3QGVA

Crystal structure of a thermostable amylase variant
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
435
structure length
435
Chain Sequence
AKYSELEKGGVIMQAFYWDVPSGGIWWDTIRQKIPEWYDAGISAIWIPPASKGMGGAYSMGYDPYDFFDLGEYDQKGTVETRFGSKQELVNMINTAHAYGMKVIADIVINHRAGGDLEWNPFVNDYTWTDFSKVASGKYTANYLDFHPNELHAGDSGTFGGYPDICHDKSWDQYWLWASQESYAAYLRSIGIDAWRFDYVKGYAPWVVKDWLNWWGGWAVGEYWDTNVDAVLNWAYSSGAKVFDFALYYKMDEAFDNKNIPALVSALQNGQTVVSRDPFKAVTFVANHDTDIIWNKYPAYAFILTYEGQPTIFYRDYEEWLNKDKLKNLIWIHENLAGGSTDIVYYDNDELIFVRNGYGDKPGLITYINLGSSKAGRWVYVPKFAGACIHEYTGNLGGWVDKYVYSSGWVYLEAPAYDPANGQYGYSVWSYCGVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha amylase
publication title Structure of a highly mutated, thermostable \xCE\xB1-amylase variant
rcsb
molecule tags Hydrolase
total genus 154
structure length 435
sequence length 435
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2011-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3qgvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3qgvA01
4AIUA 1CTNA 5E9AA 1C92A 2UY5A 1JDDA 3VSTA 3TTSA 1L0PA 1J0JA 1PJ9A 1M04A 4PSPA 1U2YA 2WC4A 4DWSB 3AIVA 3DC0A 4AW7A 2J75A 2VVNA 3SUTA 3BVTA 3U7BA 5BRPA 1NQ6A 4JIEA 2W4XA 1W9BM 3AHVA 1CGXA 4HOXA 4V28A 3WY4A 1RH9A 1VEOA 1TR1A 1UR0A 3N17A 3DX1A 3EJRA 4JCLA 4LYQA 2WANA 3UEQA 1OD8A 1WCGA 1XC6A 2J8FA 1HIZA 4AZ6A 4M24A 1UR9A 1GZJA 1WAWA 4MDPA 4RL3A 1ODZA 3RIKA 1KR0A 4PMRA 4M8UA 1JZ7A 3A23A 3GZAA 1TE1A 1GOQA 3AIBA 1NP0A 2GDVA 4PTWA 1JZ8A 3CO4A 2XN0A 4QFUA 3SCRA 1W1PA 1OGSA 3VOCA 2VUYA 1BG4A 1UKSA 3S6TA 3TTYA 1V08A 2VR5A 3DDGA 1WKYA 3U5YA 2HISA 4Z2LA 3UG5A 2FE0A 3N12A 2XSBA 2GJRA 1OIMA 3CZLA 1OGGA 1W9DM 1EHNA 2CBVA 2D0HA 4DUVA 3T2OA 5ABGA 3UCQA 4MB3A 3KZSA 5ABFB 1GJUA 3SCUA 3ZMRA 3ZR5A 4EK7A 4U31A 1UD2A 1XSIA 3I3BA 4IM4A 3M46A 3OGSA 4PMUA 1B3ZA 3VINA 4UFJA 5JBDA 3BCDA 2GDUA 1C90A 3VKKA 3W82A 1UQYA 3A4WA 2VRQA 2NSXA 4AIEA 1OB0A 3ARSA 3RDKA 4YHEA 3VTRA 3WQ8A 1E6SM 1ZU8A 1M01A 3LRMA 1BGGA 3AMDA 4UQCA 3CMJA 4W86A 5D8ZA 3VIPA 2X2JA 1CLXA 4WKAA 3FXYA 1XHGA 5A2CA 1V0LA 3WNNA 2ZUNA 1QHZA 1HKMA 4FNRA 2FH6A 1QNQA 1J0ZA 2IXUA 1GOMA 4QLJA 5LA1A 4C7FA 1E4MM 1TMQA 1GOIA 5DEZA 2QMJA 3T08A 3AS3A 4AZ5A 1H0GA 2E40A 1FFQA 1UZ4A 4AZHA 2WMHA 3SCWA 2YL5A 3ARQA 4F8XA 4GI9A 1UH2A 1FHDA 2XUCA 5A8PA 4PN2A 4TUFA 5JIWA 2VURA 1MW0A 2EEXA 4U3CA 2JE8A 1MQPA 3W4RA 1WZMA 3AHZA 2X2YA 1V0KA 3BAIA 2DT1A 4M29A 5CQ1A 3WKZA 4PTXA 4AEFA 2WLYA 4HU8A 6A3HA 2DDXA 1OSEA 2EJ1A 2XVPA 3SIMA 1O6IA 4NRSA 1UKOA 1ZL1A 4P7OA 1AMYA 4CD7A 1FA2A 4GIAA 2CKSA 4PSRA 5BRQA 3WNLA 5FOOA 3AHTA 3LXCA 4UFHA 2J74A 1G94A 1Q6EA 2YL6A 2PC8A 3PTMA 4JHZA 2DEPA 3ZOAA 2X8RA 1Q6GA 3CUFA 3A4AA 4D72A 1EQCA 1E4NA 5JUVA 3L4XA 1G5AA 3RPMA 1ZBKA 5GNZA 1TQVA 3PZIA 5D8WA 4NX0A 4HA3A 5GNYA 3BAYA 1V3LA 3D50A 1CXFA 3ARYA 2WVUA 2YA1A 1VFFA 2FH8A 3W26A 3GYCA 3AZRA 2Y8KA 3BVWA 1OWQA 4RE3A 4DM2A 1XCXA 3WUGA 4W7UA 3F5KA 1K9DA 3WMSA 3NUKA 5I78A 3BVXA 3MUIA 3WF3A 5I0DA 3AYRA 4MAZA 1JZ2A 5IDIA 2XM1A 1QPKA 4ACZA 1C7SA 2J47A 1WZLA 1G9HA 3E1F1 3ARWA 3W6LA 4FF5A 2A3BA 1GVYA 2ZUMA 4PMXA 2ZUVA 3MMWA 5BXPA 4CU7A 1RP8A 5D9OA 5I24A 5AY7A 1EA9C 4XZWA 1QX1A 1CEOA 2VX7A 3KL3A 5BROA 4U2YA 4Z2JA 3WN6A 1SR0A 1UWTA 3EMQA 2VJXA 4ZENA 3H54A 3CZJA 3T2PA 2ZUSA 2EBNA 1U30A 3O6AA 2V3FA 2PBGA 4F9JA 4R5EA 3WSUA 3DHUA 2WPGA 2PWEA 4JHOA 4NZCA 1V03A 5E6ZA 3F4VA 3LPGA 4DWSA 1UD3A 1X6LA 1HJXA 3K8MA 4MB1A 3PN8A 1J11A 1NM9A 1BAGA 1B0IA 2CIPA 4NXKA 1ISXA 4DM1A 2EPOA 3T0BA 2JFEX 4U2ZA 4L4OA 1JD9A 2WHKA 4AZ7A 1JGIA 2WHMA 3WD3A 1W3JA 5CPSA 1UWUA 3W24A 1EO5A 1MFUA 4J3TA 4P7NA 3SUSA 2XSAA 1E55A 2D2OA 1B1YA 3L4WA 3BVUA 1E5NA 2WBKA 1J0HA 2W63A 4J3SA 2E8YA 3VGHA 1G1YA 1DWAM 3LMYA 1AQ0A 4UQAA 3WENA 2DSVA 2JF6A 1GCYA 3W0KA 1JG9A 3KE0A 1DWGM 2YLAA 2XYLA 4MB5A 4D6JA 1KBKA 1HT6A 1ISVA 5IFPA 3N13A 1E6PA 3GXTA 3PZNA 3RILA 3WH6A 3VGFA 4M81A 1H09A 3QGVA 3ZJ8A 3VSVA 1VBUA 2CNCA 2CESA 2ZX5A 5ABFA 3EJSA 1B3XA 2DSUA 5A8MA 4C7DA 1Q6DA 1R33A 3KL5A 1OBAA 1OCQA 3W81A 3A22A 2W66A 3WL0A 2G3NA 4OUEA 4W8AA 3GXDA 4UZSA 4PMVA 2EQDA 5D9NA 5E0CA 1M53A 4JFTA 3PZUA 3VD9A 4XZBA 4NZJA 3VMNA 5CPQA 4CN4A 4D1IA 3AI0A 3CZEA 2C8NA 3U7VA 5F7UA 5I2UA 4TVCA 2VCBA 3ARPA 1FFRA 1EDQA 4N0RA 1UR1A 1HF6A 4AISA 3MSGA 1US2A 2MANA 2WMGA 1JAEA 3MI6A 4NXSA 4AYGA 2WZHA 1N82A 2CERA 1GVIA 3BH4A 3A21A 3CIVA 1UHVA 3LRLA 2XFRA 3WBEA 4JFSA 3LXBA 3CHEA 5BYWA 3BMWA 1EO7A 1C91A 1HJWA 2D23A 1HN1A 3WNOA 2G4FA 4LQ1A 4HP5A 1UH3A 1V3IA 1E3XA 1J10A 4A4AA 3ZIZA 5A2AA 1GQKA 3OZPA 1QHOA 3VIFA 4B9YA 4HZ6A 1B3YA 1I75A 2FGLA 1HL8A 4QAWA 1TG7A 2J78A 5DMYA 1Q6FA 2OSXA 1C3FA 4XUYA 3VIKA 1K6AA 2EAEA 4WSKA 2XG9A 3MS8A 2BHZA 2BXYA 1T0OA 2BY1A 1Q4NX 1UD8A 1R47A 3THDA 1UWSA 4HPHA 4JKKA 1WE5A 2ZICA 2WZIA 2FHBA 5AYIA 3W38A 3BLPX 1V02E 4QP0A 3MUY1 5CGMA 3WD1A 2J7GA 1GQLA 4D6DA 3QHMA 1XD1A 2F2HA 2YDSA 3APGA 3MANA 3NSMA 2VMFA 3FAWA 4UQBA 2A3EA 3ALFA 1WZAA 2XN1A 4TX8A 5EB8A 4E4PA 1E56A 1OD0A 5D9MA 4TXEA 3VGEA 2WB5A 4AY1A 1W32A 1C8YA 1CDGA 1KWGA 2IUZA 2YL9A 3B9AA 4GZIA 2AAAA 1W9VA 3FNDA 3G6LA 3II1A 5CLWA 2WHLA 1UWQA 4M82A 1A47A 1ECEA 1CXHA 4Y7EA 3CLWA 1LJYA 4MJ2A 2VX5A 7TAAA 5A69A 4D6HA 1BGAA 3CBWA 5A6JA 3GXFA 1KR1A 1ITXA 4D6GA 4Z2KA 4B9ZA 