3QGUA

L,l-diaminopimelate aminotransferase from chalmydomonas reinhardtii
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
406
structure length
406
Chain Sequence
GTIDVQRNENFGKLRAGYLFPEIARRRKAHQEKNPDAKIISLGIGDTTEPLPKYIADAMAKAAAGLATREGYSGYGAEQGQGALREAVASTFYGHAGRAADEIFISDGSKCDIARIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPDNHFFPDLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKNGSILVYDAAYALYISNPDCPKTIYEIPGADEVAIETCSFSKYAGFTGVRLGWTVVPKALKYANGEPVHADWNRVMTTCFNGASNIVQAGGLACLQPEGLKEMNAMIKFYKENAQILKTTFTEMGFSVYGGDDAPYIWVGFPGKPSWDVFAEILERCNIVTTPGSGYGPAGEGFVRASAFGSRENILEAVRRFKEAYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LL-diaminopimelate aminotransferase
publication title L,L-Diaminopimelate Aminotransferase from Chlamydomonas reinhardtii: A Target for Algaecide Development
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Transferase
total genus 154
structure length 406
sequence length 406
chains with identical sequence B
ec nomenclature ec 2.6.1.83: LL-diaminopimelate aminotransferase.
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3qguA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3qguA01
2D7YA 1O4SA 2HOZA 3QGUA 3F9TA 4KYOA 3PGYA 2YHKA 4Q76A 1YJZA 1C0NA 1SVVA 5TF5A 1X29A 1X2AA 1KL2A 2VGTA 5FT5A 2HOXA 2YRIA 5HHYA 3NDNA 2VMVA 2VI9A 3AEPA 5AX8A 1IUGA 1TOKA 2PB0A 3EIBA 2QBTA 2D5YA 9AATA 3ZRQA 3FTBA 1TATA 1FG7A 2RFVA 4A6TA 1W7MA 2XH1A 2W7HA 1MLYA 2AY5A 3LVLB 3DR7A 4M2KA 2V0YA 1I48A 1AMQA 1G4XA 2YRRA 3L44A 5FT6A 1EJIA 4PFFA 3IF2A 3PD6B 4NOGA 2BKWA 1GBNA 1CL1A 1V2EA 2EZ1A 4DGTA 5F8VA 2VLHA 5JAYA 1YJSA 4F5LA 4WYGA 3TCMA 5EFSA 1C7OA 1M0PA 3AATA 3LWSA 4F5HA 1H0CA 4JE5A 4WYDA 5EIGA 2R2NA 2HOYA 2WK8A 3EZ1A 3JWBA 3QN6A 4A72A 3VOMA 2OQXA 3ZZKA 1YAAA 3CAIA 1ASMA 3F6TA 2TPLA 3JZLA 3NU8A 4JE5D 2VMRA 3MADA 2FM1A 1W7LA 2FQ6A 1ARIA 3AENA 3BWNC 3EI6A 1BS0A 4Y0HA 3TFTA 4RJ0A 3RBFA 1CZCA 1VJOA 4I8AA 4RKDA 2WK9A 2HUUA 2DKBA 2X3LA 4RJYA 1AKAA 2JJGA 4OBUA 2ZY4A 1ORDA 1JS6A 4MKJA 4TV7A 3GZDC 5M49A 3A2BA 1PFFA 1AIAA 3ELEA 3I4JA 4W1WA 1VEFA 4UHNA 1D2FA 3BC8A 2JG2A 4ZSYA 5FT4A 3VK4A 4W5KA 2CTZA 3BCAA 3UE8A 1KMJA 1QGNA 3GETA 1ELUA 4AOAA 1OHYA 2W7DA 4F5FA 2CJDA 1GEWA 3MAFB 2YOBA 1DJEA 3W1HA 3MKJA 3PDXA 3B1DA 3BN1A 5G2QA 2NMPA 1ECXA 5I92A 2CSTA 4PVFA 4CXRA 1IVRA 4R5FA 2VIBA 5G4JA 4UQVA 5LH9A 2HP2A 2G6WA 3FSLA 3VP6A 4W1XA 1AIBA 3MAUA 2GB3A 3HMUA 5EAVA 2BI1A 3AV7A 5K8BA 4TMRA 1S0AA 4WLHA 2W7IA 3HLMA 4ZDPA 2EPJA 4ZSWA 2JJFA 3CQ5A 3UWCA 3TATA 2BIAA 1AHGA 1D7VA 3A8UX 3AEJC 1W3UA 2VMYA 3LVJA 2QB3A 5BJ3A 1BJ4A 4A6UA 3ZZJA 2OKKA 4CXQA 2BI3A 4OYTA 1ZOBA 4EB7A 2VMTA 2QLRA 3K40A 4XJPA 4PFNA 1CQ6A 3BWOA 1IBJA 4GSAA 4U1TA 1SF2A 4W8IA 4XAUA 3ACZA 4LNJA 1ASBA 2BI5A 1T3IA 2O0RA 1UU2A 3K7YA 4ZASA 4F5JA 2AY8A 1LW5A 3EUCA 4WYAA 2AEUA 2D61A 2HUIA 3FCRA 3R4TA 4CBSA 4OT8A 1WYTA 4P7YA 1QITA 1RVUA 3B1EA 2ZY3A 4BMKA 3QM2A 2VMNA 4LW2A 2D65A 2JISA 1ASAA 1GEXA 1LK9A 1QZ9A 2W7KA 1MAPA 1U08A 2HORA 1DJ9A 3E2ZB 4IXZA 2VMUA 4E3QA 1B9IA 3FVSA 3ASBA 2HUFA 4ZM3A 3DU4A 2YKUA 4A00A 3EIAA 1B5OA 1O62A 1X28A 1UU0A 2Z61A 3WX9A 3NX3A 4XEWA 2ORDA 2W7JA 1IJIA 4ZDOA 4BA4A 3N75A 4AO9A 1P3WA 1G7WA 2JJHA 1GC2A 2CINA 4MSOA 2O1BA 3OKSA 1AY8A 1UU1A 4WYFA 1E5EA 4LC3A 3NYTA 1BQDA 1EG5A 3UAKA 1RV3A 3PD6A 4HF8A 4RM1A 2WKAA 4E77A 2W7LA 3QI6A 3PAAA 3Q8NA 3FQ7A 4BA5A 2E7UA 3KGXA 4WB0B 4K2IA 4HVKA 1LS3A 4F4EA 2CY8A 1D7SA 2CJGA 4JEZA 4E1OA 3E2YA 4MKKA 4Q75A 3W1IA 1OATA 4MGRA 2GMUA 1LC7A 4ZM4A 2AY2A 4Q6RA 3FVXA 3II0A 3PPLA 2FNIA 1AMSA 4IY7A 4JEXA 3WCOA 1QISA 1BQAA 1IX8A 3VK2A 3GWPA 2FNUA 1KMKA 1PG8A 1DJUA 3KE3A 1MGVA 4N0WA 4UHMA 2PB2A 5M4DA 3HDOA 1TASA 4ZLVA 1SZKA 4B9BA 5D95A 2R5CB 3ISLA 1G4VA 1PMOA 4R8DA 3EI8A 1ASLA 2CB1A 2BI9A 1GC3A 2W8TA 1TOIA 4A0GA 1IAYA 3AEOA 4A6RA 4BHDA 5BJ4A 1JS3A 3FZ6A 1AHXA 1W23A 3FD0A 5D5SA 3WZFA 1UKJA 3WCNA 1N2TA 4Q31A 3FFHA 4PIWA 3E77A 3MC6C 5E4ZA 1XI9A 1PMMA 2JGTA 2OGEA 2VGUA 4OBVA 4RLGA 1WYVB 5IWQA 3MAFA 2HZPA 2ZSLA 3ZRRA 3G0TA 1AY5A 4QGRA 3TQXA 1VP4A 1AICA 1DFOA 4W1VA 3NYUA 1ASDA 1BW0A 3NYSA 2CANA 3L8AA 4WLJA 1TPLA 2V1PA 1TOGA 1IX7A 3WKRA 1BJNA 1ASGA 1GDEA 3BWNA 3ATHA 4F5IA 2VGZA 4ZWMA 3PIUA 1J32A 3HL2A 4XK1A 2W8JA 4MQQA 3N5MA 3E2FA 4Y0DA 3QHXA 2C44A 4H51A 4XJMA 4MQPA 1AJSB 3FZ8A 4ATPA 4KAMA 2BIGA 1GEYA 4A0RA 1S06A 3EI5A 3G8MA 3EZSA 1WYUB 2Z67A 3H7FA 2XBNA 2W7GA 2DGMA 2W8WA 3LG0A 5G2PA 2W7FA 3PDBA 4F5MA 3GZDA 2W8UA 3RCHB 3HBXA 3LVKA 4EMYA 1JG8A 5G09A 2AY9A 1YJYA 2DKJA 1FC4A 3F0HA 4ZWVA 1AHEA 3G7QA 1V72A 2ZY5A 2D7ZA 4Y0IA 4WBTA 2AY7A 3AELA 3LV2A 4F5GA 3DXVA 3PDBB 4L0OA 4EFFA 3I5TA 1AMAA 1S07A 3FFRA 2YCPA 5EAAA 2AEVA 4WYEA 2AY1A 3NNKA 4MQRA 4A0HA 4M2JA 3B1CA 1D7UA 1CJ0A 1O69A 4ITXA 4JEWA 4RITA 3NU7A 3E2ZA 5DX5A 1O61A 4B98A 2OGAA 4W91A 1YNUA 4ZDLA 2AY3A 4OTLA 2YKXA 1LC8A 4DQ6A 1AMRA 3RBLA 3VK3A 2EO5A 4F5KA 1ELQA 1I29A 1QJ3A 1XEYA 3BS8A 4RAEA 2DGKA 4BQ0A 2Z20A 3WGBA 1GC0A 1OXPA 1ASNA 4XJOA 3R9AA 4ATQA 4WD2A 5F9SA 3AEMC 4ADBA 2BI2A 5E5IA 4U2HA 3EI7A 1CL2A 2BWOA 2ZP7A 1LKCA 3WY7A 1OXOA 2BYLA 2HP1A 5DJ1A 3NRAA 4JF0A 3TFUA 3DXWA 4WXFA 4IYOB 1E5FA 1B8GA 4R2NA 4WB0A 3FDDA 2CJHA 2QA3A 3ASAA 4K2MA 4OMAA 1ARGA 2AY4A 2D66A 3W1JA 4WYCA 1AKBA 5E3KA 2BIEA 2R0TA 2VMZA 3K28A 3T32A 4CVQA 1BKGA 3JWAA 3LY1A 2C7TA 4AZJA 1WKGA 4E3RA 1DGDA 4R5ZA 4ZAHA 3QBOA 2BHXA 1TOEA 3FQ8A 1GD9A 2YKVA 3NUBA 3BCXA 2ZSMA 2Z9WA 3HT4A 3DYDA 2WK7A 2R5CA 1J04A 2OATA 1EQBA 2E7JA 2W7EA 5M4BA 1LW4A 1RVYA 3PJ0A 2QB2A 1ZODA 1M7YA 1QIRA 3A9ZA 3CQ6A 1DTYA 3A9XA 2YCTA 1MAQA 3DODA 4FL0A 5EUEA 4LW4A 5FT8A 1YIYA 1BJOB 1AAWA 3GR9A 1Y4IA 1BJWA 4ADEA 2C0RA 2GSAA 4GRXA 4ADCA 5EUNA 4IX8A 3FQAA 4JEVA 2VMQA 4XQ2A 2DR1A 3E6GA 4FFCA 1CQ7A 1MDXA 2FYFA 2ZC0A 1MDOA 2GMSA 3JU7A 4A0FA 5DB5A 3I16A 2VLFA 2F8JA 3EI9A 2EZ2A 5G4IA 1WYVA 1AJRA 4LNLA 1B5PA 4IXOA 2Z9UA 2ZJGA 3N0LA 2CH2A 2OKJA 4LNMA 2QMAA 5DJ9A 1ARHA 2PO3A 2Z1ZA 1MDZA 2VIAA 1AX4A 3P1TA 3BV0A 3BCBA 4AO4A 1SPAA 2W7MA 3RQ1A 4DBCA 2EGYA 4GE9A 1M32A 3GBXA 4GEBA 4IW7A 4JEYA 3AOVA 1CZEA 3DC1A 4OCAA 