3QFOA

Crystal structure of streptococcal asymmetric ap4a hydrolase and phosphodiesterase spr1479/saph im complex with amp
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
250
structure length
250
Chain Sequence
MTKIALLSDIHGNTTALEAVLADARQLGVDEYWLLGDILMPGTGRRRILDLLDQLPITARVLGNWEDSLWHGVRKELDSTRPSQRYLLRQCQYVLEEISLEEIEVLHNQPLQIHRQFGDLTVGISHHLPDKNWGRELIHTGKQEEFDRLVTHPPCDIAVYGHIHQQLLRYGTGGQLIVNPGSIGQPFFLDAQLRKDLRAQYMILEFDDKGLVDMDFRRVDYDVAAELQLAKDLRLPYFEVYYESLVNGIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and enzymatic characterization of a Streptococcal ATP/diadenosine polyphosphate and phosphodiester hydrolase Spr1479/SapH
rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords Putative uncharacterized protein
total genus 91
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12850 Metallophos_2 Calcineurin-like phosphoesterase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3qfoA00
1OI8A 1AUIA 2USHA 4LU9A 1HPUA 2HY1A 3AV0A 4FBWA 4H2GA 4IYPC 4UWQA 4WWLA 3QG5C 2NPPC 4V0XA 2QFRA 4MP0A 4V0WA 4H2BA 1V73A 1UF3A 1T70A 4UT3A 2Z72A 4ORAA 4DT2A 2HYPA 3PSNA 4OR9A 3H64A 5HPEA 4UT3B 2ZBMA 3H61A 3K7VC 2WDFA 3P71C 2BQ8X 3E7AA 1S3MA 3N5UA 4ORCA 5B8IA 3HVQA 4I5LC 1S95A 3IB8A 4NZVA 1WAO1 1XZWA 1HO5A 4JA9A 3IB7A 1S3LA 4H1SA 5C1VA 4J6OA 2NYMC 4MOYA 1NNWA 5JJTA 3QFNA 1OIEA 3ZTVA 1QFCA 4FBQA 4HD0A 4YKEA 1G5BA 3K7WC 4H2IA 1FJMA 1UTEA 2NXFA 4V0VA 2Q8UA 2IAEC 1U32A 5J28A 4TUIA 2A22A 3QFOA 4H1YP 1Z2WA 3IVDA 2JOGA 2BCDA 5GTUA 3DSDA 4UT2A 4DSYA 3V4YA 2XMOA 2R17A 3T1IA 3DW8C 1JK7A 4MOVA 1W24A 2O8GA 1OIDA 4FBKA 4TUGA 1XM7A 3THNA 4ZVZA 2QFPA 3H67A 3ZU0A 2Z1AA 1HP1A 4O43A 2IE3C 2YVTA 3CK2A 2HYOA 3DSCA 3JYFA 1S3NA 4G9JA 1TCOA 3EGHA 3PSOA 3RL3A 5JPEA 4XPNA 5IOHA 1IT6A 4LACC 4M0VA 1QHWA 3THOB 5DNYA 3ICFA 3H60A 2GJUA 3LL8A 3AUZA 3EGGA 2O8AA 3C9FA 3GVEA 2WDEA 2BDXA 3H66A 4O24A 2CV9A 4FCXA 3RQZA 1II7A 1WARA 4LTYA 2WDDA 3H63A 2P6BA 4JA7A 4F0ZA 3FGAC 3H62B 4O5GA 3TGHA 2NYLC 1S70A 3QFMA 2IE4C 3H69A 5F3WA 4I5NC 1Z2XA 4IL1A 4O4KA 4ZX2A 5JPFA 1S8EA 1KBPA 4H2FA 2QJCA 4KBPA 2Z06A 3RL4A 3E7BA 1MF8A 2WDCA 1M63A 4Q7FA 5EQVA 4ORBA 3KBPA 2KKNA 3H68A 5INBA 1SU1A 1USHA 4KKZA 4B2OA 1T71A 4DHLA 3QFKA 2AHDA 3RL5A 3C5WC 2DFJA 3IVEA