3U5UA 3JUGA 2D73A 2G8ZA 3VDHA 4AMWA 4JFWA 1V0MA 5AC5A 1KFWA 4TVUA 4NI3A 3CV5A 6TAAA 2ZWZA 1R7OA 4QLLA 2CEQA 5ECUA 4P8UA 2W91A 2F18A 2D22A 1O7AA 4W5ZA 3AOFA 3ZT5A 2X05A 4FNTA 4UOQA 1KBBA 1CGYA 4MNJA 4KMQA 4GI6A 2CHOA 1KGXA 1OGBA 3QOKA 5CPTA 2VNCA 1H2JA 3OA5A 2BY0A 3GXPA 3VD4A 2BXZA 4E8DA 4J3WA 5C70A 2WC3A 3ZJ7A 1PX8A 4MDOA 2JEPA 1C8XA 2W62A 4DWSC 1V02A 1UR8A 1CGWA 3CHCA 4B15A 1HXJA 3FAXA 3GDBA 4GZEA 2QV4A 3KEHA 1LL7A 5A6MA 3AXIA 4KGJA 1CENA 1IZJA 4W7VA 5I79A 3WDQA 3AIWA 1GOKA 3ARZA 1ISZA 1D2KA 2J7CA 3VDAA 4YPJA 4HA1A 4JFVA 3W37A 2VVSA 3G6MA 2G3MA 4EAMA 4PMQA 2EPKX 1UD5A 2W5FA 4BQ3A 3S5ZA 1I1WA 4P7QA 5A6BD 2GFTA 3VX1A 2E9BA 1DP0A 1WB0A 3VNYA 1RPKA 1R85A 3NDYA 5E1QA 4MNKA 9CGTA 2WNWA 3DX4A 4HOWA 4U33A 5E70A 2WK2A 4PTMA 4UTFA 3NCOA 3N04A 3BAWA 2WWDA 2ZXQA 4H8UA 4K68A 4HPGA 3EDKA 1ZB5A 1TFVA 4UZUA 1Y7VA 1MQRA 1E9LA 1DTUA 4AC1X 4JFUA 2WLZA 4GXPA 2ZUWA 3AS0A 3L4VA 1EHAA 4Z2HA 4PMOA 1BYDA 3NSNA 1EOKA 2GVYA 4KH2A 2BY2A 2GK1B 4D1JA 2WHJA 3QR3A 2VI0A 1UD4A 4AYSA 1UR2A 1XD0A 3ARXA 1WP6A 2W92A 3PZ9A 2VRKA 1QI4A 1PPIA 1DEDA 1V6XA 3WF2A 4X0VA 4B16A 1K9FA 5HPCA 8A3HA 3CC1A 5FKYA 2WMFA 3EJPA 5E6YA 3A24A 2QMKA 1PZ3A 3DDFA 3CMGA 1E73M 2BV9A 5JIPA 2GJXB 2YLLA 1JNEA 2UY3A 2F1AA 1CGVA 2E3ZA 1CXEA 2BS9A 1UH4A 1UZ1A 4A3HA 3AIEA 4W89A 2Y8VA 1J0YA 3WFZA 4F9DA 4WSJA 3OLEA 1E43A 4CCEA 2OW6A 3UR8A 3WY2A 3CZGA 2ZXBA 3RM4A 1TQTA 2X0HA 4AD1A 4HU0A 2GUYA 2VZSA 2J7BA 1TQUA 2YJQA 3EJUA 2TAAA 4HMCA 4D6EA 1UKQA 3GBEA 1H0IA 1CECA 1WDSA 1SMDA 4QLKA 1W9XA 2OSYA 1UQZA 4AD5A 3TP4A 1X1NA 4JKLA 5GQBA 3HG3A 4PYSA 1VBRA 4HMEA 2FYVA 3HG4A 1QNRA 3WQWA 1Z32X 4CCCA 3SUVA 4LPCA 3F5JA 4WLCA 3BSHA 4CGTA 4IUGA 4XV0A 4ATDA 3UETA 1W1VA 3UERA 3EDFA 1BHGA 4KRTA 2X2IA 3M6DA 2J79A 3K1DA 2ZX8A 1VFUA 3IJ8A 1JIBA 1ESWA 3WDRA 1BTCA 1BYAA 2ZOXA 2F8QA 4B3KA 4IPNB 1WZKA 4EE9A 2Q8XA 3VIOA 1DWIM 1GQJA 4OIFA 2O9OA 3MO4A 3SCVA 1PS3A 1VFOA 3WNPA 1MFVA 4WKFA 5A2BA 2XIBA 4AZIA 1SZNA 5ABEA 1W91A 3IJ9A 1CNVA 3MU7A 2VR4A 4AEEA 2XFYA 3WF4A 5KZ6A 1NP2A 1B3VA 2ZE0A 2O9PA 3T0AA 4H7VA 4KWUA 3WEOA 2GJPA 1R8LA 2CBIA 3A5VA 2XTKA 4V2XA 3N18A 1UA3A 1BF2A 1DWFM 3WQVA 1KCKA 3IK2A 4W85A 1NOUA 1R46A 1CPUA 3CTTA 5I23A 2EPNA 4E8CA 3WUBA 1E15A 1UYQA 3WBAA 3BUPA 4CVWA 1XYZA 3OGVA 3EBVA 1JZ5A 2J7HA 3MKKA 3UG4A 3DYPA 3THCA 3LXAA 1HP5A 3POHA 1HNYA 1IT0A 1JYXA 3AQUA 2EADA 1V6WA 3K4AA 2E8ZA 3BCFA 4Q7NA 3WMCA 1QWNA 1JAKA 2J25A 1E1EA 4F66A 3FN9A 4GZJA 2CBUA 3ZT7A 1E71M 1ZBCA 1ITCA 1J0KA 3OG2A 4GINA 5M17A 5LYRA 5EMYA 5D4YA 1JYWA 3D4ZA 3AMKA 2Y4SA 2BVTA 1B30A 1QBAA 3GM8A 3BGAA 4ZXOA 1E6RA 1MW3A 4FNPA 3SCQA 3WD2A 3W29A 5CXPA 2F7RA 4DO6A 3TONA 1KTCA 4UFLA 2OWXA 1M7XA 1PX3A 2WSKA 1VB9A 4D6CA 2ZUUA 4MPKA 3MV01 1QOXA 3HZ3A 1BSIA 4S3KA 3ZJ6A 2ZIDA 2YA2A 4PEEA 1LL4A 4NZFA 1WPCA 3TA9A 2WVVB 4JCMA 3AROA 2VX4A 3OB8A 5E09A 4ATLA 3FW6A 3PZVA 1EGZA 4CN1A 4P8VA 1TCMA 1TA3B 2WMKA 2YBUA 2D0FA 3H55A 2J77A 2FHCA 2W61A 1VIWA 3POCA 2DSZA 3WNKA 1R7AA 1PEZA 4F79A 1PAMA 3H53A 3AIQA 2VL4A 1BPLB 4CD4A 4CD5A 3NIYA 3AHXA 3VM7A 2O9RA 3WEMA 3OZOA 3OGRA 1WDRA 3CZSA 2PWDA 1JFHA 5A6AA 1M03A 1F4HA 1NOFA 3DX0A 1DHKA 3K8KA 1JFXA 3SCTA 1XV8A 1HKJA 3WUEA 8CGTA 2GK1A 3D4YA 4AZCB 2ZX7A 3CUJA 1GW1A 1E6QM 5IXEA 3SCSA 1GHSA 1QVBA 3AHYA 1EIBA 3MMUA 4UQEA 5CGTA 4LX4A 4UNIA 3BLBA 5A8OA 4IISA 4X9YA 1LL6A 2CYGA 4FNQA 1TQSA 1QNSA 2GJXA 4ZXLA 3AISA 3WY3A 4Z2IA 3ZO9A 3ARTA 2XWEA 4PTVA 3WFLA 1EDGA 1LWJA 3AS1A 1E1FA 2ZUTA 4EANA 2WKGA 2XVNA 3ARUA 1D7FA 2J8GA 1W3HA 2ZXAA 4OKDA 2B31A 4PBGA 1BG9A 4OOUA 4GKLA 2UY2A 5A6KA 5KEZA 3GH7A 1QI2A 1TQWA 2NT1A 1OM0A 2VQUA 3EDDA 1US3A 2ZX6A 1JYNA 1TVPA 4W88A 4W7WA 3WELA 4GPNA 1VF8A 4HTYA 1K9TA 3KLLA 3RJXA 2DSKA 3DYMA 1JF5A 2PWFA 3BUQA 1XGZA 4X0NA 1B3WA 1CBGA 1FP9A 1R87A 2PI6A 3AIRA 4W8LA 1JI1A 2WBGA 5A3HA 1RD6A 2E4TA 1QNPA 3TTOA 3WH8A 1QW9A 5GNXA 4PRWA 3DX2A 5C71A 3RM8A 1BQCA 4P8XA 1UWRA 1U33A 1UKPA 1E6NA 4GO8A 1HVQA 1C7TA 1XH0A 4UOZA 1F4AA 4CU6A 1UUQA 3KL0A 3WQ6A 3WUFA 1UASA 4A3YA 3WY1A 3VVGA 4CKQA 1UR4A 3BUDA 4H41A 2O92A 3LPPA 1NWRA 2DGAA 5GPRA 3PZQA 4ZFMA 4J3UA 3KWXA 4HZ8A 5A6BA 1TUXA 1HKKA 1LG1A 2QPSA 3N15A 6CGTA 4RE4A 3AIUA 1B31A 1V0NA 3RMEA 1GHRA 3AZSA 1YHTA 3BUIA 3CUIA 2YDQA 5A8QA 5EBAA 2Y24A 5M5DA 2VZUA 2OLHA 4TVDA 4RE2A 2VTFA 3T2QA 5AC4A 1HKIA 1JL8A 2BHYA 2ZX9A 1GUVA 2D3NA 2OYKA 1WNOA 1W9UA 4DUWA 1TVNA 5BXRA 4M1RA 3CZKA 4NRRA 3HJEA 2DT3A 1G0CA 1CGUA 3AFBA 3I3EA 4AWEA 4OJYA 1GJWA 2EPMX 2VRJA 5E0FA 4CN6A 2CHNA 3PTQA 5M03A 1XH1A 1OIFA 1TZ7A 2J7EA 4U3AA 2AOSA 4TOQA 5IHSA 1GOWA 1NWSA 3ARRA 3LPFA 7A3HA 3S2CA 3WIJA 1FHLA 4EKJA 3LRKA 4PMDA 3QOMA 3CGTA 3B8SA 3FHAA 2OSWA 2PWHA 3VGDA 1UA7A 1NWUA 3ALGA 2XHYA 4FK9A 1CXLA 2YFOA 5LA0A 3DX3A 2X1IA 4J27A 3N1AA 3CHFA 3VMOA 5D9PA 1LWHA 1WO2A 5FL1A 4UFMA 2BHUA 3W53A 1UG6A 2XJ7A 3B9DA 4MNMA 1CWYA 4FLOA 4C7GA 1C8QA 2UWFA 4B3LA 3WEZA 2QPUA 5AYBA 3L4UA 1QHPA 1V3HA 1E0VA 3RJYA 3AJ7A 4MTVA 3K4DA 2BVDA 3BSGA 1KQZA 3CHDA 1J18A 2VCCA 3BC9A 1VJSA 1FH7A 2E9MA 4CD6A 1J01A 5A6LA 4V27A 2WKLA 2WVVA 4QCFA 2YOCA 4P8WA 1E5JA 3D3AA 3M7SA 5DF0A 1JF6A 2YL8A 5I6SA 1QW8A 4AIOA 4GQRA 2XVGA 3GH5A 1TA3A 4W87A 1E3ZA 1CXIA 2ZXDA 3OLIA 4HOZA 3NYDA 3W27A 2OW7A 3T0DA 2WVSA 4PMNA 4LXFA 1ISWA 3AMGA 2F7QA 3IAPA 