3QGVA

Crystal structure of a thermostable amylase variant
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
435
structure length
435
Chain Sequence
b'AKYSELEKGGVIMQAFYWDVPSGGIWWDTIRQKIPEWYDAGISAIWIPPASKGMGGAYSMGYDPYDFFDLGEYDQKGTVETRFGSKQELVNMINTAHAYGMKVIADIVINHRAGGDLEWNPFVNDYTWTDFSKVASGKYTANYLDFHPNELHAGDSGTFGGYPDICHDKSWDQYWLWASQESYAAYLRSIGIDAWRFDYVKGYAPWVVKDWLNWWGGWAVGEYWDTNVDAVLNWAYSSGAKVFDFALYYKMDEAFDNKNIPALVSALQNGQTVVSRDPFKAVTFVANHDTDIIWNKYPAYAFILTYEGQPTIFYRDYEEWLNKDKLKNLIWIHENLAGGSTDIVYYDNDELIFVRNGYGDKPGLITYINLGSSKAGRWVYVPKFAGACIHEYTGNLGGWVDKYVYSSGWVYLEAPAYDPANGQYGYSVWSYCGVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha amylase
publication title Structure of a highly mutated, thermostable \xCE\xB1-amylase variant
rcsb
molecule tags Hydrolase
total genus 154
structure length 435
sequence length 435
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2011-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3qgvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3qgvA01
4BQ2A 5CXPA 4H8VA 4PMNA 2VTFA 2AMGA 1E4NA 1UQYA 1XYFA 2X2IA 2CBVA 3EJPA 1J11A 2VR5A 4C7GA 5GNZA 1V02A 3HJEA 3EDDA 2X05A 5DT5A 1V6UA 4GXPA 4TTUA 2F7OA 2XYLA 5HPOA 2WC4A 1CTNA 1JZ7A 4PMOA 4F9DA 3ARTA 5EMYA 1K9DA 4U2ZA 3ARUA 2V3DA 2FH8A 1R8LA 4JKMA 2XUCA 4PTVA 1EHNA 3AQUA 3BUQA 5E09A 4JL2A 2ZXQA 4R27A 1UWRA 1GOMA 2VRQA 2YL9A 3KE0A 3NSNA 4UR9A 4MDPA 1O7AA 4H8HA 1VF8A 4A4AA 2ZUVA 2DSKA 3WDPP 1UR0A 4WIWA 4NI3A 4BQ4A 2EEXA 3AXHA 1NOUA 2F7QA 1UR2A 4UOZA 1SFSA 1AMYA 1ISWA 5AC4A 3D4ZA 1U2YA 5EFDA 1CZ1A 1KXHA 3AIEA 1GOKA 3B9AA 4PMRA 1UA7A 2PC8A 3WF1A 1L8NA 3SURA 3RM4A 1UKQA 1UWSA 3PHAA 4TVDA 3RM9A 2EXOA 2GK1B 2WYSA 2VC9A 4XX6A 3BUPA 2YBTA 1QI3A 2Y4SA 1CGYA 1OD0A 2GSJA 5DMYA 4BQ3A 2FGZA 3PTQA 2QMKA 1ZL1A 1UG6A 1WO2A 2NT0A 5A6BD 1HL9A 5CJ5A 2G3MA 1H4PA 3WQ4A 3WNPA 1D3CA 4UQDA 4W85A 2VT0A 3PTKA 2AAAA 2FH6A 3EJQA 5A3HA 3POHA 2DH2A 4UQAA 4M80A 3FHAA 3L4ZA 2NT1A 1JAEA 2XN2A 3DX0A 1JF5A 1UH3A 3K46A 2CITA 4DUWA 3RO8A 1BVZA 3AHXA 1JYXA 4TUFA 1T0OA 3D50A 3VUPA 1GJUA 4AZCB 2F1AA 3RCNA 1WKYA 4PTWA 3BVXA 1QOXA 4HPHA 2V5CA 1B3YA 3WD0A 4AYSA 4GQRA 3HZ3A 5FOOA 4B9ZA 3WMCA 5I2UA 3NSMA 3A22A 3AHYA 4UFMA 1JI1A 2EPLX 3AMCA 3CUFA 3K8LA 3CUJA 3NYDA 2VNCA 3SUUA 1CGXA 3W27A 3TTYA 4DM2A 2VQTA 3OIHA 4A3YA 5A8NA 1JD7A 1XHGA 5A8PA 2V3FA 3HG4A 2J7HA 5IHSA 3THCA 2BFGA 3QOMA 2XFYA 1QNQA 3ALGA 3N9KA 3ZJKA 1TQUA 2J79A 3FN9A 3AIWA 6TAAA 5A8OA 3L4XA 1BYBA 1ITCA 4Z2IA 4AIUA 3T0BA 5CPTA 3WUGA 5I78A 2QV4A 1R34A 2W61A 2XFFA 1XD0A 2OWXA 1JDCA 4PMUA 3LPFA 1J10A 2YDRA 4P8WA 1WDSA 4JFVA 4BS0A 1NWUA 3MUZ1 3U7VA 3VGGA 1DWFM 4XB3A 3IK2A 2V3GA 1EDTA 3CV5A 1TA3B 4UOJA 3FNDA 2XVNA 2UY5A 1E4LA 1H41A 2OSYA 1UWTA 3WDQA 1CXLA 1CECA 2WANA 1KGUA 4Y7EA 3ALFA 2WB5A 2EQDA 2D1ZA 2CKSA 4CN4A 2GJRA 2D0GA 1B3WA 1UR9A 3AZSA 1MXGA 1QVBA 4UCFA 1QNPA 4NZCA 1W1VA 1KCKA 4D6HA 4UFHA 5I79A 2EPOA 3VIOA 2WVUA 2BVYA 3AHVA 2J8FA 2ZWYA 3LXBA 3CUHA 3WKZA 4UQ9A 1ESWA 2VX5A 1E6ZA 1JNDA 1U33A 1UYQA 2WMFA 3BMWA 1CXIA 1Q6DA 1CXEA 2C7FA 2BXYA 5E6YA 3ZR5A 4AIEA 4AMWA 1GQKA 2F8QA 5TD4A 1CXKA 2FHBA 3A4AA 4AD1A 2WSKA 4J28A 4CCDA 1BAGA 2W62A 4U31A 1KXVA 2PWGA 2WCSA 