3QFNA

Crystal structure of streptococcal asymmetric ap4a hydrolase and phosphodiesterase spr1479/saph in complex with inorganic phosphate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
249
structure length
249
Chain Sequence
MTKIALLSDIHGNTTALEAVLADARQLGVDEYWLLGDILMPGTGRRRILDLLDQLPITARVLGNWEDSLWHGVRKELDSTRPSQRYLLRQCQYVLEEISLEEIEVLHNQPLQIHRQFGDLTVGISHHLPDKNWGRELIHTGKQEEFDRLVTHPPCDIAVYGHIHQQLLRYGTGGQLIVNPGSIGQPFFLDAQLRKDLRAQYMILEFDDKGLVDMDFRRVDYDVAAELQLAKDLRLPYFEVYYESLVNGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and enzymatic characterization of a Streptococcal ATP/diadenosine polyphosphate and phosphodiester hydrolase Spr1479/SapH
rcsb
molecule keywords Putative uncharacterized protein
molecule tags Hydrolase
source organism Streptococcus pneumoniae
total genus 88
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12850 Metallophos_2 Calcineurin-like phosphoesterase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3qfnA00
2BDXA 4HD0A 4V0VA 3QFOA 4DSYA 2BQ8X 1S3NA 4NZVA 3H69A 3H67A 3DSCA 1OIDA 3QFMA 3QG5C 2O8GA 3FGAC 3H66A 1V73A 4Q7FA 3RL5A 4UT3B 3V4YA 5B8IA 3IB7A 5INBA 3TGHA 2USHA 4O24A 1S3LA 3THNA 2QFPA 3K7WC 4B2OA 2Z72A 2WDCA 5DNYA 1QHWA 4LACC 4TUIA 5C1VA 2YVTA 4FBQA 5IOHA 1HPUA 1II7A 1OIEA 5F3WA 2QJCA 2HYOA 1SU1A 2IAEC 1G5BA 1NNWA 4H1SA 3IVEA 4DT2A 3IVDA 2NXFA 1TCOA 2IE3C 1HO5A 1T71A 1Z2XA 5EQVA 2WDFA 4F0ZA 4O4KA 3N5UA 4XPNA 1S70A 3ZTVA 4JA9A 4IL1A 3EGHA 4V0XA 5GTUA 3H68A 1S95A 2R17A 4UWQA 4ZX2A 4V0WA 3THOB 1MF8A 3AUZA 4H2GA 3ZU0A 1USHA 1Z2WA 1HP1A 2NPPC 3H60A 4DHLA 2JOGA 2A22A 1AUIA 1IT6A 2HY1A 2KKNA 4H1YP 3E7BA 5JPEA 1JK7A 1QFCA 3E7AA 3QFNA 5HPEA 4LU9A 4ORBA 3CK2A 4O43A 1XZWA 3H63A 2BCDA 4I5NC 4TUGA 3DSDA 1FJMA 1OI8A 3H62B 1M63A 2GJUA 1S3MA 3P71C 2Q8UA 2NYLC 4G9JA 4MP0A 3EGGA 4H2FA 4J6OA 4KBPA 2ZBMA 2AHDA 3RL3A 1S8EA 2NYMC 3KBPA 4WWLA 4JA7A 4ORAA 4UT3A 1XM7A 5JJTA 4LTYA 2DFJA 1T70A 1U32A 2QFRA 2XMOA 1WAO1 4UT2A 3JYFA 3ICFA 4FBKA 3RL4A 3IB8A 3K7VC 3AV0A 2Z06A 4I5LC 3QFKA 4M0VA 2WDEA 3HVQA 4KKZA 3H64A 4ZVZA 1UTEA 4ORCA 4H2BA 2CV9A 2IE4C 3C5WC 4OR9A 2Z1AA 3RQZA 3C9FA 1UF3A 2HYPA 4MOVA 4FCXA 3DW8C 5JPFA 3PSOA 1KBPA 3T1IA 4FBWA 2P6BA 4MOYA 1WARA 4YKEA 2O8AA 1W24A 3LL8A 4H2IA 3H61A 4IYPC 2WDDA 4O5GA 3PSNA 5J28A 3GVEA
