3QFOA

Crystal structure of streptococcal asymmetric ap4a hydrolase and phosphodiesterase spr1479/saph im complex with amp
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
250
structure length
250
Chain Sequence
MTKIALLSDIHGNTTALEAVLADARQLGVDEYWLLGDILMPGTGRRRILDLLDQLPITARVLGNWEDSLWHGVRKELDSTRPSQRYLLRQCQYVLEEISLEEIEVLHNQPLQIHRQFGDLTVGISHHLPDKNWGRELIHTGKQEEFDRLVTHPPCDIAVYGHIHQQLLRYGTGGQLIVNPGSIGQPFFLDAQLRKDLRAQYMILEFDDKGLVDMDFRRVDYDVAAELQLAKDLRLPYFEVYYESLVNGIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and enzymatic characterization of a Streptococcal ATP/diadenosine polyphosphate and phosphodiester hydrolase Spr1479/SapH
rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords Putative uncharacterized protein
total genus 91
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12850 Metallophos_2 Calcineurin-like phosphoesterase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3qfoA00
1S8EA 3JYFA 5EQVA 1HO5A 3QFOA 2WDEA 4B2OA 1G5BA 3PSNA 2O8AA 3HVQA 1T70A 3V4YA 2XMOA 5C1VA 3E7BA 4IYPC 4H2BA 1W24A 3H67A 4NZVA 1QHWA 4ORBA 4TUIA 3RL3A 3C5WC 3GVEA 2Q8UA 4LACC 2KKNA 1KBPA 3H64A 4KBPA 4DSYA 2QFPA 3E7AA 2BQ8X 2HY1A 4FBWA 4M0VA 4MOYA 3PSOA 3N5UA 3TGHA 2QJCA 5IOHA 5DNYA 2QFRA 2CV9A 4ORAA 3K7WC 1MF8A 3IB7A 3KBPA 4MOVA 3ZU0A 3QFNA 4H2IA 3DW8C 5J28A 3H62B 4FBKA 3K7VC 2NXFA 4WWLA 3FGAC 3ICFA 4JA9A 1WAO1 2ZBMA 4F0ZA 4UT3A 1OIDA 2Z72A 1UTEA 2Z06A 4HD0A 4OR9A 4KKZA 2Z1AA 4TUGA 1M63A 2GJUA 2HYOA 1T71A 1S70A 2O8GA 3IVEA 2R17A 3H61A 4ORCA 3H66A 2NYMC 3AUZA 4O5GA 4H2GA 3THNA 3QFMA 1U32A 4XPNA 4FBQA 4V0WA 4IL1A 3DSDA 4ZX2A 5JJTA 1OI8A 4MP0A 3ZTVA 5F3WA 2WDDA 2IE4C 3IB8A 3T1IA 1HP1A 4O4KA 4UT2A 5HPEA 2USHA 1Z2XA 1IT6A 3H63A 3DSCA 4ZVZA 1TCOA 3QG5C 4UT3B 3CK2A 3LL8A 4G9JA 4UWQA 4O43A 1OIEA 4Q7FA 5INBA 1QFCA 3P71C 2P6BA 5JPEA 3H60A 1JK7A 2NYLC 4I5LC 4DHLA 1AUIA 3H68A 3AV0A 1USHA 2IE3C 4H1YP 2YVTA 3RL4A 1HPUA 1SU1A 3C9FA 4JA7A 2JOGA 2BDXA 2A22A 1S3LA 2HYPA 5JPFA 1Z2WA 2WDCA 4LU9A 3THOB 4DT2A 4H2FA 1V73A 4V0VA 2AHDA 1NNWA 4LTYA 3EGGA 1UF3A 2WDFA 2DFJA 2IAEC 3EGHA 4J6OA 2NPPC 3IVDA 3H69A 1WARA 3QFKA 1FJMA 1S3MA 1XM7A 2BCDA 4V0XA 1II7A 1S3NA 3RQZA 1XZWA 4YKEA 4FCXA 4O24A 4I5NC 3RL5A 5GTUA 5B8IA 1S95A 4H1SA