5FCZA 1KXQA 4DO5A 3GTNA 3PZOA 2ZX8A 1E1FA 2CXGA 4GINA 4IISA 3CHDA 1LL4A 2X0HA 5IDIA 5A2AA 5BROA 2YOCA 1QI5A 3BH4A 4Q22A 2YL6A 3NJ3A 2G4FA 2DEPA 5D4YA 2J8GA 3CZEA 4ACZA 3BSHA 1HIZA 4QP0A 3WENA 3ARQA 3VIKA 4MNLA 1WAWA 1FFRA 4FNSA 1NWRA 2DSUA 4CVWA 1J01A 2J74A 1R47A 4PUEA 3VM7A 5I23A 1OM0A 4R5EA 1V3HA 1CPUA 3ZJ8A 5HDRA 1KXTA 3AI0A 1ISZA 4F9JA 3DYOA 1G1YA 1HJVA 2VZUA 1HXKA 5BWFA 1W1PA 5A6AA 2WBKA 4M24A 1ZBWA 1MW0A 2WAGA 3KWXA 1UWIA 2WVVB 4JFUA 2JALA 4OKDA 1MXDA 2Y8KA 4DUVA 4HPGA 1OT1A 3BMVA 1NH6A 1GCYA 1ZJBA 4PMDA 1E0XA 4J7RA 1B9ZA 3VD3A 3U5UA 1XCWA 1UR1A 4HA4A 3M46A 2XSAA 3AZRA 3UERA 2ZICA 2VZSA 1V3KA 3UG4A 1OSEA 5HBFA 1FA2A 2PF0A 5I5RA 1PJ9A 3CUIA 1QHOA 2XHYA 3VIJA 2PB1A 1HJUA 4JCLA 5AYIA 4AD0A 1EDGA 3FAWA 3T0AA 4JFWA 4Z2JA 3PBGA 1SMDA 1R33A 2A3AA 3EJRA 1RP9A 1OD8A 3WF4A 2X8RA 4WKAA 4EK7A 3GNOA 3D5HA 1V6VA 4CU7A 1R87A 4RL3A 1NOFA 2YFNA 2EACA 4WF7A 1R75A 1ITXA 4LYPA 2VI0A 4P8UA 3WQ5A 4PN2A 4OZOA 4PMVA 2XVPA 4HZ8A 1KB3A 1C8XA 2WVSA 3UG3A 1OGGA 4H7VA 2VL4A 3U57A 1H2JA 2WMIB 1UH4A 5E1QA 3AS1A 3KL0A 4W7WA 2E3ZA 2DGAA 3HG5A 1AVAA 2XN1A 2IXUA 3LPPA 3LXAA 2TAAA 1TFVA 4D1IA 4M1RA 1C92A 1W3LA 4HA1A 2YDQA 2YL5A 3GDBA 3CUGA 1HVXA 4JKLA 3WNOA 2J7EA 1J0HA 3MU7A 4D6CA 1HX0A 2EJ1A 3VIMA 3MV01 4P7OA 3WUBA 3WMSA 3O6AA 3TTQA 3PZ9A 1KGXA 3WY1A 4PMZA 1BF2A 3HG3A 1KBBA 3CTTA 3EDKA 1TCMA 3VNZA 3PZVA 1ISVA 3AZTA 3ZT7A 4U5IA 5CG0A 1H09A 2DSWA 1WZMA 2GJXB 3AS0A 3WD1A 4UFLA 3MKKA 4DM1A 3WFLA 1V6YA 4WJXA 2EO7A 1BYDA 3ZR6A 4PTXA 4U3CA 3GNPA 1KWKA 4OBRA 5JBDA 2O9RA 2FHCA 1JDDA 2X2JA 5M5DA 3GH5A 2Y2WA 4NZJA 1UKSA 3ARXA 3GXMA 2D22A 3EJSA 3PZNA 4PSPA 3DDFA 3VIHA 1UQZA 4KWUA 1E6PA 2DSZA 1MWOA 2W63A 1SMAA 1VBRA 1WP6A 3AYRA 5JIWA 1R86A 3TV8A 4QDMA 2NW0A 4DUXA 4J3VA 3ARPA 4ZFMA 1KBKA 2WMKA 3DECA 1PIGA 4AY1A 2BY1A 3KEHA 3BLKA 1LL6A 4NSBA 1XCXA 1NOWA 3WH6A 1TZ7A 1TQSA 1V02E 2OYMA 1HJSA 1V0NA 4L4OA 1IT0A 1JIBA 2XVLA 3CZLA 1GQJA 4JCMA 4B16A 2WCGA 4AEEA 2A3EA 2WVTA 2DT1A 4P7QA 4GO8A 2W66A 2NSXA 3DX1A 3WEOA 2O92A 1V08A 2XM1A 5M17A 2D23A 5D9OA 4E8DA 3ZO9A 1CIUA 3ZIZA 4CD7A 3VIPA 2CBUA 4CN1A 4DO4A 2JEQA 1DTUA 3GZAA 3WN6A 1KTBA 1E3ZA 1VJSA 1H49A 1H0IA 2OW7A 1M04A 1S46A 1LWJA 3IJ9A 4S3KA 1GVIA 1OB0A 4V2XA 3BUBA 3CZNA 4CCEA 5CGTA 1KR0A 3II1A 5D9NA 1HKJA 1JZ8A 2OYKA 1NARA 1JZ4A 3D51A 4FNQA 4AD3A 3RMEA 4PCSA 2ZUSA 3GXDA 1J9YA 3VX0A 1FP8A 3LPOA 4AZHA 4OUEA 3BVUA 1CGUA 3S6TA 2XPKA 2GFTA 3U5YA 3ZJ6A 3WDIA 4JFSA 2WMHA 1EIBA 3DX4A 3A4WA 1HN1A 3KZSA 1O6IA 1X1NA 1VFOA 1JD9A 3BVTA 3J7HA 4CVUA 1TVPA 5IFTA 2YJQA 4PSRA 1E15A 4J3XA 1GOWA 1X6LA 4RE2A 1VIWA 5D9MA 4B3KA 4MNKA 1CGWA 1W32A 3ECQA 3QHOA 1AQ0A 3GYCA 4AISA 1BHGA 1EDQA 1WNOA 1CBGA 3L2LA 5BXTA 1XD1A 1M03A 1CENA 1WDPA 3W29A 5BRQA 3F5JA 4JHOA 1RP8A 5A2BA 2EPNA 1G5AA 3RJXA 4OGZA 3VOCA 2PWEA 3LRKA 3N1AA 2Z1KA 2BXZA 3BCFA 8CGTA 4MB5A 1OINA 1IZJA 4MNJA 1BSIA 3NSXA 2HVMA 1TQWA 2F7RA 1LF1A 1US3A 3EBVA 1HF6A 3BLPX 4AZGA 3IAQA 4CGTA 1W1TA 4PBGA 3NUKA 2IUZA 3PZQA 5F7UA 4GO9A 2J7CA 1BQCA 2G3NA 1GNXA 1H0GA 1Q6EA 4W84A 3GH4A 4H41A 1K9TA 4HU0A 5I6SA 3TOPA 1EXPA 4AWEA 2GK1A 1K6AA 4F66A 3AS3A 1BYAA 1QWNA 1EA9C 3BSGA 1W9UA 7CGTA 1R7OA 3SCNA 4JAWA 1JXKA 5A1AA 3WELA 1LQ0A 