ZZ5A 3RLUA 3W7MA 5FEPA 2C3ZA 3L0KA 1XM3A 2FFCA 2BLEA 3HIJA 1QMLA 1EB3A 1G67A 4WOQA 1EPXA 2A2IA 2P10A 5I3HA 5DY2A 3NR0A 4OGZA 5C55A 3DI0A 1PE1A 2A4AA 1W5QA 4NX5A 1TV8A 4JTEA 3W75A 2ISSA 3W86A 2Y61A 1R2SA 4N6FA 2FPVA 3G0UA 1VZWA 4IMFA 3W7QA 4UTHA 4UR8A 4AVFA 1D3GA 1OFAA 1X8FA 5CGQA 3FJLA 1ADOA 4N9BA 4YXGA 1X7FA 1RQBA 1JR1A 3M1ZA 3S5OA 2YXGA 3P67A 3NPUA 3NGJA 2R91A 1RPXA 1KM3A 2X1TA 3NL3A 3P60A 1G69A 3NQDA 5AYYA 4DEFA 1H7PA 2QCEA 3G1SA 4NU7A 3LB0A 4O11A 5D09A 5F2GA 3KFTA 1OG0A 3SFKA 5LNUA 3VFLA 1H63A 3SR7A 3ATYA 5D02A 2TYSA 4LC6A 1YADA 2WSQA 3EX4A 3FEMA 4RJEA 2QUUA 3NQ7A 3T4CA 4FNQA 3UWWA 3DU0A 2QAFA 4N6EA 1H1YA 4AEOA 4MYXA 4HNUA 4GBUA 1JUBA 2NV2A 4K37A 5BMWA 1OJXA 2R94A 3HG5A 4AWTA 4UMBA 2OX1A 3M0ZA 3RLVA 5AC6A 1O4UA 4UC5A 1F05A 4NNAA 1SW0A 1TPVA 1QCWA 4UTUA 3C56A 2I14A 5AHMA 4RCXA 3TQVA 3ABQA 2XN0A 1J2WA 2OT0A 4NJJA 1GQNA 4O54A 3G1YA 1AK5A 1ZJIA 4R53A 1KLYA 2DZXA 1ZHAA 4UTMA 1RVGA 4N9CA 1TV5A 3S9YA 3W1NA 2ZZ2A 3BARA 3NQVA 3O8AA 2FQIA 5I3JA 4UTIA 3GR7A 1GOXA 1K7XA 1Q45A 2RDTA 3WK0A 4IMDA 3E9AA 3BO9A 3FKRA 4ICNA 2J9YA 2PRHA 3USBA 1FCBA 1VLIA 1H7XA 5LNRA 2Q3OA 1IF2A 1GVOA 5DBTA 3PS7A 1KW1A 3NEVA 4CNNA 2ZRXA 5AHIA 4DO4A 3R8RA 1TPH1 4NUWA 1LP6A 4AB4A 4EF8A 4K36A 3PUOA 4A2SA 4Z08A 3HG3A 3KHJA 2A5HA 4Z1DA 1MEWA 4LS0A 3QYQA 2AGKA 3TH6A 3TROA 5K9CA 4O1AA 3OIXA 4O1CA 2ZDRA 2A85A 1OYCA 3UPBA 5D04C 3L9CA 3N3MA 3BPWA 3T7VA 4PCFA 1ME8A 5D32A 4S2BA 3CQ0A 3DFOA 3TMLA 1I4NA 5LGZA 2VFFA 3UY8A 3A5FA 2E77A 1G4PA 1L6WA 5C5YA 4LTSA 1TPUA 3NQGA 1A53A 3GNDA 4JICA 3TV8A 3C3NA 4YMZA 1PVNA 3N9RA 4JTHA 3ANYA 4Z0SA 4XBSA 1QPNA 3W83A 2E5CA 3TA6A 4BI6A 5DELA 4JGDA 1IIHA 3G18A 3LTPA 1XBYA 5G2WA 2Q8ZA 1KFBA 5AHFA 2BZNA 1TSIA 5G4EA 1XKYA 1LRQA 1E51A 3DHDA 2X1SA 5FEXA 1NEYA 3EWYA 1VRDA 1SFLA 3QMSA 1WA3A 4HIBA 4HNVA 1TV7A 4JTSA 3W85A 4Z1CA 3JS3A 1VYSX 2ZA3A 3PUEA 3QQ1A 3LX9A 1G4SA 3TJXA 2GPTA 1GYLA 5FEZA 2D73A 5F1UA 1ZAHA 3MP3A 5D33A 4O8RA 5LGXA 2DZPA 1G4TA 4JNMA 4RX0A 2QAPA 1AG1O 1K03A 3TAKA 3UWZA 3A24A 4RZ5A 1JCNA 5A8GA 2WJZA 3ATZA 4K6AA 1W56A 3W73A 1VR6A 5F2MA 2QCGA 1KTBA 2BWGA 4ADUA 5AN7A 1X6UA 2E09A 3HMJG 3GB6A 2B7QA 2A0NA 4KWWA 1EX5A 3PBWA 1OFRA 5DXYA 4LS1A 1G4EA 4M5PA 3ZS4A 3W7NA 1UASA 5D2YA 2RKXA 1A5AA 3D0CA 4NVTA 2VOMA 3DFSA 1H50A 4WX2A 4WJEA 1JCXA 4XWUA 5CG7A 3R89A 3FOKA 4D2JA 4DPPA 5D05A 4MFEA 5AC8A 1VPXA 2NUWA 1EEPA 1LOQA 1FXPA 3LCFA 1B57A 1SUXA 2ZRZA 5FI8A 3UWQA 5LNWA 2GOUA 3FKKA 1YTKA 4DBEA 3C2RA 4CLMA 4FO4A 4WQ6A 1ME9A 3HGOA 4E0CA 2FJKA 4YL2A 3EXRA 1R46A 3TC6A 1XDLA 3PF3A 4CCEA 1S3HA 3B8DA 1QPQA 4S2CA 3FS2A 1KTCA 4MLJA 4FB7A 1OFEA 1KTNA 2ZZ7A 1GWJA 4QIUA 2A7RA 1NFBA 3QQ0A 2Y88A 5D03A 1L6SA 1RQEA 4GUIA 5FESA 1SR9A 3ZWTA 5EKYA 2G95A 4JX5A 5H91A 3ELFA 1EP3A 5J5RA 3G1XA 2X1UA 1K8XA 4K8EA 4XKYA 3PBVA 4RK8A 3S42A 3SIZA 4UFLA 1FWNA 3QMTA 3W1LA 3S1UA 3LHYA 3OBKA 3TXVA 5K7JA 2OCZA 2QUTA 1MEIA 4UNLA 5H2ZA 4HNTA 3B0VC 1JUEA 3UQNA 3LLDA 5BMXA 1DQWA 3GK0A 2PE4A 3DKLA 2W0UA 4OBTA 1SQ7A 1R47A 3MYPA 3W7PA 3SJ3A 2I9EA 2DJXA 4PA8A 1L2UA 3NL2A 3IIXA 3DH7A 3LHUA 3TX9A 3AO0A 3HF3A 4R7JA 5EYWA 4JTTA 4FEZA 1P0KA 1T99A 3IGUA 2Y63A 3PUDA 3ZR4A 5T26A 5HNRA 4R34A 3LBMA 4BK9A 3C4UA 3CU2A 2E5BA 2W6RA 3H53A 3NL5A 5I3KA 4JS3A 1TPWA 5K9XA 3LI1A 4UNKA 4UTWC 1H5YA 4NX0A 3LM7A 1OF8A 4CCCA 1QOPA 1NF7A 2EKCA 2YYTA 1W8SA 3W1QA 4ZQMA 3W70A 3A5VA 4HN4A 1O95A 5L6UA 1LORA 5G5IA 3RF9A 2CW6A 1PCWA 3G1AA 1I2QA 3DAQA 1TRDA 3W2LA 3BG3A 3G0XA 3M5YA 2X30A 2VFHA 3EWWA 3PC0A 2DZWA 2QEZA 1QWGA 1FXQA 4UUIA 2VEPA 3UXDA 4RZ6A 1SZEA 1LDCA 3ABOA 1M7OA 4GUHA 1UJPA 3TDFA 4H4IA 3RMJA 1FWSA 3O6YX 1TPFA 4OV4A 3WJSA 4UTWA 1G7VA 2ABAA 1BTMA 3BG5A 5KINA 4XKYB 2HS6A 4IMCA 5D37A 4OT7A 3B04A 4JTFA 1SO4A 3IIOA 1I8JA 3MHUA 3KOFA 4ZQOA 1BWKA 3TU9A 2G97A 4NJHA 1GVRA 1XDMA 3SY5A 3DFTA 4LRTA 1F74A 2YFNA 4PTNA 3P5ZA 2GVLA 4DO5A 3N2XA 4PH6A 4ZZ9A 5CZJA 2VEIA 2DZUA 1OFQA 4MZYA 5AC7A 3EWBX 3IVTA 2NLIA 3Q58A 5DXXA 3NQFA 2ABBA 3W2JA 3CTLA 4MJZA 2QDHA 4NJGA 1TPB1 3HPSA 4H6KA 4DF2A 3W7HA 1VGAA 2NWSA 4MY9A 4Z1BA 5CPLA 5IBXC 3BG9A 1XBXA 4NXSA 3N14A 5A5WA 3LHTA 4UMCA 4HT3A 4O0ZA 2Y7DA 1ZFJA 5HQEA 3LHWA 4A29A
