3QG2A

Plasmodium falciparum dhfr-ts qradruple mutant (n51i+c59r+s108n+i164l, v1/s) pyrimethamine complex
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
608
structure length
547
Chain Sequence
MMEQVCDVFDIYAICACCKVESKNEGKKNEVFNNYTFRGLGNKGVLPWKCISLDMKYFRAVTTYVNESKYEKLKYKRCKYLNKETKKLQNVVVMGRTNWESIPKKFKPLSNRINVILSRTLKKEDFDEDVYIINKVEDLIVLLGKLNYYKCFILGGSVVYQEFLEKKLIKKIYFTRINSTYECDVFFPEINENEYQIISVSDVYTSNNTTLDFIIYKKTNNDDEEEDDFVYFNFNKEKEEKNKNSIHPNDFQIYNSLKYKYHPEYQYLNIIYDIMMNGNKQSDRTGVGVLSKFGYIMKFDLSQYFPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIWEANGTREFLDNRKLFHREVNDLGPIYGFQWRHFGAEYTNMYDNYENKGVDQLKNIINLIKNDPTSRRILLCAWNVKDLDQMALPPCHILCQFYVFDGKLSCIMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVYNNHIDSLKIQLNRIPYPFPTLKLNPDIKNIEDFTISDFTIQNYVHHEKISMDMAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Trypanosomal dihydrofolate reductase reveals natural antifolate resistance
pubmed doi rcsb
molecule keywords Bifunctional dihydrofolate reductase-thymidylate synthase
molecule tags Oxidoreductase, transferase/inhibitor
source organism Plasmodium falciparum
total genus 173
structure length 547
sequence length 608
chains with identical sequence B
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2011-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 3qg2A03
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 3qg2A01
1BDUA 3GHCA 1DHJA 4O1UA 3IK1A 1DR6A 1DRHA 4FGTA 3K47A 1F4EA 1DG7A 3JVXA 5BY6A 1RB3A 3IJZA 4QLEA 4TMSA 4QI9A 3FRAX 1JMHA 1BSPA 5CC9A 3GG5A 1JG0A 1RA2A 1VZDA 3C06A 3NTZA 1AOBA 1BO7A 1DR1A 2ANQA 3F8YA 3IHIA 3OAFA 3S9UA 1HFRA 4PSTA 4EINA 5HF0X 1B5DA 3EEJA 4ISKA 1BSFA 1EVGA 1KZIA 4KJJA 1YHOA 1JMFA 1J3JC 5HSRA 4KM2A 4IXGX 3N5GA 3IK0A 5WRNA 1NJEA 1EV8A 4Q0DA 3UWLA 4KLXA 4JEFA 1YPVA 3H9KA 2C2TA 4KEBA 3ZPGA 1B49A 2D5NA 4X5FA 1DDUA 4LRRA 1PD8A 1RF7A 3FL9A 2W9SA 1BZFA 1VZCA 1DRAA 3EBUA 1TLSA 3DG8C 4KYAA 1TSVA 4Q67A 4GEVA 1DYJA 4EZ8A 1HFQA 2W9GA 3K45A 4ELGA 1CI7A 3DGAC 1J3IC 1TDAA 1QZFA 2FZHA 1TDBA 4EB4A 1RE7A 4O7UA 5FCTA 5HVBA 1F28A 3INVA 3NXRA 3D80A 3QLXA 3V8HA 3F0QX 1RX6A 4FOXA 4DPHA 1AN5A 1FFLA 3JWMA 4M6KA 4KY4A 3FQZA 4I13A 1RX7A 4FGGA 3HBBA 3FQ0A 2TSCA 3EJLA 4IXFX 4KM0A 1TSMA 1DR4A 1RX9A 4LAGX 4XT5A 4IXED 1DYRA 4O1XA 3RG9A 2RD8B 1DR3A 3FRFX 5HQYA 5DFRA 4FQSA 2AZNA 2W3MA 3IA4A 1RX4A 3EIGA 3UWLB 1S3UA 3ZPCA 3BHLA 3CLBA 3NZ6X 4XECX 3NZDA 1JMGA 1S3VA 3RO9A 3JWKA 2D0KA 4ELEA 3S7AA 5HSUA 1NJCA 3I3RA 4NX7A 3NXYA 1BOZA 2G8AA 3M09A 1B02A 4H0UA 3SAIA 1EV5A 1JMIA 5ECCA 3IA5A 1PD9A 4KBNA 5HPBA 1DNAA 1BQ2A 2G89A 1DREA 2QK8A 2W9TA 3FY9X 4OSGA 5HQZA 1IA1A 1LCAA 2HQPA 3SRQX 3F0UX 4X5HA 1DIUA 1BKOA 1DLSA 1VZBA 3BZ0A 1KMVA 1ZDRA 3NZ9X 4KJKA 1HW4A 1U70A 1HZWA 4QHVA 1BO8A 4HOFA 2HM9A 3SRSX 1BQ1A 2FTNA 2JYBA 1D1GA 4ELHA 1AI9A 1DYHA 4I1NA 1TVUA 5U26A 1DISA 4XT7A 3JWCA 2DRCA 4LAHX 3FQCA 3DL5A 4KL9A 4M7VA 3DRCA 3KY8A 1IA3A 4G95A 1RG7A 1TDCA 4G2OX 4FGHA 1J3KC 1E26A 4EJ1A 4G6WX 2KGKA 1LCEA 4EIGA 3CL9A 2RD8A 4QLGA 3KGYA 4X5IA 2RDAA 4QJZD 1TSWA 7DFRA 1FWMA 1RB2A 1DRBA 2OIPA 3QLSA 3VCOA 1RH3A 1HFPA 3EEKA 1DF7A 3L3RA 3QGTA 1OHKA 3N5EA 2GD9A 5HVEA 3F0XX 1RC4A 3M08A 2CIGA 3I8AX 4H0RA 4E28A 3QLWA 3CSEA 4IQQA 3KFYA 1CZ3A 1BKPA 4NX6A 3TQ9A 3UM8A 2W3AA 4XT6A 1ZPRA 3TD8A 2BL9A 3F0VX 1IA2A 3QYLA 3UM5A 5CCCA 1JOLA 2DHFA 3HJ3A 3B9HA 4XT8A 4KFJA 4H95A 3KJSA 3NXTA 3FYWX 1QQQA 3EX8A 1LUDA 1AJMA 4IQBA 5U27A 1VJ3A 1RX5A 3FQVA 4X5JA 2KCEA 5DXVA 1M7AA 1DHFA 2BBQA 3QYOA 3SRRX 5ECXA 1J3JA 3N0HA 4XSCA 2ONBA 4PDJA 1RD7A 4M2XA 1I00A 1JOMA 1JUTA 2O7PA 3TQ8A 3IRNA 1TSLA 1TSDA 4KNEA 4P3RA 3NXVA 4XSDA 4TU5X 3ROAA 1DAJA 1DHIA 5HUIA 1DR7A 2W3WA 4GD7A 1U71A 1LCBA 3BFIA 2G8XA 1SEJA 3FRDX 3IX9A 3TQAA 1NJDA 2W3VA 3QL3A 3QFXA 3JW5A 3JSUA 3DG8A 1VDRA 3EELA 4EILA 2FZJA 3IX6A 1JTUA 3FREX 4H98A 3IRMA 5HS3A 3SQYX 3DGAA 3N5EB 1J3IA 1TVWA 3FY8X 1AO8A 3K2HA 2VETA 3GHVA 6DFRA 1RA1A 2ANOA 2TDMA 3Q1HA 3GI2A 2ITHA 2BLBA 4XRBA 4FOAA 3SR5X 1VZAA 2P4GA 3GYFA 4GH8A 4ELFA 1M79A 3SA1A 3NRRA 4UP1A 3IROA 3QLZA 1DR5A 