5A2CA 3T08A 3VILA 3AXIA 3GXFA 2G3IA 3QGVA 3VU2A 1W9DM 2JF7A 2PWDA 4D71A 3VGHA 2DPEA 4QFUA 3N13A 1MQRA 2WBGA 4WK9A 3VMNA 5AY7A 4MADA 3SEPA 4HA3A 2E8ZA 1IV8A 2E4TA 3ZOAA 3W81A 1PPIA 3O2LA 3AIVA 2ZIDA 1UOKA 2ZX9A 1MQQA 1HP5A 1DWGM 3QOKA 3BXWA 4XZBA 1J0IA 5E9AA 4FLRA 4W5ZA 2WM0A 1K9EA 1XH0A 1GZJA 3CHCA 4D6GA 1QI2A 3KL3A 2XWEA 5A6SA 3AYSA 2XFRA 2WKLA 1UKOA 3RJYA 2C8NA 2VX7A 3VD5A 5ABEA 1GORA 1V6WA 1ODZA 3VD9A 3PZGA 3W38A 2JEPA 3AROA 3MANA 4Z2LA 1W1YA 4J3SA 4HU8A 1Q6GA 3O9NA 1KCLA 1UD5A 1E72M 1JFXA 1HJQA 1E4MM 4ZXLA 1B1YA 5ABHA 5C8BB 1G9HA 3SCSA 5AC5A 2YL8A 1IZKA 3ZSTA 1VJZA 2J7DA 5HPCA 3CO4A 5AYBA 5A8MA 3CH9A 1E6SM 1EQCA 2YLAA 1FFQA 3M07A 3SUVA 3WD3A 3SUWA 1EGZA 4D6JA 3E1F1 3K4DA 2DSVA 1LL7A 3AISA 2WMGA 5ECUA 1E6NA 4JIEA 3WH5A 2DT2A 1CYGA 2E9MA 4LYRA 1XC6A 4CD5A 4W8BA 1JZ6A 4J3UA 3WQWA 1V3LA 3W28A 3PZUA 3WUFA 4PRWA 3VGBA 1XGZA 2EAEA 1GVYA 2PBGA 1WE5A 1TA3A 1JYNA 1HNYA 2CHNA 2OLHA 4BZYA 1DWJM 3LPGA 5A6LA 5CPQA 3BVVA 1TG7A 3EDEA 2EADA 5A6MA 4QLJA 3B9EA 3MMUA 1C7TA 1PEZA 3VMOA 1CGTA 4J3TA 5IHRA 1FHDA 3GXTA 1OT2A 2E8YA 4AW7A 4CUCA 3N11A 4FLSA 3SCQA 2ZX7A 3VKKA 3A24A 1W2VA 2E9LA 1BTCA 1MW2A 4NX0A 1UASA 1E0WA 4HZ7A 2D3LA 4WKHA 2X2HA 3VDCA 2YBUA 2YLLA 2WNWA 2ZE0A 2WZHA 5D9PA 2JF6A 1PX4A 3BAIA 4N42A 3ZJ7A 2W67A 3WQVA 4OOUA 2WC7A 1HJXA 4XZWA 3L4VA 1MFVA 3ARWA 1WZKA 4FNRA 5E6ZA 3DYMA 4KRTA 2VZOA 3CBWA 1BFNA 4K68A 4KMQA 1JI2A 4W88A 2VCBA 2CESA 1I1XA 1OBAA 2C0HA 2UY4A 2X09A 1C93A 1V0KA 3FAXA 1W3HA 4ZEPA 2BY0A 5FD0A 2OSXA 4AZ5A 1K9FA 2J7GA 2F1BA 4DWSA 4EKJA 1UR4A 2FDMA 1ZBKA 3WH7A 2CEQA 4P7LA 2XWDA 2CBIA 1YQ2A 2Y5EA 2YA1A 3SCRA 4ACZB 1GHSA 1B31A 1GONA 1CGVA 1EOKA 2ALWA 1E9LA 2ZXBA 4OJYA 2EABA 4WSJA 1TVNA 4RE3A 1Q6FA 3L2MA 3SCUA 4LGXA 3GBDA 3WDJA 4MNMA 4GZEA 3G6LA 3EJUA 2IXVA 2GJPA 1W3KA 2BY3A 4ACYA 2J7BA 3WY4A 4UQBA 2F61A 3S5ZA 1WDQA 1ZU8A 4HTYA 2VUYA 4PUDA 2AOSA 3HU7A 1NP0A 3UR7A 1I75A 4GZJA 2BVTA 2ZXAA 5A6KA 5LA0A 1HKIA 5DO8A 1GOIA 3VGEA 3NIYA 1JXJA 3T0DA 3SCVA 1I1WA 3T2PA 3EDFA 3W26A 1E5JA 3A21A 4LXFA 4D6DA 3FY1A 4E2OA 3VSVA 2DH3A 3U7BA 1KFWA 3L4TA 1W9VA 2G41A 2VVNA 4NF7A 3BGAA 2WKGA 5CLTA 1H3GA 2VCAA 2WHJA 4WKFA 3EMCA 3VDAA 4MJ4A 3AOFA 1TQVA 2BV9A 9CGTA 3L4WA 1R85A 2CIPA 3TP4A 4X0NA 3RIKA 1FH8A 1C91A 3K8MA 2YA2A 1QWUA 1R46A 3W53A 4P7RA 1C8YA 1HXJA 3POCA 4MB4A 2J25A 1VFUA 1UZ1A 1VEOA 4MB3A 3FW6A 3WH8A 1QPKA 3PN8A 5CLWA 2WK2A 4CD8A 3AS2A 1J18A 4AXNA 4FMVA 1F4AA 3KLLA 2V3EA 2XIBA 3WIJA 1UD2A 3OBAA 4P7NA 3SUSA 4J3WA 3VDHA 1SYTA 1HKMA 4HOWA 6A3HA 4J27A 1C7SA 1A47A 2YA0A 3WNNA 2DDXA 2FYVA 1KGWA 3TTOA 2WWDA 1OIFA 3VIGA 4YN5A 3AFBA 2FHFA 3ARVA 3GNRA 1JL8A 2ZUNA 4D6IA 3TTSA 2VOTA 3WD4A 3RM8A 1V0MA 3DDGA 3WBEA 3LRMA 3OLGA 4UZSA 1KTCA 4CU6A 3SCOA 3QHMA 3CZKA 3DYPA 5DEZA 3VIFA 4DWSD 4TVUA 2QPSA 1LG1A 3EMQA 4CN6A 1G0CA 3A4XA 1HVQA 1PBGA 4JKKA 4V28A 1V3IA 4ATLA 2WZEA 1GOOA 2J77A 1MVYA 4AEFA 4AD5A 4LQ1A 3AMDA 2GUYA 1E4IA 3VPLA 1CDGA 3NDZA 4AIOA 1Q4NX 2ZXDA 3OZOA 1EHAA 3WD2A 3ZMRA 3W6MA 1HT6A 4N0RA 2OSWA 2UY3A 4HP5A 3CZGA 3LRLA 1GW1A 5ABGA 2F7PA 1HTYA 2Y24A 1GJWA 1XV8A 3B8SA 3MS8A 1UZ4A 4S3JA 4WSKA 2D0FA 1WZLA 1UH2A 4GPNA 2VQUA 5ABFA 1G01A 1DEDA 3MV11 3GXPA 4RE4A 3BAJA 2G8ZA 3W4RA 