chains in the Genus database with same CATH superfamily
1OI8A 1AUIA 2USHA 4LU9A 1HPUA 2HY1A 3AV0A 4FBWA 4H2GA 4IYPC 4UWQA 4WWLA 3QG5C 2NPPC 4V0XA 2QFRA 4MP0A 4V0WA 4H2BA 1V73A 1UF3A 1T70A 4UT3A 2YEQA 2Z72A 4ORAA 4DT2A 2HYPA 3PSNA 4OR9A 3H64A 5HPEA 4UT3B 2ZBMA 3H61A 3K7VC 2WDFA 3P71C 2BQ8X 3E7AA 1S3MA 3N5UA 4ORCA 5B8IA 3HVQA 4I5LC 1S95A 2DXLA 3IB8A 2ZO9B 4NZVA 1WAO1 1XZWA 1HO5A 4JA9A 3IB7A 1S3LA 4H1SA 5C1VA 4J6OA 2NYMC 4MOYA 1NNWA 5JJTA 3QFNA 1OIEA 3ZTVA 1QFCA 4FBQA 4HD0A 4YKEA 1G5BA 3K7WC 4H2IA 1FJMA 1UTEA 2NXFA 4V0VA 2Q8UA 2IAEC 1U32A 5J28A 4TUIA 2A22A 3QFOA 4H1YP 1Z2WA 3IVDA 2JOGA 2BCDA 5GTUA 3DSDA 4UT2A 4DSYA 3V4YA 2XMOA 2R17A 3T1IA 1JK7A 3DW8C 4MOVA 1W24A 2O8GA 1OIDA 3D03A 4FBKA 4TUGA 1XM7A 3THNA 4ZVZA 2QFPA 3H67A 3ZU0A 2Z1AA 2ZOAA 1HP1A 4O43A 2IE3C 2YVTA 3CK2A 2HYOA 3DSCA 3JYFA 1S3NA 4G9JA 1TCOA 3EGHA 3PSOA 3RL3A 5JPEA 4XPNA 5IOHA 1IT6A 4LACC 4M0VA 1QHWA 3THOB 5DNYA 3ICFA 3H60A 2GJUA 3LL8A 3AUZA 3EGGA 2O8AA 3C9FA 3GVEA 2WDEA 2BDXA 3H66A 4O24A 2CV9A 4FCXA 3RQZA 1II7A 1WARA 2DXNA 3FLOA 4LTYA 2WDDA 3H63A 2P6BA 4JA7A 4F0ZA 3FGAC 3H62B 4O5GA 3TGHA 2NYLC 1S70A 3QFMA 2IE4C 3H69A 5F3WA 4I5NC 1Z2XA 4IL1A 3E0JA 4O4KA 4ZX2A 5JPFA 1S8EA 1KBPA 4H2FA 2QJCA 4KBPA 2Z06A 3RL4A 3E7BA 1MF8A 2WDCA 1M63A 4Q7FA 5EQVA 4ORBA 3KBPA 2KKNA 3H68A 5INBA 1SU1A 1USHA 4KKZA 4B2OA 1T71A 4DHLA 3QFKA 2AHDA 3RL5A 3C5WC 2DFJA 3IVEA
chains in the Genus database with same CATH topology
1OI8A 1AUIA 2USHA 4LU9A 1HPUA 2HY1A 3AV0A 4FBWA 4H2GA 4IYPC 4UWQA 4WWLA 3QG5C 2NPPC 4V0XA 2QFRA 4MP0A 4V0WA 4H2BA 1V73A 1UF3A 1T70A 4UT3A 2YEQA 2Z72A 4ORAA 4DT2A 2HYPA 3PSNA 4OR9A 3H64A 5HPEA 4UT3B 2ZBMA 3H61A 3K7VC 2WDFA 3P71C 2BQ8X 3E7AA 1S3MA 3N5UA 4ORCA 5B8IA 3HVQA 4I5LC 1S95A 2DXLA 3IB8A 2ZO9B 4NZVA 1WAO1 1XZWA 1HO5A 4JA9A 3IB7A 1S3LA 4H1SA 5C1VA 4J6OA 2NYMC 4MOYA 1NNWA 5JJTA 3QFNA 1OIEA 3ZTVA 1QFCA 4FBQA 4HD0A 4YKEA 1G5BA 3K7WC 4H2IA 1FJMA 1UTEA 2NXFA 4V0VA 2Q8UA 2IAEC 1U32A 5J28A 4TUIA 2A22A 3QFOA 4H1YP 1Z2WA 3IVDA 2JOGA 2BCDA 5GTUA 3DSDA 4UT2A 4DSYA 3V4YA 2XMOA 2R17A 3T1IA 1JK7A 3DW8C 4MOVA 1W24A 2O8GA 1OIDA 3D03A 4FBKA 4TUGA 1XM7A 3THNA 4ZVZA 2QFPA 3H67A 3ZU0A 2Z1AA 2ZOAA 1HP1A 4O43A 2IE3C 2YVTA 3CK2A 2HYOA 3DSCA 3JYFA 