3QFMA

Crystal structure of streptococcal asymmetric ap4a hydrolase and phosphodiesterase spr1479/saph
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
258
structure length
258
Chain Sequence
MTKIALLSDIHGNTTALEAVLADARQLGVDEYWLLGDILMPGTGRRRILDLLDQLPITARVLGNWEDSLWHGVRKELDSTRPSQRYLLRQCQYVLEEISLEEIEVLHNQPLQIHRQFGDLTVGISHHLPDKNWGRELIHTGKQEEFDRLVTHPPCDIAVYGHIHQQLLRYGTGGQLIVNPGSIGQPFFLDAQLRKDLRAQYMILEFDDKGLVDMDFRRVDYDVAAELQLAKDLRLPYFEVYYESLVNGIHHTHHQEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and enzymatic characterization of a Streptococcal ATP/diadenosine polyphosphate and phosphodiester hydrolase Spr1479/SapH
rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords Putative uncharacterized protein
total genus 92
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12850 Metallophos_2 Calcineurin-like phosphoesterase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3qfmA00
4OR9A 2DFJA 1USHA 2KKNA 4XPNA 2WDEA 4UT3A 4HD0A 3HVQA 4I5LC 1KBPA 4UWQA 4O5GA 5F3WA 1QHWA 4H2IA 4ZVZA 2WDFA 3EGHA 1S3LA 4ORAA 3IB8A 3QFOA 4IYPC 3RL5A 1W24A 1HO5A 2NYMC 2IAEC 4M0VA 2BQ8X 1U32A 2WDDA 4F0ZA 2O8GA 4G9JA 1Z2XA 1QFCA 3DW8C 3TGHA 3RL3A 4B2OA 1NNWA 3V4YA 3AV0A 3E7AA 3IVEA 5HPEA 3THNA 2HYPA 1S3NA 1JK7A 4O43A 4JA9A 4V0VA 2GJUA 4MOVA 2Z72A 3ZU0A 3H67A 3IB7A 4H2FA 3LL8A 4MP0A 1WARA 4MOYA 4DHLA 1XZWA 3PSOA 5B8IA 2HYOA 3C5WC 2A22A 2O8AA 2QJCA 4O4KA 1G5BA 2AHDA 3JYFA 5J28A 1TCOA 1AUIA 1S8EA 5EQVA 4H2BA 4LU9A 4TUIA 2R17A 3H60A 3E7BA 3KBPA 5C1VA 3H62B 4H1YP 5JJTA 4V0XA 3ZTVA 5JPEA 2WDCA 4ORBA 3K7VC 4FBKA 2BDXA 3QG5C 3AUZA 1V73A 2JOGA 1S70A 2NXFA 3P71C 2NYLC 2QFPA 3CK2A 1HP1A 3GVEA 4IL1A 3RQZA 4O24A 5GTUA 4ZX2A 1OIDA 4FCXA 5JPFA 3QFMA 4H2GA 3FGAC 4FBWA 3T1IA 2QFRA 4UT2A 1T70A 2NPPC 2YVTA 3EGGA 3H63A 3RL4A 2Q8UA 4KBPA 2ZBMA 4LTYA 4KKZA 1FJMA 4JA7A 1T71A 5INBA 3K7WC 4DT2A 2IE3C 4ORCA 3H66A 2HY1A 4Q7FA 4TUGA 4UT3B 1S3MA 3DSCA 5IOHA 2Z06A 1MF8A 5DNYA 1WAO1 1Z2WA 4LACC 2IE4C 4J6OA 4I5NC 1XM7A 1IT6A 3H61A 2CV9A 3PSNA 4YKEA 3QFKA 1SU1A 4FBQA 4V0WA 4WWLA 2BCDA 1UF3A 3N5UA 3H68A 2USHA 3IVDA 2XMOA 1OIEA 3QFNA 1UTEA 4NZVA 3H64A 2P6BA 3DSDA 4DSYA 1M63A 4H1SA 3C9FA 1OI8A 1S95A 1II7A 3ICFA 3THOB 3H69A 1HPUA 2Z1AA