1JG9A 3WY3A 3GBEA 3TONA 5A8QA 1HKKA 5JBFA 5HXMA 2V38A 2GDVA 1UKTA 4Z2HA 1KQYA 3IANA 2WLYA 1E43A 2VX6A 3MSDA 1J0JA 3F5LA 1TQTA 4ZE4A 3N12A 2RGLA 4OIFA 5BCAA 2QLYA 1FH7A 1PX8A 3N15A 2OW6A 1X6NA 1JZ3A 3RDKA 1AQHA 2Z1SA 1UR8A 4KRUA 3WL0A 1GPFA 4JFTA 4M56A 3AHZA 5DT7A 1H1NA 1UWQA 3OGRA 4U3AA 1B3XA 4TX8A 4IPLA 1CLVA 2D0HA 4AYGA 3T2OA 1B90A 3AMLA 1JAKA 3CC1A 1BGAA 4AD2A 3IJ8A 1JZ2A 2XVKA 4PMXA 3OLEA 3DX3A 4H8UA 1LLOA 5CZKA 3WDRA 1CWYA 1PX3A 1WCGA 4LX4A 2ZX6A 3SIMA 3W25A 4URIA 1UUQA 1LWHA 4B3LA 4EE9A 2WHMA 3CPUA 1LG2A 5M3WA 4OOZA 1W2PA 2ESCA 1PZ2A 3MUIA 3A6OA 3WL1A 3BUDA 3QR3A 1C8QA 4M81A 3AIBA 4UTFA 5I0DA 2W92A 4C7FA 1UKPA 3WEZA 2PI6A 5CQ1A 2JFEX 1JYVA 2WLZA 1E55A 1OIMA 3D4YA 4W8LA 3VINA 1BGGA 2F18A 1FHLA 3UESA 3A3HA 4FNUA 5CSUA 3VMPA 3MO4A 5D8ZA 1XH2A 1W9XA 2QHAA 1QHZA 1ISYA 3W24A 2JIWA 4W7UA 4TTGA 4WLCA 4FLQA 3CZSA 1OWQA 2BHYA 3ZSSA 3DC0A 1UD8A 4HOZA 1J12A 1KR1A 4W7VA 3W37A 1H5VA 2PBOA 2VMFA 5E0CA 1VAHA 2D20A 2WSPA 2VX4A 4FNTA 4X9YA 4U2YA 1KQZA 5CGMA 2ZUMA 4W93A 1WDRA 4L4PA 3OLDA 2J4GA 3QHNA 1MYRA 1OGSA 1CXFA 1DWIM 4YHEA 3OB8A 2MANA 3HG2A 3DHPA 1A3HA 2VRKA 1HL8A 7TAAA 2WMJA 3SCWA 3A23A 5GPRA 4D6EA 2A3CA 1V3MA 4LYQA 7A3HA 3PZMA 3CLWA 5A6JA 1E70M 1V6XA 4P8XA 4HMEA 3L4UA 4EAMA 2QF8A 1TMQA 3CMJA 4IPNB 4CKQA 2DIJA 3BAKA 4ZXOA 3BLBA 4ZENA 2CCRA 4PMYA 3H53A 2VCCA 3VTRA 2E0PA 1J0ZA 2J7FA 2VJXA 3CGTA 4UFKA 3VX1A 1ZJAA 4M29A 2FE0A 3OA5A 2BY2A 5GQBA 1ZB5A 3RPMA 3OLIA 1BVNP 3A5VA 4DO6A 3W0KA 4AZCA 3FHQA 4D6FA 5EBAA 4HMCA 4DWSC 4PCTA 3PZTA 4AZ6A 3AIRA 2WZIA 1ODUA 4GQQA 1O7DC 2JE8A 3N04A 2D24A 1RH9A 2WC3A 4M8UA 3WNMA 1JF6A 3UCQA 1BG4A 3CMGA 3VO0A 4B15A 1Z32X 4GZIA 1DP0A 5CPSA 3VIIA 4KGJA 3K4AA 1WPCA 1HWWA 3H55A 4TX6A 3WQ6A 5BXRA 4A3HA 5A94A 1CXHA 3K1DA 1J0YA 3GM8A 1QX1A 3IGUA 3BVWA 2A3HA 2EPKX 2EPMX 1GUVA 4UZUA 2J62A 1E1EA 2E40A 3MMDA 5A69A 3VVGA 1DHKA 1W3JA 2WXDM 3AMKA 3PZIA 1NWSA 1JZ5A 1JDAA 5JUVA 2W91A 1NWTA 3CZJA 1B30A 2D73A 3ARZA 3PTMA 1MW1A 3IJ7A 8A3HA 5FL0A 5GNYA 4AMCA 1ECEA 4JZ5A 5C70A 4B9YA 5IXEA 1QW9A 2A3BA 1MQPA 4BF7A 3RILA 5BYWA 3SCPA 1E6QM 2X1IA 4UQEA 2O9PA 3UEQA 2JIEA 3EJTA 4PMQA 1BLIA 3VNYA 4CD4A 1E56A 4Z2KA 3WEMA 1B3VA 5BXSA 2CBJA 4NXSA 3TA9A 3WNKA 3S2CA 2WW5A 4AZIA 3F4VA 5LA2A 1U30A 1QBAA 3AXXA 4AZ7A 5EB8A 4UFJA 3WBAA 4C7DA 2XM2A 2B31A 2CHOA 3OG2A 4TOQA 1NM9A 2O9OA 1G94A 4JL1A 3IAPA 5I77A 4PYSA 1E5NA 3SUTA 1H11A 1VENA 1UA3A 4MB1A 3I3BA 1AQMA 3M6DA 4ATWA 5KZ6A 3VDBA 3ZQ9A 2VZVA 3S5YA 1EH9A 1PS3A 3W6LA 2XN0A 4GKLA 1VEPA 1M01A 2BNJA 4YPJA 2X2YA 3WH9A 3B9DA 1US2A 1XSJA 3VSUA 2ZX5A 5E70A 2Q8XA 2CERA 1VFFA 4AD4A 3WQ8A 1JGIA 3A47A 2D2OA 4NRRA 3UR8A 4XV0A 3VM5A 3ARYA 4W89A 3WF3A 4QCEA 1JFHA 2DT3A 2PWHA 2YFOA 1QHPA 2X0YA 2XGIA 4TXEA 3LXCA 2EBNA 1KWGA 4ML4A 2WHKA 4MDOA 3EDJA 5DF0A 3F5KA 3BC9A 2J47A 3AIUA 4W8AA 1QI0A 2XIIA 1MFUA 3UG5A 4NZFA 5GNXA 4AC1X 4NXKA 3ARSA 4CCCA 4FNPA 1E6XM 4D72A 3JUGA 1PZ3A 5I3DA 1EQPA 3BAYA 1VBUA 1E3XA 3ZT6A 2V5DA 4P8VA 2J75A 1XYZA 2VZTA 4X0VA 1TE1A 4DWSB 5FL1A 1F4HA 1E6RA 3W82A 1D7FA 4BA0A 1D2KA 4TVCA 1MW3A 3I3EA 3UETA 2YIHA 3AMGA 1ZBVA 1VB9A 4CU8A 1JNEA 1VFMA 1W91A 1GQLA 1LJYA 4F79A 3G6MA 5D8WA 1BYCA 1BPLB 2WVVA 3K8KA 3T2QA 4E4PA 4JHZA 