3PBGA 5I5RA 2IGTA 1EXPA 5A95A 1S46A 2NW0A 1R34A 2F1BA 2JALA 3WD0A 4OBRA 2XGIA 5M3WA 4FLSA 1GONA 2VZVA 4MJ4A 1YQ2A 4UQ9A 1QNOA 4WKHA 3WDPP 2BVYA 4KGLA 2AMGA 2DQXA 4ZE4A 1JDAA 2D3LA 1LQ0A 1XSJA 2C7FA 1PIFA 5DO8A 1NOWA 2DT2A 3VMPA 1HJSA 4DO5A 1D3CA 4AD2A 1KXHA 4AZCA 4AMCA 3WDIA 1W1TA 3ZJKA 1JZ4A 4CVUA 3SCOA 4GQQA 1H1NA 5ABHA 3L4YA 1KQYA 1MQQA 4W8BA 1MVYA 1NWTA 4JL1A 3AS2A 4HA4A 3VNZA 1QBBA 4CCDA 1GORA 1W2PA 3WMBA 1HXKA 1V3JA 3MUZ1 2D24A 3S5YA 5FCZA 3KLKA 3A3HA 3EJTA 1EQPA 3SUWA 4YN5A 2UY4A 1AQHA 4BZYA 2WMIB 3CZNA 3GNPA 1W3LA 1XCWA 3D5HA 1OINA 1B9ZA 1J12A 3ZQ9A 3VIJA 1MXGA 3BAXA 4PMZA 3WL1A 3CUGA 1HJQA 3SEPA 5DT5A 3B9EA 2VC9A 1XYFA 1B90A 3PTKA 4UFIA 2J4GA 3PZGA 2J7FA 3WH5A 2JIEA 1H4PA 1BVZA 3CZ8A 2YKKA 2WSPA 4W84A 3LX9A 3L4TA 1ISYA 3O9NA 1HWWA 4PUDA 4P7RA 5CLTA 5EFFA 3CUHA 2QHAA 1CXKA 3MV11 5EFDA 3DECA 1SFSA 4FNSA 3VU2A 1ZS2A 3MUAA 1H49A 2XVLA 1W1YA 5DT7A 1V6UA 2VZTA 4ATWA 1FH8A 2CPUA 3RCNA 3VDCA 1QI5A 2CITA 4WF7A 3EDJA 2WWCA 2V5DA 1AQMA 4UOJA 2WCGA 1A3HA 2ESCA 1VRXA 1K9EA 2EACA 5A94A 4PMYA 3SCPA 1L8NA 2G3IA 4ZE5A 2PWGA 3BVVA 3CH9A 4D71A 1CZ1A 2F7PA 1JI2A 3K46A 1CYGA 3U57A 2ZWYA 2BNJA 1JZ3A 1ODUA 2VQTA 1OT2A 3L4ZA 3GXNA 1JXJA 1H5VA 5BXSA 1QI0A 1E4LA 2XIIA 2OWCA 3OLGA 2WAGA 2XPKA 3GTNA 1VJZA 2VZOA 4HMDA 2F61A 3W6MA 1B2YA 2CBJA 4WIWA 3EMCA 2X09A 2DIJA 2DIEA 2HVMA 1AVAA 4YHGA 3RO8A 1CIUA 3VIIA 1PBGA 2G3JA 2G41A 1IZKA 5A8NA 1UKTA 1P6WA 2Y2WA 3MSDA 2A3AA 1IV8A 3F5LA 1BYBA 1GOOA 3A4XA 4JKMA 1HTYA 1W9PA 4M56A 4M80A 4LYRA 1MXDA 4N42A 5IHRA 4UR9A 4FLQA 5FD0A 3HN3A 4AZBA 5I77A 3PZTA 4ML4A 3ARVA 3AYSA 3EMZA 2EXOA 1JZ6A 1BLIA 2WCAA 4AD4A 3EJQA 1E40A 3NDZA 1HVXA 3L2MA 4CD8A 4DUXA 4D6IA 4OGZA 4JZ5A 4MNLA 3FY1A 4MAVA 1MW1A 3BAJA 4Q22A 1KGUA 2V38A 4OOZA 4MADA 3OBAA 4D6FA 5CZKA 5C8BB 2Z1KA 3VO0A 1KWKA 1QI3A 3SCNA 2XFFA 4JAWA 4R27A 1Q6CA 3BMVA 4Z2GA 3J7HA 2D20A 1QWUA 1H41A 3SUUA 5I3DA 1PIGA 4LYPA 2FHFA 4H04A 1V6VA 4WK9A 2WXDM 1VFMA 1DWHM 2FGZA 4U5IA 4U5KA 1E6ZA 1VENA 4UFKA 4XX6A 4AXNA 1FH9A 4L4PA 1JDCA 1UOKA 2PB1A 4CUCA 2QF8A 3WDHA 2EPLX 1ZJBA 2VO5A 2RGMA 1E6XM 3O2LA 2F7OA 2PF0A 2DH2A 1HJVA 2WC7A 4MB4A 1XSKA 3GNOA 1XH2A 3AMLA 2OYLA 5FIPA 3IGUA 1ZJAA 1E72M 4GI8A 1E0WA 3UR7A 5A6SA 3VDBA 4UQDA 2EABA 4AZGA 2BY3A 5HXMA 1I1XA 3D51A 1PX4A 5CSUA 2X0YA 4P7LA 4QCEA 1UWIA 2CXGA 1NARA 2XN2A 2WCSA 3SURA 5HDRA 3IANA 3VILA 4H2CA 1SYTA 2XM2A 1NH6A 3VX0A 2CCRA 3L2LA 2DSWA 4AMXA 3HU7A 2VOTA 1V6YA 4HZ7A 3OIHA 1WDQA 4JL2A 1GPFA 4BF7A 2D0GA 2VX6A 4URIA 1EOMA 2NT0A 4H8HA 2YDRA 1G01A 2OYMA 1W3KA 3AZTA 4GO9A 3WF0A 1JYVA 1DWJM 3GBDA 5CG0A 3HG2A 5TD4A 2DPEA 1UD6A 3ECQA 2Y5EA 1J0IA 2WM0A 1KXVA 2EO7A 1KTBA 1KXTA 3UG3A 1GQIA 2WMIA 4AD0A 3TOPA 3BUBA 2CETA 4S3JA 3NJ3A 2J7DA 1HP4A 2FDMA 5HPOA 3TTQA 2VT0A 5CSYA 2ALWA 4TX6A 1X6NA 1O7DC 3UESA 3VD5A 3VIHA 2DH3A 2QLYA 3DHPA 1OT1A 7CGTA 1FOBA 4NSBA 3GXIA 4ACYA 3WNMA 2BFGA 2WVTA 5BCAA 5CJ5A 1BYCA 3T09A 5HNNA 1ZBVA 2VCAA 1R75A 3WH7A 2V3DA 3W25A 1JXKA 3M07A 1C93A 2JF7A 2E9LA 3VIMA 1E70M 3CPUA 3MMDA 2YIHA 1KCLA 4DWSD 1JD7A 3HMCA 4J28A 3WH9A 2Z1SA 5LA2A 1WDPA 1VEPA 1VAHA 3ZR6A 2PBOA 1H3GA 2YA0A 1HL9A 1KXQA 3FHQA 3ZSSA 2E0PA 4FNUA 3K8LA 3A47A 4J3VA 4PCSA 3PHAA 3BXWA 2RGLA 2GSJA 4KRUA 4BQ5A 4XB3A 1EH9A 4NF7A 3VPLA 3OLDA 3VGBA 4AD3A 3EYPA 1FP8A 2DT0A 3WF1A 3AMCA 3N11A 4FMVA 2V5CA 1V3KA 4FLRA 1V3MA 1XRVA 3VIGA 4BA0A 3WD4A 2O9TA 1W2VA 5FL0A 4QDMA 1LF1A 5BXTA 1JNDA 5DFAA 2WZEA 2WYSA 4BS0A 3PZMA 2CKRA 1MYRA 3VSUA 3GH4A 2A3HA 1SMAA 3NSXA 2V3EA 3WQ4A 1HJUA 2A3CA 2YFNA 3WQ5A 4J3XA 3RM9A 1CGTA 3VD7A 3IJ7A 1E0XA 3PZOA 4H8VA 3TV8A 3QHNA 3AXHA 4W5UA 1HX0A 3ZT6A 4ZEPA 3ZM8A 3AXXA 2XWDA 1RP9A 2WW5A 2JIWA 2WMJA 2D1ZA 4CU8A 1GNXA 3W28A 3BLKA 2J62A 4DO4A 4OBSA 1R86A 3N9KA 1MWOA 3HG5A 2X2HA 5JBFA 4BCEA 2YBTA 3LPOA 5HOSA 5BWFA 3DYOA 4UCFA 3I3DA 4E2OA 4ACZB 1PZ2A 1ZBWA 3VGGA 3VM5A 3GNRA 2XVKA 2IXVA 4TTUA 2C0HA 4LGXA 3ZSTA 1J9YA 3A6OA 4BQ4A 2W67A 4IPLA 1LG2A 5IFTA 1BFNA 1CLVA 4WJXA 4OZOA 3GXMA 3EDEA 1VEMA 1LLOA 4W93A 2OWWA 1E4IA 2JEQA 4J7RA 4TTGA 3VD3A 2V3GA 3VUPA 3IAQA 1EDTA 1KB3A 2XGBA 5JBEA 5A1AA 1H11A 4BQ2A 3QHOA 3D52A 5HBFA 1BVNP 1KGWA 4PCTA 4PUEA 3BAKA 3WDJA 3AICA 1MW2A
chains in the Genus database with same CATH superfamily
2I5YH 4O4WA 2UZPA 4RAVA 2Z7GA 1RUSA 5D8JH 6FABL 1H63A 3N2OA 3OMAB 1H3XA 1LK2B 3V5HA 3MLRL 4PMFA 4BEQA 4IGNA 5FECB 3BISA 2EC8A 2HLFD 3OXSA 4PC8A 5K9KA 1N2RA 1T1YA 3D05A 2QQNL 2XIOA 3EBHA 1MCOH 1RUQH 1GZJA 1O0VA 3TVMA 3MYZA 4H1ZA 4KFPA 1IXQA 3GZAA 2QUMA 4XKMA 1NP0A 6XIMA 5EWIH 4LLYA 2OYPA 4A21A 2H9GA 3NCJL 4XAZA 1WAUA 2XH4A 3WHXA 4IMAA 2TRYA 1OCCB 3QIUC 2GJRA 4M6ML 4Y8FA 3IRCA 3UCQA 2HK0A 3ENLA 4LBAA 4PRIE 3VKDA 3GFUA 2P1YA 2Y7LA 3Q48A 5JZ7C 2FEJA 2VRQA 4MMZA 3WIHH 3WTUA 3BEWA 1SEQH 4NUMA 3DTUB 3WEAA 2VXVH 3WO4C 3CNKA 1NTHA 5GS0L 3BUTA 1EHKB 1SY6A 5JXEA 3WQOA 3BQUC 1B4LA 3V8CA 1EF2A 3HZMA 1T22A 1GOIA 1ZP4A 4G8AC 4HIHA 4GJIA 4J1OA 3VWKB 2YL5A 4PJAF 3FU9A 1AJ2A 4GY1A 4HZMA 1S5HB 4YIWA 3AHZA 5F70A 2DZWA 3N19B 5I74C 6A3HA 2AZUA 4CAGA 4GCAA 4DQAA 1NKOA 4NJGA 4JHZA 4PRIA 1S7UB 4D72A 4Y4FC 3HRPA 3UZYA 3DXAD 5GNZA 2XPYA 1SQMA 1K5NA 4LCIH 5KSAC 4ZS7H 4LLAA 4Z76B 3PWLB 4NQSB 3AZRA 5C6MA 1P4IL 2JQXA 4MMWA 4KY1L 3U7YL 3WMSA 