chains in the Genus database with same CATH superfamily
1S8EA 3JYFA 5EQVA 1HO5A 3QFOA 2WDEA 4B2OA 1G5BA 3PSNA 2O8AA 3HVQA 1T70A 3V4YA 2XMOA 5C1VA 2DXLA 3E7BA 4IYPC 4H2BA 1W24A 3H67A 4NZVA 1QHWA 4ORBA 4TUIA 3RL3A 3C5WC 3GVEA 2Q8UA 4LACC 2KKNA 1KBPA 3H64A 4KBPA 4DSYA 2QFPA 3E7AA 2BQ8X 2HY1A 4FBWA 4M0VA 4MOYA 3PSOA 3N5UA 3TGHA 2DXNA 2QJCA 5IOHA 5DNYA 2QFRA 2CV9A 4ORAA 3K7WC 1MF8A 3IB7A 3KBPA 4MOVA 3ZU0A 3QFNA 4H2IA 3DW8C 3FLOA 5J28A 3H62B 4FBKA 3K7VC 2NXFA 4WWLA 3FGAC 3ICFA 4JA9A 1WAO1 2ZBMA 4F0ZA 4UT3A 1OIDA 2Z72A 1UTEA 2Z06A 4HD0A 4OR9A 4KKZA 2Z1AA 4TUGA 1M63A 2GJUA 2HYOA 1T71A 1S70A 2O8GA 3IVEA 2R17A 3H61A 4ORCA 3H66A 2NYMC 3AUZA 4O5GA 4H2GA 3THNA 3QFMA 1U32A 4XPNA 4FBQA 4V0WA 4IL1A 3DSDA 4ZX2A 5JJTA 1OI8A 4MP0A 3ZTVA 3D03A 5F3WA 2WDDA 2IE4C 3IB8A 3T1IA 1HP1A 4O4KA 4UT2A 5HPEA 2USHA 1Z2XA 1IT6A 3H63A 3DSCA 4ZVZA 1TCOA 3QG5C 4UT3B 3CK2A 3LL8A 4G9JA 4UWQA 4O43A 1OIEA 4Q7FA 5INBA 1QFCA 3P71C 2P6BA 5JPEA 3H60A 1JK7A 2NYLC 4I5LC 2YEQA 4DHLA 1AUIA 3H68A 3AV0A 1USHA 2IE3C 2ZO9B 2YVTA 4H1YP 3RL4A 1HPUA 1SU1A 3E0JA 3C9FA 4JA7A 2JOGA 2BDXA 2A22A 1S3LA 2HYPA 5JPFA 1Z2WA 2WDCA 4LU9A 3THOB 4DT2A 4H2FA 1V73A 4V0VA 2AHDA 1NNWA 4LTYA 3EGGA 1UF3A 2WDFA 2DFJA 2IAEC 3EGHA 4J6OA 2NPPC 3IVDA 3H69A 1WARA 3QFKA 2ZOAA 1FJMA 1S3MA 1XM7A 2BCDA 4V0XA 1II7A 1S3NA 3RQZA 1XZWA 4YKEA 4FCXA 4O24A 4I5NC 3RL5A 5GTUA 5B8IA 1S95A 4H1SA
chains in the Genus database with same CATH topology
1S8EA 3JYFA 5EQVA 1HO5A 3QFOA 2WDEA 4B2OA 1G5BA 3PSNA 2O8AA 3HVQA 1T70A 3V4YA 2XMOA 5C1VA 2DXLA 3E7BA 4IYPC 4H2BA 1W24A 3H67A 4NZVA 1QHWA 4ORBA 4TUIA 3RL3A 3C5WC 3GVEA 2Q8UA 4LACC 2KKNA 1KBPA 3H64A 4KBPA 4DSYA 2QFPA 3E7AA 2BQ8X 2HY1A 4FBWA 4M0VA 4MOYA 3PSOA 3N5UA 3TGHA 2DXNA 2QJCA 5IOHA 5DNYA 2QFRA 2CV9A 4ORAA 3K7WC 1MF8A 3IB7A 3KBPA 4MOVA 3ZU0A 3QFNA 4H2IA 3DW8C 3FLOA 5J28A 3H62B 4FBKA 3K7VC 2NXFA 4WWLA 3FGAC 3ICFA 4JA9A 1WAO1 2ZBMA 4F0ZA 4UT3A 1OIDA 2Z72A 1UTEA 2Z06A 4HD0A 4OR9A 4KKZA 2Z1AA 4TUGA 1M63A 2GJUA 2HYOA 1T71A 1S70A 2O8GA 3IVEA 2R17A 3H61A 4ORCA 3H66A 2NYMC 3AUZA 4O5GA 4H2GA 3THNA 3QFMA 1U32A 4XPNA 4FBQA 4V0WA 4IL1A 3DSDA 4ZX2A 5JJTA 1OI8A 4MP0A 3ZTVA 3D03A 5F3WA 2WDDA 2IE4C 3IB8A 3T1IA 1HP1A 4O4KA 4UT2A 5HPEA 2USHA 