1PAMA 4QLKA 3VD4A 3WFZA 2CPUA 2ZOXA 1JYWA 4UQCA 3VD7A 4NRSA 1ZBCA 1P6WA 1HJWA 1UD3A 3WDHA 4M82A 4BCEA 3NCOA 1GQIA 3EMZA 2YDSA 1OGBA 1J0KA 2ZUUA 2ZWZA 3MMWA 1QNSA 3WUEA 4QCFA 5DFAA 3VGDA 4YHGA 2IGTA 1QI4A 4HZ6A 1EO5A 5LYRA 2G3JA 3WY2A 3MI6A 4GIAA 4IUGA 2QMJA 1VEMA 4UNIA 1CNVA 3ARRA 2XTKA 1UWUA 4GI8A 2XG9A 4CD6A 1YHTA 2DQXA 2F2HA 6CGTA 1V3JA 2YKKA 1FH9A 1M7XA 1VRXA 1TR1A 3WSUA 4FLOA 1NP2A 5M03A 3MUY1 1C90A 2WHLA 5JBEA 2E9BA 3NDYA 3SCTA 4MAVA 1NQ6A 4H04A 1E73M 2BS9A 2WMIA 3OGSA 3D3AA 1RD6A 2PWFA 4W5UA 1RPKA 3LMYA 1DWHM 2CETA 2WCAA 3DHUA 1Q6CA 3N18A 4QLLA 2XVGA 4AZBA 3WF0A 1OCQA 4KH2A 2ZUWA 3BCDA 5IFPA 5JIPA 2DIEA 1M53A 1L0PA 1QNOA 4W86A 2UWFA 2OWWA 1B0IA 4MPKA 4PTMA 4U5KA 3DX2A 1UHVA 4PEEA 5EFFA 2ZUTA 4E8CA 5CSYA 4D1JA 2WPGA 2FGLA 1E0VA 2WWCA 2Y8VA 4W87A 3BUIA 1C3FA 3N17A 3AHTA 3HMCA 2GJXA 2BHUA 1EOMA 2GVYA 3GXIA 5E0FA 2W5FA 1B3ZA 3D52A 3KL5A 3VGFA 1QW8A 1ZS2A 4GI9A 1QBBA 1EO7A 3WNLA 1BG9A 4MTVA 2OWCA 3M7SA 4BQ5A 5BRPA 4KGLA 1HP4A 3CIVA 1SR0A 1W9BM 1B2YA 5I24A 5LA1A 4IM4A 3WMBA 1R7AA 3AICA 1CEOA 3OZPA 5FKYA 3LX9A 1UD4A 3T09A 1XRVA 2HISA 3THDA 5A95A 1TUXA 3GH7A 5C71A 2VR4A 3I3DA 3ZT5A 2VO5A 1CLXA 1W9PA 3H54A 3MSGA 4F8XA 4Q7NA 4UFIA 3CHEA 5KEZA 5HOSA 1E71M 4MAZA 1FOBA 1XH1A 3OGVA 2GDUA 3WF2A 3BAWA 2OYLA 4V27A 3GXNA 3AJ7A 3BAXA 3MUAA 1SZNA 1DWAM 1WZAA 4Z2GA 5ABFB 2DT0A 3FXYA 1XSKA 2W4XA 4AMXA 1ISXA 1GHRA 3VSTA 3CZ8A 5HNNA 2J78A 3ZM8A 1GOQA 4XUYA 4ATDA 5BXPA 5A6BA 3APGA 3KLKA 4MJ2A 2BHZA 4U33A 2O9TA 1V03A 3CHFA 1V0LA 2VURA 4H2CA 2CNCA 1PIFA 4FK9A 2QPUA 2VVSA 1XSIA 1QNRA 4FF5A 2XGBA 3EYPA 3HN3A 3AIQA 2D3NA 1FP9A 2CYGA 2CKRA 4OBSA 2RGMA 1WB0A 2VRJA 2UY2A 4UOQA 4EANA 1UD6A 2XSBA 4GI6A 1N82A 2XJ7A 5FIPA 4ZE5A 3L4YA 4QAWA 4HOXA 4LPCA 1E40A 4HMDA 1Y7VA 2BVDA
chains in the Genus database with same CATH superfamily
4GBXD 4IBWA 5KBNC 4AVOA 2WNKA 1G7PA 4Z78B 3HJEA 4YXGA 5LHEA 1M57B 5TQLA 4KKCD 3RBGA 2GWGA 2Y06L 4XSMA 3BUQA 4J3OG 2ZXQA 3K30A 3UPCA 3U6XA 4JPKH 3BG5A 1Q1JH 3SPCA 1R2SA 2UV3A 1VF8A 4MWAB 2ZUVA 2CLOA 1F6YA 2HCVA 3ZN6A 1AHMA 2BFVH 3W7MA 3B3BA 1NOUA 1UR2A 1OB1B 2UV8G 5TF1L 3ZGIA 5IB5B 4YHIB 1UA7A 2PC8A 2Z31A 3TTEA 5FC9A 3SURA 4LLWB 1Q9WA 3V0JA 3TVMA 4ERSH 4LUSA 1FFPB 3PLYA 2E59A 5I73B 1BM3L 1G1KA 2ALRA 4W9ZA 3H26A 4XHJD 4YWGH 2VFEA 3PYCA 2K3TA 4U1LA 3H4HA 4OV5A 4LIQL 2DLIA 4ENED 5DFVD 4XNZC 1JRHI 1UYWH 4N2NA 1Q8MA 3ZMEA 3AUOA 5I3GA 3S46A 1GW9A 4AHOA 3GIQA 5EZOL 2X4OB 1BECA 2WWNA 1GJIA 3KBWA 3VOJA 4FDWA 2QFRA 4GUJA 1U8KB 2HJPA 2VXQH 5LAXB 2ZQ0A 4Q8PA 4JHWH 3AREB 2CZVA 1JI1A 4LF3A 4UT9H 3QRHA 5EMUA 4GISA 3H3PL 2AJVH 4Y16C 5LDSA 4BHUA 4C6LA 5JMUA 5HANA 5E1AB 2OK0L 1GOXA 6XIAA 1FCCA 3ARGC 4X9HA 1OHQA 2PDMA 3B3DA 3K80A 1Y8BA 4FKHA 3UWWA 3MMEA 5DCDA 1MO0A 4JPIA 3IK2A 3E0FA 1X7FA 4G80B 1FG2B 1E4LA 2VDKL 3OR7B 4JFEB 5JQ6L 4WENB 5I6XB 5SWZD 1SZFA 1RSYA 1I1AA 3RDTA 3NA4A 4NAFB 3HCVB 5HYSA 5IVZB 2B77A 1V7YA 5AFAA 3ILQD 5EZLA 4WW1B 2WB1A 4V11A 1E0TA 2OTUA 3FKRA 3D69B 3SFWA 3U48A 4R2GC 2Z91B 1JNDA 5MHSD 2GSIA 3CUPB 4Y9AA 4WDIA 1TV7A 4P5MB 1D3GA 4BBWA 5C0CD 5TD4A 4IDJL 5I30H 4G6ML 4EVNB 4CCDA 4A63A 3AQZA 2X1TA 4BF5A 1U3NA 1GVSA 5DEFB 2ZCHH 3ML9A 1LL4A 3STLA 1Q3NA 1QI5A 