1Q9KA 3BVXA 2CBTA 2UYLB 1U8PB 1JZ2A 5IDIA 2ANUA 4XVSL 3LSOB 1C7SA 4JO1L 1OADA 2HJPA 4BDVB 1ZLWH 4Q8TA 4IOSD 4MVBC 5J11C 2DZTA 2EE6A 5LBGA 1KFAL 4DAFA 4DYEA 1QX1A 4ZOBA 1P53A 3CG8A 2ZUSA 2Y07L 3O6AA 1XIMA 4U1HB 1LO4H 4IU2B 5T5FA 4F57L 1OCNA 1I0BA 2DL2A 4ZMOA 4F0RA 1EGJA 2OCFD 3ONBA 4UQ2A 2CWXA 4RA0C 5SWSD 2WBJA 2WLLA 3UT0A 1JD9A 3KDOA 1NQKA 2WHMA 4YFLI 5CPSA 1UWUA 5E7BA 4AIZA 3LDBC 2QJGA 1IXPA 2DQGH 1WA2X 4RETB 2VFGA 3ATDA 2Y7MA 1TJHH 2FWOB 5CD3A 4LE8A 4PJGF 5HHXL 3W0KA 3LQGA 5C0ND 1L0QA 3S36X 5ITFB 3QEGL 4OZFH 3BHBA 1I2QA 5CGQA 3UC2A 1SRDA 2C79A 1ZGDA 2P0OA 1YADA 3RTQD 2QL1A 4TOYL 3W81A 2LE9A 1DTNA 2AGJL 2DJMA 4UZSA 3GSNB 5G5DA 4JFTA 4QYOB 3L2NA 4UTMA 4FX5A 4U28A 3M1BB 1HHHA 1A3XA 2C0AA 2F9BT 3PAOA 4N0RA 1HF6A 3WTSA 1W0YT 4KI5C 3F6JA 2FJGB 4GAYA 2J6VA 3DJRA 1DBAL 1X9RA 2I9TA 4F8OA 4LQ1A 3CIAA 1IBBA 2DQJH 2B81A 3ZZ1A 1TVBA 1QHOA 3VIFA 4HZ6A 4WXYA 4QAWA 5I0VA 4I3SH 1Q6FA 4OR1A 3P9LB 3S0PA 4BGLA 1T0OA 1ML1A 3DJ9A 1BBDH 5FO7A 2XA8H 1LMIA 1XYLA 4JDVB 1GYWA 5C9WA 3M0LA 2R14A 1NL0L 2VABB 2X0VA 2V7HA 1GQLA 2YDSA 4Y19B 2XN1A 2NUTA 2IKIA 3QUYB 1HOCA 2ZSVB 1ZHLB 3CDCA 2H0JA 4NRZA 5JORB 5FHBH 1NOLA 2YBRA 3ZDXE 1A47A 2ZWNA 4JEGB 1MFBL 2VX5A 3CBWA 5A6JA 1KR1A 2I07A 2H8ZA 4FHBD 2PGWA 1V0MA 3MP3A 3F4DA 4ZCWA 3O7UA 1LRNA 1Q0YL 3BJLA 3PAVA 5DJYA 2W91A 4L4VE 3X14B 4BWLA 3W7DA 4YR6B 3BWAA 1LO2L 1BRLB 1BVOA 3MRBA 2EIBA 4I3RH 4UWMA 4XBJA 1LLAA 2WXHA 4KNTA 4UAHA 4TSCL 3HMXL 3HAEB 4CQDA 2PTTA 1QAWA 2W62A 2ZNXA 1S3KL 4ZO8A 4IIQC 3PPHA 3IDJB 1R3HB 2DZSA 5IWLA 4GZEA 3I6GA 3RWFB 4EI5D 2SEBA 3SJVB 1X5FA 1IZJA 2L7JA 3WLBB 4NENB 3SCMA 3L3KB 3DV6B 3W37A 1Q3NA 3CUXA 4A2GA 3HURA 2A4ZA 2WNWA 4DGYH 4L2LA 2Q76A 3QUZB 4MUPA 4HPGA 4OQTL 1ICPA 4UZUA 2A83B 3IRPX 5FKPB 4L4VA 2CU0A 3MI2A 5F7EH 3NSNA 3NQMA 2EDBA 1SHMA 1XXFC 2ZCGA 2BY2A 3BYYA 3OKKA 4AYSA 1KDIA 3QG7H 2C1PA 5HYQB 2G4GA 1W3TA 2C3HA 5ISZB 1JZDC 5GGTA 5FKYA 1JPTL 2C3VA 3T1GA 2YGPA 1TUPA 5TNVA 4XUGA 5D1QB 4LP8A 2QR6A 2IO5A 2OU4A 2NY0D 2UY3A 1AGFA 4JG5A 4HDIA 2G30A 5DHEA 2VAAA 5LO7A 2AJYH 2A77L 3OLEA 5DJ0B 2OW6A 4GNJA 1GVFA 3KOZA 5IJKA 1A4JB 4WO4B 4D6EA 2IDUA 1CZ8H 4PYSA 3LV3B 3H9YA 3OB0H 3MA9L 5AWNH 1QLFB 4BXVA 4Z7QB 4LSRH 3HGOA 1AG0A 3BSHA 2AEQH 5E2TH 2ESVE 1GTFA 4O1AA 1GPOH 2B77A 3H2EA 1KUMA 2HLFC 5F1KC 1CBVH 4H88H 3ARGB 5L2KE 1DWIM 3TWAA 3OP2A 5JA8B 4NDMB 2P48B 1HEZB 4EOWL 5LSMA 1GHFL 4OZHB 5AW7B 2Y1VA 5IHZB 2HG5B 2O9PA 1SPQA 3A5VA 2H8PB 2WLIA 5FDWA 1YYAA 2H1PL 4QNEA 1NINA 3IDGB 3NJHA 4Q9QH 1SJDA 2IV8A 3BUPA 4BA8A 5JPNC 3WLSA 2G37A 3PY9A 2P28B 2WCPA 1JZ5A 2F6KA 1NGQL 3QDMB 2XG4A 4JRXD 2NY2B 4UB0L 4LW7A 2ARJB 5T1LD 4IOIA 3B9KB 1I53A 3FSVA 3WBWA 3L3DB 1ZAHA 3C2OA 3HI6L 3P9WB 1I2RA 1A7OH 3WKNA 3NPXA 4QXUH 2DQTH 2ESVA 4RZBA 1G9NC 3B7RL 3TJIA 3S3PA 1XL6A 1KTCA 2G0LA 1CDIA 4A2DA 5T1KD 4RNRA 4OV5A 4MPKA 3JWOH 3QPYA 2PYFB 2CRIA 4KNUA 1P1ZA 3T44A 2E3VA 4ZQKA 1BZDA 3OHIA 4A67A 1J9SA 4IGBB 5E09A 1K70A 3FFSA 2PODA 4XNYL 4P2OA 2FSDA 5FXCH 3JXAA 4LCWE 1EJVC 1BPLB 1N64H 1U21A 3UA3A 3BIKB 2B7QA 2BOBA 4HHWA 3BSMA 4TRPL 4ZW6A 2ZAGA 3PPCA 3THAA 4PE8A 4JDBA 3EGXA 4AVIA 2J57A 5GRUL 1LYXA 1KLUA 4IQHA 4HMNA 5IB4B 4PV9B 2B7DT 4AZCB 1YC7A 1KY6A 4KKQA 1I1AD 4RKAA 4Y16A 2PSNA 4KUZH 1AE6L 5CMAA 5AHLA 4L1HA 1XFPA 4L9DA 4C58B 4DTGH 3S98A 3BJFA 3GTFA 3BKJH 5C6TL 1QNSA 2RALA 1XF2A 1XGEA 3TWCL 3T71A 4PI2A 5IHUL 5MHBA 3U1SH 1BZ9A 4HXAH 2XVNA 1Z6JT 4P5KA 3RCYA 3PGDA 2I24N 1WFMA 3T4YA 1AG1O 2GVLA 3GSVA 4JGUA 1MY5A 2NWRA 3IDXL 2B1HL 3U0PA 1N0XH 3N42F 1IIHA 2X3CA 5K9DA 5C0JB 4M7JH 3A9BA 4GUJA 1XGZA 3KRUA 4LCWA 5AUMB 4NNBA 5CZTA 4O1FA 1TCDA 4XNZB 2HS8A 1U33A 3T6XA 5C1MB 3WUFA 4U0RC 1E5AA 1JGLL 1Z7JA 3KWXA 3WTVA 2UVEA 5D93B 1ZTVA 1I82A 1CF8H 3WUWB 4R5VA 3Q67A 1N3NB 2X88A 3EWUA 3ZWSA 1A4CA 2OLHA 3UTTE 1F8TH 2JCCF 3QJOA 3B2UD 1YRRA 4QE5A 3MCLL 4NRRA 4XPHH 5F0PB 3TZVA 2HKHH 4WFGE 3BZ4A 5EULV 1WTGT 1S9VB 3WCYA 3FGCB 3UFYA 1B3JA 4LASH 2WYTA 4W9LC 4ODBD 1KCBA 3FHAA 4FTDA 1WT5A 5EUOF 4E41B 3QXBA 2WMPA 4ZD3L 1AHWB 5EEXA 4PUBH 3L67A 4HCRL 4DGVH 2DZVA 5IFJB 3VMOA 3UABA 1NLDH 4HIXL 4XMLL 3DGGB 3N6YA 4GQGA 4ZX4A 2FR4A 5E00B 2JKXA 1UATA 5ACMA 1OZUA 2E09A 1H5BB 1N7MH 1EAPB 1KQZA 4I90A 1J18A 4FLHA 1XRFA 4HU2A 4XCFL 5A6LA 2OFQA 2WVVA 2D3JA 5FEZA 3GS7A 1QPRA 3FYYA 3MC5A 2YAMA 1M3IA 3UTTA 1BIHA 4LB8A 3SKOA 1TV8A 4L18A 3SYQA 1D8WA 3J27A 3DX8A 4YC2B 1QW7A 2VZVA 3SGDH 4GSUA 3UVIA 4LBSA 1T0MB 4X7DC 3VYPA 1T2QL 1D3CA 3KNBB 4Y4KD 4FSAA 1JZ4A 4XCYA 3O6FA 3EADA 3UY8A 5DCEA 4GQQA 3MOQA 3IB4A 2IIJA 1KQYA 5DRCA 1DLFL 4NBZB 4O57A 3RRAA 4U1IA 4OM0L 5TPWL 3HZYA 3WD5H 4ZAKA 2W38A 3IFLL 4F5CE 3QEZA 1YX1A 1S7TA 3D5HA 1W8EA 4N87A 3DRQB 1J12A 3VIJA 1S7QB 3REQA 4FOKA 3OAZK 5DT5A 5JOEA 5HK4A 5EPDA 1D6VL 4NUGH 1ETJA 3PZGA 3NZ8A 5AKVA 2MEJB 3L4TA 1BZEA 4G6KH 1JHKL 3RX4A 4WGWB 5EFDA 3CFEA 1HSAB 1RQEA 3HEIB 2H3DA 5IREA 4S2BA 4EI5C 4RLIA 1BAWA 2AK4E 4UOJA 3WG7B 2ESCA 1Z5LA 4PMYA 1IC5L 1P7QD 1Q85A 1S5MA 3NG3A 4D71A 3FBKA 2X70B 1IQDB 3KBJA 4LKXB 3CFBB 3L12A 5K9OB 4HNCA 3SE9L 4GRLB 2NY5C 2ITCB 4JLRB 1VFBA 5DQ9A 2HRPL 1WWAX 3M17A 5LNDA 2XPKA 2ODHA 4F5CA 4CW1B 3FU0A 4YHPA 1AZ2A 1AVAA 3CDYA 1ADSA 2G41A 1DN0B 1G7QB 4ZUVB 3H9SD 2CMRH 4X6CF 5LGJB 3T8LA 5FV1L 3QQDB 1UUSA 