3QLYA 4X5GA 1JTQA 2FTOX 4DFRA 1TSNA 4PTHA 4DPDA 4PSYA 4F2VA 3NU0A 2C2SA 4P3QA 3BYXA 1M78A 1DRFA 4FHBA 3DFRA 4PSGA 3HB8A 3DATA 1PDBA 1RX2A 1MVSA 2HXVA 4XSEA 4HOEA 3OCHA 3K74A 1RA9A 3LG4A 1DDRA 1KLKA 1BIDA 1TSZA 3DL6A 2CD2A 2FTQA 2FZIA 3TQBA 3EGYX 4O1XD 3BGXA 4QLFA 1TLCA 1U72A 4KJLA 1DG5A 1NCEA 3F91A 3SRUX 3R33A 1TJSA 4LEKX 4CD2A 5JG0X 2A9WA 2XW7A 4KD7A 8DFRA 1AIQA 3FS6A 2VF0A 1RX8A 3QG2A 3FYVX 4P66A 3NXXA 2G6VA 2TSRA 5HI6A 3NXOA 1S3YA 1TDUA 3D84X 3F0SX 3NZCX 3SH2A 3FL8A 3DAUA 1S3WA 1OHJA 2G8DA 4PSSA 4E5OA 4XT4A 5EAJA 2W9HA 1IA4A 4P68A 3JW3A 3EDWX 2BLCA 1DR2A 4M6JA 3TMSA 1CD2A 5J7WA 1DG8A 3BNZA 4GYHA 1RA8A 4G8ZX 3E0BA 4Q6AA 1BJGA 1F4CA 1F4DA 1F4GA 4HA9A 1J3KA 3BHRA 3S3VA 4H1IA 1F4BA 1TDRA 1JU6A 1TSYA 3GHWA 1TYSA 4M6LA 4RGCA 2OBCA 4OR7A 1NJBA 1HVYA 4QJCA 4ISWA 4DQ1A 4PTJA 5HF2X 2W3BA 4H96A 4KPWA 1RX1A 1KCEA 1B5EA 3F0BX 3QLRA 1DLRA 5H39A 1TSXA 3KJRA 3C0AA 1HW3A 1RA3A 1TRGA 4FOGA 3NZBX 2INQA 4IRRA 1RTSA 4G3MA 5E8QA 3EF9A 4Q0EA 3QL0A 3ED7A 1VZEA 1MVTA 4KNZA 5JA3A 3SRWX 3F8ZA 3JTWA 5FDAA 4DP3A 3GH2X 4KY8A 1AXWA 1KZJA 3B5BA 2G86A 1LY3A 1AOEA 5H3AA 1DDSA 3OB7A 1F4FA 2H2QA 2ZZAA 3EHIX 1JUJA 2AAZA 1EVFA 4HA7A 4H97A 3JWFA 3SGYA 1KMSA 5HT5A 4ELBA 1TVVA 2TDDA 3FQOA 3UM6A 4XE6X 1JUVA 1BP0A 1TISA 3KGBA 1BPJA 2BLAA 3NZAX 4KAKA 5H38A 1LY4A 4ECKA 1THYA 3EAWX 1DYIA 5HT4A 1RX3A 2B3ZA 3EEMA 4DDRA 4LAEX 2L28A 4HOGA 3GH0A 3QJ7A 1NJAA 3FRBX 1BP6A 3FQFA 4EIZA 2LF1A 4M7UA 1SYNA 3CD2A 3SA2A
chains in the Genus database with same CATH superfamily
1BDUA 3GHCA 1DHJA 4O1UA 3IK1A 1DR6A 1DRHA 4FGTA 3K47A 1F4EA 1DG7A 3JVXA 5BY6A 1RB3A 3IJZA 4QLEA 4TMSA 4QI9A 3FRAX 1JMHA 1BSPA 5CC9A 3GG5A 1JG0A 1RA2A 1VZDA 3C06A 3NTZA 1AOBA 1BO7A 1DR1A 2ANQA 3F8YA 3IHIA 3OAFA 3S9UA 1HFRA 4PSTA 4EINA 5HF0X 1B5DA 3EEJA 4ISKA 1BSFA 1EVGA 1KZIA 4KJJA 1YHOA 1JMFA 1J3JC 5HSRA 4KM2A 4IXGX 3N5GA 3IK0A 5WRNA 1NJEA 1EV8A 4Q0DA 3UWLA 4KLXA 4JEFA 1YPVA 3H9KA 2C2TA 4KEBA 3ZPGA 1B49A 2D5NA 4X5FA 1DDUA 4LRRA 1PD8A 1RF7A 3FL9A 2W9SA 1BZFA 1VZCA 1DRAA 3EBUA 1TLSA 3DG8C 4KYAA 1TSVA 4Q67A 4GEVA 1DYJA 4EZ8A 1HFQA 2W9GA 3K45A 4ELGA 1CI7A 3DGAC 1J3IC 1TDAA 1QZFA 2FZHA 1TDBA 4EB4A 1RE7A 4O7UA 5FCTA 5HVBA 1F28A 3INVA 3NXRA 3D80A 3QLXA 3V8HA 3F0QX 1RX6A 4FOXA 4DPHA 1AN5A 1FFLA 3JWMA 4M6KA 4KY4A 3FQZA 4I13A 1RX7A 4FGGA 3HBBA 3FQ0A 2TSCA 3EJLA 4IXFX 4KM0A 1TSMA 1DR4A 1RX9A 4LAGX 4XT5A 4IXED 1DYRA 4O1XA 3RG9A 2RD8B 1DR3A 3FRFX 5HQYA 5DFRA 4FQSA 2AZNA 2W3MA 3IA4A 1RX4A 3EIGA 3UWLB 1S3UA 3ZPCA 3BHLA 3CLBA 3NZ6X 4XECX 3NZDA 1JMGA 1S3VA 3RO9A 3JWKA 2D0KA 4ELEA 3S7AA 5HSUA 1NJCA 3I3RA 4NX7A 3NXYA 1BOZA 2G8AA 3M09A 1B02A 4H0UA 3SAIA 1EV5A 1JMIA 5ECCA 3IA5A 1PD9A 4KBNA 5HPBA 1DNAA 1BQ2A 2G89A 1DREA 2QK8A 2W9TA 3FY9X 4OSGA 5HQZA 1IA1A 1LCAA 2HQPA 3SRQX 3F0UX 4X5HA 1DIUA 1BKOA 1DLSA 1VZBA 3BZ0A 1KMVA 1ZDRA 3NZ9X 4KJKA 1HW4A 1U70A 1HZWA 4QHVA 1BO8A 4HOFA 2HM9A 3SRSX 1BQ1A 2FTNA 2JYBA 1D1GA 4ELHA 1AI9A 1DYHA 4I1NA 1TVUA 5U26A 1DISA 4XT7A 3JWCA 2DRCA 4LAHX 3FQCA 3DL5A 4KL9A 4M7VA 3DRCA 3KY8A 1IA3A 4G95A 1RG7A 1TDCA 4G2OX 4FGHA 1J3KC 1E26A 4EJ1A 4G6WX 2KGKA 1LCEA 4EIGA 3CL9A 2RD8A 4QLGA 3KGYA 4X5IA 2RDAA 4QJZD 1TSWA 7DFRA 1FWMA 1RB2A 1DRBA 2OIPA 3QLSA 3VCOA 1RH3A 1HFPA 3EEKA 1DF7A 3L3RA 3QGTA 1OHKA 3N5EA 2GD9A 5HVEA 3F0XX 1RC4A 3M08A 2CIGA 3I8AX 4H0RA 4E28A 3QLWA 3CSEA 4IQQA 3KFYA 1CZ3A 1BKPA 4NX6A 3TQ9A 3UM8A 2W3AA 4XT6A 1ZPRA 3TD8A 2BL9A 3F0VX 1IA2A 3QYLA 3UM5A 5CCCA 1JOLA 2DHFA 3HJ3A 3B9HA 4XT8A 4KFJA 4H95A 3KJSA 3NXTA 3FYWX 1QQQA 3EX8A 1LUDA 1AJMA 4IQBA 5U27A 1VJ3A 1RX5A 3FQVA 4X5JA 2KCEA 5DXVA 1M7AA 1DHFA 2BBQA 3QYOA 3SRRX 5ECXA 1J3JA 3N0HA 4XSCA 2ONBA 4PDJA 1RD7A 4M2XA 1I00A 1JOMA 1JUTA 2O7PA 3TQ8A 3IRNA 1TSLA 1TSDA 4KNEA 4P3RA 3NXVA 4XSDA 4TU5X 3ROAA 1DAJA 1DHIA 5HUIA 1DR7A 2W3WA 4GD7A 1U71A 1LCBA 3BFIA 2G8XA 1SEJA 3FRDX 3IX9A 3TQAA 1NJDA 2W3VA 3QL3A 3QFXA 3JW5A 3JSUA 3DG8A 1VDRA 3EELA 4EILA 2FZJA 3IX6A 1JTUA 3FREX 4H98A 3IRMA 5HS3A 3SQYX 3DGAA 3N5EB 1J3IA 1TVWA 3FY8X 1AO8A 3K2HA 2VETA 3GHVA 6DFRA 1RA1A 2ANOA 2TDMA 3Q1HA 3GI2A 2ITHA 2BLBA 