1A80A 1NSNH 3ZZQA 3AYTA 1GYCA 3L1EA 5I1LB 5HVHB 1QFPA 3C5ZB 2O0TA 2DMBA 5DQ9A 3OKDB 2AC0A 4W9HC 4F0MA 3KVPA 3KCOA 1TJGH 1CPUA 2GI0A 1MQ8A 3MLTA 2O93L 1W1PA 3ZQXA 1XYAA 1NAKL 5K9DA 1IGTA 2XGZA 4KFPA 1AY1L 4JFUA 4N8CH 2DWDA 4K3DH 1MIML 3LRHA 4NERA 4FQ1L 4Q7IA 3RNKB 3CFNA 3KBHE 32C2A 2V9DA 1FWNA 3RLVA 1PZAA 3S1VA 4NUGL 3K6DA 2JKEA 4WU7B 4PJ7E 4H9MA 1GOHA 4JFWA 1VFSA 1Z48A 4QLWA 4KI5F 3EJRA 2X8RA 3V4UL 4WKAA 2JJUA 2F68X 3OAYK 4AUUA 3QIUD 4U6XA 2QULA 3ECUA 2VR9A 2RCSH 1NOFA 3SY0B 1R75A 2PDNA 4P8UA 2NCEA 1MZHA 1NMCB 1EP2A 4EXAA 4UTTA 4JR5A 2EIKB 3GSQB 1TFVA 4ZB2A 4MMXB 2WJZA 4PGDB 1EBHA 4JK0D 4YE4L 4Z0SA 1U95B 2AQSA 3MV01 2XRAL 3L5AA 4B5TA 2WBWB 4GQ9L 3QI9D 3WY1A 3GK8L 2Y6TE 2NVDA 4FG6D 2PLMA 3EFFA 1A1OA 2ZZUT 2GJXB 1T1WA 1KLGA 4U3CA 3GNPA 5JBDA 4AH7A 4FFYL 3DURB 1T6BX 1CD8A 1OYCA 2CGZA 4ELKA 2EE3A 1Z9SB 2ZCZA 4HS8L 1KGJA 5KJ4A 5HDBF 2JB5H 3GVQA 4TNEA 3BD3A 3CFMA 3RVUD 4YLWA 3BT2H 4GIYA 3M0ZA 3KEHA 2V6AA 4UTLA 4JICA 4H26B 5ACZA 4EWND 2ZYIA 1H8NA 1V0NA 5EGRA 3QUZB 3BEWB 2OG9A 3OC8A 3V8OA 1A6PA 1WDWA 3D3FA 3LU2A 3W3OA 1YNTF 1N70A 2CZEA 2D23A 2VLMD 5JOPD 4Z7WF 3NIFE 1YE6A 2MH4A 2H8PA 5AOLA 4IGSA 4PS7A 3DTDA 4P46A 5DLLA 1S6NA 3BUBA 2V5MA 2DZEA 3KPTA 3PP4L 3H9HB 4HK3N 3CN1A 4FABH 2LABA 1QLRB 1FBIH 1VRDA 2AQOA 4ATTA 1HQRA 5GJNA 3OGCB 1BQGA 4PG2C 5IEHB 1NFIA 5IFTA 5D1QD 5LGZA 1RZGA 4WFHE 2QTVA 1KJVB 3QMTA 3SPVB 1S2VA 4JHOA 1U58B 1GZHA 4AJ0A 4JVWA 3NO1A 4B9GA 1NGZB 1MREL 5D5MA 3D0CA 3HBPA 2B0MA 4MJ5A 2UY6B 4X7SH 5CJBA 5I9QB 2OMVA 4U1HB 2ZA1A 3T8LA 5HNRA 3S5LB 1ONXA 2R8SL 4PBGA 4NQCD 2IUZA 3D3VB 3IJHB 3VD2A 1S2WA 5ACLA 4JRYE 3RVWD 5J1TC 1EAPB 3RUGA 3GW3A 4W9IC 1XB3A 1VCAA 5SWZB 5FYLE 3S8WA 2V5KA 2ANUA 1LQ0A 4TM9A 5HJBA 3L1OH 1KY6A 2NSMA 1YQVL 2PWDA 3QAZB 5BZDB 1K8IB 3INOA 3S9YA 5SWUA 3IT8D 5PTDA 5ADPL 1W72H 2BOBB 5FYKU 4OZIA 1TLMA 1INEH 2RHEA 4XAKD 1TMCB 3RVTD 5C0CB 2YEVB 1ZVYA 3NGBB 1R3LA 3KPSE 5FUZH 3EO1A 5FW8A 3ZZ1A 4HJJH 5HHOE 2B5IB 3BKCL 4FFVD 4OZGB 5EU3B 1QCWA 4C6DA 3O0RL 3ZSTA 1HGYA 5AHIA 1RK6A 4MAYD 1NBCA 4Y8FA 2DWEA 5EUKB 4KF1A 3E0WA 5ECUA 3APYA 4ZMLA 4FFYA 3DXAE 2WIIB 4RRPG 5TTRA 1B6DA 5L88H 1GYAA 3L95B 2OR7A 3OC5A 1HNYA 2V8ZA 4UBPC 5CPQA 4XCEA 1J5HA 1RZ7L 1MZZA 4QHLA 1YNQA 1Z3RA 4WWOA 3NN8B 4AY7A 1PEZA 1YMME 1UC5A 3NXLA 2O1AA 1LE5A 2I14A 3N11A 2CRYA 5DMIH 4OCXL 2HK1A 3A24A 3RJDA 4N24A 4ZTOH 1RY7B 1FWWA 2N59A 2X9ZA 3BESR 4GACA 3PWLA 3QIUB 1ID5I 3UR2A 5DJ8A 3MBWA 3QEZA 4ZTEA 2MNWA 2JF6A 3FSUA 1P6AB 2H2PC 1ITBB 1OCWL 4XZWA 5E9DA 1WZKA 1UM5L 3BIAX 1F5ZA 1I2QA 2VCBA 4NHUA 3L65A 3RX5A 2MCMA 2B39A 2FTPA 3QI9B 4FSAA 1RLWA 3PHOB 5T1LD 4F2MB 1W5NA 3FQRB 1T5AA 2XZAL 2I5IA 3V4LA 3WH7A 2PF6A 1S2EA 2CUHA 4UM8A 4GYBA 3O3RA 4RE3A 3BUTA 4LJ3A 1U8JA 3C2EA 5DJCB 3EJUA 1YEYA 4AVHA 1ZLUK 4UQBA 4GUHA 3FO1A 2VUYA 5L9FA 4L4VD 3KPRD 2CZ5A 3H3PH 4K94H 3VWJC 3GJFA 2EAWA 4HKBA 4DVRL 4R0LA 2HT3C 1NOLA 4ORZC 3TYCA 2OYPA 3U7BA 2IH3B 4MMZC 1DBBL 5FGBC 2ADYA 5KSBB 2PWVA 3AOFA 1LO5A 3SE9L 3Q13A 2IANE 4OZFH 1PL9A 5BZWA 1KO0A 1ACYL 2A9NL 1VFUA 3C09C 2VCOA 3QVAA 2R2EA 5ILTH 4MVAA 5C0FA 4DEPB 2HE5A 1WWAX 2WP3O 3F7JA 5DRZA 1XCFA 3MYJB 4L61A 4HOWA 1OJXA 4JREB 2YA0A 1XLJA 1OIFA 1QTPA 3HPJA 3GNRA 