4DJEA 1WBZB 4UYPA 4FLQA 4AZBA 3AU0A 2C1GA 3LH2L 4P23A 2VGFA 3TQPA 3AYSA 3BP4A 4YO0A 2CGRH 4FXSA 3L54A 2F7IA 4WQ6A 1MJ8L 2F74A 4PRPD 4I5RA 4QHNB 1HKVA 3CVBA 2BWIA 3VC5A 3BICA 4Z7OB 4MADA 1INDL 2OJEA 5CZKA 3C08L 3QIWB 3SCNA 3R0KA 2AK4A 5KYXB 3J7HA 3OW1A 1W72A 1H41A 2AEPL 3LKRA 5D71L 3HPJB 5BU6A 1AP2A 1JHTA 2YB1A 1VENA 3FU5A 1K3IA 4GI4A 3KPNB 3D1MC 1MLCB 4JG1L 2RGMA 1U8MB 3K6SB 4ILSA 1Q45A 1XH2A 1IBFA 4AZGA 3D51A 3H2MA 1OCJA 4J3BA 4R4ND 1KYAA 4ALAH 1N6UA 4JZNB 4PJFF 4JZJA 3CHVA 3HU7A 2P47B 2R1XA 3T4WA 3QHFH 2YMXL 1FDZA 4JL2A 1GPFA 1JQVA 1YA5A 3LK6A 3LS9A 4UAOC 5FI8A 2UZXA 3LN9A 1UB5B 4P3DB 5IBTH 3L5WA 3K2UL 2NUWA 4JDTL 1J0IA 2WM0A 3GMOB 1KCWA 2V6AA 1NAMH 1ZVSB 1KTBA 1WF5A 3IS0X 4A2EA 1QO3A 4NP4H 2PAJA 3NJ3A 4XKYB 3SKMA 1I9IH 3OEXA 4ZMPA 2AQ1A 3IBEA 1Z9SB 1D5XA 3KCPB 1R3LB 3O6KL 1TFHA 1SUHA 3W25A 2GI7A 4K23H 3RLHA 3JWNH 4HYRA 2WXNA 3SKJL 4K7YA 1F90L 4S1RH 3LTSA 3C3UA 1YXDA 3GUFA 1IXOA 3BMXA 4M5ZH 5M95B 3L21A 1EEYA 3ARED 3FHQA 4XVOA 2X1QA 1OD7A 5I71C 2X9XA 2XYBA 2H0FA 3INUL 3MLYL 1EH9A 1H8OA 3W9DA 2RDTA 2H1LM 4KTEH 4I5UA 2WZEA 1YDOA 3S1XA 2I32A 5E9DD 4AEIL 1QSFE 4N9GB 3L17A 5BS0E 4MIMA 3U3HA 3RM9A 4M7TA 1JPST 1CICD 3ZE0B 3QHNA 4KKLC 3SECA 1FVDA 2Z91A 4ACPA 4WU7B 3QF0A 3C0SA 1CDCA 2CK0H 2P5EA 4GSDL 1IEBA 3V9FA 4HKZA 4YHKH 4EF8A 5GSVB 2J8UF 1EGMA 3ZRCC 3DYOA 3N06B 3I3DA 5HDOA 4TTUA 2DQFB 2ADGA 1Y1DA 5D6DC 5BQ7B 2DM3A 2DZUA 1E8ZA 1I8LA 2XGBA 3L23A 1WDAA 3MGTA 1PKMA 3TT1H 1LHZA 4Y2LA 4PCTA 3BAKA 4HALA 1MW2A 4P3WA 4H8WH 5FYJH 1CK0H 2UY5A 1DQJA 3BDXA 1XYAA 4A3RA 4V33A 4GEJA 4R26H 3DC0A 2J75A 1QSFA 3HNVL 2OOFA 4YWGH 3HOJA 5KSBF 5BS0A 4Y2DB 3AY4A 3DOSB 5D03A 4X4YB 2F54B 5I1LB 2VDML 2ZVIA 5I6OA 4K0OA 2VLKE 2XVBA 3ZWTA 2WZMA 3V4VB 3FT2B 4Q8BA 4FI6A 4MDPA 2VE6B 4PJ8C 3RIKA 5IF0B 1KR0A 1OANA 3N6JA 2Q7NA 1A22B 3TBVB 2QKSA 5E1HB 1XLJA 1HXMA 2MCG1 3QIBD 5AYQA 3G1SA 3VE7A 4KEZA 3V4PA 4GRWB 3B2UC 3FN0H 1F6AB 1DSYA 4HIPA 4N0YH 3CT2A 4HK0A 1EHNA 1IU1A 4XPTL 5I30L 1GR7A 1ZLUH 1JWSA 1CFMA 1A1MB 4L8SC 3WS3B 3P0YH 1CDBA 1UQYA 3OVQA 1L9MA 3OKYA 3BLEA 1M7IA 2DY2A 5FAGA 3QEUA 1UG9A 1SY6L 4RZ6A 4JGDA 4I1NB 4PGDA 1TPXC 2ZUNA 2F19L 4U1JB 3FTWA 3RKDD 3VXQA 1G4TA 3R6IA 2LLLA 3RA7L 2VXSL 4J8QA 1W1A1 3N55A 4AHOA 3GIZL 1GAFL 4A7TA 1LK3H 1SZEA 3W4RA 4N22A 4ZTEA 3RGVA 1ZIBA 4HU8A 4PS8A 5C5YA 1KT2B 3UJSA 3UZWA 3RRQA 4EJ1C 3DG7A 4PWFA 3IDIB 2Y5TA 4E9WA 3CIQA 4Y4KC 1JVKA 4JO3L 1VFFA 3WLKX 3MACH 3HUJB 1F4XL 5EZPA 3GS4A 1ED3B 2X1XR 1J5OL 4ACZA 1DYSA 5GGUB 2WD0A 2R2CA 3CL6A 3OAWA 4K71C 1JTOA 3BAEH 3R94A 2E75C 3KL3A 1OQXA 4IKLA 1FPTH 2ZZ6A 4PS3A 1AZ1A 3LKSB 5T5FL 2INFA 4DLMA 3ASWA 1KO0A 2QCDB 1OFQA 1EGJL 2VSCA 3QO1B 4XHJC 5CBEB 4HSCX 1VGKA 2FIQA 3W87A 4ZQRA 1G6RB 4LDCA 5E6UB 4AZ7A 2G5WA 3D87B 1KW1A 4ODSL 1TQXA 4ZMWA 1MFUA 1K8CA 1I85C 1TVHA 2X7LB 2ZWSA 1EWHA 2MQ3A 2W63A 3HBZA 2VR6A 2L4OA 1F8IA 4L3AA 1GEHA 4W9ZA 3SE6A 2ZYSA 1DEEB 3M7OA 1XPYA 2YSSB 3WENA 1GCYA 2Q1EA 2VJ8A 3UJJH 1R3JA 2Q86B 3GX9A 4XWGH 4JK0D 2HKFH 1KJ3H 4FQ1H 2ENJA 1P7BA 1EWDA 3WLRA 4TVSa 3GFXA 4LLUA 1OBAA 1EEUA 1DHPA 2NX9A 4KZEH 2TSBA 3UC0H 3WN5A 2C9PA 3SADA 4NZJA 3UA4A 4CN4A 1NDMA 1SF5A 3MREA 3ITTA 1HQ4B 4R9XA 1OFOA 4UTLA 4KMTH 1ZLPA 5ALCH 1P43A 5ENWA 4X80H 4F0HA 3ATZA 4KKCD 5LKYA 2HPMA 1N82A 3U4AA 3A21A 5J57B 5D2VA 4JFSA 2ZA1A 3AO0A 1OV8A 3XISA 3TBYA 3LEYL 1TJIH 3BT0A 1GQKA 4Y2OB 1CB2A 4AUUA 5IKCA 1P4LB 1QWHA 4JD4A 2NLYA 4UUJA 3PWNB 3V95A 2EYRB 4GHRA 3BCJA 1UD8A 5ADOL 5CKGA 2BODX 1PXGA 2ZKHH 1FVCB 2MQGA 5C8JA 2BK8A 1VZHA 1P5VA 2C15A 1WE5A 4NPYA 1IGYA 3IWVA 5I82A 3PM6A 3V0HA 4C6JA 3A4JA 4XCCL 5DJDB 3DX6B 1IIKA 4R4NC 5EB8A 3GY1A 4ZTPH 3O0RL 1L5GA 4TXEA 1FWBC 4NAQA 1C5DA 3ZDZF 3G6LA 3C5ZA 2VN6A 3C5SA 1ET8A 2PU1A 1ZD6A 3RK8A 4JTHA 1WAEA 1UOZA 2OQHA 1ZT4B 2D73A 2G8ZA 2XZQH 3IAGC 4HVXA 2A74A 4Y7OC 3ZDYB 4MSSA 2VZ1A 3VWJA 4MQ7A 4IOTA 3ZT5A 2ITDB 3S5OA 5JZ7D 3IJEA 2CHOA 3W73A 4RWHA 4HETA 2WUCL 4XX1E 2PNDA 3CXHK 4Z0BL 4UOW1 3MRGB 4I7VA 4P5UA 4PJDE 1F3WA 2BY0A 4WEBL 1AO7B 1F6PA 4E8DA 2F38A 4NKMA 2RIKA 4M3KB 1PX8A 3FUNA 4HK5A 4FXFA 3FQNA 4NUWA 5I1JH 4L1WA 4UM8A 3G6JB 4B15A 2D7QA 3H7RA 4JG9A 3QV9A 1JN6B 3EOLA 3V8OA 4HQVA 4XZIA 2CXKA 3AREC 5REQA 1XDMA 2PTXA 5AW8B 2OSLA 5I8CB 1ISZA 1QBML 4BHYA 2HVJB 4RRPM 1BZ7A 2BIPA 3O8XA 1A3LH 2DAVA 2FEEI 1RPKA 5C0BB 1X8FA 3OD3A 2FZ8A 1MCWM 1RULH 1WJ3A 4JR9L 1PG7L 4GYPA 1LROA 4PGLA 3DX5A 5KZDA 1MQRA 1A9VA 1IGWA 4JFDE 1L6GA 4Y4FD 3HS0C 1CICC 4ZX6A 1LDPL 2D2CC 1VZGA 1L6PA 1T2JA 3AU1B 5E23A 2JKTM 5ICXB 1QI4A 1PY0A 2EVGA 1IKFH 4PJDA 1KF9B 5GGTL 5AYYA 3MZNA 1NVMA 2BSCA 5G4NA 2FZDA 3U4EA 5DVNA 4G80B 2CM5A 4G5AA 5L8JB 1KM3A 3QKEA 3KP0A 3MXVH 4CVZB 4AC2A 1J0YA 1K3UA 3I75A 1AH3A 4X83A 4JKPL 2CE6A 3T55A 4JZOA 1V10A 1UURA 1HKLL 5F7FA 4JNZA 4X4XA 2DUXA 1J8HD 4MA1B 2YC1B 3EWXA 5D7JA 2B59B 2ZCHH 3HG4A 3MNMA 1KGCE 3UERA 4KRTA 4JFDA 4HD5A 4HWEL 4NQVB 4Y90A 4HHLA 4N9CA 1XINA 4YBLB 1TO4A 3Q45A 4FXGA 3MO7A 2BPBA 3X3GL 3FT1A 3ZXAC 2F8QA 4H6KA 1WZKA 1UJTA 3KBNA 3IT8D 4K7PY 4WJG3 4A2HA 4K7PH 1YJDC 1JPHA 3ULSA 3NJMA 2BP1A 1GVSA 2ZSWA 1F41A 1ECZA 4KWUA 2XKNB 1OGTB 4PS4H 4JPGA 1DWFM 3U7AA 2OJPA 5CZXD 3FH8A 1YTEA 4DF2A 4BJHA 4HUXA 4L8BB 3EBVA 1S2CA 5IUCA 3L68A 4J23A 2Z65C 1T20A 2GOKA 