chains in the Genus database with same CATH superfamily
3GYEA 4DBUA 3GVVA 1DPMA 1Z44A 1Z42A 3I6EA 2WZMA 1TYGA 2R1NA 4WOZA 3EDEA 1PZ0A 4MLRA 3GG7A 2CZVA 5LSMA 1GUVA 3MSGA 3STEA 2XIIA 1BAGA 3NM1A 4GLEA 4ZFMA 2CLEA 3W1MA 1EXBA 4KCWA 3LGGA 3V75A 1XH1A 4WR3A 3RHGA 1MW1A 1GOMA 4PBGA 3EMCA 1NTHA 5IBXA 2PB1A 1TELA 2EJ1A 2VFIA 2YX0A 3W71A 4ATLA 3WELA 3VUPA 3LNPA 4G7EB 4C6IA 5B80A 2Z25A 1FVPA 2FDSA 3E5PA 3B9OA 1ISVA 4IM4A 3CNYA 4XD4A 3WDHA 2HJPA 4B15A 1CZ1A 2CZ5A 4KRTA 4ZO8A 3NPVA 1RK5A 3GD6A 3GIYA 1JYNA 4PBEA 1AD4A 3R8GA 1IT0A 4QJ4B 4NG3A 5K3VA 3IARA 2FPYA 3ZT6A 3VKDA 2CXEA 1YXCA 4HA3A 1I1XA 2C6QA 3ES7A 7TIMA 3W53A 1DIKA 1QJWA 4FXRA 4PUNA 4ASTA 4QGCA 3PWAA 8A3HA 1IGSA 1BQCA 1XIMA 4JPGA 4UR9A 3THAA 1J96A 3W00A 1EZWA 4FOUA 3OLGA 3UERA 3AICA 2ZFAA 2VFDA 3FNDA 3U3HA 4GRSA 3KLKA 3H70A 2ZXQA 3MW7A 4EF9A 7PTDA 3S4TA 4GCAA 1KM6A 1XICA 1JUKA 5MF5A 3W28A 1AFSA 3CUZA 2I5GA 5D30A 4K8HA 2PDMA 4J3WA 1H62A 1JRBA 3HJZA 3MJYA 4B5NA 1H3GA 1TJPA 2F7FA 4KESA 3AYVA 2FHFA 5JUVA 2XDFA 3EOOA 2PTWA 1V77A 3CEUA 1J4EA 1WAUA 1HJSA 4AHQA 1XV8A 1W9XA 4TU1A 4IP7A 4MSSA 4D8LA 4S3BA 3DCPA 4QEEA 3NVTA 1QPRA 3BK0A 1BXCA 1HGWA 2XN2A 5TQLA 1KO0A 4A3YA 1GOKA 1R38A 1QI0A 1A5LC 4D6CA 1V79A 2DV0A 2Y8VA 2ZVIA 2HEJA 3W22A 1SO6A 4UTFA 1KM4A 2XFWA 3W1PA 4JTRA 1ZAIA 1QI5A 1J0HA 1T41A 1V0MA 1U1UA 4G56A 5KZ6A 4P8WA 2ATMA 3ARQA 2EHHA 1U1HA 4ZTYA 1GJUA 1TTPA 1XL9A 3OHMB 4NZ1A 1YQ2A 3KBSA 4RE2A 5E09A 4O8AA 1LM1A 2QCDA 2ZA1A 3WJZA 2NUYA 4XZ9A 3LCXA 4I5XA 1PHWA 1XDJA 4XIAA 2V3GA 3C3UA 3V1HA 2ACQA 4JKKA 5K9DA 4QXIA 4QG8A 2X41A 5AVHA 3ENLA 1QW8A 2D0FA 1Q4NX 2QMKA 1GG1A 3S2LA 1UIPA 2PDWA 1IIGA 1XLAA 3BLEA 3NUKA 2YW3A 1XUUA 4LCSA 3W76A 3C8FA 1W31A 4PMYA 5FF4A 4JHMA 2R14A 5C2GA 4AQLA 3EA3A 1WZAA 2BVWA 1CGVA 3VE9A 5T9BG 2P1FA 3V1PA 1OX4B 3KL0A 4O53A 4M7TA 4LB4A 4RDVA 1JZ8A 1XC4A 3DYMA 4Q4QA 1SFJA 1TRIA 2VGIA 3CUJA 4QDMA 1KGWA 4RNFA 3QW4B 4NNCA 1E0TA 2ZUNA 1XSJA 3KTXA 4GABA 5KZDA 1W2VA 4Q4KA 3RN6A 3MI2A 1JQXA 3A4WA 4S3EA 4IIHA 3ZFHA 3THCA 2H9AB 3VD7A 3BW3A 2V2DA 4MWAE 1T6MA 3EA1A 1AA1B 1T0OA 4AMCA 4QE4A 1L9WA 4GOAA 1S2CA 4EPKA 1H09A 3N17A 7REQB 2OPJA 1HTIA 2QVHA 4IPLA 3U9IA 2BXZA 2XVNA 3UG3A 2CLFA 4PZVA 1QT1A 3S2MA 4HGXA 4H8HA 1A5SA 1XBZA 1KV8A 4AD2A 4CVWA 2X0YA 4X9SA 4B5XA 5AVNA 3I3DA 1A5UA 2FZDA 4AF0B 1R9YA 3TR2A 4WJXA 1ZBCA 3CUHA 3PTKA 4HCLA 4HCDA 4HNCA 4QNEA 3N34A 3DGRA 3TUUA 1FWJC 1A5NC 4N42A 4A22A 3LCLA 4HU3A 4JZ5A 2GJNA 1ZLPA 2QNEA 3L4XA 2BGNE 3T42A 3WJXA 4IXXA 3NPXA 4RPPA 4KWVA 1AMYA 1W3NA 5JH2A 3QPYA 3OQ8A 1CENA 4AU0A 3TW9A 3R7MA 4PMUA 1O5KA 1TG7A 3WIJA 4F9DA 4Q8TA 4TTGA 2PCEA 1QHZA 3LSBA 4BQ2A 2OODA 1MW0A 2PWHA 5L9FA 5GQBA 4RKAA 3NA8A 4YVPA 1V7YA 1OIMA 2OQLA 1ZCOA 3SUWA 1MYRA 1L8NA 3H12A 3NO3A 1IEIA 2CWNA 4L4LA 1E40A 2YIHA 5FJTA 4O0KA 4CQAA 1WBHA 4HMNA 3CT2A 3NZGA 2ZXDA 3RLHA 5C7VA 5XIAA 3CJPA 3KDNA 3LRLA 3EPOA 4DO6A 3HGRA 3RILA 3T2PA 4TO8A 4F4RA 2OZ0A 2BY3A 1SO5A 2ZX7A 4F40A 5FJOA 2DSWA 3MZ2A 4UQEA 3Q4DA 3VMOA 1VCGA 3QOKA 4O16A 4K39A 3Q2DA 2IQDA 4OWGA 3HA1A 1QVBA 3FYYA 3U5UA 2EPHA 3TYDA 2J9XA 2JGYA 4P7QA 3UR5A 5CZ0A 3TNBA 2QCCA 2XJ7A 3VGGA 1MQPA 4JFWA 1GKPA 4ZBCA 2OOFA 2EBNA 1Q3NA 3GNNA 3WQ6A 2CLOA 3VNIA 1DWAM 2G3IA 2HVMA 1XCXA 4FMVA 1JYVA 1FUYA 5A8OA 3DFQA 2QCMA 3TTYA 2W91A 1CXLA 4JR5A 2E8ZA 4F0LA 3EKZA 2BG5A 1J01A 3KWSA 1MRAA 2JIEA 4GJIA 3TAOA 4UQAA 4BA0A 4X0NA 2YDRA 2CHRA 1VFHA 3BURA 3M0VA 1MUMA 5HUOA 1X1OA 2HDJA 4PCTA 1EP2A 3SRKA 2IQ0A 2VO5A 3STGA 4OBRA 4LEFA 4RZBA 4F2TA 4XK2A 2OYLA 1OX6A 3L23A 1IEXA 4TMBA 3EXSA 2FZ8A 1WBJA 4I7VA 3TFXA 2J74A 1JZ3A 4QLJA 4YPJA 3E5BA 3ARRA 3VK5A 2FTWA 4LCQA 4ZOBA 2CPUA 5C9ZA 2AL1A 4WCJA 4G1KA 