4XRBA 4FOAA 3SR5X 1VZAA 2P4GA 3GYFA 4GH8A 4ELFA 1M79A 3SA1A 3NRRA 4UP1A 3IROA 3QLZA 1DR5A 3QLYA 4X5GA 1JTQA 2FTOX 4DFRA 1TSNA 4PTHA 4DPDA 4PSYA 4F2VA 3NU0A 2C2SA 4P3QA 3BYXA 1M78A 1DRFA 4FHBA 3DFRA 4PSGA 3HB8A 3DATA 1PDBA 1RX2A 1MVSA 2HXVA 4XSEA 4HOEA 3OCHA 3K74A 1RA9A 3LG4A 1DDRA 1KLKA 1BIDA 1TSZA 3DL6A 2CD2A 2FTQA 2FZIA 3TQBA 3EGYX 4O1XD 3BGXA 4QLFA 1TLCA 1U72A 4KJLA 1DG5A 1NCEA 3F91A 3SRUX 3R33A 1TJSA 4LEKX 4CD2A 5JG0X 2A9WA 2XW7A 4KD7A 8DFRA 1AIQA 3FS6A 2VF0A 1RX8A 3QG2A 3FYVX 4P66A 3NXXA 2G6VA 2TSRA 5HI6A 3NXOA 1S3YA 1TDUA 3D84X 3F0SX 3NZCX 3SH2A 3FL8A 3DAUA 1S3WA 1OHJA 2G8DA 4PSSA 4E5OA 4XT4A 5EAJA 2W9HA 1IA4A 4P68A 3JW3A 3EDWX 2BLCA 1DR2A 4M6JA 3TMSA 1CD2A 5J7WA 1DG8A 3BNZA 4GYHA 1RA8A 4G8ZX 3E0BA 4Q6AA 1BJGA 1F4CA 1F4DA 1F4GA 4HA9A 1J3KA 3BHRA 3S3VA 4H1IA 1F4BA 1TDRA 1JU6A 1TSYA 3GHWA 1TYSA 4M6LA 4RGCA 2OBCA 4OR7A 1NJBA 1HVYA 4QJCA 4ISWA 4DQ1A 4PTJA 5HF2X 2W3BA 4H96A 4KPWA 1RX1A 1KCEA 1B5EA 3F0BX 3QLRA 1DLRA 5H39A 1TSXA 3KJRA 3C0AA 1HW3A 1RA3A 1TRGA 4FOGA 3NZBX 2INQA 4IRRA 1RTSA 4G3MA 5E8QA 3EF9A 4Q0EA 3QL0A 3ED7A 1VZEA 1MVTA 4KNZA 5JA3A 3SRWX 3F8ZA 3JTWA 5FDAA 4DP3A 3GH2X 4KY8A 1AXWA 1KZJA 3B5BA 2G86A 1LY3A 1AOEA 5H3AA 1DDSA 3OB7A 1F4FA 2H2QA 2ZZAA 3EHIX 1JUJA 2AAZA 1EVFA 4HA7A 4H97A 3JWFA 3SGYA 1KMSA 5HT5A 4ELBA 1TVVA 2TDDA 3FQOA 3UM6A 4XE6X 1JUVA 1BP0A 1TISA 3KGBA 1BPJA 2BLAA 3NZAX 4KAKA 5H38A 1LY4A 4ECKA 1THYA 3EAWX 1DYIA 5HT4A 1RX3A 2B3ZA 3EEMA 4DDRA 4LAEX 2L28A 4HOGA 3GH0A 3QJ7A 1NJAA 3FRBX 1BP6A 3FQFA 4EIZA 2LF1A 4M7UA 1SYNA 3CD2A 3SA2A
chains in the Genus database with same CATH topology
1BDUA 3GHCA 1DHJA 4O1UA 3IK1A 1DR6A 1DRHA 4FGTA 3K47A 1F4EA 1DG7A 3JVXA 5BY6A 1RB3A 3IJZA 4QLEA 4TMSA 4QI9A 3FRAX 1JMHA 1BSPA 5CC9A 3GG5A 1JG0A 1RA2A 1VZDA 3C06A 3NTZA 1AOBA 1BO7A 1DR1A 2ANQA 3F8YA 3IHIA 3OAFA 3S9UA 1HFRA 4PSTA 4EINA 5HF0X 1B5DA 3EEJA 4ISKA 1BSFA 1EVGA 1KZIA 4KJJA 1YHOA 1JMFA 1J3JC 5HSRA 4KM2A 4IXGX 3N5GA 3IK0A 5WRNA 1NJEA 1EV8A 4Q0DA 3UWLA 4KLXA 4JEFA 1YPVA 3H9KA 2C2TA 4KEBA 3ZPGA 1B49A 2D5NA 4X5FA 1DDUA 4LRRA 1PD8A 1RF7A 3FL9A 2W9SA 1BZFA 1VZCA 1DRAA 3EBUA 1TLSA 3DG8C 4KYAA 1TSVA 4Q67A 4GEVA 1DYJA 4EZ8A 1HFQA 2W9GA 3K45A 4ELGA 1CI7A 3DGAC 1J3IC 1TDAA 1QZFA 2FZHA 1TDBA 4EB4A 1RE7A 4O7UA 5FCTA 5HVBA 1F28A 3INVA 3NXRA 3D80A 3QLXA 3V8HA 3F0QX 1RX6A 4FOXA 4DPHA 1AN5A 1FFLA 3JWMA 4M6KA 4KY4A 3FQZA 4I13A 1RX7A 4FGGA 3HBBA 3FQ0A 2TSCA 3EJLA 4IXFX 4KM0A 1TSMA 1DR4A 1RX9A 4LAGX 4XT5A 4IXED 1DYRA 4O1XA 3RG9A 2RD8B 1DR3A 3FRFX 5HQYA 5DFRA 4FQSA 2AZNA 2W3MA 3IA4A 1RX4A 3EIGA 3UWLB 1S3UA 3ZPCA 3BHLA 3CLBA 3NZ6X 4XECX 3NZDA 1JMGA 1S3VA 3RO9A 3JWKA 2D0KA 4ELEA 3S7AA 5HSUA 1NJCA 3I3RA 4NX7A 3NXYA 1BOZA 2G8AA 3M09A 1B02A 4H0UA 3SAIA 1EV5A 1JMIA 5ECCA 3IA5A 1PD9A 4KBNA 5HPBA 1DNAA 1BQ2A 2G89A 1DREA 2QK8A 2W9TA 3FY9X 4OSGA 5HQZA 1IA1A 1LCAA 2HQPA 3SRQX 3F0UX 4X5HA 1DIUA 1BKOA 1DLSA 1VZBA 3BZ0A 1KMVA 1ZDRA 3NZ9X 4KJKA 1HW4A 1U70A 1HZWA 4QHVA 1BO8A 4HOFA 2HM9A 3SRSX 1BQ1A 2FTNA 2JYBA 1D1GA 4ELHA 1AI9A 1DYHA 4I1NA 1TVUA 5U26A 1DISA 4XT7A 3JWCA 2DRCA 4LAHX 3FQCA 3DL5A 4KL9A 4M7VA 3DRCA 3KY8A 1IA3A 4G95A 1RG7A 1TDCA 4G2OX 4FGHA 1J3KC 1E26A 4EJ1A 4G6WX 2KGKA 1LCEA 4EIGA 3CL9A 2RD8A 4QLGA 3KGYA 4X5IA 2RDAA 4QJZD 1TSWA 7DFRA 1FWMA 1RB2A 1DRBA 2OIPA 3QLSA 3VCOA 1RH3A 1HFPA 3EEKA 1DF7A 3L3RA 3QGTA 1OHKA 3N5EA 2GD9A 5HVEA 3F0XX 1RC4A 3M08A 2CIGA 3I8AX 4H0RA 4E28A 3QLWA 3CSEA 4IQQA 3KFYA 1CZ3A 1BKPA 4NX6A 3TQ9A 3UM8A 2W3AA 4XT6A 1ZPRA 3TD8A 2BL9A 3F0VX 1IA2A 3QYLA 3UM5A 5CCCA 1JOLA 2DHFA 3HJ3A 3B9HA 4XT8A 4KFJA 4H95A 3KJSA 3NXTA 3FYWX 1QQQA 3EX8A 1LUDA 1AJMA 4IQBA 5U27A 1VJ3A 1RX5A 3FQVA 4X5JA 2KCEA 5DXVA 1M7AA 1DHFA 2BBQA 3QYOA 3SRRX 5ECXA 1J3JA 3N0HA 4XSCA 2ONBA 4PDJA 1RD7A 4M2XA 1I00A 1JOMA 1JUTA 2O7PA 3TQ8A 3IRNA 1TSLA 1TSDA 4KNEA 4P3RA 3NXVA 4XSDA 4TU5X 3ROAA 1DAJA 1DHIA 5HUIA 1DR7A 2W3WA 4GD7A 1U71A 1LCBA 3BFIA 2G8XA 1SEJA 3FRDX 3IX9A 3TQAA 1NJDA 2W3VA 3QL3A 3QFXA 3JW5A 3JSUA 3DG8A 1VDRA 3EELA 4EILA 2FZJA 3IX6A 1JTUA 3FREX 4H98A 3IRMA 5HS3A 3SQYX 3DGAA 3N5EB 1J3IA 