3B46A 5LHAA 1H1CA 2W8VA 1AJSA 2C81A 3COGA 4KXKA 4TN4A 5EIGB 4GE7A 3BB8A 1M0QA 4ITGA 1WYUA 1IX6A 2VYCA 1GCKA 2CFBA 1N31A 3CBFA 4XJLA 1B4XA 1YOOA 3DR4A 3RCHA 5HXXA 3FDBA 1M0OA 4N0BA 3ZRPA 4UHOA 1M6SA 1MLZA 1CS1A 3RUYA 3AENB 2FN6A 2DGLA 3MC6A 1C4KA 2D64A 1KL1A 5G0AA 1KKPA 3DRDA 1M4NA 4EB5A 2X5FA 2VGSA 4RIZA 1Z3ZA 4CBRA 1TOJA 1V2DA 2VMWA 3MBBA 3QPGA 2Z9VA 1WKHA 2YCNA 4AH3A 3PA9A 3FRKA 1ARTA 1C7NA 2Z9XA 3FZ7A 1OHWA 2VMPA 3OP7A 2E54A 2VGWA 4ISYA 3AOWA 3M5UA 1ARSA 2E7IA 4AZKA 4J8LA 2R5EA 1YIZA 2YKYA 2BWNA 1BT4A 4O6ZA 3FKDA 1D7RA 1DGEA 3GJUA 1RV4A 1V2FA 4RKCA 1B9HA 3RI6A 3D6KA 3NTJA 3USFA 1SFFA 2D63A 2Q7WA 2AATA 1SZUA 1I43A 1S08A 2BYJA 2JJEA 4K2BA 5EUDA 1AHFA 1LC5A 3DZZA 1KKJA 4MY5A 1AKCA 1G7XA 4ADDA 3LVMA 1AY4A 3AEJA 4P3MA 1WSTA 1N8PA 2EH6A 1FG3A 4EU1A 1GC4A 2DOUA 2CH1A 1ASCA 1ASEA 4IYOA 5HDMA 2ZUKA 1DKAA 2VMOA 3ELPA 3GSBA 3HQTA 4GDYA 4UOYA 1ZC9A 3KGWA 5M46A 8AATA 3MEBA 3JW9A 2VMXA 2VMSA 2GQNA 2VGVA 1W7NA 1TARA 2ZY2A 3KKIA 4OC9A 1X0MA 3FVUA 3ECDA 1QJ5A 1Z7DA 4M2MA 3GZCA 5EQCA 1JF9A 2Z1YA 4IXSA 4WXGA 3WKSA 1AAMA 2AY6A 5C6UA 1C9CA 1I41A 2O7CA 2X5DA 3WLXA 2BWPA 3H14A 3WGCA 3HVYA 3JTXA 1AHYA 1C7GA 1IAXA 1OHVA 1M0NA 3A9YA 3B8XA 2ZYJA 1SZSA 1WYTB 2VI8A 5J8QA 1ASFA 3NUIA 2X8UA 4WP0A 1S09A 1CQ8A 3E9KA 3IHJA 3P6KA 4J5UA 3VAXA 4WXBA 3AEMA 3CQ4A 1BJOA 7AATA 4JF1A 4GE4A
chains in the Genus database with same CATH superfamily
2D7YA 1O4SA 2HOZA 3QGUA 3F9TA 4KYOA 3PGYA 2YHKA 4Q76A 1YJZA 1C0NA 1SVVA 5TF5A 1X29A 1X2AA 1KAFA 1KL2A 2VGTA 5FT5A 2HOXA 2YRIA 5HHYA 2G7JA 3NDNA 2VMVA 2VI9A 3AEPA 5AX8A 1IUGA 1TOKA 2PB0A 3EIBA 2QBTA 2D5YA 9AATA 3ZRQA 3FTBA 1TATA 1FG7A 2RFVA 4A6TA 1W7MA 2XH1A 2W7HA 1MLYA 2AY5A 3LVLB 3DR7A 4M2KA 2V0YA 1I48A 1AMQA 1G4XA 2YRRA 3L44A 5FT6A 1EJIA 4PFFA 3IF2A 3PD6B 4NOGA 2BKWA 1GBNA 1CL1A 1V2EA 2EZ1A 4DGTA 5F8VA 2VLHA 5JAYA 1YJSA 4F5LA 4WYGA 3TCMA 5EFSA 1C7OA 1M0PA 3AATA 3LWSA 4F5HA 1H0CA 4JE5A 4WYDA 5EIGA 2R2NA 2HOYA 2WK8A 3EZ1A 3JWBA 3QN6A 4A72A 3VOMA 2OQXA 3ZZKA 1YAAA 3CAIA 1ASMA 3F6TA 2TPLA 3JZLA 3NU8A 4JE5D 2VMRA 3MADA 2FM1A 1W7LA 2FQ6A 1ARIA 3AENA 3BWNC 3EI6A 1BS0A 4Y0HA 3TFTA 4RJ0A 3RBFA 1CZCA 1VJOA 4I8AA 4RKDA 2WK9A 2HUUA 2DKBA 2X3LA 2FKIA 4RJYA 1AKAA 2JJGA 4OBUA 2ZY4A 1ORDA 1JS6A 4MKJA 4TV7A 3GZDC 5M49A 3A2BA 1PFFA 1AIAA 3ELEA 3I4JA 4W1WA 1VEFA 4UHNA 1D2FA 3BC8A 2JG2A 4ZSYA 5FT4A 3VK4A 4W5KA 2CTZA 3BCAA 3UE8A 1KMJA 1QGNA 3GETA 1ELUA 4AOAA 1OHYA 2W7DA 4F5FA 2CJDA 1GEWA 3MAFB 2YOBA 1DJEA 3W1HA 3MKJA 3PDXA 3B1DA 3BN1A 5G2QA 2NMPA 1ECXA 5KTBA 5I92A 2CSTA 4PVFA 4CXRA 1IVRA 4R5FA 2VIBA 5G4JA 4UQVA 5LH9A 2KFPA 2HP2A 2G6WA 3FSLA 3VP6A 4W1XA 1AIBA 3MAUA 2GB3A 3HMUA 5EAVA 2BI1A 3AV7A 5K8BA 4TMRA 1S0AA 4WLHA 2W7IA 3HLMA 4ZDPA 2EPJA 4ZSWA 2JJFA 3CQ5A 3UWCA 3TATA 2BIAA 1AHGA 1D7VA 3A8UX 3AEJC 1W3UA 2VMYA 3LVJA 2QB3A 5BJ3A 1BJ4A 4A6UA 3ZZJA 2A1VA 2OKKA 4CXQA 2BI3A 4OYTA 1ZOBA 4EB7A 2VMTA 3N4RA 2QLRA 3K40A 4XJPA 4PFNA 1CQ6A 3BWOA 1IBJA 4GSAA 4U1TA 1SF2A 4W8IA 4XAUA 3ACZA 4LNJA 1ASBA 2BI5A 1T3IA 2O0RA 1UU2A 3K7YA 4ZASA 4F5JA 2AY8A 1LW5A 3EUCA 4WYAA 2AEUA 2D61A 2HUIA 3FCRA 3R4TA 4CBSA 4OT8A 1WYTA 4P7YA 1QITA 1RVUA 3B1EA 2ZY3A 4BMKA 3QM2A 2VMNA 4LW2A 2D65A 2JISA 1ASAA 1GEXA 1LK9A 1QZ9A 2W7KA 1MAPA 1U08A 2HORA 1DJ9A 3E2ZB 4IXZA 2VMUA 4E3QA 1B9IA 3FVSA 3ASBA 2HUFA 4ZM3A 3DU4A 2YKUA 4A00A 3EIAA 1B5OA 1O62A 1X28A 1UU0A 2Z61A 3WX9A 3NX3A 4XEWA 2ORDA 2W7JA 1IJIA 4ZDOA 4BA4A 3N75A 4AO9A 1P3WA 1G7WA 2JJHA 1GC2A 2CINA 4MSOA 2O1BA 3OKSA 1AY8A 1UU1A 4WYFA 1E5EA 4LC3A 3NYTA 1BQDA 1EG5A 3UAKA 1RV3A 3PD6A 4HF8A 4RM1A 2WKAA 4E77A 2W7LA 3QI6A 3PAAA 3Q8NA 3FQ7A 4BA5A 2E7UA 3KGXA 4WB0B 4K2IA 4HVKA 1LS3A 4F4EA 2CY8A 1D7SA 2CJGA 4JEZA 4E1OA 3E2YA 4MKKA 4Q75A 3W1IA 1OATA 4MGRA 2GMUA 1LC7A 4ZM4A 2AY2A 4Q6RA 3FVXA 3II0A 3PPLA 2FNIA 1AMSA 4IY7A 4JEXA 3WCOA 1QISA 1BQAA 1IX8A 3VK2A 3H9XA 3GWPA 2FNUA 1KMKA 1PG8A 1DJUA 3KE3A 1MGVA 4N0WA 4UHMA 2PB2A 5M4DA 3HDOA 1TASA 4ZLVA 1SZKA 4B9BA 5D95A 2R5CB 3ISLA 1G4VA 1PMOA 4K05A 4R8DA 3EI8A 1ASLA 2CB1A 2BI9A 1GC3A 2W8TA 1TOIA 4A0GA 1IAYA 3AEOA 4A6RA 4BHDA 5BJ4A 1JS3A 3FZ6A 1AHXA 1W23A 3FD0A 5D5SA 3WZFA 1UKJA 3WCNA 1N2TA 4Q31A 3FFHA 4PIWA 3E77A 3MC6C 5E4ZA 1XI9A 1PMMA 2JGTA 2OGEA 2VGUA 4OBVA 4RLGA 3N4SA 1WYVB 5IWQA 3MAFA 2HZPA 2ZSLA 3ZRRA 3G0TA 1AY5A 4QGRA 3TQXA 1VP4A 1AICA 1DFOA 4W1VA 3NYUA 1ASDA 1BW0A 3NYSA 2CANA 3L8AA 4WLJA 1TPLA 2V1PA 1TOGA 1IX7A 3WKRA 1BJNA 1ASGA 1GDEA 3BWNA 3ATHA 4F5IA 2VGZA 4ZWMA 4H63Q 3PIUA 1J32A 3HL2A 4XK1A 2W8JA 4MQQA 3N5MA 3E2FA 4Y0DA 3QHXA 2C44A 4H51A 4XJMA 4MQPA 1AJSB 3FZ8A 4ATPA 4KAMA 2BIGA 1GEYA 4A0RA 1S06A 3EI5A 3G8MA 3EZSA 2EYQA 1WYUB 2Z67A 3H7FA 2XBNA 2W7GA 2DGMA 2W8WA 3LG0A 5G2PA 2W7FA 3PDBA 4F5MA 3GZDA 2W8UA 3RCHB 3HBXA 3LVKA 4EMYA 1JG8A 5G09A 2AY9A 1YJYA 2DKJA 1FC4A 3F0HA 4ZWVA 1AHEA 3G7QA 1V72A 2ZY5A 2D7ZA 4Y0IA 4WBTA 2AY7A 3AELA 3LV2A 4F5GA 3DXVA 3PDBB 4L0OA 4EFFA 3I5TA 1AMAA 1S07A 3FFRA 2YCPA 5EAAA 2AEVA 4WYEA 2AY1A 3NNKA 4MQRA 4A0HA 4M2JA 3B1CA 1D7UA 1CJ0A 1O69A 4ITXA 4JEWA 4RITA 3NU7A 3E2ZA 5DX5A 1O61A 4B98A 2OGAA 4W91A 1YNUA 4ZDLA 2AY3A 4OTLA 2YKXA 1LC8A 4DQ6A 1AMRA 3RBLA 3VK3A 2EO5A 4F5KA 1ELQA 1I29A 1QJ3A 1XEYA 3BS8A 4RAEA 2DGKA 4BQ0A 2Z20A 3WGBA 1GC0A 1OXPA 1ASNA 4XJOA 3R9AA 3N4XA 4ATQA 4WD2A 5F9SA 3AEMC 4ADBA 2BI2A 5E5IA 4U2HA 3EI7A 1CL2A 2BWOA 2ZP7A 1LKCA 3WY7A 1OXOA 2BYLA 2HP1A 5DJ1A 3NRAA 4JF0A 3TFUA 3DXWA 4WXFA 4IYOB 1E5FA 1B8GA 4R2NA 4WB0A 3FDDA 2CJHA 2QA3A 3ASAA 4K2MA 4OMAA 1ARGA 2AY4A 2D66A 3W1JA 4WYCA 1AKBA 5E3KA 2BIEA 2R0TA 2VMZA 3K28A 3T32A 4CVQA 1BKGA 3JWAA 3LY1A 2C7TA 4AZJA 1WKGA 4E3RA 1DGDA 4R5ZA 4ZAHA 3QBOA 2BHXA 1TOEA 3FQ8A 1GD9A 2YKVA 3NUBA 3BCXA 2ZSMA 2Z9WA 3HT4A 3DYDA 2WK7A 2R5CA 1J04A 2OATA 1EQBA 2E7JA 2W7EA 5M4BA 1LW4A 1RVYA 3PJ0A 2QB2A 1ZODA 1M7YA 1QIRA 3A9ZA 3CQ6A 1DTYA 3A9XA 2YCTA 1MAQA 3DODA 4FL0A 5EUEA 4LW4A 5FT8A 1YIYA 1BJOB 1AAWA 3GR9A 1Y4IA 1BJWA 4ADEA 3N7NA 2C0RA 2GSAA 4GRXA 4ADCA 5EUNA 4IX8A 3FQAA 4JEVA 2VMQA 4XQ2A 2DR1A 3E6GA 4FFCA 1CQ7A 1MDXA 2FYFA 2ZC0A 1MDOA 2GMSA 3JU7A 4A0FA 5DB5A 3I16A 