1V03A 6TIMA 4CD4A 4AAJA 4DUWA 3ABXA 3N6JA 3LQLA 3MP5A 3U48A 3U2OA 2JKPA 1QO2A 1E5JA 5AYIA 4Y7EA 2W9MA 4AD5A 4WY0B 2ISWA 4HPNA 2OR2A 1BVZA 3LCWA 1YDOA 2WJFA 3AYRA 3PM6A 5HOSA 1XFBA 4JAWA 3RMEA 5BXPA 4O4WA 2HPMA 1EJSC 1UP0A 1JGIA 3H2EA 3TJLA 4D8ZA 2V0TA 3QR1A 2A7PA 1QBBA 2Q01A 4X61A 1A80A 3MWAA 4HOXA 4N2YA 5CG0A 1DWIM 1BQGA 4MB5A 4DYJA 4J2PA 5EMMA 1H41A 4MPQA 1DL3A 1TTJA 5FEWA 3H7VA 4WSJA 1OK4A 2WO5A 3NSMA 4I6KA 3UWUA 1G7UA 3H2AA 3CT7A 3V16A 2XWDA 3R11A 3W02A 2DUZA 1GVFA 3HPAA 1GPWA 4D8AA 4NJKA 5GNZA 1TZZA 2PGFA 3G3MA 1WXYA 1O60A 1KFKA 3CHEA 3QFWA 3QGVA 3S47A 4JDBA 5LXXA 2GSHA 2OOGA 1F76A 3E0LA 3GU2A 3Q37A 1UWRA 3HQOA 3ME3A 1OYAA 2D0GA 3I6TA 3QPZA 1ONRA 2ISFA 3IK2A 3VIHA 3OHIA 5BWFA 6XIAA 3ZZ1A 3DXIA 4ENLA 4QSFA 3TZFA 4DN1A 1XRVA 5C54A 3ZWSA 3CH0A 3ZVHB 3QF0A 4MYAA 5AZ1A 4Q7NA 3NEHA 4IWWA 3W2NA 1W37A 4D9PA 1ZENA 1DBTA 3A6OA 1DKWA 1JD7A 3TK7A 3AMCA 5I23A 1UR8A 2CLHA 4XUGA 5HXMA 4MKVA 4M80A 3R94A 3VKBA 2ALDA 3AI0A 4PMXA 1TVLA 3PZGA 1I2NA 3HBLA 3RCMA 3KXQA 4GZ7A 1KNWA 5JU6A 1EOKA 3MKKA 2E68A 3TYCA 4DLMA 2E4TA 3H4WA 1H5VA 2PD9A 4HN8A 1NH6A 3EXTA 3WBXA 2WHKA 2NX1A 2EKGA 2C15A 2RGLA 3WD4A 4H41A 5HATA 3PBUA 1CPUA 3WFAA 4D72A 4IJRA 1FKXA 4JFTA 4UXDA 1T40A 4IPNB 3W81A 3T08A 3VOGA 4O12A 1KB3A 5HBFA 4ROQA 5CPSA 2BFGA 1OVDA 4NZJA 1WUFA 3BOLA 4K7YA 3FVDA 4O28A 4G9PA 1G6CA 3PBYA 5AHLA 1EGZA 2HMCA 3QEZA 3UJEA 4RW3A 3AZRA 1BWVA 1U1JA 2OWCA 4DWSD 2XSBA 1VRXA 1SFTA 3QZ6A 4W93A 1DJHA 2FH8A 3WLJA 1W3JA 1YPFA 5IFPA 1ISZA 3TQ0A 2W92A 4XD3A 4DXVA 3WKZA 1K9TA 1KFEA 4A8RA 1Q65A 3OVQA 2GJPA 1J12A 1U5HA 5LA0A 1NWUA 2WMJA 1V02A 3EA2A 2G37A 3EB3A 3T6CA 3SUTA 4P2VA 3ZM8A 3T40A 1R7OA 3RAOA 5E6YA 1HO4A 4OOZA 3NOEA 2WMHA 5G1MA 4L56A 1AZ1A 4ORIA 3A13A 2ESCA 1IR2A 1W6TA 3N4FA 1M9HA 3M6DA 2UY5A 4BZYA 1XLLA 1VQTA 4PTWA 5CKSA 4ZGYA 1JQVA 1V3KA 1JZ7A 4TVCA 2YBTA 3EOEA 5MKGB 1Q66A 4XZWA 1UOKA 4UFMA 4FPSA 3QLLA 1JCJA 3CHVA 2INEA 4NZ4A 4DZAA 2PDNA 1XRFA 4FX6M 3NTYA 3JZEA 4QJ1A 4NKCA 1J0YA 2VC5A 3MJMA 4MFDA 3P81A 4ADTA 2VKZG 3K8KA 1GZ1A 5LYRA 4R3UA 3ARWA 1EJ7L 3ZLHA 5F7UA 5EY5A 1F8IA 3GVQA 1QU4A 1EJWC 1PJ9A 2YL5A 3CWHA 3L2IA 4L7ZA 4FAMA 3ITTA 5IM51 4B9YA 3PB0A 2VVSA 3UJFA 1KLZA 1IZKA 2VYOA 4QLLA 1P5BA 4FNRA 3BAXA 3EDFA 4ADSA 2BVDA 5LIKX 5TIMA 3KVJA 3GVWA 1LBLA 2ZE0A 5FL0A 3M0YA 3C8NA 2QCLA 4P61A 3R2GA 3DG6A 3QY6A 3VIMA 4KWOA 3UCDA 2BGSA 5F4SA 4LS2A 5GJPA 1ESWA 2PWEA 1UKSA 2XVLA 3CMFA 4PODA 2UY3A 3P93A 4IG2A 3C61A 4JY8A 4QFUA 1OM0A 5D2WA 2PEVA 1XXXA 2ZRUA 4QJ3B 3A23A 3WYZA 3S2NA 2AQWA 4JL2A 3A4AA 3MWCA 2FHCA 3N3TA 4UFKA 4JIEA 3S5ZA 3R79A 5AECA 5KMYA 3ITVA 2V82A 4O57A 2P0OA 3CIWA 2IPFA 4DXXA 2J79A 3EPNA 2RFGA 1BD0A 2BASA 4R7OA 2O9PA 1J2BA 4MOZA 5BYWA 1HKMA 3KOWA 3VA8A 3SQLA 3M0MA 4LV4A 4A6GA 1WYIA 1JGMA 4U3CA 4Y9OA 2J7BA 2FVKA 1IV8A 2FZ9A 3W6YA 3UZXA 1T8XA 2WMGA 3FJNA 2PWDA 2QULA 2QCFA 2X05A 1VB9A 2WJEA 3OPSA 4ZQPA 4AZ5A 4IUGA 2AQVA 2D0HA 2V5JA 1REQA 1ZCCA 2WNZA 3OBAA 4WKFA 1JI1A 1XF0A 5G2HA 5IDIA 5KZEA 3A12A 5E6ZA 1HW6A 4PR4A 3OVPA 2WWDA 2IKGA 3KBJA 1SSGA 1K02A 4PEKA 3QZAA 2BNJA 2Q09A 4C65A 3F4VA 4D1IA 1MFVA 4PRTA 3UNDA 4JTCA 3I7SA 3KP0A 1GHRA 3MVIA 4ZXLA 2SFPA 1A4LA 1P43A 1H7OA 2X2GA 1ZJHA 1OFBA 3LXAA 3C5QA 3OGVA 5DY3A 1PZ2A 1KBIA 2J4GA 3GNXA 2WVVB 1NIUA 1VHNA 5FAJA 1CGTA 4J3SA 3GVRA 2Z00A 3M41A 3H54A 2IS7A 1K77A 1E6ZA 1V3LA 3ABRA 3MI3A 2Y0FA 4X3ZA 1CYGA 1XJBA 3FIGA 4QROA 2VC6A 1AMKA 1UG6A 3LHVA 5A69A 2XG9A 1E55A 1X1ZA 1N55A 3N1AA 2C71A 1N8WA 4RNHA 1TWDA 2RDUA 3EMZA 4E4FA 1MDRA 3BWWA 4B5TA 4CUCA 1F6YA 2ZTKA 4B5VA 3VIKA 1R3YA 2VX7A 4XZNX 4G2DA 3QGKC 3KTCA 3I68A 4U2ZA 3CZLA 2ICSA 3G0SA 4G1NA 1VFFA 3E02A 1C8VA 1B9BA 3H4XA 1YE6A 4QE5A 4LUTA 4ZQNA 2XGIA 2NQ9A 2GQ8A 4GE8A 3VOCA 4H9VA 3BLOA 3N2BA 3RCYA 4ALDA 3ANUA 3WF2A 1FRBA 1EGMA 3DZ1A 2NV1A 3W07A 2VEKA 1NQ6A 3PPFA 1FQ0A 3NQCA 4ZFCA 3UY7A 4PRRA 1F8MA 3VCCA 1R9XA 2BXVA 5FJPA 2CLKA 