1S3NA 4G9JA 1TCOA 3EGHA 3PSOA 3RL3A 5JPEA 4XPNA 5IOHA 1IT6A 4LACC 4M0VA 1QHWA 3THOB 5DNYA 3ICFA 3H60A 2GJUA 3LL8A 3AUZA 3EGGA 2O8AA 3C9FA 3GVEA 2WDEA 2BDXA 3H66A 4O24A 2CV9A 4FCXA 3RQZA 1II7A 1WARA 2DXNA 3FLOA 4LTYA 2WDDA 3H63A 2P6BA 4JA7A 4F0ZA 3FGAC 3H62B 4O5GA 3TGHA 2NYLC 1S70A 3QFMA 2IE4C 3H69A 5F3WA 4I5NC 1Z2XA 4IL1A 3E0JA 4O4KA 4ZX2A 5JPFA 1S8EA 1KBPA 4H2FA 2QJCA 4KBPA 2Z06A 3RL4A 3E7BA 1MF8A 2WDCA 1M63A 4Q7FA 5EQVA 4ORBA 3KBPA 2KKNA 3H68A 5INBA 1SU1A 1USHA 4KKZA 4B2OA 1T71A 4DHLA 3QFKA 2AHDA 3RL5A 3C5WC 2DFJA 3IVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OI8 A;  1AUI A;  2USH A;  4LU9 A;  1HPU A;  2HY1 A;  3AV0 A;  4FBW A;  4H2G A;  4IYP C;  4UWQ A;  4WWL A;  3QG5 C;  2NPP C;  4V0X A;  2QFR A;  4MP0 A;  4V0W A;  4H2B A;  1V73 A;  1UF3 A;  1T70 A;  4UT3 A;  2Z72 A;  4ORA A;  4DT2 A;  2HYP A;  3PSN A;  4OR9 A;  3H64 A;  5HPE A;  4UT3 B;  2ZBM A;  3H61 A;  3K7V C;  2WDF A;  3P71 C;  2BQ8 X;  3E7A A;  1S3M A;  3N5U A;  4ORC A;  5B8I A;  3HVQ A;  4I5L C;  1S95 A;  3IB8 A;  4NZV A;  1WAO 1;  1XZW A;  1HO5 A;  4JA9 A;  3IB7 A;  1S3L A;  4H1S A;  5C1V A;  4J6O A;  2NYM C;  4MOY A;  1NNW A;  5JJT A;  3QFN A;  1OIE A;  3ZTV A;  1QFC A;  4FBQ A;  4HD0 A;  4YKE A;  1G5B A;  3K7W C;  4H2I A;  1FJM A;  1UTE A;  2NXF A;  4V0V A;  2Q8U A;  2IAE C;  1U32 A;  5J28 A;  4TUI A;  2A22 A;  3QFO A;  4H1Y P;  1Z2W A;  3IVD A;  2JOG A;  2BCD A;  5GTU A;  3DSD A;  4UT2 A;  4DSY A;  3V4Y A;  2XMO A;  2R17 A;  3T1I A;  3DW8 C;  1JK7 A;  4MOV A;  1W24 A;  2O8G A;  1OID A;  4FBK A;  4TUG A;  1XM7 A;  3THN A;  4ZVZ A;  2QFP A;  3H67 A;  3ZU0 A;  2Z1A A;  1HP1 A;  4O43 A;  2IE3 C;  2YVT A;  3CK2 A;  2HYO A;  3DSC A;  3JYF A;  1S3N A;  4G9J A;  1TCO A;  3EGH A;  3PSO A;  3RL3 A;  5JPE A;  4XPN A;  5IOH A;  1IT6 A;  4LAC C;  4M0V A;  1QHW A;  3THO B;  5DNY A;  3ICF A;  3H60 A;  2GJU A;  3LL8 A;  3AUZ A;  3EGG A;  2O8A A;  3C9F A;  3GVE A;  2WDE A;  2BDX A;  3H66 A;  4O24 A;  2CV9 A;  4FCX A;  3RQZ A;  1II7 A;  1WAR A;  4LTY A;  2WDD A;  3H63 A;  2P6B A;  4JA7 A;  4F0Z A;  3FGA C;  3H62 B;  4O5G A;  3TGH A;  2NYL C;  1S70 A;  3QFM A;  2IE4 C;  3H69 A;  5F3W A;  4I5N C;  1Z2X A;  4IL1 A;  4O4K A;  4ZX2 A;  5JPF A;  1S8E A;  1KBP A;  4H2F A;  2QJC A;  4KBP A;  2Z06 A;  3RL4 A;  3E7B A;  1MF8 A;  2WDC A;  1M63 A;  4Q7F A;  5EQV A;  4ORB A;  3KBP A;  2KKN A;  3H68 A;  5INB A;  1SU1 A;  1USH A;  4KKZ A;  4B2O A;  1T71 A;  4DHL A;  3QFK A;  2AHD A;  3RL5 A;  3C5W C;  2DFJ A;  3IVE A; 