2VLFA 2F8JA 3EI9A 2EZ2A 5G4IA 1WYVA 1AJRA 4LNLA 1B5PA 4IXOA 2Z9UA 2ZJGA 3N0LA 2CH2A 2OKJA 4LNMA 2QMAA 5DJ9A 1ARHA 2PO3A 2Z1ZA 1MDZA 2VIAA 1AX4A 3P1TA 2WB6A 3BV0A 3BCBA 4AO4A 1SPAA 2W7MA 3RQ1A 4DBCA 2EGYA 4GE9A 1M32A 3GBXA 4GEBA 4IW7A 4JEYA 3AOVA 1CZEA 3DC1A 4OCAA 3B46A 5LHAA 1H1CA 2W8VA 1AJSA 2C81A 3COGA 4KXKA 4TN4A 5EIGB 4GE7A 3BB8A 1M0QA 4ITGA 1WYUA 1IX6A 2VYCA 1GCKA 2CFBA 1N31A 3CBFA 4XJLA 1B4XA 1YOOA 3DR4A 3RCHA 5HXXA 3FDBA 1M0OA 4N0BA 3ZRPA 4UHOA 1M6SA 1MLZA 1CS1A 3RUYA 3AENB 2FN6A 2DGLA 3MC6A 1C4KA 2D64A 1KL1A 5G0AA 1KKPA 3DRDA 1M4NA 4EB5A 2X5FA 2VGSA 4RIZA 1Z3ZA 4CBRA 1TOJA 1V2DA 2VMWA 3MBBA 3QPGA 2Z9VA 1WKHA 2YCNA 4AH3A 3PA9A 3FRKA 1ARTA 1C7NA 2Z9XA 3FZ7A 1OHWA 2VMPA 3OP7A 2E54A 2VGWA 4ISYA 3AOWA 3M5UA 1ARSA 2E7IA 4AZKA 4J8LA 2R5EA 1YIZA 2YKYA 2BWNA 1BT4A 4O6ZA 3FKDA 1D7RA 1DGEA 3GJUA 1RV4A 1V2FA 4RKCA 1B9HA 3RI6A 3D6KA 3NTJA 3USFA 1SFFA 2D63A 2Q7WA 2AATA 1SZUA 1I43A 1S08A 2BYJA 2JJEA 4K2BA 5EUDA 1AHFA 1LC5A 3DZZA 1KKJA 4MY5A 1AKCA 1G7XA 4ADDA 3LVMA 1AY4A 3AEJA 4P3MA 1WSTA 1N8PA 2EH6A 1FG3A 4EU1A 1GC4A 2DOUA 2CH1A 1ASCA 1ASEA 4IYOA 5HDMA 2ZUKA 1DKAA 2VMOA 3ELPA 3GSBA 3HQTA 4GDYA 4UOYA 1ZC9A 3KGWA 5M46A 8AATA 3MEBA 3JW9A 2VMXA 2VMSA 2GQNA 2VGVA 1W7NA 1TARA 2ZY2A 3KKIA 4OC9A 1X0MA 3FVUA 3ECDA 1QJ5A 1Z7DA 4M2MA 2QSRA 3GZCA 5EQCA 1JF9A 2Z1YA 4IXSA 4WXGA 3WKSA 1AAMA 2AY6A 5C6UA 1C9CA 1I41A 2O7CA 2X5DA 3WLXA 2BWPA 3H14A 3WGCA 3HVYA 3JTXA 1AHYA 1C7GA 1IAXA 1OHVA 1M0NA 3A9YA 3B8XA 2ZYJA 1SZSA 1WYTB 2VI8A 5J8QA 1ASFA 3NUIA 2X8UA 4WP0A 1S09A 1CQ8A 3E9KA 3IHJA 3P6KA 4J5UA 3VAXA 4WXBA 3AEMA 3CQ4A 1BJOA 7AATA 4JF1A 4GE4A
chains in the Genus database with same CATH topology
2D7YA 1O4SA 2HOZA 3QGUA 3F9TA 4KYOA 3PGYA 2YHKA 4Q76A 1YJZA 1C0NA 1SVVA 5TF5A 1X29A 1X2AA 1KL2A 2VGTA 5FT5A 2HOXA 2YRIA 5HHYA 2G7JA 3NDNA 2VMVA 2VI9A 3AEPA 5AX8A 1IUGA 1TOKA 2PB0A 3EIBA 2QBTA 2D5YA 9AATA 3ZRQA 3FTBA 1TATA 1FG7A 2RFVA 4A6TA 1W7MA 2XH1A 2W7HA 1MLYA 2AY5A 3LVLB 3DR7A 4M2KA 2V0YA 1I48A 1AMQA 1G4XA 2YRRA 3L44A 5FT6A 1EJIA 4PFFA 3IF2A 3PD6B 4NOGA 2BKWA 1GBNA 1CL1A 1V2EA 2EZ1A 4DGTA 5F8VA 2VLHA 5JAYA 1YJSA 4F5LA 4WYGA 3TCMA 5EFSA 1C7OA 1M0PA 3AATA 3LWSA 4F5HA 1H0CA 4JE5A 4WYDA 5EIGA 2R2NA 2HOYA 2WK8A 3EZ1A 3JWBA 3QN6A 4A72A 3VOMA 2OQXA 3ZZKA 1YAAA 3CAIA 1ASMA 3F6TA 2TPLA 3JZLA 3NU8A 4JE5D 2VMRA 3MADA 2FM1A 1W7LA 2FQ6A 1ARIA 3AENA 3BWNC 3EI6A 1BS0A 4Y0HA 3TFTA 4RJ0A 3RBFA 1CZCA 1VJOA 4I8AA 4RKDA 2WK9A 2HUUA 2DKBA 2X3LA 2FKIA 4RJYA 1AKAA 2JJGA 4OBUA 2ZY4A 1ORDA 1JS6A 4MKJA 4TV7A 3GZDC 5M49A 3A2BA 1PFFA 1AIAA 3ELEA 3I4JA 4W1WA 1VEFA 4UHNA 1D2FA 3BC8A 2JG2A 4ZSYA 5FT4A 3VK4A 4W5KA 2CTZA 3BCAA 3UE8A 1KMJA 1QGNA 3GETA 1ELUA 4AOAA 1OHYA 2W7DA 4F5FA 2CJDA 1GEWA 3MAFB 2YOBA 1DJEA 3W1HA 3MKJA 3PDXA 3B1DA 3BN1A 5G2QA 2NMPA 1ECXA 5KTBA 5I92A 2CSTA 4PVFA 4CXRA 1IVRA 4R5FA 2VIBA 5G4JA 4UQVA 5LH9A 2KFPA 2HP2A 2G6WA 3FSLA 3VP6A 4W1XA 1AIBA 3MAUA 2GB3A 3HMUA 5EAVA 2BI1A 3AV7A 5K8BA 4TMRA 1S0AA 4WLHA 2W7IA 3HLMA 4ZDPA 2EPJA 4ZSWA 2JJFA 3CQ5A 3UWCA 3TATA 2BIAA 1AHGA 1D7VA 3A8UX 3AEJC 1W3UA 2VMYA 3LVJA 2QB3A 5BJ3A 1BJ4A 4A6UA 3ZZJA 2A1VA 2OKKA 4CXQA 2BI3A 4OYTA 1ZOBA 4EB7A 2VMTA 3N4RA 2QLRA 3K40A 4XJPA 4PFNA 1CQ6A 3BWOA 1IBJA 4GSAA 4U1TA 1SF2A 4W8IA 4XAUA 3ACZA 4LNJA 1ASBA 2BI5A 1T3IA 2O0RA 1UU2A 3K7YA 4ZASA 4F5JA 2AY8A 1LW5A 3EUCA 4WYAA 2AEUA 2D61A 2HUIA 3FCRA 3R4TA 4CBSA 4OT8A 1WYTA 4P7YA 1QITA 1RVUA 3B1EA 2ZY3A 4BMKA 3QM2A 2VMNA 4LW2A 2D65A 2JISA 1ASAA 1GEXA 1LK9A 1QZ9A 2W7KA 1MAPA 1U08A 2HORA 1DJ9A 3E2ZB 4IXZA 2VMUA 4E3QA 1B9IA 3FVSA 3ASBA 2HUFA 4ZM3A 3DU4A 2YKUA 4A00A 3EIAA 1B5OA 1O62A 1X28A 1UU0A 2Z61A 3WX9A 3NX3A 4XEWA 2ORDA 2W7JA 1IJIA 4ZDOA 4BA4A 3N75A 4AO9A 1P3WA 1G7WA 2JJHA 1GC2A 2CINA 4MSOA 2O1BA 3OKSA 1AY8A 1UU1A 4WYFA 1E5EA 4LC3A 3NYTA 1BQDA 1EG5A 3UAKA 1RV3A 3PD6A 4HF8A 4RM1A 2WKAA 4E77A 2W7LA 3QI6A 3PAAA 3Q8NA 3FQ7A 4BA5A 2E7UA 3KGXA 4WB0B 4K2IA 4HVKA 1LS3A 4F4EA 2CY8A 1D7SA 2CJGA 4JEZA 4E1OA 3E2YA 4MKKA 4Q75A 3W1IA 1OATA 4MGRA 2GMUA 1LC7A 4ZM4A 2AY2A 4Q6RA 3FVXA 3II0A 3PPLA 2FNIA 1AMSA 4IY7A 4JEXA 3WCOA 1QISA 1BQAA 1IX8A 3VK2A 3H9XA 3GWPA 2FNUA 1KMKA 1PG8A 1DJUA 3KE3A 1MGVA 4N0WA 4UHMA 2PB2A 5M4DA 3HDOA 1TASA 4ZLVA 1SZKA 4B9BA 5D95A 2R5CB 3ISLA 1G4VA 1PMOA 4K05A 4R8DA 3EI8A 1ASLA 2CB1A 2BI9A 1GC3A 2W8TA 1TOIA 4A0GA 1IAYA 3AEOA 4A6RA 4BHDA 5BJ4A 1JS3A 3FZ6A 1AHXA 1W23A 3FD0A 5D5SA 3WZFA 1UKJA 3WCNA 1N2TA 4Q31A 3FFHA 4PIWA 3E77A 3MC6C 5E4ZA 1XI9A 1PMMA 2JGTA 2OGEA 2VGUA 4OBVA 4RLGA 3N4SA 1WYVB 5IWQA 3MAFA 2HZPA 2ZSLA 3ZRRA 3G0TA 1AY5A 4QGRA 3TQXA 1VP4A 1AICA 1DFOA 4W1VA 3NYUA 1ASDA 1BW0A 3NYSA 2CANA 3L8AA 4WLJA 1TPLA 2V1PA 1TOGA 1IX7A 3WKRA 1BJNA 1ASGA 1GDEA 3BWNA 3ATHA 4F5IA 2VGZA 4ZWMA 4H63Q 3PIUA 1J32A 3HL2A 4XK1A 2W8JA 4MQQA 3N5MA 3E2FA 4Y0DA 3QHXA 2C44A 4H51A 4XJMA 4MQPA 1AJSB 3FZ8A 4ATPA 4KAMA 2BIGA 1GEYA 4A0RA 1S06A 3EI5A 3G8MA 3EZSA 2EYQA 1WYUB 2Z67A 3H7FA 2XBNA 2W7GA 2DGMA 2W8WA 3LG0A 5G2PA 2W7FA 3PDBA 4F5MA 3GZDA 2W8UA 3RCHB 3HBXA 3LVKA 4EMYA 1JG8A 5G09A 2AY9A 1YJYA 2DKJA 1FC4A 3F0HA 4ZWVA 1AHEA 3G7QA 1V72A 2ZY5A 2D7ZA 4Y0IA 4WBTA 2AY7A 3AELA 3LV2A 4F5GA 3DXVA 3PDBB 4L0OA 4EFFA 3I5TA 1AMAA 1S07A 3FFRA 2YCPA 5EAAA 2AEVA 4WYEA 2AY1A 3NNKA 4MQRA 4A0HA 4M2JA 3B1CA 1D7UA 1CJ0A 1O69A 4ITXA 4JEWA 4RITA 3NU7A 3E2ZA 5DX5A 1O61A 4B98A 2OGAA 4W91A 1YNUA 4ZDLA 2AY3A 4OTLA 2YKXA 1LC8A 4DQ6A 1AMRA 3RBLA 3VK3A 2EO5A 4F5KA 1ELQA 1I29A 1QJ3A 1XEYA 3BS8A 4RAEA 2DGKA 4BQ0A 2Z20A 3WGBA 1GC0A 1OXPA 1ASNA 4XJOA 3R9AA 3N4XA 4ATQA 4WD2A 5F9SA 3AEMC 4ADBA 2BI2A 5E5IA 4U2HA 3EI7A 1CL2A 2BWOA 2ZP7A 1LKCA 3WY7A 1OXOA 2BYLA 2HP1A 5DJ1A 3NRAA 4JF0A 3TFUA 3DXWA 4WXFA 4IYOB 1E5FA 1B8GA 4R2NA 4WB0A 3FDDA 2CJHA 2QA3A 3ASAA 4K2MA 4OMAA 1ARGA 2AY4A 2D66A 3W1JA 4WYCA 1AKBA 5E3KA 2BIEA 2R0TA 2VMZA 3K28A 3T32A 4CVQA 1BKGA 3JWAA 3LY1A 2C7TA 4AZJA 1WKGA 4E3RA 1DGDA 4R5ZA 4ZAHA 3QBOA 2BHXA 1TOEA 3FQ8A 1GD9A 2YKVA 3NUBA 3BCXA 2ZSMA 2Z9WA 3HT4A 3DYDA 2WK7A 2R5CA 1J04A 2OATA 1EQBA 2E7JA 2W7EA 5M4BA 1LW4A 1RVYA 3PJ0A 2QB2A 1ZODA 