1Z2XA 1IT6A 3H63A 3DSCA 4ZVZA 1TCOA 3QG5C 4UT3B 3CK2A 3LL8A 4G9JA 4UWQA 4O43A 1OIEA 4Q7FA 5INBA 1QFCA 3P71C 2P6BA 5JPEA 3H60A 1JK7A 2NYLC 4I5LC 2YEQA 4DHLA 1AUIA 3H68A 3AV0A 1USHA 2IE3C 2ZO9B 2YVTA 4H1YP 3RL4A 1HPUA 1SU1A 3E0JA 3C9FA 4JA7A 2JOGA 2BDXA 2A22A 1S3LA 2HYPA 5JPFA 1Z2WA 2WDCA 4LU9A 3THOB 4DT2A 4H2FA 1V73A 4V0VA 2AHDA 1NNWA 4LTYA 3EGGA 1UF3A 2WDFA 2DFJA 2IAEC 3EGHA 4J6OA 2NPPC 3IVDA 3H69A 1WARA 3QFKA 2ZOAA 1FJMA 1S3MA 1XM7A 2BCDA 4V0XA 1II7A 1S3NA 3RQZA 1XZWA 4YKEA 4FCXA 4O24A 4I5NC 3RL5A 5GTUA 5B8IA 1S95A 4H1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S8E A;  3JYF A;  5EQV A;  1HO5 A;  3QFO A;  2WDE A;  4B2O A;  1G5B A;  3PSN A;  2O8A A;  3HVQ A;  1T70 A;  3V4Y A;  2XMO A;  5C1V A;  3E7B A;  4IYP C;  4H2B A;  1W24 A;  3H67 A;  4NZV A;  1QHW A;  4ORB A;  4TUI A;  3RL3 A;  3C5W C;  3GVE A;  2Q8U A;  4LAC C;  2KKN A;  1KBP A;  3H64 A;  4KBP A;  4DSY A;  2QFP A;  3E7A A;  2BQ8 X;  2HY1 A;  4FBW A;  4M0V A;  4MOY A;  3PSO A;  3N5U A;  3TGH A;  2QJC A;  5IOH A;  5DNY A;  2QFR A;  2CV9 A;  4ORA A;  3K7W C;  1MF8 A;  3IB7 A;  3KBP A;  4MOV A;  3ZU0 A;  3QFN A;  4H2I A;  3DW8 C;  5J28 A;  3H62 B;  4FBK A;  3K7V C;  2NXF A;  4WWL A;  3FGA C;  3ICF A;  4JA9 A;  1WAO 1;  2ZBM A;  4F0Z A;  4UT3 A;  1OID A;  2Z72 A;  1UTE A;  2Z06 A;  4HD0 A;  4OR9 A;  4KKZ A;  2Z1A A;  4TUG A;  1M63 A;  2GJU A;  2HYO A;  1T71 A;  1S70 A;  2O8G A;  3IVE A;  2R17 A;  3H61 A;  4ORC A;  3H66 A;  2NYM C;  3AUZ A;  4O5G A;  4H2G A;  3THN A;  3QFM A;  1U32 A;  4XPN A;  4FBQ A;  4V0W A;  4IL1 A;  3DSD A;  4ZX2 A;  5JJT A;  1OI8 A;  4MP0 A;  3ZTV A;  5F3W A;  2WDD A;  2IE4 C;  3IB8 A;  3T1I A;  1HP1 A;  4O4K A;  4UT2 A;  5HPE A;  2USH A;  1Z2X A;  1IT6 A;  3H63 A;  3DSC A;  4ZVZ A;  1TCO A;  3QG5 C;  4UT3 B;  3CK2 A;  3LL8 A;  4G9J A;  4UWQ A;  4O43 A;  1OIE A;  4Q7F A;  5INB A;  1QFC A;  3P71 C;  2P6B A;  5JPE A;  3H60 A;  1JK7 A;  2NYL C;  4I5L C;  4DHL A;  1AUI A;  3H68 A;  3AV0 A;  1USH A;  2IE3 C;  4H1Y P;  2YVT A;  3RL4 A;  1HPU A;  1SU1 A;  3C9F A;  4JA7 A;  2JOG A;  2BDX A;  2A22 A;  1S3L A;  2HYP A;  5JPF A;  1Z2W A;  2WDC A;  4LU9 A;  3THO B;  4DT2 A;  4H2F A;  1V73 A;  4V0V A;  2AHD A;  1NNW A;  4LTY A;  3EGG A;  1UF3 A;  2WDF A;  2DFJ A;  2IAE C;  3EGH A;  4J6O A;  2NPP C;  3IVD A;  3H69 A;  1WAR A;  3QFK A;  1FJM A;  1S3M A;  1XM7 A;  2BCD A;  4V0X A;  1II7 A;  1S3N A;  3RQZ A;  1XZW A;  4YKE A;  4FCX A;  4O24 A;  4I5N C;  3RL5 A;  5GTU A;  5B8I A;  1S95 A;  4H1S A; 