chains in the Genus database with same CATH superfamily
2BDXA 4HD0A 4V0VA 3QFOA 4DSYA 2BQ8X 1S3NA 4NZVA 3H69A 3H67A 3DSCA 1OIDA 3QFMA 3QG5C 2O8GA 3FGAC 3H66A 1V73A 4Q7FA 3RL5A 4UT3B 3V4YA 3PSNA 3IB7A 5B8IA 3TGHA 5INBA 2USHA 4O24A 1S3LA 3THNA 2QFPA 3K7WC 4B2OA 2Z72A 2WDCA 5DNYA 1QHWA 4LACC 4TUIA 5C1VA 2YVTA 4FBQA 5IOHA 1HPUA 1II7A 1OIEA 5F3WA 2QJCA 2HYOA 1SU1A 2IAEC 1G5BA 1NNWA 4H1SA 3IVEA 4DT2A 3IVDA 2NXFA 1TCOA 2IE3C 1HO5A 1T71A 1Z2XA 5EQVA 2WDFA 4F0ZA 4O4KA 3N5UA 4XPNA 1S70A 3ZTVA 4JA9A 4IL1A 3EGHA 4V0XA 2DXLA 5GTUA 3H68A 1S95A 2R17A 4UWQA 4ZX2A 4V0WA 3THOB 1MF8A 3AUZA 4H2GA 3ZU0A 1USHA 1Z2WA 1HP1A 2NPPC 3H60A 4DHLA 2JOGA 2A22A 1AUIA 1IT6A 2HY1A 2KKNA 2ZOAA 4H1YP 3E7BA 5JPEA 1JK7A 1QFCA 3E7AA 3QFNA 5HPEA 4LU9A 4ORBA 3CK2A 4O43A 1XZWA 3H63A 2BCDA 4I5NC 4TUGA 3DSDA 1FJMA 1OI8A 3E0JA 1M63A 3H62B 2GJUA 1S3MA 3P71C 2Q8UA 2NYLC 4G9JA 4MP0A 3EGGA 4H2FA 4J6OA 4KBPA 2ZBMA 2AHDA 3RL3A 1S8EA 2NYMC 3KBPA 4WWLA 4JA7A 4ORAA 4UT3A 1XM7A 5JJTA 4LTYA 2DFJA 1T70A 1U32A 2QFRA 2XMOA 1WAO1 4UT2A 3JYFA 2DXNA 3ICFA 4FBKA 2YEQA 3IB8A 3RL4A 3K7VC 3AV0A 2Z06A 3D03A 4I5LC 3QFKA 4M0VA 2WDEA 3HVQA 4KKZA 3H64A 4ZVZA 1UTEA 4ORCA 4H2BA 2CV9A 2IE4C 3C5WC 4OR9A 2Z1AA 3RQZA 3C9FA 1UF3A 2HYPA 4MOVA 4FCXA 3DW8C 5JPFA 3PSOA 1KBPA 3T1IA 4FBWA 2P6BA 4MOYA 1WARA 4YKEA 2O8AA 1W24A 3LL8A 4H2IA 3H61A 4IYPC 2ZO9B 2WDDA 4O5GA 3FLOA 5J28A 3GVEA
chains in the Genus database with same CATH topology
2BDXA 4HD0A 4V0VA 3QFOA 4DSYA 2BQ8X 1S3NA 4NZVA 3H69A 3H67A 3DSCA 1OIDA 3QFMA 3QG5C 2O8GA 3FGAC 3H66A 1V73A 4Q7FA 3RL5A 4UT3B 3V4YA 3PSNA 3IB7A 5B8IA 3TGHA 5INBA 2USHA 4O24A 1S3LA 3THNA 2QFPA 3K7WC 4B2OA 2Z72A 2WDCA 5DNYA 1QHWA 4LACC 4TUIA 5C1VA 2YVTA 4FBQA 5IOHA 1HPUA 1II7A 1OIEA 5F3WA 2QJCA 2HYOA 1SU1A 2IAEC 1G5BA 1NNWA 4H1SA 3IVEA 4DT2A 3IVDA 2NXFA 1TCOA 2IE3C 1HO5A 1T71A 1Z2XA 5EQVA 2WDFA 4F0ZA 4O4KA 3N5UA 4XPNA 1S70A 3ZTVA 4JA9A 4IL1A 3EGHA 4V0XA 2DXLA 5GTUA 3H68A 1S95A 2R17A 4UWQA 4ZX2A 4V0WA 3THOB 1MF8A 3AUZA 4H2GA 3ZU0A 1USHA 1Z2WA 1HP1A 2NPPC 3H60A 4DHLA 2JOGA 2A22A 1AUIA 1IT6A 2HY1A 2KKNA 2ZOAA 4H1YP 3E7BA 5JPEA 1JK7A 1QFCA 3E7AA 3QFNA 5HPEA 4LU9A 4ORBA 3CK2A 4O43A 1XZWA 3H63A 2BCDA 4I5NC 