1TVWA 3FY8X 1AO8A 3K2HA 2VETA 3GHVA 6DFRA 1RA1A 2ANOA 2TDMA 3Q1HA 3GI2A 2ITHA 2BLBA 4XRBA 4FOAA 3SR5X 1VZAA 2P4GA 3GYFA 4GH8A 4ELFA 1M79A 3SA1A 3NRRA 4UP1A 3IROA 3QLZA 1DR5A 3QLYA 4X5GA 1JTQA 2FTOX 4DFRA 1TSNA 4PTHA 4DPDA 4PSYA 4F2VA 3NU0A 2C2SA 4P3QA 3BYXA 1M78A 1DRFA 4FHBA 3DFRA 4PSGA 3HB8A 3DATA 1PDBA 1RX2A 1MVSA 2HXVA 4XSEA 4HOEA 3OCHA 3K74A 1RA9A 3LG4A 1DDRA 1KLKA 1BIDA 1TSZA 3DL6A 2CD2A 2FTQA 2FZIA 3TQBA 3EGYX 4O1XD 3BGXA 4QLFA 1TLCA 1U72A 4KJLA 1DG5A 1NCEA 3F91A 3SRUX 3R33A 1TJSA 4LEKX 4CD2A 5JG0X 2A9WA 2XW7A 4KD7A 8DFRA 1AIQA 3FS6A 2VF0A 1RX8A 3QG2A 3FYVX 4P66A 3NXXA 2G6VA 2TSRA 5HI6A 3NXOA 1S3YA 1TDUA 3D84X 3F0SX 3NZCX 3SH2A 3FL8A 3DAUA 1S3WA 1OHJA 2G8DA 4PSSA 4E5OA 4XT4A 5EAJA 2W9HA 1IA4A 4P68A 3JW3A 3EDWX 2BLCA 1DR2A 4M6JA 3TMSA 1CD2A 5J7WA 1DG8A 3BNZA 4GYHA 1RA8A 4G8ZX 3E0BA 4Q6AA 1BJGA 1F4CA 1F4DA 1F4GA 4HA9A 1J3KA 3BHRA 3S3VA 4H1IA 1F4BA 1TDRA 1JU6A 1TSYA 3GHWA 1TYSA 4M6LA 4RGCA 2OBCA 4OR7A 1NJBA 1HVYA 4QJCA 4ISWA 4DQ1A 4PTJA 5HF2X 2W3BA 4H96A 4KPWA 1RX1A 1KCEA 1B5EA 3F0BX 3QLRA 1DLRA 5H39A 1TSXA 3KJRA 3C0AA 1HW3A 1RA3A 1TRGA 4FOGA 3NZBX 2INQA 4IRRA 1RTSA 4G3MA 5E8QA 3EF9A 4Q0EA 3QL0A 3ED7A 1VZEA 1MVTA 4KNZA 5JA3A 3SRWX 3F8ZA 3JTWA 5FDAA 4DP3A 3GH2X 4KY8A 1AXWA 1KZJA 3B5BA 2G86A 1LY3A 1AOEA 5H3AA 1DDSA 3OB7A 1F4FA 2H2QA 2ZZAA 3EHIX 1JUJA 2AAZA 1EVFA 4HA7A 4H97A 3JWFA 3SGYA 1KMSA 5HT5A 4ELBA 1TVVA 2TDDA 3FQOA 3UM6A 4XE6X 1JUVA 1BP0A 1TISA 3KGBA 1BPJA 2BLAA 3NZAX 4KAKA 5H38A 1LY4A 4ECKA 1THYA 3EAWX 1DYIA 5HT4A 1RX3A 2B3ZA 3EEMA 4DDRA 4LAEX 2L28A 4HOGA 3GH0A 3QJ7A 1NJAA 3FRBX 1BP6A 3FQFA 4EIZA 2LF1A 4M7UA 1SYNA 3CD2A 3SA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BDU A;  3GHC A;  1DHJ A;  4O1U A;  3IK1 A;  1DR6 A;  1DRH A;  4FGT A;  3K47 A;  1F4E A;  1DG7 A;  3JVX A;  5BY6 A;  1RB3 A;  3IJZ A;  4QLE A;  4TMS A;  4QI9 A;  3FRA X;  1JMH A;  1BSP A;  5CC9 A;  3GG5 A;  1JG0 A;  1RA2 A;  1VZD A;  3C06 A;  3NTZ A;  1AOB A;  1BO7 A;  1DR1 A;  2ANQ A;  3F8Y A;  3IHI A;  3OAF A;  3S9U A;  1HFR A;  4PST A;  4EIN A;  5HF0 X;  1B5D A;  3EEJ A;  4ISK A;  1BSF A;  1EVG A;  1KZI A;  4KJJ A;  1YHO A;  1JMF A;  1J3J C;  5HSR A;  4KM2 A;  4IXG X;  3N5G A;  3IK0 A;  5WRN A;  1NJE A;  1EV8 A;  4Q0D A;  3UWL A;  4KLX A;  4JEF A;  1YPV A;  3H9K A;  2C2T A;  4KEB A;  3ZPG A;  1B49 A;  2D5N A;  4X5F A;  1DDU A;  4LRR A;  1PD8 A;  1RF7 A;  3FL9 A;  2W9S A;  1BZF A;  1VZC A;  1DRA A;  3EBU A;  1TLS A;  3DG8 C;  4KYA A;  1TSV A;  4Q67 A;  4GEV A;  1DYJ A;  4EZ8 A;  1HFQ A;  2W9G A;  3K45 A;  4ELG A;  1CI7 A;  3DGA C;  1J3I C;  1TDA A;  1QZF A;  2FZH A;  1TDB A;  4EB4 A;  1RE7 A;  4O7U A;  5FCT A;  5HVB A;  1F28 A;  3INV A;  3NXR A;  3D80 A;  3QLX A;  3V8H A;  3F0Q X;  1RX6 A;  4FOX A;  4DPH A;  1AN5 A;  1FFL A;  3JWM A;  4M6K A;  4KY4 A;  3FQZ A;  4I13 A;  1RX7 A;  4FGG A;  3HBB A;  3FQ0 A;  2TSC A;  3EJL A;  4IXF X;  4KM0 A;  1TSM A;  1DR4 A;  1RX9 A;  4LAG X;  4XT5 A;  4IXE D;  1DYR A;  4O1X A;  3RG9 A;  2RD8 B;  1DR3 A;  3FRF X;  5HQY A;  5DFR A;  4FQS A;  2AZN A;  2W3M A;  3IA4 A;  1RX4 A;  3EIG A;  3UWL B;  1S3U A;  3ZPC A;  3BHL A;  3CLB A;  3NZ6 X;  4XEC X;  3NZD A;  1JMG A;  1S3V A;  3RO9 A;  3JWK A;  2D0K A;  4ELE A;  3S7A A;  5HSU A;  1NJC A;  3I3R A;  4NX7 A;  3NXY A;  1BOZ A;  2G8A A;  3M09 A;  1B02 A;  4H0U A;  3SAI A;  1EV5 A;  1JMI A;  5ECC A;  3IA5 A;  1PD9 A;  4KBN A;  5HPB A;  1DNA A;  1BQ2 A;  2G89 A;  1DRE A;  2QK8 A;  2W9T A;  3FY9 X;  4OSG A;  5HQZ A;  1IA1 A;  1LCA A;  2HQP A;  3SRQ X;  3F0U X;  4X5H A;  1DIU A;  1BKO A;  1DLS A;  1VZB A;  3BZ0 A;  1KMV A;  1ZDR A;  3NZ9 X;  4KJK A;  1HW4 A;  1U70 A;  1HZW A;  4QHV A;  1BO8 A;  4HOF A;  2HM9 A;  3SRS X;  1BQ1 A;  2FTN A;  2JYB A;  1D1G A;  4ELH A;  1AI9 A;  1DYH A;  4I1N A;  1TVU A;  5U26 A;  1DIS A;  4XT7 A;  3JWC A;  2DRC A;  4LAH X;  3FQC A;  3DL5 A;  4KL9 A;  4M7V A;  3DRC A;  3KY8 A;  1IA3 A;  4G95 A;  1RG7 A;  1TDC A;  4G2O X;  4FGH A;  1J3K C;  1E26 A;  4EJ1 A;  4G6W X;  2KGK A;  1LCE