1IT0A 2WQPA 1IBZA 5BW6A 5F2GA 4B27A 3TLRA 2FVMA 2G60L 5C08E 3R1GL 1ZSHA 4YVUA 1U1HA 4ZYKA 2CBUA 5M17A 1RQBA 5D4YA 2Y4SA 5AN7A 2X1RA 1QBAA 3O3RA 3GM8A 3VOIA 1XWYA 2PDHA 5CBJA 2CR0A 4X5XA 3LBCA 4IWWA 1Q90A 1HILA 4G3YH 4PRBA 3NJLA 2OTWA 2J8HA 4TLTA 3WE6B 2XJLA 2ZIDA 1HOEA 5H37A 3FB6A 2KLRA 5F0JB 4GA8A 4IL2A 5K93A 3GMNB 1UEMA 1LD9A 5HJ3B 3MRIB 1IAII 1EO8H 3L1OH 3FW6A 1WWWX 3V5KA 2BWDA 3H55A 4TNWF 3RNDA 2VIRB 4HX1A 1JGUH 2FHCA 3EF7A 3VXTB 3GHBH 4AQZA 1OCRB 1NFBA 3NPSC 1UZHA 3KYNB 5LIYX 1JV2A 1FSKC 1E0TA 3CZSA 4HKJA 3N0PB 3DX0A 3SCTA 1E51A 3UAJD 3PG2A 5C08A 3D2TA 1DE4A 2V68A 5I3KA 3S36L 3MMUA 2AEIT 4PJHE 5ESVB 1T04B 2J6EH 1MUJA 3RJDA 3V9EA 2GJXA 3F8UB 1EJOH 1N70A 1KTLB 1K7FA 3CH1A 4XGZA 4GG6E 1Q72H 2ZXAA 5DWUH 3FONB 1OLZA 1JRCA 2V5TA 4HS6A 4QTIL 3ERXA 1CD0A 1IC4H 3KDNA 4W4OC 3HAEH 1LEIB 5I6LA 4NQCE 5A8GA 2O6FA 2Y6ZA 2XXGA 1CBGA 5DD5H 2PI6A 2IWKA 3K0YA 4JFOA 1I8KA 1QW9A 2HKAA 1UM5H 2FO8A 3ROLA 4G7RB 4A6YH 3UIZA 3UXAA 2PETA 3ZBMA 3P4OA 4K7FA 3TN0D 2OJZH 3LZQA 4FFYL 2IXQB 2E67A 3ZTDC 1DL7H 5K2ZA 3HG1E 3RFZA 1KCSL 4LU0A 4QRSB 4ECNA 3KOFA 1W3NA 5K9JL 5EU4B 1YMHB 4PJHA 1GZGA 5AZ2L 5M5DA 1QFWI 2GJ6D 3OR7A 1VRSA 2KYIA 4R7WA 1XQ4A 2OYKA 5HJXA 2PXYD 5C09D 2IFFL 4QTHB 2PO6B 1O6TA 2I9UA 2W27A 3NFNA 2E27L 5MP6H 2APTA 4PJ5D 3ARRA 1X4YA 1XIWD 4GXWA 3DK0A 4H83A 4F2TA 4LAKA 5F2FA 4L0YA 3FFCE 3V7MA 3HI5H 4NQCA 1DVUA 2GIXA 2ADYA 5JIQA 4AQEA 3SBWC 3CHFA 4QR6A 3J2PA 5KVEE 3W2KA 3MLZL 1BQ5A 4BH7B 2YD0A 35C8L 4KKCC 4FLOA 12E8H 2QPUA 4XCEA 3HG1A 5L8LB 2VEPA 2G3XA 2NY1D 1RLCL 1SFTA 4OLZL 2VCCA 2E9MA 3KLDA 2YOCA 1L6FA 5HPMA 3UQNA 4JTGA 3DO7A 5KWYC 3PNWA 5H8MA 1AJ7L 4GQRA 1YY9C 4CNUA 4Q9BA 5IHLB 2HK1A 2DN7A 1JGDA 3FUFA 4APQD 3UBXA 3PBGA 5J5DA 4L65A 1QPQA 1TZAA 1GGOA 1FGVH 3GO1L 1YLBB 1RERA 2DQXA 1VFTA 4U4MA 4GO6B 4GVIA 2IAMB 3AUJA 1EERB 3W7OA 1KXHA 4I6VA 3HLAA 4M5PA 3W0WB 3FFCA 3TCLB 1L2UA 4OSUL 4BQCA 3EOBB 3VVVA 3BGGA 5LXVA 2W95A 1LEGB 2Z29A 1VACA 1DIEA 3S88L 4MQSB 1KBVA 1QSEE 4KX9A 2FEDD 5GS2D 2DD8H 5DHYB 1KXTB 1RPQA 3GLAA 3WIIH 2CR6A 5EZIH 4PTUB 4ROQA 1BF5A 3QUGA 1OINA 5BO1L 5I1KH 3BAXA 4UTTC 4MNQD 3ME0A 3TOYA 4ANXA 2VC9A 5FYKU 5KN5B 2GTZB 1URZA 3O9WA 1HH6B 5HMSA 2TRSA 3CQQA 2CJTA 5T3ZD 1L9TA 4ZUTA 4E68A 3QK0A 1RFDH 1ZANL 1EMTL 3UJRA 1FO0A 1OSPL 1Y1UA 2XWBB 3LDVA 2CITA 5D5ME 2VLJE 4OFPA 2R2HA 3GSOA 4Y7MA 4UU9A 1R2TA 3PDOB 1VRXA 4DEPC 4FFWD 4LC8A 3SCPA 5K9QI 4H9UA 1G7HA 3OKEB 3RX5A 1R3KA 4IPIA 1NGWA 1ZNNA 3S4TA 4HXBL 2FBJH 4H0LC 4LAZA 5DLMH 5ITBL 4PR5B 3CK0L 2X6CA 4I77H 4PJEF 1PCSA 5DT1H 5I1AB 1L9WA 5AKSA 5BMFH 5DJZA 5ANMB 3B5GA 1F5WA 5F7YC 1P0SE 2R29A 5I0WA 4QDGA 1G4EA 4XXWC 4CQAA 8FABB 5KVDH 3GAKA 1BM3L 4FRWA 4RX0A 3MCG1 4JZ5A 4MA3B 4XX1G 3QO0A 3C61A 3STEA 1MCQA 1NUDA 4D6FA 3QULB 1AI1H 5DQDL 2I57A 4ZVJA 3UR2A 2Q2LA 2R2EB 5ABZA 1WWBX 3PUEA 4JX6A 2VLJA 4ZO7A 4JUTA 5MENE 1OK4A 2Z31B 3RAJL 4OGQC 1HH9A 1W72L 4YNYB 2Z0UA 3LNDA 3VA6A 1TDQA 2C9RA 3UZVA 3MA7A 1GIGH 3GO2A 1UYWL 4ODVL 4ES9A 1E8WA 3LS5L 2Y9RT 3OC5A 5TDNB 3QXDA 6ENLA 4QNPE 4C54A 4MB4A 4LVNC 3BVNB 2FRGP 1XKJA 1E0WA 5I1GL 2FB4L 1MCLA 1UWIA 4LAQH 3TJEL 2K0RA 4GBXA 1B5TA 3RZCB 4N02A 4B7LA 1LWRA 3PQYD 1MCJA 1OAXL 1FV1A 4MJ6B 1PDYA 1YNYA 1TETH 1XH3A 3G0UA 1MMFA 2PPGA 2FT6A 1DWJM 5CZXC 4FQIL 4MX7B 2BP8B 3FA5A 3NACH 3EWZA 3LEXB 4UT6A 3N2MA 3UG3A 2H26B 5MENA 3WS6C 2NXZB 1OKEA 1R2SA 1K8ZA 5I8KH 4HHPA 2NUPB 3CBKB 1O7DC 3UESA 3DA0A 2Y7EA 4NSBA 1UACL 2WV8A 3G8EA 3CAQA 5CJ5A 1Z9NA 1BYCA 3P8IA 2VCAA 4JM2B 1K72A 2Q5BA 2CM6A 4D0CB 4YJZL 3T65A 3WH9A 4DPAX 4H40A 3SY0B 1QWKA 3P3TA 2PBOA 4EN2A 4HHAB 1CFQA 4I9WE 5ESQB 5LWYH 2Y6SC 4YVPA 2OQJB 3A47A 3PUDA 3A3WA 3KPQA 2EIKB 2QGYA 4ADIA 5B3SB 2O30A 2FSEB 5H37G 3KPSB 4AYDC 2V5JA 3S47A 4ALDA 1A1OB 4NZ3A 4PTTB 4D8ZA 1QSZA 2WGXA 4QHMB 3R0DA 4P5MB 8TIMA 1HHIA 2P7TB 1MI5E 2JB5H 4G2AA 3B5TA 3UAJC 4QIRA 1SBSL 3ZT6A 1Q65A 5IEHA 3WIFB 4GLRH 2Z6JA 3CMOL 2Y06H 3RAOA 1ZXQA 3ALXA 2Q01A 3T9WA 2D03H 3WBDA 3DFYA 4CNOA 4EPEC 5T26A 3S96A 2PUZA 4CSPA 3DIVA 2IQAB 2RQ8A 3OJDB 3V0WL 3WK2A 2C0HA 1VGEL 2W67A 5DR5L 4Q4OA 3FQWA 5E8EB 1CT5A 3QHTC 3LCGA 2VDNB 5JBEA 5A1AA 5EMMA 1T8XA 1EFXA 3O2DA 5HBFA 2PYEB 3I6LD 2D8KA 1YXYA 1N5AB 4DEFA 4BF5A 4N2YA 1W0MA 1LNUB 2OXGA 3AIVA 2YKLL 4L5FE 3T8VA 2FJFB 3PV6A 3TN0C 1MI5A 1RL1A 4DP9X 5HAOA 3Q8EA 5G2NA 2XKSA 3IPBA 2PDQA 2PTVA 4YDVB 5TH2A 4F2MB 1PLAA 1TJ1A 1FIGL 2BS71 4PB0H 3BDYL 5MF5A 4M7SA 1PKYA 4N8PA 3OHXA 3OAYK 3IDMB 3DMMC 2GDVA 4EN3B 3MV7D 1NJJA 1BFTA 5IHHA 3OKNB 1ONQA 3V4PL 3I6KA 4LK4A 2V9TA 1MIMH 4I0PB 1HYSD 2FE0A 5B1AB 2PXYC 3O3EB 3DUSB 2MTPA 4M1GH 3E5BA 3FB5A 1H0DA 1KTRL 2R2BB 4HK6A 3FTSA 3FA3A 1XIWC 4AQ8C 2FQDA 1N8ZA 5HY9B 2GDUA 4DN3L 1D7KA 2DLIA 1UWXH 4FYQA 2NWSA 2C9VA 5H8UA 3G5YB 3ILPA 2QCLA 1NIAA 4HW6A 4TKWA 3ZE1B 2IPTH 3RNQA 1OSZB 4JM0A 4LAUA 5JW4Q 1FFOA 3OA3A 2VYOA 3PB0A 3FK3A 1HKMA 3R19A 1F58H 1TQJA 5KBLA 1E4MM 3T08A 4P05A 4JQ3A 2NY1C 1UPPA 4DK3A 2WMHA 4ZFOA 4FJ6A 1P2CB 3HHSA 2FZ3A 4KO9A 1PU0A 1X7FA 1GZQB 2EEXA 2JE8A 3JYCA 4PREB 5G55A 2JLPA 2FJHA 4APQC 4OFIA 1XEUA 3MLUL 4MRBA 1O6IA 2XQBH 3QWRD 3LEVH 4HGKC 4MLJA 2W0FB 4DKFL 4YBHA 1EVUA 3PTMA 4M8QB 5JUVA 3QT2A 2X1WL 4QRBA 3CLEL 3UBXG 4NN5B 2WXFA 4IFKA 3NIDE 1QTSA 1R3QA 4ZQNA 