3P61A 3RDKA 1ZRQA 4AZCB 3VKCA 1S5VA 3MSRA 1RZMA 3GR8A 1CCWB 1OADA 1UC4A 2HSAA 4J3XA 1LRTA 2XIQA 4V28A 1S5TA 3WLTA 3ZT5A 5DFAA 1V4YA 3RLUA 3QR0A 3W7MA 4KRZA 1XG4A 3L0KA 3MUZ1 1XM3A 2PDHA 4S3AA 5CC3A 1EPXA 5I3HA 3OLDA 3G77A 3E2QA 3PFMA 3IUHA 1PE1A 1A5OC 4NX5A 1TV8A 3W75A 2X42A 1PYMA 1W1IE 1W91A 2ISSA 1BXNA 2DZAA 2QPSA 3VKKA 4N6FA 2ASHA 3HFTA 1QNOA 3URBA 3TN3A 3WDQA 4A4AA 1UW9A 1NP2A 1X8FA 5CGQA 4YXGA 1X7FA 7A3HA 2YXGA 3VVGA 3NPUA 2R91A 1E70M 3IUDA 1KM3A 3P60A 5H1WA 4N7QA 2XIMA 1E9ZB 2G3FA 3M0XA 3QHOA 3LB0A 5D09A 3GDBA 2IUZA 4DJDA 3TONA 1QASA 4LC6A 3VNZA 2O56A 2WSQA 1DWHM 4L80A 5A2BA 5EMJA 3PP7A 2QGYA 3EPMA 3UWWA 3ITLA 4Y9NA 4F0HA 2BV9A 2NVCA 2Z2BA 1HP4A 3MV01 4GBUA 3NIYA 4K1GA 1Y65A 3BSGA 3VPLA 1ONEA 2OLHA 2OX1A 3KM8A 3M0ZA 3RLVA 5AC6A 5C7HA 1L6FA 1SW0A 4MNMA 2IXUA 1UWSA 4OVXA 1X98A 4J3ZA 1J2WA 1GQNA 2DZXA 2WVTA 2GJRA 4ZB5A 2ADAA 3S9YA 3M64A 4IT1A 3W1NA 2ZZ2A 5HMEA 1OIFA 1PXGA 4DJEA 4V1XA 2EEXA 1K7XA 5FSEC 2RDTA 2QLYA 3E9AA 3BO9A 4HNLA 2YXOA 5I2UA 3ZYZA 4OUEA 3CPGA 3V35A 4X9YA 3WUBA 3PZIA 5I0DA 3T2OA 1VLIA 2Q3OA 4E3TA 3VFCA 3PS7A 1XWYA 3LQGA 2Z29A 4DO4A 1BFNA 2EQDA 1HVXA 4FK9A 1LP6A 5A3HA 2OKTA 4JQ3A 3HG3A 3ABZA 2ZX6A 2A5HA 1EJUC 2PDLA 2OEKA 4GNKB 3TH6A 4MADA 5D04C 1I75A 1AUSL 1XYFA 4PMZA 4C6NA 4S2BA 1KXHA 3SADA 3UY8A 5FACA 4XAGA 5TNVA 3GNDA 2RGMA 3C3NA 2YBVA 1PAMA 4V2XA 4DLFA 2BY1A 4HZ6A 4Y8EA 2BP1A 3HTWA 3OZPA 4LAOA 1NFGA 2ALRA 1DXFA 3G18A 2I9UA 1XBYA 4LF2A 5G2WA 2XGZA 1AH4A 1HVQA 2V38A 2X40A 3MA8A 3TJ4A 2PTDA 1R3TA 4GIAA 1O6IA 5FEXA 5ABGA 1NEYA 1VRDA 3TTOA 1TKKA 1RHCA 4DXKA 1M3UA 2VWTA 1G4SA 1NDWA 1GYLA 3AUOA 1XIBA 2D73A 5LGXA 2QAPA 3P6LA 3A24A 4H9UA 1JCNA 3ATZA 4K6AA 3THDA 3CAQA 5DMNA 3QBUA 3W38A 5HK4A 2JEPA 4GI4A 1GOIA 5F2MA 3OQEA 1KTBA 3RX3A 4ZSTA 2D2OA 3SCPA 1X6UA 2XFRA 1BYAA 3GB6A 4KWWA 2A0NA 4C6JA 4Q22A 1UASA 5D2YA 4YHEA 1OC7A 2RKXA 1W9DM 1GYMA 1JDCA 4QQUA 2CITA 4XG1A 1H50A 4WJEA 4F0SA 3FOKA 1GOOA 4S3GA 4JKLA 1EEPA 3LCFA 4H9ZA 4KQNA 4QLKA 1SUXA 2ZRZA 4CLMA 3L4YA 2C8NA 4Z2KA 4YL2A 4MWAA 3EXRA 4XKMA 1R46A 4H83A 1RP8A 1E6SM 1XDLA 3PF3A 3M0HA 3B8DA 4HU0A 3R25A 4MLJA 4FB7A 3DHPA 3VX0A 1QI3A 1OFEA 1W3KA 2ZZ7A 2INZA 1J5SA 2I17A 5D03A 1KXVA 2WKLA 3UG5A 2OXNA 3SM0A 4CD8A 1QWKA 2X1UA 3VOJA 1UP2A 4K8EA 5BXRA 3PBVA 4RK8A 4UFLA 3W1LA 3B4YA 1YPXA 3CPUA 2QQ6A 3TXVA 3OBKA 3DYPA 3B9EA 3VXGA 3QY8A 5H2ZA 2OLSA 4QG6A 3MCMA 5LA2A 3AROA 3LLDA 3A3HA 5BMXA 1DE5A 4HZ8A 4NZ3A 4TVUA 5AZ0A 1GW9A 1LWHA 2W0UA 4KBXA 1ZS2A 3GHSA 3MYPA 4FP1A 1S2WA 3ZSSA 2I9EA 2DJXA 5KEZA 3BLLA 4R7JA 4HNOA 2Y63A 3ZR4A 5HNRA 4KEUA 2PPGA 4JS3A 1RH9A 1XLCA 3I4KA 4DWSB 1SM9A 3NVDA 4OZOA 4ERAA 3H26A 4F3HA 4NX0A 3LM7A 1GKQA 5IHSA 1EDQA 4CCCA 4I9TA 1NFPA 1NF7A 1XYBA 3AU6A 4ZQMA 4KF1A 3A5VA 1O95A 1UWAA 4QRNA 2J8TA 5L6UA 1GCYA 1LORA 1AH3A 5G5IA 1DP0A 2ON3A 3VOFA 3BAIA 1RBLA 1UMLA 4PEEA 1D2KA 2DQWA 3BG3A 2X0HA 2DZWA 2YL8A 1VBJA 1QWGA 3UXDA 2DSZA 3AHTA 1H2JA 1OCQA 3SY8A 1XSKA 2F2KA 1C7TA 4FSAA 2PODA 3RMJA 1FWSA 1TPFA 3WJSA 4UTWA 1EBHA 2GGIA 4MNLA 1CNVA 5KINA 1GKRA 4XKYB 5D37A 1I8JA 2R1MA 3WUGA 5REQB 3UCQA 2JEQA 1XDMA 2WCGA 4J28A 3SY5A 3DFTA 2J7DA 3EZ4A 3MVTA 3P5ZA 2GVLA 4PH6A 3LLXA 2FH6A 5AC7A 3EWBX 2NLIA 1CXIA 5M03A 2OSWA 3TYEA 1XQLA 3C2YA 3KCOA 1VGAA 4XIMA 3VM7A 5IOBA 4Z1BA 2VL4A 2W67A 3BV7A 5CPLA 2D22A 1Q7QA 1RP9A 1XBXA 2OKOA 4W88A 1V0NA 2FGLA 4O0ZA 2Y7DA 3IS4A 3LHWA 3AZTA 4A29A 2W3ZA 4YS1A 4JTJA 1GVSA 3G1VA 3MMWA 1ELSA 3FYOA 3HV8A 1TR1A 4M81A 1CB7B 3R12A 1UR2A 1X7IA 1UWQA 2XVKA 1U30A 4BWLC 2PF8A 4LQ1A 3BH4A 3EOSA 1FOBA 2FB2A 3GH7A 2AAMA 2QR6A 2EJAA 3GAYA 3DFNA 3LDVA 3PWIA 4AUBA 2A1YA 5J04A 3QZEA 1M01A 3TZNA 1R2TA 2HTMA 3C2EA 3WQWA 3F2DA 1CLVA 1LL7A 5K4ZA 3QTGA 3SW6A 4XAZA 1TIMA 5FL1A 3K5XA 2NT0A 5CZSA 5F1VA 3STFA 3S8HA 1V0LA 3KHDA 4I8YA 3BTNA 4AHOA 1QOQA 1XLBA 1F07A 3MHFA 4FHAA 3OZYA 5FF7A 2BVYA 1MZHA 5D2TA 5T9CE 1WDPA 1HKIA 3G2GA 1C8YA 