1GVQA 4EXPX 2ZUNA 4U6VL 3BOVA 3R4DA 5D1QB 5AAMC 3EF7A 4OCSH 3QHMA 2YAPA 1XW8A 4H1LH 2IKGA 4AGLA 2YR3A 3GTTA 1WWCA 4QF1B 3NIDE 2DV0A 3CBRA 4AEFA 3V6ZA 5A2JH 3QQ9D 5EEYA 2V68A 5DMGC 3W7OA 2Y9RT 3FA4A 5ECJE 3MHUA 3D2TA 4S3JA 1FO0H 4BFIB 1OTSD 4JTTA 3WBYA 3C60D 9XIAA 3T0EC 2OMZA 3W4RA 1ZPTA 4J2PA 5DQDH 3PGFH 1P4LB 1ZLPA 5MERB 5EBMB 3IANA 2DZAA 4UTAH 1UXLA 4PS4H 4FP1A 3UPRA 4RFNC 4TNWF 4QROA 4Q6KA 1UP2A 2IWKA 3H2WA 3MAWA 3VFMA 1TQTA 2YXOA 8XIMA 2OW6A 5C3LD 5GS0C 2H6RA 1GPFA 1ASQA 3OGRA 4AEOA 3QJFA 1B3XA 2D0HA 3FT4B 2XKNB 3FL7A 1UUNA 4ES9A 1AP2A 3I9PA 2HZGA 1KM4A 3GRIA 3PXJA 4URIA 4JN2A 2PPCA 3B7TA 1U8OA 2EECA 2WM1A 1LWHA 2E68A 2BIHA 4X7DC 4KTEH 4IKJA 1OX4A 4EIZC 3WEBA 3MRHB 5LXGL 3RGVA 1E55A 4RZCB 3D4YA 3OW1A 2VEPA 4H7ZA 3MO4A 3DOPA 4GGBA 4MAYB 5T5NG 2QS8A 2QQ6A 4ZW5A 4YE4H 3RY6A 4NQXB 4BKNA 5AOUA 4E5XB 3AM8A 3NEEA 5AAWA 1KQZA 2A5HA 3RN6A 4YDKH 3RU8L 1NCCL 2E1DA 4P23A 2J66A 1MYRA 5GJTH 4TL4A 2MANA 3HG2A 4UAHA 2EUZA 3BPLC 4JGNA 4WJG3 3BZ4A 4JDTH 3DI2B 2ETWA 3W56A 4NOFA 2BC4A 3S37X 3F12A 1XPYA 5ETUA 5EIIB 1ET8A 4WWKA 2HLFC 3H53A 5JW4M 1OTUD 5ENWA 5IHZB 4LALA 1ZJAA 4GT7A 2XJKA 1J7VR 2AXJA 3MTXA 1T1XA 5INDB 1CDYA 5AKVA 3GSNB 4S3BA 5AYZA 5AYXA 3W2JA 4R26L 4PN6A 4GZIA 5CPSA 5C8JA 3DAQA 3QV7A 3W57A 5DD3H 3JWDL 3H55A 3WJJA 4REQA 3CSGA 4ANUA 3BVWA 4QRRD 1FGVL 4J1UB 4A7GF 4AQEB 2MNJB 4UZUA 4LPWA 3MMDA 1BRLA 1Z41A 4AWTA 3KPMA 3L0GA 4O0ZA 1N26A 1SR9A 4WUUA 1QBML 3ANVA 4BELD 4HWEH 2QQNL 1HO1A 2D73A 3UDWC 1LEIB 2AKMA 1SVDA 1JWSA 1UJ3A 3GI9L 1KM3A 5EBGA 4B3ZA 1QUPA 1W0VA 1WAAF 3EOBB 2FPVA 3U6RA 5EH1A 1JGLH 4H6QA 1GVRA 4JM2F 1UZ6E 3OG2A 4TOQA 4JL1A 1XIWA 2Z65C 2VZVA 7ENLA 2CBQA 5DD1H 3GBML 4WEBH 3UF9A 4RNIA 3C86A 3R06B 5JH1A 3GDKA 1ZVHA 2CK0H 1J1OL 2YFOA 1QHPA 5CBBA 4ZX4A 4XXCA 3G1DA 3QISA 3AIUA 5I2IB 1ZQ5A 5LIWX 5GNXA 3RCMA 1YQVH 4FQXA 3WFEL 4Z8FH 5AYQA 4D72A 4KQNA 4ETQB 4PJ5E 4NZ8A 1IBDA 5AW6B 2IGLA 1JPTL 3TPKA 3BKYH 3WQCA 3W82A 3IVUA 4DIAA 2W0PA 2Y63A 1QSVA 3E9AA 3G5VA 3HGRA 3T2QA 1TJHL 4IIQA 1JRBA 3PP7A 1RUSA 5ENLA 2ZOXA 3DGRA 5CS7A 1DXIA 4EPSA 5KSVB 5FF3A 2RDXA 1A5BA 4BCEA 1H61A 3NCOA 2VDNL 4O12A 4X5PA 1PY0A 4UIKH 2R51A 1OAXH 4PRHB 2G3JA 3TEXA 2EG7A 3O0FA 4DNHA 4MXWL 4UT6L 1W6WA 4MCZB 1ACXA 1UM4L 5I3IA 3RO6A 1BVNT 5KTEL 2RGSA 2ED6A 5BRZE 2VXUL 1XFPA 3G6JB 3V0WL 3O0KA 1D5IL 5KW9L 3T8VA 4E2VA 4OJAA 1FP5A 1JCNA 1CK0L 1RZ7H 4AM0A 1AI1L 3U2OA 4YK4C 2Q01A 1QFOA 2AK4A 1H7RA 1YN7A 1MHPH 4XP6H 3HZVB 2B7QA 1CFNB 1UMLA 2QCCA 3VI4B 1TTBA 4JAMA 3LQAC 1NUGA 1QACA 3NP3A 4Q4PA 3QPQC 2DQCL 3MV7B 2AKRA 4M6NH 4HJEA 2W5FA 1QW8A 2ZF9A 4XPAL 1HYSD 4MYXA 2JTYA 2HISA 1PTAA 5T8IA 4DOHB 3I3DA 1SFHA 1GTNA 4S39A 1HHGA 3H54A 4B96A 3MSGA 4MZ2A 1XSOA 4K8RH 2C3VB 2IV8A 2G37A 4GFIA 2WBJC 3GGWA 3GNNA 3OGVA 4FQLL 4XBPB 1W6TA 1OAUL 3BAWA 1R17A 3BAXA 4QEEA 4WTZG 2VOMA 4X5XA 1GY2A 1DO6A 2P8CA 3HR5A 4ORGB 2UXFA 1IGCH 2Y3AA 3VXRE 5F1OB 5B21A 3HPXA 2N7BA 5DC9B 4G42A 1AXSB 4MJ2A 3FFCD 4QRSA 4XG1A 2X87A 3W1AA 1TVLA 2DOCA 2VJ8A 2WXPA 4FK9A 1RUMH 3SOBH 3AIQA 3C0JA 2D3NA 4OFYD 4Z5RA 3PS7A 4QRPA 4ZDHB 5HJ3A 2ICWI 5HYQA 4CBPA 5SV4A 4DEUA 1DSFH 5D4QA 1ZSDA 1N9PA 4HUWA 1RK5A 5CXPA 4WGWB 3TBTA 2VHLA 3FEMA 5CZTA 