1M7YA 1QIRA 3A9ZA 3CQ6A 1DTYA 3A9XA 2YCTA 1MAQA 3DODA 4FL0A 5EUEA 4LW4A 5FT8A 1YIYA 1BJOB 1AAWA 3GR9A 1Y4IA 1BJWA 4ADEA 3N7NA 2C0RA 2GSAA 4GRXA 4ADCA 5EUNA 4IX8A 3FQAA 4JEVA 2VMQA 4XQ2A 2DR1A 3E6GA 4FFCA 1CQ7A 1MDXA 2FYFA 2ZC0A 1MDOA 2GMSA 3JU7A 4A0FA 5DB5A 3I16A 2VLFA 2F8JA 3EI9A 2EZ2A 5G4IA 1WYVA 1AJRA 4LNLA 1B5PA 4IXOA 2Z9UA 2ZJGA 3N0LA 2CH2A 2OKJA 4LNMA 2QMAA 5DJ9A 1ARHA 2PO3A 2Z1ZA 1MDZA 2VIAA 1AX4A 3P1TA 2WB6A 3BV0A 3BCBA 4AO4A 1SPAA 2W7MA 3RQ1A 4DBCA 2EGYA 4GE9A 1M32A 3GBXA 4GEBA 4IW7A 4JEYA 3AOVA 1CZEA 3DC1A 4OCAA 3B46A 5LHAA 1H1CA 2W8VA 1AJSA 2C81A 3COGA 4KXKA 4TN4A 5EIGB 4GE7A 3BB8A 1M0QA 4ITGA 1WYUA 1IX6A 2VYCA 1GCKA 2CFBA 1N31A 3CBFA 4XJLA 1B4XA 1YOOA 3DR4A 3RCHA 5HXXA 3FDBA 1M0OA 4N0BA 3ZRPA 4UHOA 1M6SA 1MLZA 1CS1A 3RUYA 3AENB 2FN6A 2DGLA 3MC6A 1C4KA 2D64A 1KL1A 5G0AA 1KKPA 3DRDA 1M4NA 4EB5A 2X5FA 2VGSA 4RIZA 1Z3ZA 4CBRA 1TOJA 1V2DA 2VMWA 3MBBA 3QPGA 2Z9VA 1WKHA 2YCNA 4AH3A 3PA9A 3FRKA 1ARTA 1C7NA 2Z9XA 3FZ7A 1OHWA 2VMPA 3OP7A 2E54A 2VGWA 4ISYA 3AOWA 3M5UA 1ARSA 2E7IA 4AZKA 4J8LA 2R5EA 1YIZA 2YKYA 2BWNA 1BT4A 4O6ZA 3FKDA 1D7RA 1DGEA 3GJUA 1RV4A 1V2FA 4RKCA 1B9HA 3RI6A 3D6KA 3NTJA 3USFA 1SFFA 2D63A 2Q7WA 2AATA 1SZUA 1I43A 1S08A 2BYJA 2JJEA 4K2BA 5EUDA 1AHFA 1LC5A 3DZZA 1KKJA 4MY5A 1AKCA 1G7XA 4ADDA 3LVMA 1AY4A 3AEJA 4P3MA 1WSTA 1N8PA 2EH6A 1FG3A 4EU1A 1GC4A 2DOUA 2CH1A 1ASCA 1ASEA 4IYOA 5HDMA 2ZUKA 1DKAA 2VMOA 3ELPA 3GSBA 3HQTA 4GDYA 4UOYA 1ZC9A 3KGWA 5M46A 8AATA 3MEBA 3JW9A 2VMXA 2VMSA 2GQNA 2VGVA 1W7NA 1TARA 2ZY2A 3KKIA 4OC9A 1X0MA 3FVUA 3ECDA 1QJ5A 1Z7DA 4M2MA 2QSRA 3GZCA 5EQCA 1JF9A 2Z1YA 4IXSA 4WXGA 3WKSA 1AAMA 2AY6A 5C6UA 1C9CA 1I41A 2O7CA 2X5DA 3WLXA 2BWPA 3H14A 3WGCA 3HVYA 3JTXA 1AHYA 1C7GA 1IAXA 1OHVA 1M0NA 3A9YA 3B8XA 2ZYJA 1SZSA 1WYTB 2VI8A 5J8QA 1ASFA 3NUIA 2X8UA 4WP0A 1S09A 1CQ8A 3E9KA 3IHJA 3P6KA 4J5UA 3VAXA 4WXBA 3AEMA 3CQ4A 1BJOA 7AATA 4JF1A 4GE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7Y A;  1O4S A;  2HOZ A;  3QGU A;  3F9T A;  4KYO A;  3PGY A;  2YHK A;  4Q76 A;  1YJZ A;  1C0N A;  1SVV A;  5TF5 A;  1X29 A;  1X2A A;  1KL2 A;  2VGT A;  5FT5 A;  2HOX A;  2YRI A;  5HHY A;  3NDN A;  2VMV A;  2VI9 A;  3AEP A;  5AX8 A;  1IUG A;  1TOK A;  2PB0 A;  3EIB A;  2QBT A;  2D5Y A;  9AAT A;  3ZRQ A;  3FTB A;  1TAT A;  1FG7 A;  2RFV A;  4A6T A;  1W7M A;  2XH1 A;  2W7H A;  1MLY A;  2AY5 A;  3LVL B;  3DR7 A;  4M2K A;  2V0Y A;  1I48 A;  1AMQ A;  1G4X A;  2YRR A;  3L44 A;  5FT6 A;  1EJI A;  4PFF A;  3IF2 A;  3PD6 B;  4NOG A;  2BKW A;  1GBN A;  1CL1 A;  1V2E A;  2EZ1 A;  4DGT A;  5F8V A;  2VLH A;  5JAY A;  1YJS A;  4F5L A;  4WYG A;  3TCM A;  5EFS A;  1C7O A;  1M0P A;  3AAT A;  3LWS A;  4F5H A;  1H0C A;  4JE5 A;  4WYD A;  5EIG A;  2R2N A;  2HOY A;  2WK8 A;  3EZ1 A;  3JWB A;  3QN6 A;  4A72 A;  3VOM A;  2OQX A;  3ZZK A;  1YAA A;  3CAI A;  1ASM A;  3F6T A;  2TPL A;  3JZL A;  3NU8 A;  4JE5 D;  2VMR A;  3MAD A;  2FM1 A;  1W7L A;  2FQ6 A;  1ARI A;  3AEN A;  3BWN C;  3EI6 A;  1BS0 A;  4Y0H A;  3TFT A;  4RJ0 A;  3RBF A;  1CZC A;  1VJO A;  4I8A A;  4RKD A;  2WK9 A;  2HUU A;  2DKB A;  2X3L A;  4RJY A;  1AKA A;  2JJG A;  4OBU A;  2ZY4 A;  1ORD A;  1JS6 A;  4MKJ A;  4TV7 A;  3GZD C;  5M49 A;  3A2B A;  1PFF A;  1AIA A;  3ELE A;  3I4J A;  4W1W A;  1VEF A;  4UHN A;  1D2F A;  3BC8 A;  2JG2 A;  4ZSY A;  5FT4 A;  3VK4 A;  4W5K A;  2CTZ A;  3BCA A;  3UE8 A;  1KMJ A;  1QGN A;  3GET A;  1ELU A;  4AOA A;  1OHY A;  2W7D A;  4F5F A;  2CJD A;  1GEW A;  3MAF B;  2YOB A;  1DJE A;  3W1H A;  3MKJ A;  3PDX A;  3B1D A;  3BN1 A;  5G2Q A;  2NMP A;  1ECX A;  5I92 A;  2CST A;  4PVF A;  4CXR A;  1IVR A;  4R5F A;  2VIB A;  5G4J A;  4UQV A;  5LH9 A;  2HP2 A;  2G6W A;  3FSL A;  3VP6 A;  4W1X A;  1AIB A;  3MAU A;  2GB3 A;  3HMU A;  5EAV A;  2BI1 A;  3AV7 A;  5K8B A;  4TMR A;  1S0A A;  4WLH A;  2W7I A;  3HLM A;  4ZDP A;  2EPJ A;  4ZSW A;  2JJF A;  3CQ5 A;  3UWC A;  3TAT A;  2BIA A;  1AHG A;  1D7V A;  3A8U X;  3AEJ C;  1W3U A;  2VMY A;  3LVJ A;  2QB3 A;  5BJ3 A;  1BJ4 A;  4A6U A;  3ZZJ A;  2OKK A;  4CXQ A;  2BI3 A;  4OYT A;  1ZOB A;  4EB7 A;  2VMT A;  2QLR A;  3K40 A;  4XJP A;  4PFN A;  1CQ6 A;  3BWO A;  1IBJ A;  4GSA A;  4U1T A;  1SF2 A;  4W8I A;  4XAU A;  3ACZ A;  4LNJ A;  1ASB A;  2BI5 A;  1T3I A;  2O0R A;  1UU2 A;  3K7Y A;  4ZAS A;  4F5J A;  2AY8 A;  1LW5 A;  3EUC A;  4WYA A;  2AEU A;  2D61 A;  2HUI A;  3FCR A;  3R4T A;  4CBS A;  4OT8 A;  1WYT A;  4P7Y A;  1QIT A;  1RVU A;  3B1E A;  2ZY3 A;  4BMK A;  3QM2 A;  2VMN A;  4LW2 A;  2D65 A;  2JIS A;  1ASA A;  1GEX A;  1LK9 A;  1QZ9 A;  2W7K A;  1MAP A;  1U08 A;  2HOR A;  1DJ9 A;  3E2Z B;  4IXZ A;  2VMU A;  4E3Q A;  1B9I A;  3FVS A;  3ASB A;  2HUF A;  4ZM3 A;  3DU4 A;  2YKU A;  4A00 A;  3EIA A;  1B5O A;  1O62 A;  1X28 A;  1UU0 A;  2Z61 A;  3WX9 A;  3NX3 A;  4XEW A;  2ORD A;  2W7J A;  1IJI A;  4ZDO A;  4BA4 A;  3N75 A;  4AO9 A;  1P3W A;  1G7W A;  2JJH A;  1GC2 A;  2CIN A;  4MSO A;  2O1B A;  3OKS A;  1AY8 A;  1UU1 A;  4WYF A;  1E5E A;  4LC3 A;  3NYT A;  1BQD A;  1EG5 A;  3UAK A;  1RV3 A;  3PD6 A;  4HF8 A;  4RM1 A;  2WKA A;  4E77 A;  2W7L A;  3QI6 A;  3PAA A;  3Q8N A;  3FQ7 A;  4BA5 A;  2E7U A;  3KGX A;  4WB0 B;  4K2I A;  4HVK A;  1LS3 A;  4F4E A;  2CY8 A;  1D7S A;  2CJG A;  4JEZ A;  4E1O A;  3E2Y A;  4MKK A;  4Q75 A;  3W1I A;  1OAT A;  4MGR A;  2GMU A;  1LC7 A;  4ZM4 A;  2AY2 A;  4Q6R A;  3FVX A;  3II0 A;  3PPL A;  2FNI A;  1AMS A;  4IY7 A;  4JEX A;  3WCO A;  1QIS A;  1BQA A;  1IX8 A;  3VK2 A;  3GWP A;  2FNU A;  1KMK A;  1PG8 A;  1DJU A;  3KE3 A;  1MGV A;  4N0W A;  4UHM A;  2PB2 A;  5M4D A;  3HDO A;  1TAS A;  4ZLV A;  1SZK A;  4B9B A;  5D95 A;  2R5C B;  3ISL A;  1G4V A;  1PMO A;  4R8D A;  3EI8 A;  1ASL A;  2CB1 A;  2BI9 A;  1GC3 A;  2W8T A;  1TOI A;  4A0G A;  1IAY A;  3AEO A;  4A6R A;  4BHD A;  5BJ4 A;  1JS3 A;  3FZ6 A;  1AHX A;  1W23 A;  3FD0 A;  5D5S A;  3WZF A;  1UKJ A;  3WCN A;  1N2T A;  4Q31 A;  3FFH A;  4PIW A;  3E77 A;  3MC6 C;  5E4Z A;  