A;  4EIG A;  3CL9 A;  2RD8 A;  4QLG A;  3KGY A;  4X5I A;  2RDA A;  4QJZ D;  1TSW A;  7DFR A;  1FWM A;  1RB2 A;  1DRB A;  2OIP A;  3QLS A;  3VCO A;  1RH3 A;  1HFP A;  3EEK A;  1DF7 A;  3L3R A;  3QGT A;  1OHK A;  3N5E A;  2GD9 A;  5HVE A;  3F0X X;  1RC4 A;  3M08 A;  2CIG A;  3I8A X;  4H0R A;  4E28 A;  3QLW A;  3CSE A;  4IQQ A;  3KFY A;  1CZ3 A;  1BKP A;  4NX6 A;  3TQ9 A;  3UM8 A;  2W3A A;  4XT6 A;  1ZPR A;  3TD8 A;  2BL9 A;  3F0V X;  1IA2 A;  3QYL A;  3UM5 A;  5CCC A;  1JOL A;  2DHF A;  3HJ3 A;  3B9H A;  4XT8 A;  4KFJ A;  4H95 A;  3KJS A;  3NXT A;  3FYW X;  1QQQ A;  3EX8 A;  1LUD A;  1AJM A;  4IQB A;  5U27 A;  1VJ3 A;  1RX5 A;  3FQV A;  4X5J A;  2KCE A;  5DXV A;  1M7A A;  1DHF A;  2BBQ A;  3QYO A;  3SRR X;  5ECX A;  1J3J A;  3N0H A;  4XSC A;  2ONB A;  4PDJ A;  1RD7 A;  4M2X A;  1I00 A;  1JOM A;  1JUT A;  2O7P A;  3TQ8 A;  3IRN A;  1TSL A;  1TSD A;  4KNE A;  4P3R A;  3NXV A;  4XSD A;  4TU5 X;  3ROA A;  1DAJ A;  1DHI A;  5HUI A;  1DR7 A;  2W3W A;  4GD7 A;  1U71 A;  1LCB A;  3BFI A;  2G8X A;  1SEJ A;  3FRD X;  3IX9 A;  3TQA A;  1NJD A;  2W3V A;  3QL3 A;  3QFX A;  3JW5 A;  3JSU A;  3DG8 A;  1VDR A;  3EEL A;  4EIL A;  2FZJ A;  3IX6 A;  1JTU A;  3FRE X;  4H98 A;  3IRM A;  5HS3 A;  3SQY X;  3DGA A;  3N5E B;  1J3I A;  1TVW A;  3FY8 X;  1AO8 A;  3K2H A;  2VET A;  3GHV A;  6DFR A;  1RA1 A;  2ANO A;  2TDM A;  3Q1H A;  3GI2 A;  2ITH A;  2BLB A;  4XRB A;  4FOA A;  3SR5 X;  1VZA A;  2P4G A;  3GYF A;  4GH8 A;  4ELF A;  1M79 A;  3SA1 A;  3NRR A;  4UP1 A;  3IRO A;  3QLZ A;  1DR5 A;  3QLY A;  4X5G A;  1JTQ A;  2FTO X;  4DFR A;  1TSN A;  4PTH A;  4DPD A;  4PSY A;  4F2V A;  3NU0 A;  2C2S A;  4P3Q A;  3BYX A;  1M78 A;  1DRF A;  4FHB A;  3DFR A;  4PSG A;  3HB8 A;  3DAT A;  1PDB A;  1RX2 A;  1MVS A;  2HXV A;  4XSE A;  4HOE A;  3OCH A;  3K74 A;  1RA9 A;  3LG4 A;  1DDR A;  1KLK A;  1BID A;  1TSZ A;  3DL6 A;  2CD2 A;  2FTQ A;  2FZI A;  3TQB A;  3EGY X;  4O1X D;  3BGX A;  4QLF A;  1TLC A;  1U72 A;  4KJL A;  1DG5 A;  1NCE A;  3F91 A;  3SRU X;  3R33 A;  1TJS A;  4LEK X;  4CD2 A;  5JG0 X;  2A9W A;  2XW7 A;  4KD7 A;  8DFR A;  1AIQ A;  3FS6 A;  2VF0 A;  1RX8 A;  3QG2 A;  3FYV X;  4P66 A;  3NXX A;  2G6V A;  2TSR A;  5HI6 A;  3NXO A;  1S3Y A;  1TDU A;  3D84 X;  3F0S X;  3NZC X;  3SH2 A;  3FL8 A;  3DAU A;  1S3W A;  1OHJ A;  2G8D A;  4PSS A;  4E5O A;  4XT4 A;  5EAJ A;  2W9H A;  1IA4 A;  4P68 A;  3JW3 A;  3EDW X;  2BLC A;  1DR2 A;  4M6J A;  3TMS A;  1CD2 A;  5J7W A;  1DG8 A;  3BNZ A;  4GYH A;  1RA8 A;  4G8Z X;  3E0B A;  4Q6A A;  1BJG A;  1F4C A;  1F4D A;  1F4G A;  4HA9 A;  1J3K A;  3BHR A;  3S3V A;  4H1I A;  1F4B A;  1TDR A;  1JU6 A;  1TSY A;  3GHW A;  1TYS A;  4M6L A;  4RGC A;  2OBC A;  4OR7 A;  1NJB A;  1HVY A;  4QJC A;  4ISW A;  4DQ1 A;  4PTJ A;  5HF2 X;  2W3B A;  4H96 A;  4KPW A;  1RX1 A;  1KCE A;  1B5E A;  3F0B X;  3QLR A;  1DLR A;  5H39 A;  1TSX A;  3KJR A;  3C0A A;  1HW3 A;  1RA3 A;  1TRG A;  4FOG A;  3NZB X;  2INQ A;  4IRR A;  1RTS A;  4G3M A;  5E8Q A;  3EF9 A;  4Q0E A;  3QL0 A;  3ED7 A;  1VZE A;  1MVT A;  4KNZ A;  5JA3 A;  3SRW X;  3F8Z A;  3JTW A;  5FDA A;  4DP3 A;  3GH2 X;  4KY8 A;  1AXW A;  1KZJ A;  3B5B A;  2G86 A;  1LY3 A;  1AOE A;  5H3A A;  1DDS A;  3OB7 A;  1F4F A;  2H2Q A;  2ZZA A;  3EHI X;  1JUJ A;  2AAZ A;  1EVF A;  4HA7 A;  4H97 A;  3JWF A;  3SGY A;  1KMS A;  5HT5 A;  4ELB A;  1TVV A;  2TDD A;  3FQO A;  3UM6 A;  4XE6 X;  1JUV A;  1BP0 A;  1TIS A;  3KGB A;  1BPJ A;  2BLA A;  3NZA X;  4KAK A;  5H38 A;  1LY4 A;  4ECK A;  1THY A;  3EAW X;  1DYI A;  5HT4 A;  1RX3 A;  2B3Z A;  3EEM A;  4DDR A;  4LAE X;  2L28 A;  4HOG A;  3GH0 A;  3QJ7 A;  1NJA A;  3FRB X;  1BP6 A;  3FQF A;  4EIZ A;  2LF1 A;  4M7U A;  1SYN A;  3CD2 A;  3SA2 A; 
#chains in the Genus database with same CATH topology