chains in the Genus database with same CATH superfamily
4OR9A 2DFJA 1USHA 2KKNA 4XPNA 2WDEA 4UT3A 4HD0A 3HVQA 4I5LC 1KBPA 4UWQA 2ZO9B 4O5GA 1QHWA 4H2IA 5F3WA 4ZVZA 2WDFA 3EGHA 1S3LA 4ORAA 3IB8A 3QFOA 4IYPC 3RL5A 1W24A 1HO5A 2NYMC 2IAEC 4M0VA 2BQ8X 1U32A 2WDDA 4F0ZA 2O8GA 4G9JA 1Z2XA 1QFCA 3DW8C 3TGHA 3RL3A 4B2OA 1NNWA 3V4YA 3AV0A 3E7AA 3IVEA 5HPEA 3THNA 2HYPA 1S3NA 1JK7A 4O43A 4JA9A 4V0VA 2GJUA 4MOVA 2Z72A 3ZU0A 3H67A 3IB7A 4H2FA 3LL8A 4MP0A 1WARA 4MOYA 4DHLA 1XZWA 3PSOA 5B8IA 2HYOA 2A22A 2O8AA 2QJCA 3C5WC 4O4KA 1G5BA 2AHDA 3JYFA 5J28A 1TCOA 1AUIA 1S8EA 5EQVA 4H2BA 4LU9A 4TUIA 2R17A 3H60A 3E7BA 3KBPA 5C1VA 3H62B 4H1YP 2ZOAA 5JJTA 4V0XA 3ZTVA 5JPEA 2WDCA 4ORBA 3K7VC 4FBKA 2BDXA 3QG5C 3AUZA 1V73A 2JOGA 1S70A 2NXFA 3P71C 2NYLC 2QFPA 3CK2A 1HP1A 3GVEA 4IL1A 3RQZA 4O24A 5GTUA 4ZX2A 1OIDA 4FCXA 5JPFA 3QFMA 4H2GA 3FGAC 2YEQA 4FBWA 2QFRA 3T1IA 4UT2A 1T70A 2NPPC 2YVTA 3EGGA 3H63A 3RL4A 2Q8UA 4KBPA 2ZBMA 4LTYA 2DXLA 4KKZA 1FJMA 3D03A 4JA7A 1T71A 5INBA 3K7WC 4DT2A 2IE3C 4ORCA 3H66A 2HY1A 4Q7FA 4TUGA 4UT3B 3E0JA 1S3MA 3DSCA 5IOHA 2Z06A 1MF8A 5DNYA 1WAO1 1Z2WA 4LACC 2IE4C 4J6OA 3FLOA 4I5NC 1XM7A 1IT6A 3H61A 2CV9A 3PSNA 4YKEA 3QFKA 1SU1A 4FBQA 4V0WA 4WWLA 2BCDA 1UF3A 3N5UA 3H68A 2USHA 3IVDA 2XMOA 1OIEA 3QFNA 1UTEA 2DXNA 3H64A 4NZVA 2P6BA 3DSDA 4DSYA 1M63A 4H1SA 3C9FA 1OI8A 1S95A 1II7A 3ICFA 3THOB 3H69A 1HPUA 2Z1AA
chains in the Genus database with same CATH topology
4OR9A 2DFJA 1USHA 2KKNA 4XPNA 2WDEA 4UT3A 4HD0A 3HVQA 4I5LC 1KBPA 4UWQA 2ZO9B 4O5GA 1QHWA 4H2IA 5F3WA 4ZVZA 2WDFA 3EGHA 1S3LA 4ORAA 3IB8A 3QFOA 4IYPC 3RL5A 1W24A 1HO5A 2NYMC 2IAEC 4M0VA 2BQ8X 1U32A 2WDDA 4F0ZA 2O8GA 4G9JA 1Z2XA 1QFCA 3DW8C 3TGHA 3RL3A 4B2OA 1NNWA 3V4YA 3AV0A 3E7AA 3IVEA 5HPEA 3THNA 2HYPA 1S3NA 1JK7A 4O43A 4JA9A 4V0VA 2GJUA 4MOVA 2Z72A 3ZU0A 3H67A 3IB7A 4H2FA 3LL8A 4MP0A 1WARA 4MOYA 4DHLA 1XZWA 3PSOA 5B8IA 2HYOA 2A22A 2O8AA 2QJCA 3C5WC 4O4KA 1G5BA 2AHDA 3JYFA 5J28A 1TCOA 1AUIA 1S8EA 5EQVA 4H2BA 4LU9A 4TUIA 2R17A 3H60A 3E7BA 3KBPA 5C1VA 3H62B 4H1YP 2ZOAA 5JJTA 4V0XA 3ZTVA 5JPEA 2WDCA 4ORBA 3K7VC 4FBKA 2BDXA 3QG5C 3AUZA 1V73A 2JOGA 1S70A 2NXFA 3P71C 2NYLC 2QFPA 3CK2A 1HP1A 3GVEA 4IL1A 3RQZA 4O24A 5GTUA 4ZX2A 1OIDA 4FCXA 