1XI9 A;  1PMM A;  2JGT A;  2OGE A;  2VGU A;  4OBV A;  4RLG A;  1WYV B;  5IWQ A;  3MAF A;  2HZP A;  2ZSL A;  3ZRR A;  3G0T A;  1AY5 A;  4QGR A;  3TQX A;  1VP4 A;  1AIC A;  1DFO A;  4W1V A;  3NYU A;  1ASD A;  1BW0 A;  3NYS A;  2CAN A;  3L8A A;  4WLJ A;  1TPL A;  2V1P A;  1TOG A;  1IX7 A;  3WKR A;  1BJN A;  1ASG A;  1GDE A;  3BWN A;  3ATH A;  4F5I A;  2VGZ A;  4ZWM A;  3PIU A;  1J32 A;  3HL2 A;  4XK1 A;  2W8J A;  4MQQ A;  3N5M A;  3E2F A;  4Y0D A;  3QHX A;  2C44 A;  4H51 A;  4XJM A;  4MQP A;  1AJS B;  3FZ8 A;  4ATP A;  4KAM A;  2BIG A;  1GEY A;  4A0R A;  1S06 A;  3EI5 A;  3G8M A;  3EZS A;  1WYU B;  2Z67 A;  3H7F A;  2XBN A;  2W7G A;  2DGM A;  2W8W A;  3LG0 A;  5G2P A;  2W7F A;  3PDB A;  4F5M A;  3GZD A;  2W8U A;  3RCH B;  3HBX A;  3LVK A;  4EMY A;  1JG8 A;  5G09 A;  2AY9 A;  1YJY A;  2DKJ A;  1FC4 A;  3F0H A;  4ZWV A;  1AHE A;  3G7Q A;  1V72 A;  2ZY5 A;  2D7Z A;  4Y0I A;  4WBT A;  2AY7 A;  3AEL A;  3LV2 A;  4F5G A;  3DXV A;  3PDB B;  4L0O A;  4EFF A;  3I5T A;  1AMA A;  1S07 A;  3FFR A;  2YCP A;  5EAA A;  2AEV A;  4WYE A;  2AY1 A;  3NNK A;  4MQR A;  4A0H A;  4M2J A;  3B1C A;  1D7U A;  1CJ0 A;  1O69 A;  4ITX A;  4JEW A;  4RIT A;  3NU7 A;  3E2Z A;  5DX5 A;  1O61 A;  4B98 A;  2OGA A;  4W91 A;  1YNU A;  4ZDL A;  2AY3 A;  4OTL A;  2YKX A;  1LC8 A;  4DQ6 A;  1AMR A;  3RBL A;  3VK3 A;  2EO5 A;  4F5K A;  1ELQ A;  1I29 A;  1QJ3 A;  1XEY A;  3BS8 A;  4RAE A;  2DGK A;  4BQ0 A;  2Z20 A;  3WGB A;  1GC0 A;  1OXP A;  1ASN A;  4XJO A;  3R9A A;  4ATQ A;  4WD2 A;  5F9S A;  3AEM C;  4ADB A;  2BI2 A;  5E5I A;  4U2H A;  3EI7 A;  1CL2 A;  2BWO A;  2ZP7 A;  1LKC A;  3WY7 A;  1OXO A;  2BYL A;  2HP1 A;  5DJ1 A;  3NRA A;  4JF0 A;  3TFU A;  3DXW A;  4WXF A;  4IYO B;  1E5F A;  1B8G A;  4R2N A;  4WB0 A;  3FDD A;  2CJH A;  2QA3 A;  3ASA A;  4K2M A;  4OMA A;  1ARG A;  2AY4 A;  2D66 A;  3W1J A;  4WYC A;  1AKB A;  5E3K A;  2BIE A;  2R0T A;  2VMZ A;  3K28 A;  3T32 A;  4CVQ A;  1BKG A;  3JWA A;  3LY1 A;  2C7T A;  4AZJ A;  1WKG A;  4E3R A;  1DGD A;  4R5Z A;  4ZAH A;  3QBO A;  2BHX A;  1TOE A;  3FQ8 A;  1GD9 A;  2YKV A;  3NUB A;  3BCX A;  2ZSM A;  2Z9W A;  3HT4 A;  3DYD A;  2WK7 A;  2R5C A;  1J04 A;  2OAT A;  1EQB A;  2E7J A;  2W7E A;  5M4B A;  1LW4 A;  1RVY A;  3PJ0 A;  2QB2 A;  1ZOD A;  1M7Y A;  1QIR A;  3A9Z A;  3CQ6 A;  1DTY A;  3A9X A;  2YCT A;  1MAQ A;  3DOD A;  4FL0 A;  5EUE A;  4LW4 A;  5FT8 A;  1YIY A;  1BJO B;  1AAW A;  3GR9 A;  1Y4I A;  1BJW A;  4ADE A;  2C0R A;  2GSA A;  4GRX A;  4ADC A;  5EUN A;  4IX8 A;  3FQA A;  4JEV A;  2VMQ A;  4XQ2 A;  2DR1 A;  3E6G A;  4FFC A;  1CQ7 A;  1MDX A;  2FYF A;  2ZC0 A;  1MDO A;  2GMS A;  3JU7 A;  4A0F A;  5DB5 A;  3I16 A;  2VLF A;  2F8J A;  3EI9 A;  2EZ2 A;  5G4I A;  1WYV A;  1AJR A;  4LNL A;  1B5P A;  4IXO A;  2Z9U A;  2ZJG A;  3N0L A;  2CH2 A;  2OKJ A;  4LNM A;  2QMA A;  5DJ9 A;  1ARH A;  2PO3 A;  2Z1Z A;  1MDZ A;  2VIA A;  1AX4 A;  3P1T A;  3BV0 A;  3BCB A;  4AO4 A;  1SPA A;  2W7M A;  3RQ1 A;  4DBC A;  2EGY A;  4GE9 A;  1M32 A;  3GBX A;  4GEB A;  4IW7 A;  4JEY A;  3AOV A;  1CZE A;  3DC1 A;  4OCA A;  3B46 A;  5LHA A;  1H1C A;  2W8V A;  1AJS A;  2C81 A;  3COG A;  4KXK A;  4TN4 A;  5EIG B;  4GE7 A;  3BB8 A;  1M0Q A;  4ITG A;  1WYU A;  1IX6 A;  2VYC A;  1GCK A;  2CFB A;  1N31 A;  3CBF A;  4XJL A;  1B4X A;  1YOO A;  3DR4 A;  3RCH A;  5HXX A;  3FDB A;  1M0O A;  4N0B A;  3ZRP A;  4UHO A;  1M6S A;  1MLZ A;  1CS1 A;  3RUY A;  3AEN B;  2FN6 A;  2DGL A;  3MC6 A;  1C4K A;  2D64 A;  1KL1 A;  5G0A A;  1KKP A;  3DRD A;  1M4N A;  4EB5 A;  2X5F A;  2VGS A;  4RIZ A;  1Z3Z A;  4CBR A;  1TOJ A;  1V2D A;  2VMW A;  3MBB A;  3QPG A;  2Z9V A;  1WKH A;  2YCN A;  4AH3 A;  3PA9 A;  3FRK A;  1ART A;  1C7N A;  2Z9X A;  3FZ7 A;  1OHW A;  2VMP A;  3OP7 A;  2E54 A;  2VGW A;  4ISY A;  3AOW A;  3M5U A;  1ARS A;  2E7I A;  4AZK A;  4J8L A;  2R5E A;  1YIZ A;  2YKY A;  2BWN A;  1BT4 A;  4O6Z A;  3FKD A;  1D7R A;  1DGE A;  3GJU A;  1RV4 A;  1V2F A;  4RKC A;  1B9H A;  3RI6 A;  3D6K A;  3NTJ A;  3USF A;  1SFF A;  2D63 A;  2Q7W A;  2AAT A;  1SZU A;  1I43 A;  1S08 A;  2BYJ A;  2JJE A;  4K2B A;  5EUD A;  1AHF A;  1LC5 A;  3DZZ A;  1KKJ A;  4MY5 A;  1AKC A;  1G7X A;  4ADD A;  3LVM A;  1AY4 A;  3AEJ A;  4P3M A;  1WST A;  1N8P A;  2EH6 A;  1FG3 A;  4EU1 A;  1GC4 A;  2DOU A;  2CH1 A;  1ASC A;  1ASE A;  4IYO A;  5HDM A;  2ZUK A;  1DKA A;  2VMO A;  3ELP A;  3GSB A;  3HQT A;  4GDY A;  4UOY A;  1ZC9 A;  3KGW A;  5M46 A;  8AAT A;  3MEB A;  3JW9 A;  2VMX A;  2VMS A;  2GQN A;  2VGV A;  1W7N A;  1TAR A;  2ZY2 A;  3KKI A;  4OC9 A;  1X0M A;  3FVU A;  3ECD A;  1QJ5 A;  1Z7D A;  4M2M A;  3GZC A;  5EQC A;  1JF9 A;  2Z1Y A;  4IXS A;  4WXG A;  3WKS A;  1AAM A;  2AY6 A;  5C6U A;  1C9C A;  1I41 A;  2O7C A;  2X5D A;  3WLX A;  2BWP A;  3H14 A;  3WGC A;  3HVY A;  3JTX A;  1AHY A;  1C7G A;  1IAX A;  1OHV A;  1M0N A;  3A9Y A;  3B8X A;  2ZYJ A;  1SZS A;  1WYT B;  2VI8 A;  5J8Q A;  1ASF A;  3NUI A;  2X8U A;  4WP0 A;  1S09 A;  1CQ8 A;  3E9K A;  3IHJ A;  3P6K A;  4J5U A;  3VAX A;  4WXB A;  3AEM A;  3CQ4 A;  1BJO A;  7AAT A;  4JF1 A;  4GE4 A; 
#chains in the Genus database with same CATH topology