 1BDU A;  3GHC A;  1DHJ A;  4O1U A;  3IK1 A;  1DR6 A;  1DRH A;  4FGT A;  3K47 A;  1F4E A;  1DG7 A;  3JVX A;  5BY6 A;  1RB3 A;  3IJZ A;  4QLE A;  4TMS A;  4QI9 A;  3FRA X;  1JMH A;  1BSP A;  5CC9 A;  3GG5 A;  1JG0 A;  1RA2 A;  1VZD A;  3C06 A;  3NTZ A;  1AOB A;  1BO7 A;  1DR1 A;  2ANQ A;  3F8Y A;  3IHI A;  3OAF A;  3S9U A;  1HFR A;  4PST A;  4EIN A;  5HF0 X;  1B5D A;  3EEJ A;  4ISK A;  1BSF A;  1EVG A;  1KZI A;  4KJJ A;  1YHO A;  1JMF A;  1J3J C;  5HSR A;  4KM2 A;  4IXG X;  3N5G A;  3IK0 A;  5WRN A;  1NJE A;  1EV8 A;  4Q0D A;  3UWL A;  4KLX A;  4JEF A;  1YPV A;  3H9K A;  2C2T A;  4KEB A;  3ZPG A;  1B49 A;  2D5N A;  4X5F A;  1DDU A;  4LRR A;  1PD8 A;  1RF7 A;  3FL9 A;  2W9S A;  1BZF A;  1VZC A;  1DRA A;  3EBU A;  1TLS A;  3DG8 C;  4KYA A;  1TSV A;  4Q67 A;  4GEV A;  1DYJ A;  4EZ8 A;  1HFQ A;  2W9G A;  3K45 A;  4ELG A;  1CI7 A;  3DGA C;  1J3I C;  1TDA A;  1QZF A;  2FZH A;  1TDB A;  4EB4 A;  1RE7 A;  4O7U A;  5FCT A;  5HVB A;  1F28 A;  3INV A;  3NXR A;  3D80 A;  3QLX A;  3V8H A;  3F0Q X;  1RX6 A;  4FOX A;  4DPH A;  1AN5 A;  1FFL A;  3JWM A;  4M6K A;  4KY4 A;  3FQZ A;  4I13 A;  1RX7 A;  4FGG A;  3HBB A;  3FQ0 A;  2TSC A;  3EJL A;  4IXF X;  4KM0 A;  1TSM A;  1DR4 A;  1RX9 A;  4LAG X;  4XT5 A;  4IXE D;  1DYR A;  4O1X A;  3RG9 A;  2RD8 B;  1DR3 A;  3FRF X;  5HQY A;  5DFR A;  4FQS A;  2AZN A;  2W3M A;  3IA4 A;  1RX4 A;  3EIG A;  3UWL B;  1S3U A;  3ZPC A;  3BHL A;  3CLB A;  3NZ6 X;  4XEC X;  3NZD A;  1JMG A;  1S3V A;  3RO9 A;  3JWK A;  2D0K A;  4ELE A;  3S7A A;  5HSU A;  1NJC A;  3I3R A;  4NX7 A;  3NXY A;  1BOZ A;  2G8A A;  3M09 A;  1B02 A;  4H0U A;  3SAI A;  1EV5 A;  1JMI A;  5ECC A;  3IA5 A;  1PD9 A;  4KBN A;  5HPB A;  1DNA A;  1BQ2 A;  2G89 A;  1DRE A;  2QK8 A;  2W9T A;  3FY9 X;  4OSG A;  5HQZ A;  1IA1 A;  1LCA A;  2HQP A;  3SRQ X;  3F0U X;  4X5H A;  1DIU A;  1BKO A;  1DLS A;  1VZB A;  3BZ0 A;  1KMV A;  1ZDR A;  3NZ9 X;  4KJK A;  1HW4 A;  1U70 A;  1HZW A;  4QHV A;  1BO8 A;  4HOF A;  2HM9 A;  3SRS X;  1BQ1 A;  2FTN A;  2JYB A;  1D1G A;  4ELH A;  1AI9 A;  1DYH A;  4I1N A;  1TVU A;  5U26 A;  1DIS A;  4XT7 A;  3JWC A;  2DRC A;  4LAH X;  3FQC A;  3DL5 A;  4KL9 A;  4M7V A;  3DRC A;  3KY8 A;  1IA3 A;  4G95 A;  1RG7 A;  1TDC A;  4G2O X;  4FGH A;  1J3K C;  1E26 A;  4EJ1 A;  4G6W X;  2KGK A;  1LCE A;  4EIG A;  3CL9 A;  2RD8 A;  4QLG A;  3KGY A;  4X5I A;  2RDA A;  4QJZ D;  1TSW A;  7DFR A;  1FWM A;  1RB2 A;  1DRB A;  2OIP A;  3QLS A;  3VCO A;  1RH3 A;  1HFP A;  3EEK A;  1DF7 A;  3L3R A;  3QGT A;  1OHK A;  3N5E A;  2GD9 A;  5HVE A;  3F0X X;  1RC4 A;  3M08 A;  2CIG A;  3I8A X;  4H0R A;  4E28 A;  3QLW A;  3CSE A;  4IQQ A;  3KFY A;  1CZ3 A;  1BKP A;  4NX6 A;  3TQ9 A;  3UM8 A;  2W3A A;  4XT6 A;  1ZPR A;  3TD8 A;  2BL9 A;  3F0V X;  1IA2 A;  3QYL A;  3UM5 A;  5CCC A;  1JOL A;  2DHF A;  3HJ3 A;  3B9H A;  4XT8 A;  4KFJ A;  4H95 A;  3KJS A;  3NXT A;  3FYW X;  1QQQ A;  3EX8 A;  1LUD A;  1AJM A;  4IQB A;  5U27 A;  1VJ3 A;  1RX5 A;  3FQV A;  4X5J A;  2KCE A;  5DXV A;  1M7A A;  1DHF A;  2BBQ A;  3QYO A;  3SRR X;  5ECX A;  1J3J A;  3N0H A;  4XSC A;  2ONB A;  4PDJ A;  1RD7 A;  4M2X A;  1I00 A;  1JOM A;  1JUT A;  2O7P A;  3TQ8 A;  3IRN A;  1TSL A;  1TSD A;  4KNE A;  4P3R A;  3NXV A;  4XSD A;  4TU5 X;  3ROA A;  1DAJ A;  1DHI A;  5HUI A;  1DR7 A;  2W3W A;  4GD7 A;  1U71 A;  1LCB A;  3BFI A;  2G8X A;  1SEJ A;  3FRD X;  3IX9 A;  3TQA A;  1NJD A;  2W3V A;  3QL3 A;  3QFX A;  3JW5 A;  3JSU A;  3DG8 A;  1VDR A;  3EEL A;  4EIL A;  2FZJ A;  3IX6 A;  1JTU A;  3FRE X;  4H98 A;  3IRM A;  5HS3 A;  3SQY X;  3DGA A;  3N5E B;  1J3I A;  1TVW A;  3FY8 X;  1AO8 A;  3K2H A;  2VET A;  3GHV A;  6DFR A;  1RA1 A;  2ANO A;  2TDM A;  3Q1H A;  3GI2 A;  2ITH A;  2BLB A;  4XRB A;  4FOA A;  3SR5 X;  1VZA A;  2P4G A;  3GYF A;  4GH8 A;  4ELF A;  1M79 A;  3SA1 A;  3NRR A;  4UP1 A;  3IRO A;  3QLZ A;  1DR5 A;  3QLY A;  4X5G A;  1JTQ A;  2FTO X;  4DFR A;  1TSN A;  4PTH A;  4DPD A;  4PSY A;  4F2V A;  3NU0 A;  2C2S A;  4P3Q A;  3BYX A;  1M78 A;  1DRF A;  4FHB A;  3DFR A;  4PSG A;  3HB8 A;  3DAT A;  1PDB A;  1RX2 A;  1MVS A;  2HXV A;  4XSE A;  4HOE A;  3OCH A;  3K74 A;  1RA9 A;  3LG4 A;  1DDR A;  1KLK A;  1BID A;  1TSZ A;  3DL6 