#chains in the Genus database with same CATH topology
 1OI8 A;  1AUI A;  2USH A;  4LU9 A;  1HPU A;  2HY1 A;  3AV0 A;  4FBW A;  4H2G A;  4IYP C;  4UWQ A;  4WWL A;  3QG5 C;  2NPP C;  4V0X A;  2QFR A;  4MP0 A;  4V0W A;  4H2B A;  1V73 A;  1UF3 A;  1T70 A;  4UT3 A;  2YEQ A;  2Z72 A;  4ORA A;  4DT2 A;  2HYP A;  3PSN A;  4OR9 A;  3H64 A;  5HPE A;  4UT3 B;  2ZBM A;  3H61 A;  3K7V C;  2WDF A;  3P71 C;  2BQ8 X;  3E7A A;  1S3M A;  3N5U A;  4ORC A;  5B8I A;  3HVQ A;  4I5L C;  1S95 A;  2DXL A;  3IB8 A;  2ZO9 B;  4NZV A;  1WAO 1;  1XZW A;  1HO5 A;  4JA9 A;  3IB7 A;  1S3L A;  4H1S A;  5C1V A;  4J6O A;  2NYM C;  4MOY A;  1NNW A;  5JJT A;  3QFN A;  1OIE A;  3ZTV A;  1QFC A;  4FBQ A;  4HD0 A;  4YKE A;  1G5B A;  3K7W C;  4H2I A;  1FJM A;  1UTE A;  2NXF A;  4V0V A;  2Q8U A;  2IAE C;  1U32 A;  5J28 A;  4TUI A;  2A22 A;  3QFO A;  4H1Y P;  1Z2W A;  3IVD A;  2JOG A;  2BCD A;  5GTU A;  3DSD A;  4UT2 A;  4DSY A;  3V4Y A;  2XMO A;  2R17 A;  3T1I A;  1JK7 A;  3DW8 C;  4MOV A;  1W24 A;  2O8G A;  1OID A;  3D03 A;  4FBK A;  4TUG A;  1XM7 A;  3THN A;  4ZVZ A;  2QFP A;  3H67 A;  3ZU0 A;  2Z1A A;  2ZOA A;  1HP1 A;  4O43 A;  2IE3 C;  2YVT A;  3CK2 A;  2HYO A;  3DSC A;  3JYF A;  1S3N A;  4G9J A;  1TCO A;  3EGH A;  3PSO A;  3RL3 A;  5JPE A;  4XPN A;  5IOH A;  1IT6 A;  4LAC C;  4M0V A;  1QHW A;  3THO B;  5DNY A;  3ICF A;  3H60 A;  2GJU A;  3LL8 A;  3AUZ A;  3EGG A;  2O8A A;  3C9F A;  3GVE A;  2WDE A;  2BDX A;  3H66 A;  4O24 A;  2CV9 A;  4FCX A;  3RQZ A;  1II7 A;  1WAR A;  2DXN A;  3FLO A;  4LTY A;  2WDD A;  3H63 A;  2P6B A;  4JA7 A;  4F0Z A;  3FGA C;  3H62 B;  4O5G A;  3TGH A;  2NYL C;  1S70 A;  3QFM A;  2IE4 C;  3H69 A;  5F3W A;  4I5N C;  1Z2X A;  4IL1 A;  3E0J A;  4O4K A;  4ZX2 A;  5JPF A;  1S8E A;  1KBP A;  4H2F A;  2QJC A;  4KBP A;  2Z06 A;  3RL4 A;  3E7B A;  1MF8 A;  2WDC A;  1M63 A;  4Q7F A;  5EQV A;  4ORB A;  3KBP A;  2KKN A;  3H68 A;  5INB A;  1SU1 A;  1USH A;  4KKZ A;  4B2O A;  1T71 A;  4DHL A;  3QFK A;  2AHD A;  3RL5 A;  3C5W C;  2DFJ A;  3IVE A; 