 2D7Y A;  1O4S A;  2HOZ A;  3QGU A;  3F9T A;  4KYO A;  3PGY A;  2YHK A;  4Q76 A;  1YJZ A;  1C0N A;  1SVV A;  5TF5 A;  1X29 A;  1X2A A;  1KAF A;  1KL2 A;  2VGT A;  5FT5 A;  2HOX A;  2YRI A;  5HHY A;  2G7J A;  3NDN A;  2VMV A;  2VI9 A;  3AEP A;  5AX8 A;  1IUG A;  1TOK A;  2PB0 A;  3EIB A;  2QBT A;  2D5Y A;  9AAT A;  3ZRQ A;  3FTB A;  1TAT A;  1FG7 A;  2RFV A;  4A6T A;  1W7M A;  2XH1 A;  2W7H A;  1MLY A;  2AY5 A;  3LVL B;  3DR7 A;  4M2K A;  2V0Y A;  1I48 A;  1AMQ A;  1G4X A;  2YRR A;  3L44 A;  5FT6 A;  1EJI A;  4PFF A;  3IF2 A;  3PD6 B;  4NOG A;  2BKW A;  1GBN A;  1CL1 A;  1V2E A;  2EZ1 A;  4DGT A;  5F8V A;  2VLH A;  5JAY A;  1YJS A;  4F5L A;  4WYG A;  3TCM A;  5EFS A;  1C7O A;  1M0P A;  3AAT A;  3LWS A;  4F5H A;  1H0C A;  4JE5 A;  4WYD A;  5EIG A;  2R2N A;  2HOY A;  2WK8 A;  3EZ1 A;  3JWB A;  3QN6 A;  4A72 A;  3VOM A;  2OQX A;  3ZZK A;  1YAA A;  3CAI A;  1ASM A;  3F6T A;  2TPL A;  3JZL A;  3NU8 A;  4JE5 D;  2VMR A;  3MAD A;  2FM1 A;  1W7L A;  2FQ6 A;  1ARI A;  3AEN A;  3BWN C;  3EI6 A;  1BS0 A;  4Y0H A;  3TFT A;  4RJ0 A;  3RBF A;  1CZC A;  1VJO A;  4I8A A;  4RKD A;  2WK9 A;  2HUU A;  2DKB A;  2X3L A;  2FKI A;  4RJY A;  1AKA A;  2JJG A;  4OBU A;  2ZY4 A;  1ORD A;  1JS6 A;  4MKJ A;  4TV7 A;  3GZD C;  5M49 A;  3A2B A;  1PFF A;  1AIA A;  3ELE A;  3I4J A;  4W1W A;  1VEF A;  4UHN A;  1D2F A;  3BC8 A;  2JG2 A;  4ZSY A;  5FT4 A;  3VK4 A;  4W5K A;  2CTZ A;  3BCA A;  3UE8 A;  1KMJ A;  1QGN A;  3GET A;  1ELU A;  4AOA A;  1OHY A;  2W7D A;  4F5F A;  2CJD A;  1GEW A;  3MAF B;  2YOB A;  1DJE A;  3W1H A;  3MKJ A;  3PDX A;  3B1D A;  3BN1 A;  5G2Q A;  2NMP A;  1ECX A;  5KTB A;  5I92 A;  2CST A;  4PVF A;  4CXR A;  1IVR A;  4R5F A;  2VIB A;  5G4J A;  4UQV A;  5LH9 A;  2KFP A;  2HP2 A;  2G6W A;  3FSL A;  3VP6 A;  4W1X A;  1AIB A;  3MAU A;  2GB3 A;  3HMU A;  5EAV A;  2BI1 A;  3AV7 A;  5K8B A;  4TMR A;  1S0A A;  4WLH A;  2W7I A;  3HLM A;  4ZDP A;  2EPJ A;  4ZSW A;  2JJF A;  3CQ5 A;  3UWC A;  3TAT A;  2BIA A;  1AHG A;  1D7V A;  3A8U X;  3AEJ C;  1W3U A;  2VMY A;  3LVJ A;  2QB3 A;  5BJ3 A;  1BJ4 A;  4A6U A;  3ZZJ A;  2A1V A;  2OKK A;  4CXQ A;  2BI3 A;  4OYT A;  1ZOB A;  4EB7 A;  2VMT A;  3N4R A;  2QLR A;  3K40 A;  4XJP A;  4PFN A;  1CQ6 A;  3BWO A;  1IBJ A;  4GSA A;  4U1T A;  1SF2 A;  4W8I A;  4XAU A;  3ACZ A;  4LNJ A;  1ASB A;  2BI5 A;  1T3I A;  2O0R A;  1UU2 A;  3K7Y A;  4ZAS A;  4F5J A;  2AY8 A;  1LW5 A;  3EUC A;  4WYA A;  2AEU A;  2D61 A;  2HUI A;  3FCR A;  3R4T A;  4CBS A;  4OT8 A;  1WYT A;  4P7Y A;  1QIT A;  1RVU A;  3B1E A;  2ZY3 A;  4BMK A;  3QM2 A;  2VMN A;  4LW2 A;  2D65 A;  2JIS A;  1ASA A;  1GEX A;  1LK9 A;  1QZ9 A;  2W7K A;  1MAP A;  1U08 A;  2HOR A;  1DJ9 A;  3E2Z B;  4IXZ A;  2VMU A;  4E3Q A;  1B9I A;  3FVS A;  3ASB A;  2HUF A;  4ZM3 A;  3DU4 A;  2YKU A;  4A00 A;  3EIA A;  1B5O A;  1O62 A;  1X28 A;  1UU0 A;  2Z61 A;  3WX9 A;  3NX3 A;  4XEW A;  2ORD A;  2W7J A;  1IJI A;  4ZDO A;  4BA4 A;  3N75 A;  4AO9 A;  1P3W A;  1G7W A;  2JJH A;  1GC2 A;  2CIN A;  4MSO A;  2O1B A;  3OKS A;  1AY8 A;  1UU1 A;  4WYF A;  1E5E A;  4LC3 A;  3NYT A;  1BQD A;  1EG5 A;  3UAK A;  1RV3 A;  3PD6 A;  4HF8 A;  4RM1 A;  2WKA A;  4E77 A;  2W7L A;  3QI6 A;  3PAA A;  3Q8N A;  3FQ7 A;  4BA5 A;  2E7U A;  3KGX A;  4WB0 B;  4K2I A;  4HVK A;  1LS3 A;  4F4E A;  2CY8 A;  1D7S A;  2CJG A;  4JEZ A;  4E1O A;  3E2Y A;  4MKK A;  4Q75 A;  3W1I A;  1OAT A;  4MGR A;  2GMU A;  1LC7 A;  4ZM4 A;  2AY2 A;  4Q6R A;  3FVX A;  3II0 A;  3PPL A;  2FNI A;  1AMS A;  4IY7 A;  4JEX A;  3WCO A;  1QIS A;  1BQA A;  1IX8 A;  3VK2 A;  3H9X A;  3GWP A;  2FNU A;  1KMK A;  1PG8 A;  1DJU A;  3KE3 A;  1MGV A;  4N0W A;  4UHM A;  2PB2 A;  5M4D A;  3HDO A;  1TAS A;  4ZLV A;  1SZK A;  4B9B A;  5D95 A;  2R5C B;  3ISL A;  1G4V A;  1PMO A;  4K05 A;  4R8D A;  3EI8 A;  1ASL A;  2CB1 A;  2BI9 A;  1GC3 A;  2W8T A;  1TOI A;  4A0G A;  1IAY A;  3AEO A;  4A6R A;  4BHD A;  5BJ4 A;  1JS3 A;  3FZ6 A;  1AHX A;  1W23 A;  3FD0 A;  5D5S A;  3WZF A;  1UKJ A;  3WCN A;  1N2T A;  4Q31 A;  3FFH A;  4PIW A;  3E77 A;  3MC6 C;  5E4Z A;  1XI9 A;  1PMM A;  2JGT A;  2OGE A;  2VGU A;  4OBV A;  4RLG A;  3N4S A;  1WYV B;  5IWQ A;  3MAF A;  2HZP A;  2ZSL A;  3ZRR A;  3G0T A;  1AY5 A;  4QGR A;  3TQX A;  1VP4 A;  1AIC A;  1DFO A;  4W1V A;  3NYU A;  1ASD A;  1BW0 A;  3NYS A;  2CAN A;  3L8A A;  4WLJ A;  1TPL A;  2V1P A;  1TOG A;  1IX7 A;  3WKR A;  1BJN A;  1ASG A;  1GDE A;  3BWN A;  3ATH A;  4F5I A;  2VGZ A;  4ZWM A;  4H63 Q;  3PIU A;  1J32 A;  3HL2 A;  4XK1 A;  2W8J A;  4MQQ A;  3N5M A;  3E2F A;  4Y0D A;  3QHX A;  2C44 A;  4H51 A;  4XJM A;  4MQP A;  1AJS B;  3FZ8 A;  4ATP A;  4KAM A;  2BIG A;  1GEY A;  4A0R A;  1S06 A;  3EI5 A;  3G8M A;  3EZS A;  2EYQ A;  1WYU B;  2Z67 A;  3H7F A;  2XBN A;  2W7G A;  2DGM A;  2W8W A;  3LG0 A;  5G2P A;  2W7F A;  3PDB A;  4F5M A;  3GZD A;  2W8U A;  3RCH B;  3HBX A;  3LVK A;  4EMY A;  1JG8 A;  5G09 A;  2AY9 A;  1YJY A;  2DKJ A;  1FC4 A;  3F0H A;  4ZWV A;  1AHE A;  3G7Q A;  1V72 A;  2ZY5 A;  2D7Z A;  4Y0I A;  4WBT A;  2AY7 A;  3AEL A;  3LV2 A;  4F5G A;  3DXV A;  3PDB B;  4L0O A;  4EFF A;  3I5T A;  1AMA A;  1S07 A;  3FFR A;  2YCP A;  5EAA A;  2AEV A;  4WYE A;  2AY1 A;  3NNK A;  4MQR A;  4A0H A;  4M2J A;  3B1C A;  1D7U A;  1CJ0 A;  1O69 A;  4ITX A;  4JEW A;  4RIT A;  3NU7 A;  3E2Z A;  5DX5 A;  1O61 A;  4B98 A;  2OGA A;  4W91 A;  1YNU A;  4ZDL A;  2AY3 A;  4OTL A;  2YKX A;  1LC8 A;  4DQ6 A;  1AMR A;  3RBL A;  3VK3 A;  2EO5 A;  4F5K A;  1ELQ A;  1I29 A;  1QJ3 A;  1XEY A;  3BS8 A;  4RAE A;  2DGK A;  4BQ0 A;  2Z20 A;  3WGB A;  1GC0 A;  1OXP A;  1ASN A;  4XJO A;  3R9A A;  3N4X A;  4ATQ A;  4WD2 A;  5F9S A;  3AEM C;  4ADB A;  2BI2 A;  5E5I A;  4U2H A;  3EI7 A;  1CL2 A;  2BWO A;  2ZP7 A;  1LKC A;  3WY7 A;  1OXO A;  2BYL A;  2HP1 A;  5DJ1 A;  3NRA A;  4JF0 A;  3TFU A;  3DXW A;  4WXF A;  4IYO B;  1E5F A;  1B8G A;  4R2N A;  4WB0 A;  3FDD A;  2CJH A;  2QA3 A;  3ASA A;  4K2M A;  4OMA A;  1ARG A;  2AY4 A;  2D66 A;  3W1J A;  4WYC A;  1AKB A;  5E3K A;  2BIE A;  2R0T A;  2VMZ A;  3K28 A;  3T32 A;  4CVQ A;  1BKG A;  3JWA A;  3LY1 A;  2C7T A;  4AZJ A;  1WKG A;  4E3R A;  1DGD A;  4R5Z A;  4ZAH A;  3QBO A;  2BHX A;  1TOE A;  3FQ8 A;  1GD9 A;  2YKV A;  3NUB A;  3BCX A;  2ZSM A;  2Z9W A;  3HT4 A;  3DYD A;  2WK7 A;  2R5C A;  1J04 A;  2OAT A;  1EQB A;  2E7J A;  2W7E A;  5M4B A;  1LW4 A;  1RVY A;  3PJ0 A;  2QB2 A;  1ZOD A;  1M7Y A;  1QIR A;  3A9Z A;  3CQ6 A;  1DTY A;  3A9X A;  2YCT A;  1MAQ A;  3DOD A;  4FL0 A;  5EUE A;  4LW4 A;  5FT8 A;  1YIY A;  1BJO B;  1AAW A;  3GR9 A;  1Y4I A;  1BJW A;  4ADE A;  3N7N A;  2C0R A;  2GSA A;  4GRX A;  4ADC A;  5EUN A;  4IX8 A;  3FQA A;  4JEV A;  2VMQ A;  4XQ2 A;  2DR1 A;  3E6G