2PU0A 3A21A 1YHTA 3CQHA 1GT8A 1O7AA 3HPZA 3LI0A 1MW2A 3DENA 2V68A 3H23A 3O3RA 1VFMA 4HZMA 4GWEA 4P7LA 3TFCA 1Z48A 4Y6GA 1BXBA 3S1XA 5BWAA 2DZSA 1E4MM 1GTEA 3BW2A 3WN6A 1IT7A 1KFCA 1KRCC 3DECA 1WKDA 4ZOEA 3TWBA 2X1IA 3SIMA 5AB3A 1TJRA 4B5SA 1BEUA 3AJ7A 4RDZA 2VM8A 4UIOA 4XZLX 3TOYA 4LV9A 3U7BA 3O06A 4JY9A 3ONCA 3S46A 3WNPA 4DM1A 2YDSA 2Y7GA 4XTDA 3IV3A 1VJIA 3U5YA 4F9JA 3TSBA 3FAWA 3N29A 4MIMA 2ZTJA 1FWDC 1VP5A 3EB4A 2BY0A 1H11A 2BHUA 2YSWA 4ACYA 2XH7A 1I45A 3RK8A 4ZQCA 3LG3A 2NXHA 2PC8A 2NSXA 1KKRA 3P80A 1WDSA 3QV8A 4JIRA 3GXIA 5A95A 2P76A 3DESA 3FSUA 3WBWA 1FP9A 3GH4A 4JD4A 4TVDA 2PWFA 2E8YA 1Z9AA 1BPLB 4OOUA 1DQXA 4MKNA 3FGCA 1WZMA 1IXOA 2PLMA 3KLLA 3VNLA 1H60A 3M0IA 5DF0A 3AXXA 1WDRA 1J18A 2DIJA 2ZRVA 2J88A 5TBOA 1W3HA 5C71A 2PDUA 3A4JA 4DJFC 4IIGA 4ONVA 1BKSA 2IPGA 3OYZA 2PWVA 4FZIA 3ZT7A 2Z6IA 1VPYA 2IMRA 4A3RA 1WDQA 3EEGA 4AIOA 5FJJA 1FP8A 4EPBC 3W7OA 5C9XA 1QNVA 3YPIA 4XV0A 4Z1YA 5PTDA 2BOEX 3B0YA 3ZO9A 3STCA 1MI3A 2A7NA 4PGLA 3R6IA 3FEQA 4HK7A 3PFRA 4HVXA 1P1XA 3UWYA 2NV9A 2P53A 5D2VA 3ECQA 3IEBA 1KRAC 1FWRA 4YJ5A 4G6CA 1ZPTA 3KCLA 1M6JA 2V30A 5D38A 5I3DA 4KFOA 3GXMA 4GJJA 2YCEA 3EOLA 3GO2A 1OCNA 5DN1A 1HFBA 3QH2A 5CSSA 1CB2A 4IMGA 2VEFA 3VI2A 4TV5A 4FS9A 4QEHA 3PG9A 1AL8A 3BL3A 4PMQA 4NZFA 1PTGA 2W66A 4UWMA 4AY1A 1DJXA 3EDDA 4I5UA 4PCPA 3TOPA 2PF0A 4E8GA 1VJZA 2POTA 2C19A 1TTQA 3SQSA 2UWFA 3UZYA 2FGBA 1H0IA 2DSUA 2DSVA 2VX5A 3KVMA 3I10A 4K38A 2YBUA 4JCLA 2E7FA 2ZICA 2D2HA 3BOXA 1BTCA 1Q2SA 2CLIA 4H6EA 3N9SA 3SBFA 4DRSA 1XINA 5E70A 2YB1A 1M41A 3DX5A 2Z2AA 4GI9A 2WKJA 2Q6ZA 2JKEA 3ARXA 4LU0A 1OB0A 1P0DA 1TPEA 1J9YA 3W7IA 3FXYA 1Q6DA 5RUBA 4KIEA 3XINA 2NZLA 4QAWA 5I3GA 1XC6A 3EX2A 3GWQA 4MUPA 1ZNNA 2BTMA 2NWRA 3WEMA 1PZ3A 2DVTA 3GE7A 1XP3A 5JQ9A 2A6LA 2WCAA 4LVDA 2ZIDA 4MVAA 3WQFA 3VDBA 5CPOA 1K1DA 3EKGA 3TMQA 3WQDA 4MKSA 4AISA 5CC7A 4E38A 5AC4A 2FJUB 3RIKA 2IXVA 3BMXA 5HDRA 4FLRA 1ADSA 4N0RA 2O7QA 3WBEA 4J1OA 1QFEA 1UD4A 3S1GA 2VJXA 3WLMA 3O16A 1A5MC 3CH9A 1UZHA 1UP3A 2WZIA 4L4PA 4E5TA 5FAGA 2V5LA 1HKVA 5HR6A 1SJBA 5HPCA 1MNSA 4FNPA 3NPWA 1BF2A 4GQGA 4YTQA 1RXOB 4W4QA 4FIRA 4AZBA 5K2ZA 2NX9A 4DNHA 2OFJA 1YIXA 3SCUA 2GWNA 3SGUA 1KXTA 2A21A 4JTDA 4J35A 4GQBA 3SCQA 3F4NA 3LERA 3PR2A 5A6AA 3R5EA 3S2JA 5HA7A 2NQZA 2B81A 3UZJA 2OB3A 3W87A 4U5IA 5CBBA 3V0TA 3GSMA 1TPDA 1K4GA 2WB5A 1XR2A 3DG7A 5FF3A 4M0XA 5I3FA 2E9LA 3URNA 1I2PA 3BV4A 1B90A 1V7AA 3EDKA 4PCSA 5A6TC 3N4EA 4KS0A 1GONA 2HZGA 1IE7C 2XFFA 3UPWA 1F6PA 2R1PA 4W89A 4DPQA 2ZQ0A 1GJPA 4UZUA 1I2OA 4GFSA 4LALA 5LZLA 1E15A 1Y0EA 3FHQA 2ZZ1A 5BROA 4G7FA 3GH5A 4B3LA 1SYTA 2FDMA 3BLFA 4NNBA 4C5YA 1WDDA 2F84A 1VKFA 2C18A 3HJEA 1MUWA 3CK5A 1D8CA 1K6AA 1XX1A 2W79A 3UPMA 1TA3B 1JEZA 5CPQA 5HWJA 3WCZA 2W62A 3N25A 2A3CA 3EWCA 2GL5A 2PDYA 4XVEA 6A3HA 2XGBA 3SSZA 4M6PA 3SSJA 3QR3A 3V7PA 3R0KA 4O1BA 1KGUA 3HQPA 4DJDD 4Y9PA 2LLEA 3M0KA 1EO7A 3KRUA 3W24A 2WNWA 4O17A 1QATA 4S3CA 5CQ1A 4N9DA 1YDVA 1NQKA 1VENA 4JNZA 4MPKA 1KC7A 3W3OA 3DHFA 1IXNA 1PDYA 3WFZA 1MQRA 4H6QA 1LL6A 5AYZA 3TKFA 2WHMA 4DAIA 4WGXA 2W27A 2XYLA 2XIJA 2DT1A 3WD2A 5DCDA 4FXSA 3G5EA 5BOEA 2G96A 3P82A 2VFEA 1WX0A 1VEOA 1ECEA 1JNEA 3QV7A 2AMXA 5A6JA 1Q6FA 1K4HA 3TXZA 3VNDA 4J3VA 4UFHA 1JVNA 3WLPA 1KA9F 4OV9A 4LW7A 4DJED 2EXOA 3OOQA 2WCSA 3WQEA 4US5A 1MXSA 1MRQA 4E2BA 3MI6A 4JTQA 1GEHA 4UTLA 1US0A 3MB9A 4Q8PA 5EBAA 2Z1BA 3E0IA 1A0DA 3GYCA 3K4AA 2X1RA 3U6WA 4TX9A 2OMAA 4PSPA 1AJ0A 3REQA 2JKAA 3IANA 3G1HA 1XBVA 4HU8A 4Z2GA 4DELA 2G4JA 3AIRA 2NVDA 1BG4A 4M51A 5DCEA 4QR6A 2OWXA 4N9EA 1BYDA 1OQFA 1R0MA 4LXFA 3WDJA 2CFFA 3OLEA 3HG4A 1UR3M 1H7NA 1Q6QA 4L4MA 3SEPA 5LA1A 2FZNA 4IMEA 4DNMA 1EYWA 5HNNA 3IGHX 4O4VA 1KWKA 1GZGA 4HKPA 2FVMA 1Q4WA 1SO3A 4DYKA 4YTRA 3EB2A 4ERIA 2D2JA 4GG9A 4NAFA 4PTVA 4KCTA 3MKVA 3UXKA 4HZ7A 4JOMA 5CSYA 1XLKA 1E4LA 2YDAA 4ZTXA 2X7WA 4PL2A 4AC1X 1FWFC 1Q6GA 3BQ5A 4LY8A 