A;  2CD2 A;  2FTQ A;  2FZI A;  3TQB A;  3EGY X;  4O1X D;  3BGX A;  4QLF A;  1TLC A;  1U72 A;  4KJL A;  1DG5 A;  1NCE A;  3F91 A;  3SRU X;  3R33 A;  1TJS A;  4LEK X;  4CD2 A;  5JG0 X;  2A9W A;  2XW7 A;  4KD7 A;  8DFR A;  1AIQ A;  3FS6 A;  2VF0 A;  1RX8 A;  3QG2 A;  3FYV X;  4P66 A;  3NXX A;  2G6V A;  2TSR A;  5HI6 A;  3NXO A;  1S3Y A;  1TDU A;  3D84 X;  3F0S X;  3NZC X;  3SH2 A;  3FL8 A;  3DAU A;  1S3W A;  1OHJ A;  2G8D A;  4PSS A;  4E5O A;  4XT4 A;  5EAJ A;  2W9H A;  1IA4 A;  4P68 A;  3JW3 A;  3EDW X;  2BLC A;  1DR2 A;  4M6J A;  3TMS A;  1CD2 A;  5J7W A;  1DG8 A;  3BNZ A;  4GYH A;  1RA8 A;  4G8Z X;  3E0B A;  4Q6A A;  1BJG A;  1F4C A;  1F4D A;  1F4G A;  4HA9 A;  1J3K A;  3BHR A;  3S3V A;  4H1I A;  1F4B A;  1TDR A;  1JU6 A;  1TSY A;  3GHW A;  1TYS A;  4M6L A;  4RGC A;  2OBC A;  4OR7 A;  1NJB A;  1HVY A;  4QJC A;  4ISW A;  4DQ1 A;  4PTJ A;  5HF2 X;  2W3B A;  4H96 A;  4KPW A;  1RX1 A;  1KCE A;  1B5E A;  3F0B X;  3QLR A;  1DLR A;  5H39 A;  1TSX A;  3KJR A;  3C0A A;  1HW3 A;  1RA3 A;  1TRG A;  4FOG A;  3NZB X;  2INQ A;  4IRR A;  1RTS A;  4G3M A;  5E8Q A;  3EF9 A;  4Q0E A;  3QL0 A;  3ED7 A;  1VZE A;  1MVT A;  4KNZ A;  5JA3 A;  3SRW X;  3F8Z A;  3JTW A;  5FDA A;  4DP3 A;  3GH2 X;  4KY8 A;  1AXW A;  1KZJ A;  3B5B A;  2G86 A;  1LY3 A;  1AOE A;  5H3A A;  1DDS A;  3OB7 A;  1F4F A;  2H2Q A;  2ZZA A;  3EHI X;  1JUJ A;  2AAZ A;  1EVF A;  4HA7 A;  4H97 A;  3JWF A;  3SGY A;  1KMS A;  5HT5 A;  4ELB A;  1TVV A;  2TDD A;  3FQO A;  3UM6 A;  4XE6 X;  1JUV A;  1BP0 A;  1TIS A;  3KGB A;  1BPJ A;  2BLA A;  3NZA X;  4KAK A;  5H38 A;  1LY4 A;  4ECK A;  1THY A;  3EAW X;  1DYI A;  5HT4 A;  1RX3 A;  2B3Z A;  3EEM A;  4DDR A;  4LAE X;  2L28 A;  4HOG A;  3GH0 A;  3QJ7 A;  1NJA A;  3FRB X;  1BP6 A;  3FQF A;  4EIZ A;  2LF1 A;  4M7U A;  1SYN A;  3CD2 A;  3SA2 A; 
#chains in the Genus database with same CATH homology
 1BDU A;  3GHC A;  1DHJ A;  4O1U A;  3IK1 A;  1DR6 A;  1DRH A;  4FGT A;  3K47 A;  1F4E A;  1DG7 A;  3JVX A;  5BY6 A;  1RB3 A;  3IJZ A;  4QLE A;  4TMS A;  4QI9 A;  3FRA X;  1JMH A;  1BSP A;  5CC9 A;  3GG5 A;  1JG0 A;  1RA2 A;  1VZD A;  3C06 A;  3NTZ A;  1AOB A;  1BO7 A;  1DR1 A;  2ANQ A;  3F8Y A;  3IHI A;  3OAF A;  3S9U A;  1HFR A;  4PST A;  4EIN A;  5HF0 X;  1B5D A;  3EEJ A;  4ISK A;  1BSF A;  1EVG A;  1KZI A;  4KJJ A;  1YHO A;  1JMF A;  1J3J C;  5HSR A;  4KM2 A;  4IXG X;  3N5G A;  3IK0 A;  5WRN A;  1NJE A;  1EV8 A;  4Q0D A;  3UWL A;  4KLX A;  4JEF A;  1YPV A;  3H9K A;  2C2T A;  4KEB A;  3ZPG A;  1B49 A;  2D5N A;  4X5F A;  1DDU A;  4LRR A;  1PD8 A;  1RF7 A;  3FL9 A;  2W9S A;  1BZF A;  1VZC A;  1DRA A;  3EBU A;  1TLS A;  3DG8 C;  4KYA A;  1TSV A;  4Q67 A;  4GEV A;  1DYJ A;  4EZ8 A;  1HFQ A;  2W9G A;  3K45 A;  4ELG A;  1CI7 A;  3DGA C;  1J3I C;  1TDA A;  1QZF A;  2FZH A;  1TDB A;  4EB4 A;  1RE7 A;  4O7U A;  5FCT A;  5HVB A;  1F28 A;  3INV A;  3NXR A;  3D80 A;  3QLX A;  3V8H A;  3F0Q X;  1RX6 A;  4FOX A;  4DPH A;  1AN5 A;  1FFL A;  3JWM A;  4M6K A;  4KY4 A;  3FQZ A;  4I13 A;  1RX7 A;  4FGG A;  3HBB A;  3FQ0 A;  2TSC A;  3EJL A;  4IXF X;  4KM0 A;  1TSM A;  1DR4 A;  1RX9 A;  4LAG X;  4XT5 A;  4IXE D;  1DYR A;  4O1X A;  3RG9 A;  2RD8 B;  1DR3 A;  3FRF X;  5HQY A;  5DFR A;  4FQS A;  2AZN A;  2W3M A;  3IA4 A;  1RX4 A;  3EIG A;  3UWL B;  1S3U A;  3ZPC A;  3BHL A;  3CLB A;  3NZ6 X;  4XEC X;  3NZD A;  1JMG A;  1S3V A;  3RO9 A;  3JWK A;  2D0K A;  4ELE A;  3S7A A;  5HSU A;  1NJC A;  3I3R A;  4NX7 A;  3NXY A;  1BOZ A;  2G8A A;  3M09 A;  1B02 A;  4H0U A;  3SAI A;  1EV5 A;  1JMI A;  5ECC A;  3IA5 A;  1PD9 A;  4KBN A;  5HPB A;  1DNA A;  1BQ2 A;  2G89 A;  1DRE A;  2QK8 A;  2W9T A;  3FY9 X;  4OSG A;  5HQZ A;  1IA1 A;  1LCA A;  2HQP A;  3SRQ X;  3F0U X;  4X5H A;  1DIU A;  1BKO A;  1DLS A;  1VZB A;  3BZ0 A;  1KMV A;  1ZDR A;  3NZ9 X;  4KJK A;  1HW4 A;  1U70 A;  1HZW A;  4QHV A;  1BO8 A;  4HOF A;  2HM9 A;  3SRS X;  1BQ1 A;  2FTN A;  2JYB A;  1D1G A;  4ELH A;  1AI9 A;  1DYH A;  4I1N A;  1TVU A;  5U26 