A;  4FFC A;  1CQ7 A;  1MDX A;  2FYF A;  2ZC0 A;  1MDO A;  2GMS A;  3JU7 A;  4A0F A;  5DB5 A;  3I16 A;  2VLF A;  2F8J A;  3EI9 A;  2EZ2 A;  5G4I A;  1WYV A;  1AJR A;  4LNL A;  1B5P A;  4IXO A;  2Z9U A;  2ZJG A;  3N0L A;  2CH2 A;  2OKJ A;  4LNM A;  2QMA A;  5DJ9 A;  1ARH A;  2PO3 A;  2Z1Z A;  1MDZ A;  2VIA A;  1AX4 A;  3P1T A;  2WB6 A;  3BV0 A;  3BCB A;  4AO4 A;  1SPA A;  2W7M A;  3RQ1 A;  4DBC A;  2EGY A;  4GE9 A;  1M32 A;  3GBX A;  4GEB A;  4IW7 A;  4JEY A;  3AOV A;  1CZE A;  3DC1 A;  4OCA A;  3B46 A;  5LHA A;  1H1C A;  2W8V A;  1AJS A;  2C81 A;  3COG A;  4KXK A;  4TN4 A;  5EIG B;  4GE7 A;  3BB8 A;  1M0Q A;  4ITG A;  1WYU A;  1IX6 A;  2VYC A;  1GCK A;  2CFB A;  1N31 A;  3CBF A;  4XJL A;  1B4X A;  1YOO A;  3DR4 A;  3RCH A;  5HXX A;  3FDB A;  1M0O A;  4N0B A;  3ZRP A;  4UHO A;  1M6S A;  1MLZ A;  1CS1 A;  3RUY A;  3AEN B;  2FN6 A;  2DGL A;  3MC6 A;  1C4K A;  2D64 A;  1KL1 A;  5G0A A;  1KKP A;  3DRD A;  1M4N A;  4EB5 A;  2X5F A;  2VGS A;  4RIZ A;  1Z3Z A;  4CBR A;  1TOJ A;  1V2D A;  2VMW A;  3MBB A;  3QPG A;  2Z9V A;  1WKH A;  2YCN A;  4AH3 A;  3PA9 A;  3FRK A;  1ART A;  1C7N A;  2Z9X A;  3FZ7 A;  1OHW A;  2VMP A;  3OP7 A;  2E54 A;  2VGW A;  4ISY A;  3AOW A;  3M5U A;  1ARS A;  2E7I A;  4AZK A;  4J8L A;  2R5E A;  1YIZ A;  2YKY A;  2BWN A;  1BT4 A;  4O6Z A;  3FKD A;  1D7R A;  1DGE A;  3GJU A;  1RV4 A;  1V2F A;  4RKC A;  1B9H A;  3RI6 A;  3D6K A;  3NTJ A;  3USF A;  1SFF A;  2D63 A;  2Q7W A;  2AAT A;  1SZU A;  1I43 A;  1S08 A;  2BYJ A;  2JJE A;  4K2B A;  5EUD A;  1AHF A;  1LC5 A;  3DZZ A;  1KKJ A;  4MY5 A;  1AKC A;  1G7X A;  4ADD A;  3LVM A;  1AY4 A;  3AEJ A;  4P3M A;  1WST A;  1N8P A;  2EH6 A;  1FG3 A;  4EU1 A;  1GC4 A;  2DOU A;  2CH1 A;  1ASC A;  1ASE A;  4IYO A;  5HDM A;  2ZUK A;  1DKA A;  2VMO A;  3ELP A;  3GSB A;  3HQT A;  4GDY A;  4UOY A;  1ZC9 A;  3KGW A;  5M46 A;  8AAT A;  3MEB A;  3JW9 A;  2VMX A;  2VMS A;  2GQN A;  2VGV A;  1W7N A;  1TAR A;  2ZY2 A;  3KKI A;  4OC9 A;  1X0M A;  3FVU A;  3ECD A;  1QJ5 A;  1Z7D A;  4M2M A;  2QSR A;  3GZC A;  5EQC A;  1JF9 A;  2Z1Y A;  4IXS A;  4WXG A;  3WKS A;  1AAM A;  2AY6 A;  5C6U A;  1C9C A;  1I41 A;  2O7C A;  2X5D A;  3WLX A;  2BWP A;  3H14 A;  3WGC A;  3HVY A;  3JTX A;  1AHY A;  1C7G A;  1IAX A;  1OHV A;  1M0N A;  3A9Y A;  3B8X A;  2ZYJ A;  1SZS A;  1WYT B;  2VI8 A;  5J8Q A;  1ASF A;  3NUI A;  2X8U A;  4WP0 A;  1S09 A;  1CQ8 A;  3E9K A;  3IHJ A;  3P6K A;  4J5U A;  3VAX A;  4WXB A;  3AEM A;  3CQ4 A;  1BJO A;  7AAT A;  4JF1 A;  4GE4 A; 
#chains in the Genus database with same CATH homology
 2D7Y A;  1O4S A;  2HOZ A;  3QGU A;  3F9T A;  4KYO A;  3PGY A;  2YHK A;  4Q76 A;  1YJZ A;  1C0N A;  1SVV A;  5TF5 A;  1X29 A;  1X2A A;  1KL2 A;  2VGT A;  5FT5 A;  2HOX A;  2YRI A;  5HHY A;  2G7J A;  3NDN A;  2VMV A;  2VI9 A;  3AEP A;  5AX8 A;  1IUG A;  1TOK A;  2PB0 A;  3EIB A;  2QBT A;  2D5Y A;  9AAT A;  3ZRQ A;  3FTB A;  1TAT A;  1FG7 A;  2RFV A;  4A6T A;  1W7M A;  2XH1 A;  2W7H A;  1MLY A;  2AY5 A;  3LVL B;  3DR7 A;  4M2K A;  2V0Y A;  1I48 A;  1AMQ A;  1G4X A;  2YRR A;  3L44 A;  5FT6 A;  1EJI A;  4PFF A;  3IF2 A;  3PD6 B;  4NOG A;  2BKW A;  1GBN A;  1CL1 A;  1V2E A;  2EZ1 A;  4DGT A;  5F8V A;  2VLH A;  5JAY A;  1YJS A;  4F5L A;  4WYG A;  3TCM A;  5EFS A;  1C7O A;  1M0P A;  3AAT A;  3LWS A;  4F5H A;  1H0C A;  4JE5 A;  4WYD A;  5EIG A;  2R2N A;  2HOY A;  2WK8 A;  3EZ1 A;  3JWB A;  3QN6 A;  4A72 A;  3VOM A;  2OQX A;  3ZZK A;  1YAA A;  3CAI A;  1ASM A;  3F6T A;  2TPL A;  3JZL A;  3NU8 A;  4JE5 D;  2VMR A;  3MAD A;  2FM1 A;  1W7L A;  2FQ6 A;  1ARI A;  3AEN A;  3BWN C;  3EI6 A;  1BS0 A;  4Y0H A;  3TFT A;  4RJ0 A;  3RBF A;  1CZC A;  1VJO A;  4I8A A;  4RKD A;  2WK9 A;  2HUU A;  2DKB A;  2X3L A;  2FKI A;  4RJY A;  1AKA A;  2JJG A;  4OBU A;  2ZY4 A;  1ORD A;  1JS6 A;  4MKJ A;  4TV7 A;  3GZD C;  5M49 A;  3A2B A;  1PFF A;  1AIA A;  3ELE A;  3I4J A;  4W1W A;  1VEF A;  4UHN A;  1D2F A;  3BC8 A;  2JG2 A;  4ZSY A;  5FT4 A;  3VK4 A;  4W5K A;  2CTZ A;  3BCA A;  3UE8 A;  1KMJ A;  1QGN A;  3GET A;  1ELU A;  4AOA A;  1OHY A;  2W7D A;  4F5F A;  2CJD A;  1GEW A;  3MAF B;  2YOB A;  1DJE A;  3W1H A;  3MKJ A;  3PDX A;  3B1D A;  3BN1 A;  5G2Q A;  2NMP A;  1ECX A;  5KTB A;  5I92 A;  2CST A;  4PVF A;  4CXR A;  1IVR A;  4R5F A;  2VIB A;  5G4J A;  4UQV A;  5LH9 A;  2KFP A;  2HP2 A;  2G6W A;  3FSL A;  3VP6 A;  4W1X A;  1AIB A;  3MAU A;  2GB3 A;  3HMU A;  5EAV A;  2BI1 A;  3AV7 A;  5K8B A;  4TMR A;  1S0A A;  4WLH A;  2W7I A;  3HLM A;  4ZDP A;  2EPJ A;  4ZSW A;  2JJF A;  3CQ5 A;  3UWC A;  3TAT A;  2BIA A;  1AHG A;  1D7V A;  3A8U X;  3AEJ C;  1W3U A;  2VMY A;  3LVJ A;  2QB3 A;  5BJ3 A;  1BJ4 A;  4A6U A;  3ZZJ A;  2A1V A;  2OKK A;  4CXQ A;  2BI3 A;  4OYT A;  1ZOB A;  4EB7 A;  2VMT A;  3N4R A;  2QLR A;  3K40 A;  4XJP A;  4PFN A;  1CQ6 A;  3BWO A;  1IBJ A;  4GSA A;  4U1T A;  1SF2 A;  4W8I A;  4XAU A;  3ACZ A;  4LNJ A;  1ASB A;  2BI5 A;  1T3I A;  2O0R A;  1UU2 A;  3K7Y A;  4ZAS A;  4F5J A;  2AY8 A;  1LW5 A;  3EUC A;  4WYA A;  2AEU A;  2D61 A;  2HUI A;  3FCR A;  3R4T A;  4CBS A;  4OT8 A;  1WYT A;  4P7Y A;  1QIT A;  1RVU A;  3B1E A;  2ZY3 A;  4BMK A;  3QM2 A;  2VMN A;  4LW2 A;  2D65 A;  2JIS A;  1ASA A;  1GEX A;  1LK9 A;  1QZ9 A;  2W7K A;  1MAP A;  1U08 A;  2HOR A;  1DJ9 A;  3E2Z B;  4IXZ A;  2VMU A;  4E3Q A;  1B9I A;  3FVS A;  3ASB A;  2HUF A;  4ZM3 A;  3DU4 A;  2YKU A;  4A00 A;  3EIA A;  1B5O A;  1O62 A;  1X28 A;  1UU0 A;  2Z61 A;  3WX9 A;  3NX3 A;  4XEW A;  2ORD A;  2W7J A;  1IJI A;  4ZDO A;  4BA4 A;  3N75 A;  4AO9 A;  1P3W A;  1G7W A;  2JJH A;  1GC2 A;  2CIN A;  4MSO A;  2O1B A;  3OKS A;  1AY8 A;  1UU1 A;  4WYF A;  1E5E A;  4LC3 A;  3NYT A;  1BQD A;  1EG5 A;  3UAK A;  1RV3 A;  3PD6 A;  4HF8 A;  4RM1 A;  2WKA A;  4E77 A;  2W7L A;  3QI6 A;  3PAA A;  3Q8N A;  3FQ7 A;  4BA5 A;  2E7U A;  3KGX A;  4WB0 B;  4K2I A;  4HVK A;  1LS3 A;  4F4E A;  2CY8 A;  1D7S A;  2CJG A;  4JEZ A;  4E1O