1LWJA 2VDHA 2F2HA 3GTNA 3I7RA 3VMPA 1YNPA 1NJJA 1ISYA 2HXUA 3SZ8A 4C1KA 4WZHA 4JIHA 1QTWA 1FDYA 2PTXA 2C14A 2VCBA 1GTHA 1HQTA 1GYNA 3TW6A 3O63A 4JTIA 1I2RA 3GU9A 5EGRA 3B0PA 3RM4A 3UZ5A 4DBWA 3GR4A 1YXYA 2V69A 2GVGA 3HG2A 1R8LA 2Y24A 3LPGA 4HMDA 1QR7A 3NDZA 4PUWA 2D20A 4JEQA 1LJYA 4B3ZA 3DUGA 1EFZA 1N7KA 1ZBWA 4RDWA 1ODZA 2EO7A 3BGGA 4O0QA 3KTSA 2WLYA 4MWAD 2Q8LA 4B16A 1TJ2A 5LHEA 3OBEA 1EJTC 1EL3A 3M0LA 3S1VA 1T8QA 2Q3RA 1NAL1 3GZAA 1JDDA 1UH4A 1WQ5A 5AY7A 3CYJA 1Y5WA 2VT0A 3IIVA 4Q8QA 2Y5SA 3E0VA 1S38A 4LAMA 3I7QA 1B54A 2KZHA 1U5JA 1BVNP 5KSWA 5M3WA 3TN5A 3ORWA 1YBQA 1FY6A 4KEMA 2VR2A 4J27A 2J7EA 3SUVA 4UCFA 4D6IA 3OTRA 2R1KA 4Y9AA 5ENLA 4JTKA 3VNJA 2WQDA 3NQ2A 5DCBA 5AHEA 2XFYA 1VPQA 4H9XA 4XUYA 1DJIA 1QPOA 4NRSA 1KBJA 2P88A 4ZCWA 2PGEA 1BVWA 5ABTA 1CTNA 8XIAA 2QIIA 3MV11 3T81A 4KGLA 1AQMA 5CBIA 1MQQA 3R0UA 2C0AA 3M43A 2QUMA 3AFBA 3GQYA 1RBOB 2R1LA 3ES8A 3PY2A 4P5UA 4RR4A 3S2CA 4D6EA 3RCNA 1E43A 1RCXB 4O18A 3L21A 1YPIA 4M8UA 3RPMA 1VIZA 3ID7A 2E6DA 1LG2A 2YLAA 2PWUA 3NGFA 2FIQA 1POKA 2P3ZA 1E6PA 1EA9C 3SGZA 4AD0A 1AD1A 3AS1A 3F4WA 3W84A 3CLMA 1B30A 3FSTA 3XISA 2Q8XA 2ATSA 2WQPA 2TMDA 1UWIA 1F3EA 1KBLA 1DIDA 1OHLA 1XLDA 5DLCA 1ICSA 1M7JA 1UBSA 1UKPA 1XD1A 2A3HA 4DWSA 2WJDA 1E6NA 3M07A 3MY9A 4NP7A 4YTUA 2QJGA 3UWVA 1HUVA 4YYFA 1WE5A 1PUDA 3PWGA 1P6BA 4L65A 1X6LA 3P84A 3LM3A 2I5IA 1B9ZA 1P4CA 2JBMA 2HXTA 4CQDA 1EJXC 3VMNA 4PMVA 3WG6A 1HL8A 1WXZA 3NDOA 5BZAA 2YPIA 1IEWA 3PZQA 4OHQA 5LHFA 2ZXAA 2GGJA 2XH0A 3KUMA 1Z6KA 1ODUA 5AOUA 4H01A 1SZNA 4Z1AA 4LVGA 4H9YA 4PFHA 3E1F1 4TQTA 2GGHA 3IGSA 5ABEA 4P7NA 3DC8A 3LV6A 4OQVA 2PU1A 2O92A 3MBFA 3NQEA 1HIZA 3E3HA 4AD3A 1IXPA 4J5NA 3UJRA 1GGOA 3KP1A 2QJNA 3WLQA 1ZGDA 4KEZA 3W1UA 3GKAA 1OX5A 3LPFA 1PYFA 3WH9A 4PMNA 5EMUA 3GC5A 5A8PA 1Q6EA 4QM1A 4F2BA 2ZUUA 3MPGA 4C6DA 2OJPA 3RXZA 3W01A 2HVNA 4AWSA 1XYZA 4PUKA 1OC5A 1EXPA 3H4GA 3FFSA 2YCKX 3OG3A 3AIWA 4IQLA 3IVUA 3MYOA 3E96A 3G1FA 2OO6A 1J5TA 3NQ6A 2NLYA 4LB3A 4REQA 4WDTA 1M5WA 3AWNA 3W7LA 3O7UA 2BHZA 5F2LA 1W17A 1YYAA 4WK9A 3NQ8A 3EX1A 1TCMA 4JTGA 1UR4A 5HAOA 1BGGA 1Q2RA 1SZFA 4GD0A 4PYSA 2HRWA 2ZX5A 3KZSA 1QAPA 2P8CA 5EMKA 3W23A 2UBPC 1W1ZA 3UR2A 1Z89A 1WOBA 4EWJA 1SW7A 4LNYA 1VD6A 5I09A 3MT1A 2DH2A 4O1EA 3ZLFA 3AYTA 2FHBA 4XAPA 4B90A 2EG8A 4IH3A 2QHAA 1VH7A 1J0KA 2G8ZA 1ICPA 1FBAA 1ITQA 4R9XA 1VCFA 3T0BA 1PCKA 3GUWA 2QCHA 1FCQA 4ZOAA 2TRSA 3NZQA 2WOQA 3W74A 3HV9A 1H51A 2BBFA 5D8WA 4ICCX 2WBGA 3FVMA 5E93A 4UOJA 1JCYA 1E72M 4HMEA 1C91A 2WM0A 4JN6A 5U7SA 1REQB 1IGWA 1OGBA 1Q5MA 6ENLA 5JBDA 2HBXA 4R5EA 3FA3A 4N02A 3WENA 1XLHA 2D2GA 2AAAA 3PNZA 3L2LA 3AZSA 3R1ZA 1FCUA 3BMWA 4IX2A 4HTBA 4O52A 2CLLA 3QN3A 1ONWA 4GNVA 1RD6A 1E4NA 2YGYA 3FDGA 3B40A 3RX2A 3RO6A 5AFDA 2GUYA 3BGAA 4HYVA 1LOLA 5BW6A 1Q63A 3LPPA 2CLMA 5XINA 3RM8A 2G41A 4O13A 1X97A 1FDZA 2J78A 3UGVA 1SW3A 2GFTA 2FPTA 3KBWA 2QV5A 2V67A 4GZIA 2X0SA 4OBSA 4Q7BA 3P3BA 4JQ2A 3W2UA 2V5DA 1GEQA 1PS9A 3KOZA 2BDQA 1A3WA 1W3IA 3WNKA 4CQ8A 3N9KA 3TC7A 3IACA 4UR7A 2ZZ5A 4JQAA 3H24A 4RE3A 1QMLA 1EB3A 1G67A 3V5OA 1IWBA 3NR0A 2VTFA 4OGZA 5C55A 1JPMA 2WZEA 4UQCA 5KETA 2A4AA 1XYCA 1W5QA 2PP3A 3B8WA 1XIEA 1D8WA 4JTEA 2FPVA 4X63A 3W7QA 1EH9A 2R24A 3BJSA 4UR8A 4AVFA 1D3GA 2VVNA 1OFAA 4I6VA 4K2SA 4HYWA 3SJNA 4L1GA 4C1NA 3P67A 5CAHA 1OEPA 1RPXA 3BXWA 2X1TA 3NL3A 3VX1A 4ATDA 1G69A 3NQDA 4LUTB 3QYSA 1H7PA 3OO2A 4NU7A 4IICA 4C6CA 4O11A 1V08A 3WO8A 2GWGA 3NXLA 3VIOA 3LSCA 3DYOA 4E6MA 3VFLA 1H63A 3K8LA 3WSUA 1FH8A 1YADA 2V3FA 3FEMA 3WLKX 4RJEA 1XLMA 2QUUA 1RCOB 2V5CA 1BKHA 3SDOA 5BXTA 3DU0A 3ZJ8A 4AEOA 4MYXA 1EYEA 3JUGA 2NV2A 4K37A 1OJXA 2R94A 3HG5A 4AWTA 3CV7A 1F05A 1VBUA 3I3EA 4IPPA 1TPVA 3PTQA 2I14A 5AHMA 5LIYX 2AQOA 2XN0A 3IAPA 5I06A 4B5UA 3T0AA 1AK5A 1ZJIA 5JMUA 3W37A 1ZHAA 4UTMA 3MDUA 4CEXC 4N9CA 4TXEA 2J7GA 4DBSA 1UD6A 4UTIA 1E9YB 4US6A 3WK0A 3FXGA 4GMEA 3FKRA 3B8UA 