5JPFA 3QFMA 4H2GA 3FGAC 2YEQA 4FBWA 2QFRA 3T1IA 4UT2A 1T70A 2NPPC 2YVTA 3EGGA 3H63A 3RL4A 2Q8UA 4KBPA 2ZBMA 4LTYA 2DXLA 4KKZA 1FJMA 3D03A 4JA7A 1T71A 5INBA 3K7WC 4DT2A 2IE3C 4ORCA 3H66A 2HY1A 4Q7FA 4TUGA 4UT3B 3E0JA 1S3MA 3DSCA 5IOHA 2Z06A 1MF8A 5DNYA 1WAO1 1Z2WA 4LACC 2IE4C 4J6OA 3FLOA 4I5NC 1XM7A 1IT6A 3H61A 2CV9A 3PSNA 4YKEA 3QFKA 1SU1A 4FBQA 4V0WA 4WWLA 2BCDA 1UF3A 3N5UA 3H68A 2USHA 3IVDA 2XMOA 1OIEA 3QFNA 1UTEA 2DXNA 3H64A 4NZVA 2P6BA 3DSDA 4DSYA 1M63A 4H1SA 3C9FA 1OI8A 1S95A 1II7A 3ICFA 3THOB 3H69A 1HPUA 2Z1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OR9 A;  2DFJ A;  1USH A;  2KKN A;  4XPN A;  2WDE A;  4UT3 A;  4HD0 A;  3HVQ A;  4I5L C;  1KBP A;  4UWQ A;  4O5G A;  5F3W A;  1QHW A;  4H2I A;  4ZVZ A;  2WDF A;  3EGH A;  1S3L A;  4ORA A;  3IB8 A;  3QFO A;  4IYP C;  3RL5 A;  1W24 A;  1HO5 A;  2NYM C;  2IAE C;  4M0V A;  2BQ8 X;  1U32 A;  2WDD A;  4F0Z A;  2O8G A;  4G9J A;  1Z2X A;  1QFC A;  3DW8 C;  3TGH A;  3RL3 A;  4B2O A;  1NNW A;  3V4Y A;  3AV0 A;  3E7A A;  3IVE A;  5HPE A;  3THN A;  2HYP A;  1S3N A;  1JK7 A;  4O43 A;  4JA9 A;  4V0V A;  2GJU A;  4MOV A;  2Z72 A;  3ZU0 A;  3H67 A;  3IB7 A;  4H2F A;  3LL8 A;  4MP0 A;  1WAR A;  4MOY A;  4DHL A;  1XZW A;  3PSO A;  5B8I A;  2HYO A;  3C5W C;  2A22 A;  2O8A A;  2QJC A;  4O4K A;  1G5B A;  2AHD A;  3JYF A;  5J28 A;  1TCO A;  1AUI A;  1S8E A;  5EQV A;  4H2B A;  4LU9 A;  4TUI A;  2R17 A;  3H60 A;  3E7B A;  3KBP A;  5C1V A;  3H62 B;  4H1Y P;  5JJT A;  4V0X A;  3ZTV A;  5JPE A;  2WDC A;  4ORB A;  3K7V C;  4FBK A;  2BDX A;  3QG5 C;  3AUZ A;  1V73 A;  2JOG A;  1S70 A;  2NXF A;  3P71 C;  2NYL C;  2QFP A;  3CK2 A;  1HP1 A;  3GVE A;  4IL1 A;  3RQZ A;  4O24 A;  5GTU A;  4ZX2 A;  1OID A;  4FCX A;  5JPF A;  3QFM A;  4H2G A;  3FGA C;  4FBW A;  3T1I A;  2QFR A;  4UT2 A;  1T70 A;  2NPP C;  2YVT A;  3EGG A;  3H63 A;  3RL4 A;  2Q8U A;  4KBP A;  2ZBM A;  4LTY A;  4KKZ A;  1FJM A;  4JA7 A;  1T71 A;  5INB A;  3K7W C;  4DT2 A;  2IE3 C;  4ORC A;  3H66 A;  2HY1 A;  4Q7F A;  4TUG A;  4UT3 B;  1S3M A;  3DSC A;  5IOH A;  2Z06 A;  1MF8 A;  5DNY A;  1WAO 1;  1Z2W A;  4LAC C;  2IE4 C;  4J6O A;  4I5N C;  1XM7 A;  1IT6 A;  3H61 A;  2CV9 A;  3PSN A;  4YKE A;  3QFK A;  1SU1 A;  4FBQ A;  4V0W A;  4WWL A;  2BCD A;  1UF3 A;  3N5U A;  3H68 A;  2USH A;  3IVD A;  2XMO A;  1OIE A;  3QFN A;  1UTE A;  4NZV A;  3H64 A;  2P6B A;  3DSD A;  4DSY A;  1M63 A;  4H1S A;  3C9F A;  1OI8 A;  1S95 A;  1II7 A;  3ICF A;  3THO B;  3H69 A;  1HPU A;  2Z1A A; 