A;  1DIS A;  4XT7 A;  3JWC A;  2DRC A;  4LAH X;  3FQC A;  3DL5 A;  4KL9 A;  4M7V A;  3DRC A;  3KY8 A;  1IA3 A;  4G95 A;  1RG7 A;  1TDC A;  4G2O X;  4FGH A;  1J3K C;  1E26 A;  4EJ1 A;  4G6W X;  2KGK A;  1LCE A;  4EIG A;  3CL9 A;  2RD8 A;  4QLG A;  3KGY A;  4X5I A;  2RDA A;  4QJZ D;  1TSW A;  7DFR A;  1FWM A;  1RB2 A;  1DRB A;  2OIP A;  3QLS A;  3VCO A;  1RH3 A;  1HFP A;  3EEK A;  1DF7 A;  3L3R A;  3QGT A;  1OHK A;  3N5E A;  2GD9 A;  5HVE A;  3F0X X;  1RC4 A;  3M08 A;  2CIG A;  3I8A X;  4H0R A;  4E28 A;  3QLW A;  3CSE A;  4IQQ A;  3KFY A;  1CZ3 A;  1BKP A;  4NX6 A;  3TQ9 A;  3UM8 A;  2W3A A;  4XT6 A;  1ZPR A;  3TD8 A;  2BL9 A;  3F0V X;  1IA2 A;  3QYL A;  3UM5 A;  5CCC A;  1JOL A;  2DHF A;  3HJ3 A;  3B9H A;  4XT8 A;  4KFJ A;  4H95 A;  3KJS A;  3NXT A;  3FYW X;  1QQQ A;  3EX8 A;  1LUD A;  1AJM A;  4IQB A;  5U27 A;  1VJ3 A;  1RX5 A;  3FQV A;  4X5J A;  2KCE A;  5DXV A;  1M7A A;  1DHF A;  2BBQ A;  3QYO A;  3SRR X;  5ECX A;  1J3J A;  3N0H A;  4XSC A;  2ONB A;  4PDJ A;  1RD7 A;  4M2X A;  1I00 A;  1JOM A;  1JUT A;  2O7P A;  3TQ8 A;  3IRN A;  1TSL A;  1TSD A;  4KNE A;  4P3R A;  3NXV A;  4XSD A;  4TU5 X;  3ROA A;  1DAJ A;  1DHI A;  5HUI A;  1DR7 A;  2W3W A;  4GD7 A;  1U71 A;  1LCB A;  3BFI A;  2G8X A;  1SEJ A;  3FRD X;  3IX9 A;  3TQA A;  1NJD A;  2W3V A;  3QL3 A;  3QFX A;  3JW5 A;  3JSU A;  3DG8 A;  1VDR A;  3EEL A;  4EIL A;  2FZJ A;  3IX6 A;  1JTU A;  3FRE X;  4H98 A;  3IRM A;  5HS3 A;  3SQY X;  3DGA A;  3N5E B;  1J3I A;  1TVW A;  3FY8 X;  1AO8 A;  3K2H A;  2VET A;  3GHV A;  6DFR A;  1RA1 A;  2ANO A;  2TDM A;  3Q1H A;  3GI2 A;  2ITH A;  2BLB A;  4XRB A;  4FOA A;  3SR5 X;  1VZA A;  2P4G A;  3GYF A;  4GH8 A;  4ELF A;  1M79 A;  3SA1 A;  3NRR A;  4UP1 A;  3IRO A;  3QLZ A;  1DR5 A;  3QLY A;  4X5G A;  1JTQ A;  2FTO X;  4DFR A;  1TSN A;  4PTH A;  4DPD A;  4PSY A;  4F2V A;  3NU0 A;  2C2S A;  4P3Q A;  3BYX A;  1M78 A;  1DRF A;  4FHB A;  3DFR A;  4PSG A;  3HB8 A;  3DAT A;  1PDB A;  1RX2 A;  1MVS A;  2HXV A;  4XSE A;  4HOE A;  3OCH A;  3K74 A;  1RA9 A;  3LG4 A;  1DDR A;  1KLK A;  1BID A;  1TSZ A;  3DL6 A;  2CD2 A;  2FTQ A;  2FZI A;  3TQB A;  3EGY X;  4O1X D;  3BGX A;  4QLF A;  1TLC A;  1U72 A;  4KJL A;  1DG5 A;  1NCE A;  3F91 A;  3SRU X;  3R33 A;  1TJS A;  4LEK X;  4CD2 A;  5JG0 X;  2A9W A;  2XW7 A;  4KD7 A;  8DFR A;  1AIQ A;  3FS6 A;  2VF0 A;  1RX8 A;  3QG2 A;  3FYV X;  4P66 A;  3NXX A;  2G6V A;  2TSR A;  5HI6 A;  3NXO A;  1S3Y A;  1TDU A;  3D84 X;  3F0S X;  3NZC X;  3SH2 A;  3FL8 A;  3DAU A;  1S3W A;  1OHJ A;  2G8D A;  4PSS A;  4E5O A;  4XT4 A;  5EAJ A;  2W9H A;  1IA4 A;  4P68 A;  3JW3 A;  3EDW X;  2BLC A;  1DR2 A;  4M6J A;  3TMS A;  1CD2 A;  5J7W A;  1DG8 A;  3BNZ A;  4GYH A;  1RA8 A;  4G8Z X;  3E0B A;  4Q6A A;  1BJG A;  1F4C A;  1F4D A;  1F4G A;  4HA9 A;  1J3K A;  3BHR A;  3S3V A;  4H1I A;  1F4B A;  1TDR A;  1JU6 A;  1TSY A;  3GHW A;  1TYS A;  4M6L A;  4RGC A;  2OBC A;  4OR7 A;  1NJB A;  1HVY A;  4QJC A;  4ISW A;  4DQ1 A;  4PTJ A;  5HF2 X;  2W3B A;  4H96 A;  4KPW A;  1RX1 A;  1KCE A;  1B5E A;  3F0B X;  3QLR A;  1DLR A;  5H39 A;  1TSX A;  3KJR A;  3C0A A;  1HW3 A;  1RA3 A;  1TRG A;  4FOG A;  3NZB X;  2INQ A;  4IRR A;  1RTS A;  4G3M A;  5E8Q A;  3EF9 A;  4Q0E A;  3QL0 A;  3ED7 A;  1VZE A;  1MVT A;  4KNZ A;  5JA3 A;  3SRW X;  3F8Z A;  3JTW A;  5FDA A;  4DP3 A;  3GH2 X;  4KY8 A;  1AXW A;  1KZJ A;  3B5B A;  2G86 A;  1LY3 A;  1AOE A;  5H3A A;  1DDS A;  3OB7 A;  1F4F A;  2H2Q A;  2ZZA A;  3EHI X;  1JUJ A;  2AAZ A;  1EVF A;  4HA7 A;  4H97 A;  3JWF A;  3SGY A;  1KMS A;  5HT5 A;  4ELB A;  1TVV A;  2TDD A;  3FQO A;  3UM6 A;  4XE6 X;  1JUV A;  1BP0 A;  1TIS A;  3KGB A;  1BPJ A;  2BLA A;  3NZA X;  4KAK A;  5H38 A;  1LY4 A;  4ECK A;  1THY A;  3EAW X;  1DYI A;  5HT4 A;  1RX3 A;  2B3Z A;  3EEM A;  4DDR A;  4LAE X;  2L28 A;  4HOG A;  3GH0 A;  3QJ7 A;  1NJA A;  3FRB X;  1BP6 A;  3FQF A;  4EIZ A;  2LF1 A;  4M7U A;  1SYN A;  3CD2 A;  3SA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...