A;  3E2Y A;  4MKK A;  4Q75 A;  3W1I A;  1OAT A;  4MGR A;  2GMU A;  1LC7 A;  4ZM4 A;  2AY2 A;  4Q6R A;  3FVX A;  3II0 A;  3PPL A;  2FNI A;  1AMS A;  4IY7 A;  4JEX A;  3WCO A;  1QIS A;  1BQA A;  1IX8 A;  3VK2 A;  3H9X A;  3GWP A;  2FNU A;  1KMK A;  1PG8 A;  1DJU A;  3KE3 A;  1MGV A;  4N0W A;  4UHM A;  2PB2 A;  5M4D A;  3HDO A;  1TAS A;  4ZLV A;  1SZK A;  4B9B A;  5D95 A;  2R5C B;  3ISL A;  1G4V A;  1PMO A;  4K05 A;  4R8D A;  3EI8 A;  1ASL A;  2CB1 A;  2BI9 A;  1GC3 A;  2W8T A;  1TOI A;  4A0G A;  1IAY A;  3AEO A;  4A6R A;  4BHD A;  5BJ4 A;  1JS3 A;  3FZ6 A;  1AHX A;  1W23 A;  3FD0 A;  5D5S A;  3WZF A;  1UKJ A;  3WCN A;  1N2T A;  4Q31 A;  3FFH A;  4PIW A;  3E77 A;  3MC6 C;  5E4Z A;  1XI9 A;  1PMM A;  2JGT A;  2OGE A;  2VGU A;  4OBV A;  4RLG A;  3N4S A;  1WYV B;  5IWQ A;  3MAF A;  2HZP A;  2ZSL A;  3ZRR A;  3G0T A;  1AY5 A;  4QGR A;  3TQX A;  1VP4 A;  1AIC A;  1DFO A;  4W1V A;  3NYU A;  1ASD A;  1BW0 A;  3NYS A;  2CAN A;  3L8A A;  4WLJ A;  1TPL A;  2V1P A;  1TOG A;  1IX7 A;  3WKR A;  1BJN A;  1ASG A;  1GDE A;  3BWN A;  3ATH A;  4F5I A;  2VGZ A;  4ZWM A;  4H63 Q;  3PIU A;  1J32 A;  3HL2 A;  4XK1 A;  2W8J A;  4MQQ A;  3N5M A;  3E2F A;  4Y0D A;  3QHX A;  2C44 A;  4H51 A;  4XJM A;  4MQP A;  1AJS B;  3FZ8 A;  4ATP A;  4KAM A;  2BIG A;  1GEY A;  4A0R A;  1S06 A;  3EI5 A;  3G8M A;  3EZS A;  2EYQ A;  1WYU B;  2Z67 A;  3H7F A;  2XBN A;  2W7G A;  2DGM A;  2W8W A;  3LG0 A;  5G2P A;  2W7F A;  3PDB A;  4F5M A;  3GZD A;  2W8U A;  3RCH B;  3HBX A;  3LVK A;  4EMY A;  1JG8 A;  5G09 A;  2AY9 A;  1YJY A;  2DKJ A;  1FC4 A;  3F0H A;  4ZWV A;  1AHE A;  3G7Q A;  1V72 A;  2ZY5 A;  2D7Z A;  4Y0I A;  4WBT A;  2AY7 A;  3AEL A;  3LV2 A;  4F5G A;  3DXV A;  3PDB B;  4L0O A;  4EFF A;  3I5T A;  1AMA A;  1S07 A;  3FFR A;  2YCP A;  5EAA A;  2AEV A;  4WYE A;  2AY1 A;  3NNK A;  4MQR A;  4A0H A;  4M2J A;  3B1C A;  1D7U A;  1CJ0 A;  1O69 A;  4ITX A;  4JEW A;  4RIT A;  3NU7 A;  3E2Z A;  5DX5 A;  1O61 A;  4B98 A;  2OGA A;  4W91 A;  1YNU A;  4ZDL A;  2AY3 A;  4OTL A;  2YKX A;  1LC8 A;  4DQ6 A;  1AMR A;  3RBL A;  3VK3 A;  2EO5 A;  4F5K A;  1ELQ A;  1I29 A;  1QJ3 A;  1XEY A;  3BS8 A;  4RAE A;  2DGK A;  4BQ0 A;  2Z20 A;  3WGB A;  1GC0 A;  1OXP A;  1ASN A;  4XJO A;  3R9A A;  3N4X A;  4ATQ A;  4WD2 A;  5F9S A;  3AEM C;  4ADB A;  2BI2 A;  5E5I A;  4U2H A;  3EI7 A;  1CL2 A;  2BWO A;  2ZP7 A;  1LKC A;  3WY7 A;  1OXO A;  2BYL A;  2HP1 A;  5DJ1 A;  3NRA A;  4JF0 A;  3TFU A;  3DXW A;  4WXF A;  4IYO B;  1E5F A;  1B8G A;  4R2N A;  4WB0 A;  3FDD A;  2CJH A;  2QA3 A;  3ASA A;  4K2M A;  4OMA A;  1ARG A;  2AY4 A;  2D66 A;  3W1J A;  4WYC A;  1AKB A;  5E3K A;  2BIE A;  2R0T A;  2VMZ A;  3K28 A;  3T32 A;  4CVQ A;  1BKG A;  3JWA A;  3LY1 A;  2C7T A;  4AZJ A;  1WKG A;  4E3R A;  1DGD A;  4R5Z A;  4ZAH A;  3QBO A;  2BHX A;  1TOE A;  3FQ8 A;  1GD9 A;  2YKV A;  3NUB A;  3BCX A;  2ZSM A;  2Z9W A;  3HT4 A;  3DYD A;  2WK7 A;  2R5C A;  1J04 A;  2OAT A;  1EQB A;  2E7J A;  2W7E A;  5M4B A;  1LW4 A;  1RVY A;  3PJ0 A;  2QB2 A;  1ZOD A;  1M7Y A;  1QIR A;  3A9Z A;  3CQ6 A;  1DTY A;  3A9X A;  2YCT A;  1MAQ A;  3DOD A;  4FL0 A;  5EUE A;  4LW4 A;  5FT8 A;  1YIY A;  1BJO B;  1AAW A;  3GR9 A;  1Y4I A;  1BJW A;  4ADE A;  3N7N A;  2C0R A;  2GSA A;  4GRX A;  4ADC A;  5EUN A;  4IX8 A;  3FQA A;  4JEV A;  2VMQ A;  4XQ2 A;  2DR1 A;  3E6G A;  4FFC A;  1CQ7 A;  1MDX A;  2FYF A;  2ZC0 A;  1MDO A;  2GMS A;  3JU7 A;  4A0F A;  5DB5 A;  3I16 A;  2VLF A;  2F8J A;  3EI9 A;  2EZ2 A;  5G4I A;  1WYV A;  1AJR A;  4LNL A;  1B5P A;  4IXO A;  2Z9U A;  2ZJG A;  3N0L A;  2CH2 A;  2OKJ A;  4LNM A;  2QMA A;  5DJ9 A;  1ARH A;  2PO3 A;  2Z1Z A;  1MDZ A;  2VIA A;  1AX4 A;  3P1T A;  2WB6 A;  3BV0 A;  3BCB A;  4AO4 A;  1SPA A;  2W7M A;  3RQ1 A;  4DBC A;  2EGY A;  4GE9 A;  1M32 A;  3GBX A;  4GEB A;  4IW7 A;  4JEY A;  3AOV A;  1CZE A;  3DC1 A;  4OCA A;  3B46 A;  5LHA A;  1H1C A;  2W8V A;  1AJS A;  2C81 A;  3COG A;  4KXK A;  4TN4 A;  5EIG B;  4GE7 A;  3BB8 A;  1M0Q A;  4ITG A;  1WYU A;  1IX6 A;  2VYC A;  1GCK A;  2CFB A;  1N31 A;  3CBF A;  4XJL A;  1B4X A;  1YOO A;  3DR4 A;  3RCH A;  5HXX A;  3FDB A;  1M0O A;  4N0B A;  3ZRP A;  4UHO A;  1M6S A;  1MLZ A;  1CS1 A;  3RUY A;  3AEN B;  2FN6 A;  2DGL A;  3MC6 A;  1C4K A;  2D64 A;  1KL1 A;  5G0A A;  1KKP A;  3DRD A;  1M4N A;  4EB5 A;  2X5F A;  2VGS A;  4RIZ A;  1Z3Z A;  4CBR A;  1TOJ A;  1V2D A;  2VMW A;  3MBB A;  3QPG A;  2Z9V A;  1WKH A;  2YCN A;  4AH3 A;  3PA9 A;  3FRK A;  1ART A;  1C7N A;  2Z9X A;  3FZ7 A;  1OHW A;  2VMP A;  3OP7 A;  2E54 A;  2VGW A;  4ISY A;  3AOW A;  3M5U A;  1ARS A;  2E7I A;  4AZK A;  4J8L A;  2R5E A;  1YIZ A;  2YKY A;  2BWN A;  1BT4 A;  4O6Z A;  3FKD A;  1D7R A;  1DGE A;  3GJU A;  1RV4 A;  1V2F A;  4RKC A;  1B9H A;  3RI6 A;  3D6K A;  3NTJ A;  3USF A;  1SFF A;  2D63 A;  2Q7W A;  2AAT A;  1SZU A;  1I43 A;  1S08 A;  2BYJ A;  2JJE A;  4K2B A;  5EUD A;  1AHF A;  1LC5 A;  3DZZ A;  1KKJ A;  4MY5 A;  1AKC A;  1G7X A;  4ADD A;  3LVM A;  1AY4 A;  3AEJ A;  4P3M A;  1WST A;  1N8P A;  2EH6 A;  1FG3 A;  4EU1 A;  1GC4 A;  2DOU A;  2CH1 A;  1ASC A;  1ASE A;  4IYO A;  5HDM A;  2ZUK A;  1DKA A;  2VMO A;  3ELP A;  3GSB A;  3HQT A;  4GDY A;  4UOY A;  1ZC9 A;  3KGW A;  5M46 A;  8AAT A;  3MEB A;  3JW9 A;  2VMX A;  2VMS A;  2GQN A;  2VGV A;  1W7N A;  1TAR A;  2ZY2 A;  3KKI A;  4OC9 A;  1X0M A;  3FVU A;  3ECD A;  1QJ5 A;  1Z7D A;  4M2M A;  2QSR A;  3GZC A;  5EQC A;  1JF9 A;  2Z1Y A;  4IXS A;  4WXG A;  3WKS A;  1AAM A;  2AY6 A;  5C6U A;  1C9C A;  1I41 A;  2O7C A;  2X5D A;  3WLX A;  2BWP A;  3H14 A;  3WGC A;  3HVY A;  3JTX A;  1AHY A;  1C7G A;  1IAX A;  1OHV A;  1M0N A;  3A9Y A;  3B8X A;  2ZYJ A;  1SZS A;  1WYT B;  2VI8 A;  5J8Q A;  1ASF A;  3NUI A;  2X8U A;  4WP0 A;  1S09 A;  1CQ8 A;  3E9K A;  3IHJ A;  3P6K A;  4J5U A;  3VAX A;  4WXB A;  3AEM A;  3CQ4 A;  1BJO A;  7AAT A;  4JF1 A;  4GE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...