#chains in the Genus database with same CATH topology
 4OR9 A;  2DFJ A;  1USH A;  2KKN A;  4XPN A;  2WDE A;  4UT3 A;  4HD0 A;  3HVQ A;  4I5L C;  1KBP A;  4UWQ A;  2ZO9 B;  4O5G A;  1QHW A;  4H2I A;  5F3W A;  4ZVZ A;  2WDF A;  3EGH A;  1S3L A;  4ORA A;  3IB8 A;  3QFO A;  4IYP C;  3RL5 A;  1W24 A;  1HO5 A;  2NYM C;  2IAE C;  4M0V A;  2BQ8 X;  1U32 A;  2WDD A;  4F0Z A;  2O8G A;  4G9J A;  1Z2X A;  1QFC A;  3DW8 C;  3TGH A;  3RL3 A;  4B2O A;  1NNW A;  3V4Y A;  3AV0 A;  3E7A A;  3IVE A;  5HPE A;  3THN A;  2HYP A;  1S3N A;  1JK7 A;  4O43 A;  4JA9 A;  4V0V A;  2GJU A;  4MOV A;  2Z72 A;  3ZU0 A;  3H67 A;  3IB7 A;  4H2F A;  3LL8 A;  4MP0 A;  1WAR A;  4MOY A;  4DHL A;  1XZW A;  3PSO A;  5B8I A;  2HYO A;  2A22 A;  2O8A A;  2QJC A;  3C5W C;  4O4K A;  1G5B A;  2AHD A;  3JYF A;  5J28 A;  1TCO A;  1AUI A;  1S8E A;  5EQV A;  4H2B A;  4LU9 A;  4TUI A;  2R17 A;  3H60 A;  3E7B A;  3KBP A;  5C1V A;  3H62 B;  4H1Y P;  2ZOA A;  5JJT A;  4V0X A;  3ZTV A;  5JPE A;  2WDC A;  4ORB A;  3K7V C;  4FBK A;  2BDX A;  3QG5 C;  3AUZ A;  1V73 A;  2JOG A;  1S70 A;  2NXF A;  3P71 C;  2NYL C;  2QFP A;  3CK2 A;  1HP1 A;  3GVE A;  4IL1 A;  3RQZ A;  4O24 A;  5GTU A;  4ZX2 A;  1OID A;  4FCX A;  5JPF A;  3QFM A;  4H2G A;  3FGA C;  2YEQ A;  4FBW A;  2QFR A;  3T1I A;  4UT2 A;  1T70 A;  2NPP C;  2YVT A;  3EGG A;  3H63 A;  3RL4 A;  2Q8U A;  4KBP A;  2ZBM A;  4LTY A;  2DXL A;  4KKZ A;  1FJM A;  3D03 A;  4JA7 A;  1T71 A;  5INB A;  3K7W C;  4DT2 A;  2IE3 C;  4ORC A;  3H66 A;  2HY1 A;  4Q7F A;  4TUG A;  4UT3 B;  3E0J A;  1S3M A;  3DSC A;  5IOH A;  2Z06 A;  1MF8 A;  5DNY A;  1WAO 1;  1Z2W A;  4LAC C;  2IE4 C;  4J6O A;  3FLO A;  4I5N C;  1XM7 A;  1IT6 A;  3H61 A;  2CV9 A;  3PSN A;  4YKE A;  3QFK A;  1SU1 A;  4FBQ A;  4V0W A;  4WWL A;  2BCD A;  1UF3 A;  3N5U A;  3H68 A;  2USH A;  3IVD A;  2XMO A;  1OIE A;  3QFN A;  1UTE A;  2DXN A;  3H64 A;  4NZV A;  2P6B A;  3DSD A;  4DSY A;  1M63 A;  4H1S A;  3C9F A;  1OI8 A;  1S95 A;  1II7 A;  3ICF A;  3THO B;  3H69 A;  1HPU A;  2Z1A A; 