4TUGA 3DSDA 1FJMA 1OI8A 3E0JA 1M63A 3H62B 2GJUA 1S3MA 3P71C 2Q8UA 2NYLC 4G9JA 4MP0A 3EGGA 4H2FA 4J6OA 4KBPA 2ZBMA 2AHDA 3RL3A 1S8EA 2NYMC 3KBPA 4WWLA 4JA7A 4ORAA 4UT3A 1XM7A 5JJTA 4LTYA 2DFJA 1T70A 1U32A 2QFRA 2XMOA 1WAO1 4UT2A 3JYFA 2DXNA 3ICFA 4FBKA 2YEQA 3IB8A 3RL4A 3K7VC 3AV0A 2Z06A 3D03A 4I5LC 3QFKA 4M0VA 2WDEA 3HVQA 4KKZA 3H64A 4ZVZA 1UTEA 4ORCA 4H2BA 2CV9A 2IE4C 3C5WC 4OR9A 2Z1AA 3RQZA 3C9FA 1UF3A 2HYPA 4MOVA 4FCXA 3DW8C 5JPFA 3PSOA 1KBPA 3T1IA 4FBWA 2P6BA 4MOYA 1WARA 4YKEA 2O8AA 1W24A 3LL8A 4H2IA 3H61A 4IYPC 2ZO9B 2WDDA 4O5GA 3FLOA 5J28A 3GVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BDX A;  4HD0 A;  4V0V A;  3QFO A;  4DSY A;  2BQ8 X;  1S3N A;  4NZV A;  3H69 A;  3H67 A;  3DSC A;  1OID A;  3QFM A;  3QG5 C;  2O8G A;  3FGA C;  3H66 A;  1V73 A;  4Q7F A;  3RL5 A;  4UT3 B;  3V4Y A;  5B8I A;  3IB7 A;  5INB A;  3TGH A;  2USH A;  4O24 A;  1S3L A;  3THN A;  2QFP A;  3K7W C;  4B2O A;  2Z72 A;  2WDC A;  5DNY A;  1QHW A;  4LAC C;  4TUI A;  5C1V A;  2YVT A;  4FBQ A;  5IOH A;  1HPU A;  1II7 A;  1OIE A;  5F3W A;  2QJC A;  2HYO A;  1SU1 A;  2IAE C;  1G5B A;  1NNW A;  4H1S A;  3IVE A;  4DT2 A;  3IVD A;  2NXF A;  1TCO A;  2IE3 C;  1HO5 A;  1T71 A;  1Z2X A;  5EQV A;  2WDF A;  4F0Z A;  4O4K A;  3N5U A;  4XPN A;  1S70 A;  3ZTV A;  4JA9 A;  4IL1 A;  3EGH A;  4V0X A;  5GTU A;  3H68 A;  1S95 A;  2R17 A;  4UWQ A;  4ZX2 A;  4V0W A;  3THO B;  1MF8 A;  3AUZ A;  4H2G A;  3ZU0 A;  1USH A;  1Z2W A;  1HP1 A;  2NPP C;  3H60 A;  4DHL A;  2JOG A;  2A22 A;  1AUI A;  1IT6 A;  2HY1 A;  2KKN A;  4H1Y P;  3E7B A;  5JPE A;  1JK7 A;  1QFC A;  3E7A A;  3QFN A;  5HPE A;  4LU9 A;  4ORB A;  3CK2 A;  4O43 A;  1XZW A;  3H63 A;  2BCD A;  4I5N C;  4TUG A;  3DSD A;  1FJM A;  1OI8 A;  3H62 B;  1M63 A;  2GJU A;  1S3M A;  3P71 C;  2Q8U A;  2NYL C;  4G9J A;  4MP0 A;  3EGG A;  4H2F A;  4J6O A;  4KBP A;  2ZBM A;  2AHD A;  3RL3 A;  1S8E A;  2NYM C;  3KBP A;  4WWL A;  4JA7 A;  4ORA A;  4UT3 A;  1XM7 A;  5JJT A;  4LTY A;  2DFJ A;  1T70 A;  1U32 A;  2QFR A;  2XMO A;  1WAO 1;  4UT2 A;  3JYF A;  3ICF A;  4FBK A;  3RL4 A;  3IB8 A;  3K7V C;  3AV0 A;  2Z06 A;  4I5L C;  3QFK A;  4M0V A;  2WDE A;  3HVQ A;  4KKZ A;  3H64 A;  4ZVZ A;  1UTE A;  4ORC A;  4H2B A;  2CV9 A;  2IE4 C;  3C5W C;  4OR9 A;  2Z1A A;  3RQZ A;  3C9F A;  1UF3 A;  2HYP A;  4MOV A;  4FCX A;  3DW8 C;  5JPF A;  3PSO A;  1KBP A;  3T1I A;  4FBW A;  2P6B A;  4MOY A;  1WAR A;  4YKE A;  2O8A A;  1W24 A;  3LL8 A;  4H2I A;  3H61 A;  4IYP C;  2WDD A;  4O5G A;  3PSN A;  5J28 A;  3GVE A; 