5GNYA 1DTUA 2XH2A 3ISIX 1H7XA 5LNRA 1IF2A 3CMJA 3LBOA 1Q8JA 4E3VA 3R8RA 3LMZA 4K36A 4A2SA 1H0GA 4Z08A 2DT3A 1MEWA 3QYQA 2AGKA 3ZMRA 1HX0A 3OIXA 1HJUA 2A85A 1OCJA 1OYCA 3PTDA 4IGNA 3VO0A 3L9CA 3QVQA 3BPWA 3T7VA 1F61A 1P1MA 3A5FA 4TX8A 4PUJA 2E77A 4D6HA 3NQGA 4LBUA 4LAUA 5BRPA 2IKIA 4W7VA 4FOJA 3GFXA 3N9RA 4ES4A 3QOMA 3W83A 4CCZA 1AVAA 1IIHA 4GQ0A 3LTPA 3TYBA 4J3TA 2BZNA 1CGWA 1LRQA 4PRWA 1UZDA 1M68A 3W85A 2PFHA 2NQ5A 4Z1CA 1VYSX 2ZA3A 3PUEA 4LYQA 3QQ1A 4XO6A 2E3ZA 2GPTA 2TAAA 5F1UA 1EHAA 4JNMA 1AG1O 1K03A 4ZENA 1A47A 4RZ5A 3CZ8A 1YE4A 5FD0A 3CUIA 3GNOA 2DQXA 4M6UA 1YRRA 5H8PA 1E0WA 1F4HA 3WF1A 2BWGA 3SFWA 4ADUA 4QHRA 4ZXOA 3PBWA 1OFRA 2AKMA 1ZBVA 4U3AA 3W7NA 3STPA 1MUCA 1A5AA 3D0CA 4NVTA 3DFSA 4K3ZA 1JCXA 4FALA 4XWUA 2REQA 4D2JA 2WHLA 4DPPA 3HM7A 1PTDA 2XHYA 3IJ8A 3WDPP 1NDZA 2ZOXA 3GU1A 2DEPA 3SCNA 1YTKA 3POCA 1UJQA 4WQ6A 3HGOA 2ZADA 1JI2A 4L6DA 2WWCA 2PTYA 1WZLA 4YWSA 4I5RA 3TC6A 1CGYA 4R7WA 2VCAA 2QUNA 1QPQA 2WMIB 4F48A 4PTXA 1SMDA 1GWJA 2PP1A 1YEYA 2Y88A 4CNTA 3UBPC 1E5NA 4GUIA 5FESA 3ZWTA 1JZ4A 5EKYA 3E0WA 3G1XA 4CD5A 1K8XA 1E73M 2P50A 3BSMA 2D3LA 4C60A 3R8HA 4JFSA 3LHYA 5K7JA 2GZXA 2OCZA 2QUTA 3TWAA 1MEIA 5I24A 4UNLA 1P7TA 4WDWA 1HKWA 4Q8NA 2XM2A 2CWXA 3H2OA 1G94A 1LLOA 1TA3A 3M0JA 3PN8A 2PE4A 3DKLA 3H21A 3WQ8A 4OBTA 1UIOA 2VR4A 2BMBA 3W7PA 1QPKA 3IIXA 3DH7A 3AO0A 3HF3A 3HMCA 5EYWA 4JTTA 4FEZA 3NOYA 4CNUA 1T99A 4EXAA 5T26A 2WMFA 4R34A 3C4UA 5J8LA 2CHOA 1MW3A 1H5YA 2XUCA 1H1NA 3DG3A 2EKCA 1W8SA 3A3XA 2PA6A 3BJTA 1ZSXA 3AXMA 3THUA 2XSAA 4MWAB 4US5D 3DAQA 1TRDA 2VFHA 2QMJA 7CGTA 2E9MA 1SZEA 1LDCA 4GUHA 2VURA 2P3EA 4GBDA 4H4IA 2PDIA 2Z7KA 3K13A 1WP6A 4I8DA 1DQUA 3CAVA 3O6YX 2QDDA 4OV4A 4A8IA 3JZUA 2ABAA 4EPEC 3W29A 4PMDA 4WRHA 5FJRA 2C79A 4PUMA 1KCKA 4OT7A 1SO4A 3CL8A 2OLAA 2F6KA 5JXQA 2XPKA 2WANA 3ONBA 2CC0A 1GJWA 4LRTA 1HKKA 1F74A 2YFNA 3GC2A 1OFQA 4MZYA 3IVTA 1Q85A 3GC4A 1GPFA 3TYZA 3COTA 3CZKA 3NQFA 1HXJA 4NJGA 4D71A 1DHKA 3WEZA 3HPSA 5DX7A 5GNXA 3W7HA 2Y8UA 1X1NA 2WC3A 2NWSA 1V6XA 4WKHA 1OZMA 1E4IA 2PDFA 3N6HA 1I1WA 2F6XA 2INFA 5A5WA 4UOQA 5H8UA 5BU9A 4UMCA 1TFVA 2NQJA 4HK6A 1W1B1 1PIGA 1J10A 3TTSA 1RA5A 1W3LA 1UD2A 4W7WA 4DB7A 1JDEA 5A6BA 1YTEA 3VKAA 1KFJA 1A0CA 3FA4A 2PZ0A 4CQ9A 1H7WA 4EX4A 3UFYA 2VRKA 3MMTA 2IPJA 2ZYFA 1NSJA 3V18A 4IMAA 3SRFA 1HL9A 3BAKA 4R85A 3OB8A 4A8LA 2PS2A 3GW3A 3L4WA 2V6AA 3PJWA 5HNTA 2BGQA 2PP0A 3QMRA 2IPWA 3IIZA 4BKNA 3TJIA 1M53A 4IPIA 3BLDA 4A2RA 1J6OA 1FWTA 3B8IA 5A6SA 4PMRA 3GTFA 3A9IA 1V51A 4G8TA 1XLJA 2GDQA 2IW0A 3AHZA 1SGJA 4JL1A 1KRMA 4DIAA 2CU0A 1E3ZA 3LUTA 3W6LA 4FXFA 3RG6A 4YYCA 1HJVA 3NURA 2PI6A 3W4RA 1I6NA 2A3EA 4BWLA 1XCWA 1OG6A 1TWWA 3BCJA 3RPTA 3HO8A 4JHZA 5FOOA 2DH3A 4A35A 3W0KA 3AYSA 3AHYA 3CIXA 1YLVA 5F2IA 3A22A 3S5SA 4LSBA 1B4EA 1Z32X 1NU5A 4JIPA 2JIWA 4DF0A 4WXZA 2CCRA 2Z26A 1LBFA 4XTIA 5LNSA 3CEPA 3TQKA 4E4PA 4GYJA 3WQCA 4ZE4A 4K7VA 5HWNA 3M5ZA 4K68A 4HCHA 2I5QA 1AW1A 4CNOA 1OFDA 5FF2A 1XCFA 3RGTA 3RM9A 3M7WA 4RE4A 2CESA 3H55A 3VDCA 4UOZA 1XPGA 4AVNA 2YOCA 2X8RA 1OFOA 1JJKA 2WSYA 1MSSA 3CUFA 3I65A 4E2VA 3G3DA 2PLJA 3T55A 3LNMA 1CIUA 2VUYA 2V9DA 3N2OA 4W84A 1W0MA 3NAVA 5LIXX 4LANA 4LVBA 4IIDA 4GZEA 1K6WA 3KE0A 4I7WA 4Y8FA 3QTPA 4O10A 1V6UA 3O2LA 3VDHA 1F5ZA 2I7GA 3TSDA 4IOTA 5BRBA 3J7HA 2OZ3A 2QCNA 4AX7A 4CNPA 5E1QA 2CETA 5M1TA 3F5KA 1C8XA 1KBKA 3C6CA 3LRMA 2TPSA 4KH2A 1E6RA 2YCLA 3GKFA 4I9MA 4P7OA 1G0CA 1QW7A 3RFAA 3TCEA 4IX0A 2OVLA 3L67A 4HBKA 4EXBA 3R13A 4Z42C 4HPGA 4C7DA 5I3IA 3W6MA 2UY2A 3N2MA 1NWTA 3GAKA 5JBEA 2DW7A 4BR1A 7ODCA 3W7CA 4XX6A 1IR1A 1SPQA 3CO8A 3MUXA 2O7SA 4AW7A 3AMDA 3TP4A 2C0HA 6CGTA 4TR9A 1HF6A 3WMSA 1LF1A 3GIQA 2WNNA 2GLKA 2A6NA 2YW4A 3EWUA 4O15A 5BNKA 1WKFA 1XS2A 1GZJA 3PZ9A 1LG1A 3APTA 1X38A 2VCCA 4LUIA 1QW9A 2VWSA 1MXGA 4UQ9A 4O1FA 1J79A 1TX0A 1XLGA 4D6JA 3C2FA 3T44A 2ZKMX 4DJFA 4LWWA 3L4VA 1XIGA 4Z2HA 3AWOA 