#chains in the Genus database with same CATH topology
 1S8E A;  3JYF A;  5EQV A;  1HO5 A;  3QFO A;  2WDE A;  4B2O A;  1G5B A;  3PSN A;  2O8A A;  3HVQ A;  1T70 A;  3V4Y A;  2XMO A;  5C1V A;  2DXL A;  3E7B A;  4IYP C;  4H2B A;  1W24 A;  3H67 A;  4NZV A;  1QHW A;  4ORB A;  4TUI A;  3RL3 A;  3C5W C;  3GVE A;  2Q8U A;  4LAC C;  2KKN A;  1KBP A;  3H64 A;  4KBP A;  4DSY A;  2QFP A;  3E7A A;  2BQ8 X;  2HY1 A;  4FBW A;  4M0V A;  4MOY A;  3PSO A;  3N5U A;  3TGH A;  2DXN A;  2QJC A;  5IOH A;  5DNY A;  2QFR A;  2CV9 A;  4ORA A;  3K7W C;  1MF8 A;  3IB7 A;  3KBP A;  4MOV A;  3ZU0 A;  3QFN A;  4H2I A;  3DW8 C;  3FLO A;  5J28 A;  3H62 B;  4FBK A;  3K7V C;  2NXF A;  4WWL A;  3FGA C;  3ICF A;  4JA9 A;  1WAO 1;  2ZBM A;  4F0Z A;  4UT3 A;  1OID A;  2Z72 A;  1UTE A;  2Z06 A;  4HD0 A;  4OR9 A;  4KKZ A;  2Z1A A;  4TUG A;  1M63 A;  2GJU A;  2HYO A;  1T71 A;  1S70 A;  2O8G A;  3IVE A;  2R17 A;  3H61 A;  4ORC A;  3H66 A;  2NYM C;  3AUZ A;  4O5G A;  4H2G A;  3THN A;  3QFM A;  1U32 A;  4XPN A;  4FBQ A;  4V0W A;  4IL1 A;  3DSD A;  4ZX2 A;  5JJT A;  1OI8 A;  4MP0 A;  3ZTV A;  3D03 A;  5F3W A;  2WDD A;  2IE4 C;  3IB8 A;  3T1I A;  1HP1 A;  4O4K A;  4UT2 A;  5HPE A;  2USH A;  1Z2X A;  1IT6 A;  3H63 A;  3DSC A;  4ZVZ A;  1TCO A;  3QG5 C;  4UT3 B;  3CK2 A;  3LL8 A;  4G9J A;  4UWQ A;  4O43 A;  1OIE A;  4Q7F A;  5INB A;  1QFC A;  3P71 C;  2P6B A;  5JPE A;  3H60 A;  1JK7 A;  2NYL C;  4I5L C;  2YEQ A;  4DHL A;  1AUI A;  3H68 A;  3AV0 A;  1USH A;  2IE3 C;  2ZO9 B;  2YVT A;  4H1Y P;  3RL4 A;  1HPU A;  1SU1 A;  3E0J A;  3C9F A;  4JA7 A;  2JOG A;  2BDX A;  2A22 A;  1S3L A;  2HYP A;  5JPF A;  1Z2W A;  2WDC A;  4LU9 A;  3THO B;  4DT2 A;  4H2F A;  1V73 A;  4V0V A;  2AHD A;  1NNW A;  4LTY A;  3EGG A;  1UF3 A;  2WDF A;  2DFJ A;  2IAE C;  3EGH A;  4J6O A;  2NPP C;  3IVD A;  3H69 A;  1WAR A;  3QFK A;  2ZOA A;  1FJM A;  1S3M A;  1XM7 A;  2BCD A;  4V0X A;  1II7 A;  1S3N A;  3RQZ A;  1XZW A;  4YKE A;  4FCX A;  4O24 A;  4I5N C;  3RL5 A;  5GTU A;  5B8I A;  1S95 A;  4H1S A; 