#chains in the Genus database with same CATH topology
 2BDX A;  4HD0 A;  4V0V A;  3QFO A;  4DSY A;  2BQ8 X;  1S3N A;  4NZV A;  3H69 A;  3H67 A;  3DSC A;  1OID A;  3QFM A;  3QG5 C;  2O8G A;  3FGA C;  3H66 A;  1V73 A;  4Q7F A;  3RL5 A;  4UT3 B;  3V4Y A;  3PSN A;  3IB7 A;  5B8I A;  3TGH A;  5INB A;  2USH A;  4O24 A;  1S3L A;  3THN A;  2QFP A;  3K7W C;  4B2O A;  2Z72 A;  2WDC A;  5DNY A;  1QHW A;  4LAC C;  4TUI A;  5C1V A;  2YVT A;  4FBQ A;  5IOH A;  1HPU A;  1II7 A;  1OIE A;  5F3W A;  2QJC A;  2HYO A;  1SU1 A;  2IAE C;  1G5B A;  1NNW A;  4H1S A;  3IVE A;  4DT2 A;  3IVD A;  2NXF A;  1TCO A;  2IE3 C;  1HO5 A;  1T71 A;  1Z2X A;  5EQV A;  2WDF A;  4F0Z A;  4O4K A;  3N5U A;  4XPN A;  1S70 A;  3ZTV A;  4JA9 A;  4IL1 A;  3EGH A;  4V0X A;  2DXL A;  5GTU A;  3H68 A;  1S95 A;  2R17 A;  4UWQ A;  4ZX2 A;  4V0W A;  3THO B;  1MF8 A;  3AUZ A;  4H2G A;  3ZU0 A;  1USH A;  1Z2W A;  1HP1 A;  2NPP C;  3H60 A;  4DHL A;  2JOG A;  2A22 A;  1AUI A;  1IT6 A;  2HY1 A;  2KKN A;  2ZOA A;  4H1Y P;  3E7B A;  5JPE A;  1JK7 A;  1QFC A;  3E7A A;  3QFN A;  5HPE A;  4LU9 A;  4ORB A;  3CK2 A;  4O43 A;  1XZW A;  3H63 A;  2BCD A;  4I5N C;  4TUG A;  3DSD A;  1FJM A;  1OI8 A;  3E0J A;  1M63 A;  3H62 B;  2GJU A;  1S3M A;  3P71 C;  2Q8U A;  2NYL C;  4G9J A;  4MP0 A;  3EGG A;  4H2F A;  4J6O A;  4KBP A;  2ZBM A;  2AHD A;  3RL3 A;  1S8E A;  2NYM C;  3KBP A;  4WWL A;  4JA7 A;  4ORA A;  4UT3 A;  1XM7 A;  5JJT A;  4LTY A;  2DFJ A;  1T70 A;  1U32 A;  2QFR A;  2XMO A;  1WAO 1;  4UT2 A;  3JYF A;  2DXN A;  3ICF A;  4FBK A;  2YEQ A;  3IB8 A;  3RL4 A;  3K7V C;  3AV0 A;  2Z06 A;  3D03 A;  4I5L C;  3QFK A;  4M0V A;  2WDE A;  3HVQ A;  4KKZ A;  3H64 A;  4ZVZ A;  1UTE A;  4ORC A;  4H2B A;  2CV9 A;  2IE4 C;  3C5W C;  4OR9 A;  2Z1A A;  3RQZ A;  3C9F A;  1UF3 A;  2HYP A;  4MOV A;  4FCX A;  3DW8 C;  5JPF A;  3PSO A;  1KBP A;  3T1I A;  4FBW A;  2P6B A;  4MOY A;  1WAR A;  4YKE A;  2O8A A;  1W24 A;  3LL8 A;  4H2I A;  3H61 A;  4IYP C;  2ZO9 B;  2WDD A;  4O5G A;  3FLO A;  5J28 A;  3GVE A; 