4IZGA 2VC7A 1FWGC 1OY0A 4AX6A 2WC4A 3O05A 5KZMA 4C6QA 5DRIA 1RAKA 2XISA 2C1HA 4GVGA 1R3VA 1E6XM 2WXDM 4F0RA 5HQLA 1CXEA 3V5FA 1L6YA 1XGEA 1D7KA 2V8ZA 3MCNA 1X6NA 4H19A 3UZWA 3MUCA 2GK1B 4DZIA 1GNXA 5EU9A 4YCPA 1VEMA 3O6DA 3VOHA 3FGCB 2D24A 1SFSA 3L5AA 4CQCA 3ZXWA 4W86A 1DHPA 4IFOA 4QS5A 2CKRA 4IXHA 4NASA 5I00A 3M5VA 1YKWA 4HNNA 2ZWZA 5HUPA 1V3HA 4D1JA 4JFUA 4RXFA 1DVJA 2GDUA 2E1WA 4EXQA 4QTGA 2ACUA 3WL0A 2H8XA 2OGYA 2VD8A 4ZO9A 1QUMA 1KM1A 1ML1A 2DZTA 3NO1A 3GXTA 3N13A 1MDLA 3E0FA 3AHVA 3UWEA 1EUNA 3CHDA 1UQZA 1FWWA 3W2KA 1CXKA 4MGGA 3L65A 4IF2A 2ODOA 4BQ5A 4W7UA 3O6AA 1OWQA 4U31A 3SCRA 3O6CA 4NZ5A 4AEFA 5D8ZA 3IUIA 3H2NA 4FX7A 2NVAA 3UYIA 3WDRA 1UC5A 4NQ1A 1I9CB 4XAFA 2QZRA 1FH7A 3SURA 4GKLA 2OG9A 5DO8A 5CPTA 3S3GA 1B3OA 1KM5A 3AUJA 4XAYA 2YZ5A 3OVGA 3MKCA 4Q8WA 1ZJAA 4PTMA 4JN8A 1S1PA 4BI7A 3GDMA 3Q94A 1DJGA 5CPMA 5C8BB 3F1QA 4Q8VA 1ZP3A 4ACZA 3U8GA 1SZRA 1JCMP 2HE8A 2J66A 2RJGA 3DBPA 4Q4RA 1VFSA 4W9TA 4OECA 3L4TA 3VE7A 2V5KA 1DORA 3M5XA 4GXMA 1GVQA 1HL2A 3TLQA 2C7FA 5A2CA 4GZJA 1QNPA 4LY4A 1PKLA 3E2SA 3QHNA 4A05A 4PE8A 3JR2A 2ZC1A 4B9ZA 2PLCA 5HPOA 1FX6A 4NYYA 3VTRA 1FDJA 3V0UA 1QO5A 1BG9A 2WBKA 3GXDA 3VZZA 2YA0A 3HGJA 1SSDA 3A4XA 5E5CA 1CW2A 1R6WA 2GSJA 1VFLA 2VEMA 2BS9A 2Y85A 5CSUA 1RLCL 3T1GA 1S3TC 2G5WA 4HK5A 1UBPC 2H8ZA 3MS8A 2Y5JA 4IP5A 2F38A 3WLHA 4MDPA 5DT5A 2WSPA 3UA4A 4KCUA 2VGGA 1PDZA 2G3MA 2WSKA 4GUFA 4C6MA 3GTIA 3OLIA 4EK7A 1KQYA 2GUUA 2ZCGA 2ZC8A 4GYFA 3XIMA 2I57A 3PANA 3H2CA 3BW4A 1J11A 3VGDA 2Z0IA 4LCRA 1MO0A 4KT2A 3BE7A 1L8PA 1OFPA 3OA3A 2J8GA 3TW7A 3ZOAA 2QGHA 2NT1A 4GIRA 2BOFX 4LRSA 8RUCA 1A3XA 2XIOA 1SZGA 4HD5A 4K8GA 4ZSUA 1LOSA 2QF7A 3K30A 3D5HA 5D9PA 3S6DA 1NF0A 4FNUA 3QQWA 4HHHA 3IPWA 3OGRA 3GVGA 4XVDA 4AYGA 3E6EA 4FF7A 5I7GA 4DO7A 5G1YA 5BCAA 3BMVA 4MY8A 5GVJA 3B0UX 5CPNA 2GJXB 4GC4A 3QPEA 1U2YA 3PB2A 2WSRA 1PV8A 3S83A 2F61A 4FNSA 3RPDA 5A8MA 3DFHA 3NDYA 4B5WA 3C52A 4GCXA 5CZKA 4DUXA 2JALA 4BI5A 4YU1A 5HMDA 2Y2WA 2HNHA 2J13A 4Z0JA 2ZUSA 7ENLA 3P2VA 3RJYA 1UHVA 1ISWA 4IFKA 5BRQA 1OSEA 3SUUA 3WD0A 2NUXA 4BJHA 3IJDA 1HP5A 4WEVX 3QSTA 1A49A 4NT0A 3L0NA 4GXWA 2AL2B 2OSXA 1F7BA 2VDIA 4MHBA 5AKQA 3RJXA 3B8SA 3D46A 4ML4A 2CZEA 1GOWA 4HHLA 1ZZMA 1DWGM 2J75A 3C0JA 3R4IA 5HWMA 2ZUWA 1DJNA 3IRDA 5HQMA 1WCGA 1TX2A 5FA5A 4DI9A 3WK3A 1W3TA 4LVFA 4ZMGA 1XUZA 2Y8KA 3TQPA 5HANA 4MAZA 3SI9A 1P6CA 3HURA 4ICMA 5JIPA 1BLIA 1AZ2A 1CBGA 3LRKA 3MO7A 2XVGA 3P74A 2A3BA 6REQA 3P5YA 1PKYA 1W9PA 4UTTC 3WH8A 2XZ9A 1MWOA 3LMYA 5BU6A 5T8GA 3MUAA 4AIUA 1K8ZA 2TSYA 4PL1A 3F2CA 4C90A 5C2CA 1KKOA 3B97A 2VRQA 4PTDA 4BQ4A 1AJZA 3GIPA 3NM3A 4H04A 3ARPA 1B1YA 3RU8X 1Z41A 5G1TA 3W1AA 4FIQA 1S5WA 4JKMA 3MO4A 2PZNA 4L64A 1V3MA 2EGZA 1Q8AA 3WQOA 3KOYA 3P8JA 2XINA 4FI4A 3WF4A 3M9YA 1EHNA 1HG3A 4PN2A 3LK6A 1B2YA 2VENA 3ZR5A 3L5MA 5DBUA 2VEGA 3UCCA 5C9WA 5A8QA 6ALDA 1UUMA 4RNIA 5B7ZA 4X2PA 1RA0A 1R86A 2PC4A 3VIFA 1F3TA 3EDJA 2DT0A 5K4XA 4KPLA 1UKTA 2QUVA 3EAUA 1RR2A 1DJWA 3K46A 1L2QA 4H8UA 5I5RA 3LXBA 1B31A 2OTDA 3F03K 2J24A 1HO1A 2DORA 2RJHA 3EWDA 3SQMA 3S9ZA 3WUFA 3OG2A 1WO2A 3ITYA 2JFEX 4A3UA 1ZP4A 4RV3A 3NNTA 2YKKA 2V5BA 4AHPA 1GQIA 5F4WA 4HSHA 1DJQA 2ZUMA 1ZAJA 1DTNA 2OSYA 3DDMA 4X2RA 3N18A 2BODX 4MZ1A 1JFHA 1NOWA 3T78A 3DIPA 2B7NA 3C2OA 3V5CA 3REQB 1FFRA 4KW2A 1XLEA 1V5XA 4Y9MA 4TMCA 4S1FA 3NZPA 3B4UA 4KGJA 5FJUA 3HB9A 2X7VA 3DKJA 3AISA 4PB3A 1E1CB 3URAA 1VYPX 8CGTA 1DE6A 2DPEA 2JK2A 4O50A 7TAAA 1K9EA 2W4XA 4LUYA 3FDKA 3N11A 2QIWA 3BAJA 1XPYA 1RD5A 1CI1A 4KMQA 3W88A 4NAFB 4MJMA 4LAKA 4DZ5A 1XYMA 2F6UA 4UTJA 1UB3A 1R5YA 1AQ0A 1I60A 3GX9A 2J6VA 1BHGA 3NQMA 1GORA 3PSVA 2JF7A 4QE1A 4XO7A 3H2MA 3FV9A 3QC0A 4GO8A 2WMIA 3ITGA 2WC7A 3IGXA 1EWEA 1NOUA 1D3HA 2J7CA 1QHPA 3VCRA 2FGZA 3G1DA 1VIWA 2YZRA 4L4OA 5CSRA 1U5VA 1TCDA 1E9LA 3BSHA 3GY1A 4H8VA 3T4WA 3FYPA 1UD3A 3WJWA 2J7HA 4ZEPA 4AZHA 1K8CA 5CEWA 4AZ7A 2CHNA