3LQZA 2NR6A 3UP8A 1OWQA 1SLWA 2FGWL 3BKMH 3DJZA 1W1B1 4QY8A 3HC0A 1CT8A 3VFPA 4S38A 2XV0A 1AG6A 2DMKA 3MUIA 1JK8A 4OJDH 1P7TA 3K80A 2FEDC 3DUUB 1CB7B 1VYRA 1GKEA 4Z08A 5BXPA 4PAZA 3TBSA 2VX7A 3F58L 2E86A 2XKUA 3QDAA 4Z2JA 3HI1A 1K4DA 1KEGL 4KJYA 1JXFA 5CS7A 5PTDA 3SN4A 5DZLA 5F2IA 3HE7D 5EEWA 2DWEA 4QXWA 3Q44A 2PEVA 5IVZB 5L2KA 3V7PA 2F5AL 2EVFA 2ATKA 3V5HB 4LMQE 4A39A 4A38A 5TDOA 3C4UA 3KWVA 4XO3A 5FF0A 3OXSB 5SWZE 1WA3A 3UAAA 1N2RB 5C0DB 4FFWC 2CO2A 1W3JA 3THML 4AG4L 1F6LL 3DNKA 1NCBH 4GG8A 5AHEA 3D3VD 3BVUA 1YSOA 4TR9A 1MCFA 1J86A 3SSJA 3MJGX 4U3SB 2DSVA 1E4WL 3VFTA 3I65A 1VSCA 2CDEB 2G75B 4JRYB 3PAYA 3QXTA 4KKLD 2JJUA 5C54A 3NP4A 2X0UA 1H3PH 3JSSA 3W83A 1YUHB 3MRLB 3B2VH 3P80A 5D2NB 1E7UA 2CLRA 1NGXA 4U6TA 4K4KA 1Q6DA 1X6UA 1KCUL 1ZCCA 3GXDA 5CD5D 4RSYA 5E8OB 4NT0A 4PMVA 3DVIA 4XCNB 5FA3B 4G43B 3BKYL 5I1DA 3KRSA 3B40A 3W7NA 3PCYA 4LPUA 1NANI 4FQ2L 2DQMA 1UR1A 1J8KA 2E7LA 4RXGA 2J71A 5SWZA 3W1NA 1C91A 3TK7A 2VXUL 3MLXL 4LSVL 3ULVF 2VITB 3OJMB 3EX6A 4HIHB 5AAWC 2GT9A 5DMYA 1ET7A 4XUYA 4UC5A 2P5NA 3H8AA 1X4XA 2CLMA 4L9YA 2FECI 2EDEA 4M9OA 1ZAIA 3NABL 4NN7C 3CFCL 1NIEA 5I3IA 4OFCA 4HPOH 4ES8A 1WEJL 4F8NA 3QHMA 1XD1A 4ZOCA 1OD0A 2UY7B 2BSSB 3VGEA 3V4VH 5BMWA 4PJ8D 2IUZA 5E6IC 1VPXA 3Q6GL 2A6KA 1GWJA 3G24A 4XP9L 2WYZA 1AIFA 4X2UA 1USZA 5GRJH 4JY5H 4GRWH 1Q9KB 5B38A 3MAWA 1RAKA 3S3GA 2V5KA 2N59A 3HFYA 4P8UA 4J40A 2F18A 3E0GA 4Q4PA 4H20L 3VH8B 1G6VK 1VYSX 2A6IA 3HRZC 1NDTA 2ATSA 3VVWA 3ARFD 4JDEB 5BVJB 4Y5XA 1CN4A 5I9QB 5DHVA 1H19A 2D7TL 1BXAA 4PV8A 1R6WA 2JEPA 2MWCA 4PJ9B 3F7RA 4G9FB 1OZQA 2OI9C 1BXXA 3B0YA 1KJMB 4KGJA 1QP1A 4CNIB 2WLLB 3MBWB 4YDKH 2XZCL 5I79A 3AIWA 3ARZA 3KBEA 3IARA 3A6CL 5IG7B 3P4MA 3P3RA 4YWIA 2VVSA 3NJGA 3D2UA 4NX5A 4AIZB 1H3WM 4LLWA 1WB0A 1V7MH 4F7EB 1ZXKA 1R2RA 5E70A 3NCOA 3ZE2B 3BG3A 4OZGB 5EMJA 3ECBB 3O6DA 1E9LA 3OBEA 3L0GA 3FTGB 2WNKA 4LVFA 4WUUE 2MNWA 2Q8BH 3W76A 4ODWA 1PZUB 2AI0L 3P5ZA 4IX2A 4P2RD 2QJMA 5HSFA 4QRPD 1HZHL 5ICUA 5JPMC 1ZHKA 3NIFB 3TCTA 4GQZA 3F7VA 2HXAA 1DJGA 5LNUA 2BNQE 1NEPA 1RJZA 3IIOA 3DRTA 2YLLA 1BREA 1XZWA 1BG1A 1FA4A 1RK7A 4RWYH 1RVFL 2VDRH 2OX5B 3N4EA 5KYWB 3QCUH 4YDJA 3IVKA 4LGSB 3GIVA 1NCHA 5TE6L 2XWTA 4U7KA 3KZ8A 4NZ4A 3B1UA 5DJXB 2WQXA 2ENQA 4PJIB 1CECA 4XN9A 4O58H 2BZCA 4XHJD 1AAJA 1ME8A 4HWZA 5I17B 1Z32X 3SUVA 4P2QD 3MYJB 4E9TA 3PFUA 5FM5O 3APTA 2Z34A 4HJJL 4X3ZA 2Y2TA 1VFUA 3IJ8A 4WUUA 1G6RH 1SDYA 5D09A 1YQVL 1DDHA 5BVPH 2R23A 3IJ9A 3WF4A 2BNQA 1RUMH 1MCPL 2KZ1B 2BSRB 3DVGA 2PU0A 5F4XA 3DETC 1HYSC 2IANE 2I07B 3VFOA 5J1AB 4F8TA 3PUGA 3DYPA 3U2EA 1RLWA 1FRBA 1JTPA 5LBSA 4P2VA 4X22A 1YXCA 3K81A 4AY8A 3AQUA 3N3TA 1V6WA 3K4AA 3D9AL 3RWHB 3ZVHB 4J3OH 2C9UA 5LHEA 2ZJSL 4N9OB 4ZUUA 4L37B 3QSTA 3OAUH 1RZIB 3PBYA 4JFFD 1NCDL 3TO4A 2QADC 4J2PA 1SJBA 3WD2A 2YX0A 3LTYA 3MRKA 4PJAE 5CZJA 2N1KA 3B03A 3MRRB 1KMGA 3EW3B 5DZVA 3I6GB 5DANA 1OW0A 1WRFA 2WSQA 4ELKB 4I1RA 1DCEA 4ZFQA 5DUPH 2RTTA 2YBUA 4PUNA 3NEOA 4TMCA 3DG3A 4NNPL 3EO1B 1F3JB 1U1JA 1NIUA 5BRZB 2VUNA 2YPVH 2IANA 1FZMB 2OLAA 4U1LA 5D70L 4PIBA 2I26N 2EIEA 3ZIMA 4IFOA 2EDJA 1R19A 1NPNA 2DLHA 4S11A 3QNFA 3QB7C 1XV8A 2K6YA 4EE2A 4ZUSB 1A3RL 1XBYA 4F33B 2Q9OA 1QR1A 2CJUH 1JZEA 2WM1A 2MPVA 4YCOA 4UNIA 5DCCA 1UGKA 3V0JA 3OTTA 4Y9CA 3H85A 3S37X 3MRNB 3AISA 1UM6H 3FL7A 4HG4J 3HQOA 1MRFH 3GJEA 3QWOB 1E1FA 4PJAA 3NZQA 3H2OA 2WKGA 2Q6WA 5A2KH 4HDIB 1JWUB 1YMYA 1BEYH 4NC1E 2A6JA 1FNSL 1GW6A 3CLFL 2FATL 4MZRA 3CE1A 3UJTL 4Q4EA 1JYNA 2WXMA 4MY8A 2QCHA 4IRJC 4PG2C 3BP7A 1AGDA 3HE7C 1U8JA 4JUSA 2DWTA 3AIRA 1FCBA 4S1SH 5FJRA 1NZRA 4N86A 5CIPH 4GMTH 3C6SA 1CCZA 4KHTL 1XH0A 4OV9A 1QUNB 4KO5A 1HGYA 3WY1A 1UXLA 3GSWA 4KVNH 1XZ0B 2Z6IA 3SDXF 3JZYA 1CB4A 5F2MA 4S0SD 3REWA 2VDQB 3O07A 1LG1A 4PJGE 2QPSA 2WBWB 1B31A 1V0NA 3R7RA 5F6IB 1INQA 3APDA 4OQ1A 1DLHA 3S2MA 2GUOB 2JK5A 3G5XA 5I19L 5AC4A 5FDWB 1HFBA 1MEIA 4NKDA 3GSRA 5D1XE 4XBGA 3OV6A 2ENSA 5CR8A 2BNRD 5EPMB 3RKPA 1FHVA 1JCKA 1G0CA 2Z9TA 2Z4QB 1JF1A 3RPIB 4GJJA 1ZRUA 5T1DL 3BZFB 4OCXL 1GOWA 4N2CA 2PW2A 3QZWA 4BEUA 5ELIA 5CP3A 2Y5JA 5CD5C 3BLIA 3QOMA 3IU3A 4OD2A 4AMKL 2BGNE 1YYLL 4I87A 3ALGA 1H8LA 5HGAA 5KZCD 1KY7A 2GVGA 5D9PA 3VOJA 4PRHB 1ITQA 1NBYA 4MNMA 1E8YA 1ME7A 3L5JA 4XOAA 2ZYFA 2WNGA 3KDPB 5AYBA 3CJJA 5DJCB 1DXFA 1IC1A 1U58B 2OX1A 4RCAA 1XB6A 3D0CA 1KBPA 4JHAH 1EHXA 4O51A 4PJGA 4JTCA 3JVGA 2IPWA 1FH7A 5DEGA 5TDPB 4P8WA 2YAFA 1E5JA 3D3AA 5DF0A 4C59B 1SYSA 4QJ1A 4MHBA 4H1LA 1E6OH 1ECQA 4P2OB 4N8VB 3H2WA 5D1XA 1EB3A 2IGTA 4WFHD 3VSQA 3BLLA 4X6BA 3W01A 4MAUH 1DSFL 2D7PA 5D2WA 2BOBB 1HKFA 1A7RL 2C7FA 3B1TA 4L3ED 2DT2A 2X4UB 3QJTB 3OPZL 4D9PA 1PVNA 4XXCA 4TNVF 1MQQA 3GBML 1TKWB 5F7DB 3CQPA 1PIIA 1II4E 3GQYA 5KVEL 2CLKA 5FCZA 3EJTA 3QDJE 3SE4A 1ZIAA 3FH5A 5HMFA 1VF5C 2YLKA 4JPWH 1S9YB 4G8FB 5B38G 1RK6A 3T4YB 3K1KC 3QTGA 5CC6A 3L3HA 3ARFC 2YRBA 2Z7ZA 3LMJL 3CUHA 2R56L 3DBXB 4KRZA 3NPZB 2VLKA 3MUAA 1W1YA 4IX0A 1CG9A 2ZXCA 1FO0L 2RJGA 5I1CH 2MOQA 3QXVA 4JQ4A 4OIIL 5AVYB 4QSHA 2WTPA 4DI9A 1VCAA 4YTQA 5FCUL 1CZ1A 1RUKL 1RUAH 2PTDA 3AVEA 3L4ZA 1JXJA 5BXSA 4MMYB 4OLWH 2NX5E 3QDJA 4IDJL 2F61A 2CBJA 1FCCA 3G9AB 5F3HA 3ESNA 2NYZA 3NCFB 3TCEA 3VXMD 5G4WA 4OGXH 2A3AA 3SD5A 1BYBA 4QG6A 