#chains in the Genus database with same CATH homology
 4OR9 A;  2DFJ A;  1USH A;  2KKN A;  4XPN A;  2WDE A;  4UT3 A;  4HD0 A;  3HVQ A;  4I5L C;  1KBP A;  4UWQ A;  2ZO9 B;  4O5G A;  1QHW A;  4H2I A;  5F3W A;  4ZVZ A;  2WDF A;  3EGH A;  1S3L A;  4ORA A;  3IB8 A;  3QFO A;  4IYP C;  3RL5 A;  1W24 A;  1HO5 A;  2NYM C;  2IAE C;  4M0V A;  2BQ8 X;  1U32 A;  2WDD A;  4F0Z A;  2O8G A;  4G9J A;  1Z2X A;  1QFC A;  3DW8 C;  3TGH A;  3RL3 A;  4B2O A;  1NNW A;  3V4Y A;  3AV0 A;  3E7A A;  3IVE A;  5HPE A;  3THN A;  2HYP A;  1S3N A;  1JK7 A;  4O43 A;  4JA9 A;  4V0V A;  2GJU A;  4MOV A;  2Z72 A;  3ZU0 A;  3H67 A;  3IB7 A;  4H2F A;  3LL8 A;  4MP0 A;  1WAR A;  4MOY A;  4DHL A;  1XZW A;  3PSO A;  5B8I A;  2HYO A;  2A22 A;  2O8A A;  2QJC A;  3C5W C;  4O4K A;  1G5B A;  2AHD A;  3JYF A;  5J28 A;  1TCO A;  1AUI A;  1S8E A;  5EQV A;  4H2B A;  4LU9 A;  4TUI A;  2R17 A;  3H60 A;  3E7B A;  3KBP A;  5C1V A;  3H62 B;  4H1Y P;  2ZOA A;  5JJT A;  4V0X A;  3ZTV A;  5JPE A;  2WDC A;  4ORB A;  3K7V C;  4FBK A;  2BDX A;  3QG5 C;  3AUZ A;  1V73 A;  2JOG A;  1S70 A;  2NXF A;  3P71 C;  2NYL C;  2QFP A;  3CK2 A;  1HP1 A;  3GVE A;  4IL1 A;  3RQZ A;  4O24 A;  5GTU A;  4ZX2 A;  1OID A;  4FCX A;  5JPF A;  3QFM A;  4H2G A;  3FGA C;  2YEQ A;  4FBW A;  2QFR A;  3T1I A;  4UT2 A;  1T70 A;  2NPP C;  2YVT A;  3EGG A;  3H63 A;  3RL4 A;  2Q8U A;  4KBP A;  2ZBM A;  4LTY A;  2DXL A;  4KKZ A;  1FJM A;  3D03 A;  4JA7 A;  1T71 A;  5INB A;  3K7W C;  4DT2 A;  2IE3 C;  4ORC A;  3H66 A;  2HY1 A;  4Q7F A;  4TUG A;  4UT3 B;  3E0J A;  1S3M A;  3DSC A;  5IOH A;  2Z06 A;  1MF8 A;  5DNY A;  1WAO 1;  1Z2W A;  4LAC C;  2IE4 C;  4J6O A;  3FLO A;  4I5N C;  1XM7 A;  1IT6 A;  3H61 A;  2CV9 A;  3PSN A;  4YKE A;  3QFK A;  1SU1 A;  4FBQ A;  4V0W A;  4WWL A;  2BCD A;  1UF3 A;  3N5U A;  3H68 A;  2USH A;  3IVD A;  2XMO A;  1OIE A;  3QFN A;  1UTE A;  2DXN A;  3H64 A;  4NZV A;  2P6B A;  3DSD A;  4DSY A;  1M63 A;  4H1S A;  3C9F A;  1OI8 A;  1S95 A;  1II7 A;  3ICF A;  3THO B;  3H69 A;  1HPU A;  2Z1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...