#chains in the Genus database with same CATH homology
 1S8E A;  3JYF A;  5EQV A;  1HO5 A;  3QFO A;  2WDE A;  4B2O A;  1G5B A;  3PSN A;  2O8A A;  3HVQ A;  1T70 A;  3V4Y A;  2XMO A;  5C1V A;  2DXL A;  3E7B A;  4IYP C;  4H2B A;  1W24 A;  3H67 A;  4NZV A;  1QHW A;  4ORB A;  4TUI A;  3RL3 A;  3C5W C;  3GVE A;  2Q8U A;  4LAC C;  2KKN A;  1KBP A;  3H64 A;  4KBP A;  4DSY A;  2QFP A;  3E7A A;  2BQ8 X;  2HY1 A;  4FBW A;  4M0V A;  4MOY A;  3PSO A;  3N5U A;  3TGH A;  2DXN A;  2QJC A;  5IOH A;  5DNY A;  2QFR A;  2CV9 A;  4ORA A;  3K7W C;  1MF8 A;  3IB7 A;  3KBP A;  4MOV A;  3ZU0 A;  3QFN A;  4H2I A;  3DW8 C;  3FLO A;  5J28 A;  3H62 B;  4FBK A;  3K7V C;  2NXF A;  4WWL A;  3FGA C;  3ICF A;  4JA9 A;  1WAO 1;  2ZBM A;  4F0Z A;  4UT3 A;  1OID A;  2Z72 A;  1UTE A;  2Z06 A;  4HD0 A;  4OR9 A;  4KKZ A;  2Z1A A;  4TUG A;  1M63 A;  2GJU A;  2HYO A;  1T71 A;  1S70 A;  2O8G A;  3IVE A;  2R17 A;  3H61 A;  4ORC A;  3H66 A;  2NYM C;  3AUZ A;  4O5G A;  4H2G A;  3THN A;  3QFM A;  1U32 A;  4XPN A;  4FBQ A;  4V0W A;  4IL1 A;  3DSD A;  4ZX2 A;  5JJT A;  1OI8 A;  4MP0 A;  3ZTV A;  3D03 A;  5F3W A;  2WDD A;  2IE4 C;  3IB8 A;  3T1I A;  1HP1 A;  4O4K A;  4UT2 A;  5HPE A;  2USH A;  1Z2X A;  1IT6 A;  3H63 A;  3DSC A;  4ZVZ A;  1TCO A;  3QG5 C;  4UT3 B;  3CK2 A;  3LL8 A;  4G9J A;  4UWQ A;  4O43 A;  1OIE A;  4Q7F A;  5INB A;  1QFC A;  3P71 C;  2P6B A;  5JPE A;  3H60 A;  1JK7 A;  2NYL C;  4I5L C;  2YEQ A;  4DHL A;  1AUI A;  3H68 A;  3AV0 A;  1USH A;  2IE3 C;  2ZO9 B;  2YVT A;  4H1Y P;  3RL4 A;  1HPU A;  1SU1 A;  3E0J A;  3C9F A;  4JA7 A;  2JOG A;  2BDX A;  2A22 A;  1S3L A;  2HYP A;  5JPF A;  1Z2W A;  2WDC A;  4LU9 A;  3THO B;  4DT2 A;  4H2F A;  1V73 A;  4V0V A;  2AHD A;  1NNW A;  4LTY A;  3EGG A;  1UF3 A;  2WDF A;  2DFJ A;  2IAE C;  3EGH A;  4J6O A;  2NPP C;  3IVD A;  3H69 A;  1WAR A;  3QFK A;  2ZOA A;  1FJM A;  1S3M A;  1XM7 A;  2BCD A;  4V0X A;  1II7 A;  1S3N A;  3RQZ A;  1XZW A;  4YKE A;  4FCX A;  4O24 A;  4I5N C;  3RL5 A;  5GTU A;  5B8I A;  1S95 A;  4H1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...