#chains in the Genus database with same CATH homology
 1OI8 A;  1AUI A;  2USH A;  4LU9 A;  1HPU A;  2HY1 A;  3AV0 A;  4FBW A;  4H2G A;  4IYP C;  4UWQ A;  4WWL A;  3QG5 C;  2NPP C;  4V0X A;  2QFR A;  4MP0 A;  4V0W A;  4H2B A;  1V73 A;  1UF3 A;  1T70 A;  4UT3 A;  2YEQ A;  2Z72 A;  4ORA A;  4DT2 A;  2HYP A;  3PSN A;  4OR9 A;  3H64 A;  5HPE A;  4UT3 B;  2ZBM A;  3H61 A;  3K7V C;  2WDF A;  3P71 C;  2BQ8 X;  3E7A A;  1S3M A;  3N5U A;  4ORC A;  5B8I A;  3HVQ A;  4I5L C;  1S95 A;  2DXL A;  3IB8 A;  2ZO9 B;  4NZV A;  1WAO 1;  1XZW A;  1HO5 A;  4JA9 A;  3IB7 A;  1S3L A;  4H1S A;  5C1V A;  4J6O A;  2NYM C;  4MOY A;  1NNW A;  5JJT A;  3QFN A;  1OIE A;  3ZTV A;  1QFC A;  4FBQ A;  4HD0 A;  4YKE A;  1G5B A;  3K7W C;  4H2I A;  1FJM A;  1UTE A;  2NXF A;  4V0V A;  2Q8U A;  2IAE C;  1U32 A;  5J28 A;  4TUI A;  2A22 A;  3QFO A;  4H1Y P;  1Z2W A;  3IVD A;  2JOG A;  2BCD A;  5GTU A;  3DSD A;  4UT2 A;  4DSY A;  3V4Y A;  2XMO A;  2R17 A;  3T1I A;  1JK7 A;  3DW8 C;  4MOV A;  1W24 A;  2O8G A;  1OID A;  3D03 A;  4FBK A;  4TUG A;  1XM7 A;  3THN A;  4ZVZ A;  2QFP A;  3H67 A;  3ZU0 A;  2Z1A A;  2ZOA A;  1HP1 A;  4O43 A;  2IE3 C;  2YVT A;  3CK2 A;  2HYO A;  3DSC A;  3JYF A;  1S3N A;  4G9J A;  1TCO A;  3EGH A;  3PSO A;  3RL3 A;  5JPE A;  4XPN A;  5IOH A;  1IT6 A;  4LAC C;  4M0V A;  1QHW A;  3THO B;  5DNY A;  3ICF A;  3H60 A;  2GJU A;  3LL8 A;  3AUZ A;  3EGG A;  2O8A A;  3C9F A;  3GVE A;  2WDE A;  2BDX A;  3H66 A;  4O24 A;  2CV9 A;  4FCX A;  3RQZ A;  1II7 A;  1WAR A;  2DXN A;  3FLO A;  4LTY A;  2WDD A;  3H63 A;  2P6B A;  4JA7 A;  4F0Z A;  3FGA C;  3H62 B;  4O5G A;  3TGH A;  2NYL C;  1S70 A;  3QFM A;  2IE4 C;  3H69 A;  5F3W A;  4I5N C;  1Z2X A;  4IL1 A;  3E0J A;  4O4K A;  4ZX2 A;  5JPF A;  1S8E A;  1KBP A;  4H2F A;  2QJC A;  4KBP A;  2Z06 A;  3RL4 A;  3E7B A;  1MF8 A;  2WDC A;  1M63 A;  4Q7F A;  5EQV A;  4ORB A;  3KBP A;  2KKN A;  3H68 A;  5INB A;  1SU1 A;  1USH A;  4KKZ A;  4B2O A;  1T71 A;  4DHL A;  3QFK A;  2AHD A;  3RL5 A;  3C5W C;  2DFJ A;  3IVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...