#chains in the Genus database with same CATH homology
 2BDX A;  4HD0 A;  4V0V A;  3QFO A;  4DSY A;  2BQ8 X;  1S3N A;  4NZV A;  3H69 A;  3H67 A;  3DSC A;  1OID A;  3QFM A;  3QG5 C;  2O8G A;  3FGA C;  3H66 A;  1V73 A;  4Q7F A;  3RL5 A;  4UT3 B;  3V4Y A;  3PSN A;  3IB7 A;  5B8I A;  3TGH A;  5INB A;  2USH A;  4O24 A;  1S3L A;  3THN A;  2QFP A;  3K7W C;  4B2O A;  2Z72 A;  2WDC A;  5DNY A;  1QHW A;  4LAC C;  4TUI A;  5C1V A;  2YVT A;  4FBQ A;  5IOH A;  1HPU A;  1II7 A;  1OIE A;  5F3W A;  2QJC A;  2HYO A;  1SU1 A;  2IAE C;  1G5B A;  1NNW A;  4H1S A;  3IVE A;  4DT2 A;  3IVD A;  2NXF A;  1TCO A;  2IE3 C;  1HO5 A;  1T71 A;  1Z2X A;  5EQV A;  2WDF A;  4F0Z A;  4O4K A;  3N5U A;  4XPN A;  1S70 A;  3ZTV A;  4JA9 A;  4IL1 A;  3EGH A;  4V0X A;  2DXL A;  5GTU A;  3H68 A;  1S95 A;  2R17 A;  4UWQ A;  4ZX2 A;  4V0W A;  3THO B;  1MF8 A;  3AUZ A;  4H2G A;  3ZU0 A;  1USH A;  1Z2W A;  1HP1 A;  2NPP C;  3H60 A;  4DHL A;  2JOG A;  2A22 A;  1AUI A;  1IT6 A;  2HY1 A;  2KKN A;  2ZOA A;  4H1Y P;  3E7B A;  5JPE A;  1JK7 A;  1QFC A;  3E7A A;  3QFN A;  5HPE A;  4LU9 A;  4ORB A;  3CK2 A;  4O43 A;  1XZW A;  3H63 A;  2BCD A;  4I5N C;  4TUG A;  3DSD A;  1FJM A;  1OI8 A;  3E0J A;  1M63 A;  3H62 B;  2GJU A;  1S3M A;  3P71 C;  2Q8U A;  2NYL C;  4G9J A;  4MP0 A;  3EGG A;  4H2F A;  4J6O A;  4KBP A;  2ZBM A;  2AHD A;  3RL3 A;  1S8E A;  2NYM C;  3KBP A;  4WWL A;  4JA7 A;  4ORA A;  4UT3 A;  1XM7 A;  5JJT A;  4LTY A;  2DFJ A;  1T70 A;  1U32 A;  2QFR A;  2XMO A;  1WAO 1;  4UT2 A;  3JYF A;  2DXN A;  3ICF A;  4FBK A;  2YEQ A;  3IB8 A;  3RL4 A;  3K7V C;  3AV0 A;  2Z06 A;  3D03 A;  4I5L C;  3QFK A;  4M0V A;  2WDE A;  3HVQ A;  4KKZ A;  3H64 A;  4ZVZ A;  1UTE A;  4ORC A;  4H2B A;  2CV9 A;  2IE4 C;  3C5W C;  4OR9 A;  2Z1A A;  3RQZ A;  3C9F A;  1UF3 A;  2HYP A;  4MOV A;  4FCX A;  3DW8 C;  5JPF A;  3PSO A;  1KBP A;  3T1I A;  4FBW A;  2P6B A;  4MOY A;  1WAR A;  4YKE A;  2O8A A;  1W24 A;  3LL8 A;  4H2I A;  3H61 A;  4IYP C;  2ZO9 B;  2WDD A;  4O5G A;  3FLO A;  5J28 A;  3GVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...