2XH0A 1YNQA 1A3WA 3VFSB 1KPRB 1G4SA 3PZTA 4ML4A 2ZZ1A 3GJFH 5HJBA 4I4WB 2IAAC 1B0WA 5SX5K 3HCVB 3LNGA 1KIPA 1WD9A 4XNUL 3IRSA 3PP3H 2J24A 5BV7B 4H8QA 5TQ2L 3YPIA 3WGVB 4NYLA 1OAZH 1BPVA 1QMUA 3DKLA 3P11H 2NTSP 4ADUA 2XFFA 4JAWA 2WXOA 2D20A 1YN7B 4XMKL 1QRND 1DZ0A 5K59F 1A6TB 4HLZH 3L3OB 1E5CA 4PCFA 3IE9A 1WXZA 3PWPD 5IDZA 4UMSA 4F0MA 4BZ2H 2NX5A 2PF0A 4XAPA 4NC0B 1GH7A 4E9LA 5HDBF 5G4MA 3QG6B 2Z1WA 2J1YA 5ADPH 2DQDH 5IB5B 2XN2A 3US1A 4P3CL 4TNWK 5J6SA 2LFGA 2XM2A 3AADB 4ZOEA 4N1HB 3OIHA 1R17A 3IJHB 1YEKL 5L6YL 2VGLM 3UZZA 2C19A 2OYMA 3L16A 4QRQB 1KFGA 3EAUA 5M94B 1XUZA 1VCBC 4ZA0A 1QFUL 2DQUH 5CEZD 1KXVA 4PR4A 4UT6L 2IWFA 1YC8A 4S3JA 1P5BA 5IEKA 3HQPA 4NJIA 5EBMA 1X6NA 3I50L 3LKPB 3REQB 1KM0A 4FC3E 1U4FA 3DLQR 5CU5A 3QRHA 4JQXA 2B0SH 5B3JE 2PRMA 4KPLA 3CC5A 1P6AB 3WNMA 1W5PA 1TWWA 2X9YA 3JWOC 2ZCLH 1RQ5A 2FTWA 3BWUC 4WEEA 3UTSD 4PY8J 1XP3A 3CPUA 5GSRA 1I7RB 1QPPA 5DS8A 5AAMC 4JO2H 1YN6A 4JS7A 4HFUL 2FPVA 1UCWA 3S2AA 5IB2A 1FCVA 3IKKA 1TPH1 1YEWA 2BSDA 2YWZA 4HH8A 4UNUA 3IDNA 3VU1A 5MKGB 1HAWA 1YY9D 1S9XB 3EYPA 3H7BA 1TWZA 4Z1BA 1CX9A 4NVTA 2IPUG 1A21A 1JNDA 3TURA 2P8LB 2ZP9A 2UZ9A 3LN4A 5AW4B 4MYAA 1BZQK 3NM1A 2OA9A 3KGRA 2PS2A 3M17B 2W1NA 3PDGA 3NJXA 4GABA 1I3VA 4EDXA 3IJ7A 4QRFA 3AXHA 1IEHA 2NY4D 2WAHA 2AJXL 2JI1A 2REQA 3AXXA 5IOPA 4OBSA 2DB8A 5H4YA 1A5FH 4G6CA 2KPNA 3F85A 2YW3A 1ALDA 5DK3A 4Y1AE 4AWSA 4U6YA 3DUHA 3EYQD 5HHOE 5M1TA 4CVXB 3A67L 3PE9A 4HFWB 5GS1B 1B4JH 2HUHA 2IKJA 2OJEB 4EACA 1R5WB 1ILUA 3O6LH 2WZTA 3VUPA 4PU2A 3V0DA 1WA1X 1W72B 3O2DL 3RVVD 1LP9F 3UPMA 5IVXB 1AR1B 3LKNA 3UZ5A 3ES8A 3IJDA 1JHTB 4W9GC 3CU7A 4B5EA 3DGCR 3EZJB 1NCOA 1E1CB 3KS0H 2Y6TE 2NQ3A 2WQWA 1U2YA 3D39E 5CC7A 3X3FL 3CSFA 3KBHE 1EPVA 3GDCA 4JIEA 2W4XA 4GZ7A 1UOWA 4KK9D 4KXCA 1CGXA 1A6UH 3WY4A 1WV2A 1BWMA 2EC9U 3U46A 4ETQA 3X12A 4DIAA 4B95C 1VKXA 4E0CA 5CPMA 3MU3A 4M24A 1U93B 2JCCE 4MJMA 4PRDB 4BHUI 3W39B 2WXLA 3UF9A 2ZE3A 5B7FA 4PTWA 2AV1A 1H7OA 5J4MA 3MDUA 1N8FA 3TO2A 4Y1AA 2AGTA 4IJ3B 2YBVA 3VOCA 5HHOA 3HVDA 2QSCL 5MHSD 1I1YB 1NWPA 5I15L 4ZNCD 4RGNE 1ZV2A 1L0XA 1RK5A 4LS2A 3P9MB 4R4FL 3W7LA 1C5CL 3BPNB 4WEVX 4OLXH 3IMSA 4GAJH 2LGNA 3QDGE 5EUOE 1XSIA 5FJTA 4A7GF 5I75B 5B7MA 4G2DA 3U6XS 4FA3A 4NN6C 4MNHA 1K1DA 2W6RA 3D39A 2F6UA 4L5FL 3AMDA 3G1FA 1D5XB 3QZWG 2X2JA 1O68A 1CLXA 1SXCA 4MDIB 1RZKH 4WTWA 1MWAA 3CIXA 3KBSA 2ALDA 2YWYA 4P5TA 1IEXA 1KA9F 1VR6A 4PD4K 3LNPA 4AZ5A 4HC1H 1H0GA 4Q0XH 5HUOA 4L0PB 2GBUA 4LOEA 2EH7H 2JCCA 4ZFOL 5CLZA 3ARBA 3KPMB 5A8PA 3PXHA 4K9EH 2D4FA 1FAIL 1MQPA 3WTYA 5DK0A 4GNKB 2CIKB 3OSVA 4CILA 1FA2A 1MFCH 1FJ1A 1BCIA 4H13C 2Q87A 4NU7A 3QDGA 4I8YA 1XGQA 4H1LG 3U2SB 5AQ0A 3T04D 3HLKA 1LVEA 3ZL4L 1CFNB 4EI0A 4RQQA 3VQMA 4E3TA 1V3LA 3QR2A 3W26A 1GC1L 3QJRB 5EYWA 3BVWA 3HV9A 2P5EB 1AL8A 1DVFB 3CDGA 2I17A 3AYRA 4WHCA 4MAZA 2XM1A 4HS3B 3RL1A 1D9KB 4QCIB 4Y9FA 4D8PB 1NA8A 2ADGB 4HPJA 5EU3B 3U2ZA 4QS5A 2ITFA 4Z7WF 3R4RA 3GSNH 1XHHA 2XN9D 2VJXA 3T2PA 4URTB 5C6PB 4LVHB 3IETA 4R5EA 3LCWA 1Z7AA 1IBGH 4DJFD 2UWEB 5E6ZA 4CNPA 4ZB0A 1TZHB 3T8XA 3MRJB 1KULA 4KH9A 2P8MB 3I6RA 5DVLA 5T9BG 1GZHA 1C8PA 2Y6SD 2R1PA 2X6AA 4MD4B 1QOPA 1ZVHA 2OMXA 5C0AB 4GQ9H 3ZO0A 2XSAA 1B1YA 4S3BA 3RLGA 3GDLA 4Z0XB 1J88A 1PW3A 5ETUA 2E8YA 3VGHA 3Q1SL 2GCYA 2VFEA 4GW5B 1C12A 1OM9A 2XCMC 3C60A 2ZD0A 1HXMB 4X6CE 1YDPB 4C83B 4Z1AA 1H09A 2BC4B 1DQLL 2ZX5A 3CPRA 1NDWA 4YXGA 5D7HA 4UILH 1M71B 5DJ2A 2HRWA 4GKNB 3L08A 2K8MA 2G3NA 1E5YA 2EG6A 2PDNA 2EQDA 5D9NA 2AF2A 4GXUM 1HTIA 2GITB 4Q8NA 4QOKB 4JQ1A 2JIXA 1YEDB 1E4KA 2BVEA 5D33A 3LU2A 1EDQA 2EDMA 2Y72A 2QCEA 4B4HA 4K1WA 4R2GD 5IESH 2JKPA 1WG3A 1YEHH 4NOFA 3UTPD 1ZKAA 3O3DB 2VDNH 5JIHA 3VCNA 3VXQB 4U1MB 3ZIZA 3WJLA 1Q7ZA 1JBJA 4IBQA 4CQCA 5IB3A 1O6SA 5F7WC 4ALAC 2Y7FA 4FHKA 3MRPB 4N4PA 1DUZA 4JIQA 4X6CA 5HGGS 5EU6B 4BZ1H 2E1DA 3EXSA 3CK5A 1Z9LA 1OF0A 1RXLA 2FHBA 2WUBL 1MAML 4MBRA 5CN2A 4QP0A 4PJFE 1EEXA 1SO4A 1AJZA 3VXSE 4TX8A 1QPOA 3RGHA 1AS7A 2PTWA 5HMDA 1H7WA 3MX0B 1KWGA 1KBGH 3B9AA 3DMMD 5CJQH 2ABBA 2WHLA 4NHCL 3VACA 1ECEA 3QI9A 4D6HA 4L4TE 3UBHA 4GG6A 4MHHI 1MEHA 1V8HA 4KWOA 4P2CG 2C9AA 1FC2D 5DQJB 2CLZB 1PFOA 3BUYB 4KKBD 4QLLA 4J4PA 3VFGH 3GVQA 1S7RB 2YHGA 5DZJA 2Z28A 2DLEA 5MI0B 1KBBA 1ZVNA 1SSDA 4AVKA 5HQLA 1LQ2A 3MJ6A 4TN9A 4Z8FL 4UTBA 3II2A 4NKCA 5LG6A 1Y6KR 2LAAA 5B1JC 4TL5A 3G6AA 1OFBA 1LO5B 2CRZA 1CGWA 1GZPB 1HXJA 1V5JA 5ABTA 3FAXA 1IE7C 3ZZQA 3VXSA 2QIWA 3CH0A 4WXZA 4XP6L 3DHDA 2GC4C 1AS8A 3U30B 1GOKA 3SRHA 4D9RD 4HA1A 2G3MA 4C6LA 1XF4A 3VX1A 2E9BA 3Q9QA 1TVHB 4DQOL 4L4TA 3UD6A 3FTVA 4JREB 4LANA 4L8CA 4H25B 2YQ2A 1G4RA 1UPMB 1DTUA 5E94B 2NVCA 1MHHA 1JERA 2TYSA 1JUFB 2EHHA 2NY4C 3WGUB 1T96A 4IU3B 1S9WB 3PZ9A 2GYIA 2Z7KA 2J8UE 3PXJA 4M62H 4ZDHB 4F9PA 4B5VA 3M5VA 1OP4A 4B5UA 1O66A 4Y4HB 3EYQC 2EO9A 1ZTMA 1BAFH 4WI5A 1NDMB 5M2FX 3I7SA 3RN6A 3VXUE 1KGYE 3PP4H 5DYOA 5B4MC 3F65A 4WW1B 4GLEA 3C6LD 1TQTA 1DSWA 3T1FA 4C1NB 4HNNA 4LCCB 1GYLA 4AV0A 3RVVC 3RGBA 3CB8A 3GI9L 3O4LD 2Y1YA 1SMDA 4XE5B 3QTPA 4AD5A 4BFJA 5KSBE 4N24A 25C8L 2XWCA 1AKJB 3F5JA 3USZA 4IUGA 4IBVA 1GW9A 4KK9C 1M05A 4XOBA 2ZX8A 1P5VB 5DEJA 3WDRA 4NPYB 4TMPA 5CCJA 3TJLA 4IPNB 1M7PA 1G7JA 3WNPA 2B5IC 2J8UA 4A2SA 3DK2A 5DZ9A