3GUWA 3G8EA 5HPOA 1C5DA 3PE9A 1BXUA 4FCHA 5IF0A 3IBEA 3CCHA 3STZB 1TFHA 1DPMA 4U1NB 2QHLA 1AMXA 1ZRQA 4PTVA 4DJDC 3AQUA 1ACYH 4PCKA 2W94A 3FIGA 1HCFX 3MRPA 4OE7A 1ZE3H 4F0LA 4FQCH 4X9GA 2FLMA 4GG8A 4K37A 1QSZA 3MOQA 3CO8A 4NL1A 4GRMA 2ADIB 1AYRA 3SGKA 1N6VA 1J96A 4CMMB 2QVHA 3WSQL 2WQ8A 4Z3FA 4N5EC 1KLUA 1WYJA 3ITTA 3CAVA 2VMCA 3UFYA 4R53A 3OF6D 4JM0A 3CL8A 1FSKC 1LO3H 2XWRA 3TJLA 2OX5B 4AYFA 4UT6A 1MNSA 2YUWA 4G6FD 5I0VA 1H4PA 4WO4D 5CSSA 5EC2A 4E2BA 1T4KA 2H32H 4A66A 3HNSH 4KROD 4LS0A 3G5YB 2G3XA 4H8PA 5IV2B 3BP6A 4TUFA 4MJJA 2VKXA 1GJUA 5AFDA 2HKFL 4JRXD 4OFVA 3PFQA 4DLMA 1I31A 4J40A 4NDMB 2KYIA 4AYSA 5XINA 5CCJA 5FOOA 3WLHA 4QHKJ 3KPQA 5IJKC 1FYTE 5KZMA 3W1MA 4HBCL 3I9GH 2IPFA 1GPOL 1X4XA 3M1BA 4EOUA 1Q7MA 4IU2B 5GGVY 2IH1A 6PCYA 1UB5B 3IDIA 2DQMA 3HG4A 4M03A 4R6UA 1X96A 1T22B 3FQ1A 3FDGA 3WTVA 3NSFA 1AD4A 3ZDXF 2FJFA 4KFZC 4ZX5A 5IMMA 3LPFA 4ZW6A 3O7UA 4M5YL 5GGUA 4ZMQA 2GSGA 4UOJA 3SGEH 4NWUH 1NIEA 4GC4A 4XO7A 3NACH 4GZ7A 2GVLA 3W73A 3F58H 5F88A 3C8NA 1FE8H 3KS5A 3J8F7 4MBOA 4JFDD 1AZBA 4LBSA 3HC0B 2AJ3B 1K4CA 4L7ZA 3SE3A 4AQ8C 5B38G 2N3JA 3PPSA 3CQJA 1W1VA 2P8BA 2WP3T 3R4RA 5DD5L 1BZ7B 1DDHB 3QIWA 4XVTL 2OMTA 5KVFL 5T33L 2O5YH 3O8XC 3RFRA 5DN1A 1V7NH 1KJ2B 4YSUA 5E6YA 3EYOA 1S3TC 4D9RE 3FT1A 2FHBA 4G6KH 2VLJA 4TUUA 2WSKA 4J28A 4NX5A 4U31A 2ZC8A 1TZGL 5ERWA 2Z0IA 3IRPX 2D4FA 5CGYC 4W1TA 5E5RB 4PLKD 5IDIA 1KC7A 1D7CA 4KXDA 4XWUA 4KDVA 1T7ZA 4XXWA 2OO0A 3MJWA 1NBYB 1DYSA 2EIJB 3FOMA 1WAWA 2YMXH 3QSKB 2GJ6E 4LP5A 4NT6A 1LLWA 4X6DE 3RX7A 5EOCJ 5I76B 4A04A 2IOIA 3ZK0A 2ZWNA 5FESA 4NJAL 3NRQA 4S1SH 5AG8A 2WBKA 5C97A 2H3XC 3DUGA 1GC1C 4TUJA 3TA3D 2WVVB 3G5WA 4AY8A 1KCSH 3GMMA 1YUKB 3SJVE 1HZLA 3KTXA 4K5MA 1TEFA 2OTWB 3FTZA 2ESVD 1BLNB 3BH8A 4P5KB 1V3KA 4BSWA 1S7UA 2QJDA 1JPSL 2UZYB 3GMQB 1QHOA 2NR6D 2OKMA 4PJAA 2TRHA 3SIZA 4Z2JA 3PBGA 3CZFB 4Y2WA 3ZE0E 2QQNH 1FORL 3PY9A 1QRND 2EACA 4P9ML 3GI9H 4LKCB 3B6SB 4IRSA 3MJ9L 1NFDB 3FO2B 3IWUA 3BV7A 4NENB 3WE6B 2VLKD 2ATKB 1CE6A 3RB7A 1M1XB 3LXAA 1NBVH 3FGCB 4M1RA 2FJGB 3N6JA 1JV5A 4D6CA 3PTDA 1NKOA 4PRRA 4AJWA 4KVNH 3O3EB 4IKNA 4DF9A 4A1RA 2HT4C 3K6SB 3HHRB 4E38A 2X6CA 3AS0A 4GJIA 2J1WA 3M1OA 1J9RA 2CCWA 1DLHB 2CLIA 4DM1A 3DETD 4JTGA 2R2BB 5EN2B 2A4AA 5DDHB 3P61A 5DC2A 4JHMA 5EPMB 1J1OH 4M6UA 3MW7A 5A3ID 3NCJL 5CUSH 4LVAA 5I8EB 3OVRA 3MRIA 3VE7A 3MV8D 5GXBB 1IXNA 3V4VB 3VNLA 3EJYD 2NSOA 2HNEA 3P0XA 3LEVL 4X6EA 3S3CB 3JSSA 2DDQL 5DQJA 3CZLA 4JCMA 3WYZA 3SE8H 4P9HC 2DT1A 4GO8A 2QZ5A 5H35A 1AXTL 2NSXA 1BF6A 4G6FB 1BMGA 3URAA 4J3BA 2WMPA 4G7VL 3R6IA 5FAGA 2JEQA 4DP8X 1DTUA 1A5SA 1B4EA 2NUXA 3UA3A 4AE1A 3RA7L 3MBDA 4KROB 3L3DA 5HHQB 1S46A 3EJZC 5CWSA 5J8LA 4M8QA 4Z77B 2X3BA 2DL2A 4JY5L 1HKJA 5D09A 4DJFD 3LENA 3S35X 4PCSA 5D1XE 2L8AA 1XIBA 2HVKB 1KFJA 1SXNA 3ETBJ 4OUEA 4H25A 5E2VH 2NW2A 1EEQA 2LU5A 5D6DC 1SM9A 1BD2A 1VFOA 2IGFH 1TVPA 1CT8A 2NX9A 1T03H 4HYRA 3NJMA 3IV3A 3GS7A 2NUTB 2VR6A 3OR6A 1BJ1J 3RJOA 1ES0A 2V4LA 4Z7UB 4WXZA 4O9HH 4P4KD 1YEJH 1XC4A 5SV3A 1XLHA 4TVPE 1KRMA 3BCFA 8CGTA 1DQQA 4DTGL 4KO7A 3RTLA 4PGJA 4AEIL 3O6KL 2NY2C 2AK1L 5L0QB 2DQCH 1GNXA 4OZHB 4XPAH 3EA3A 2ACQA 3SE6A 2D8KA 4HETA 4AWEA 1S9WB 2BSSA 4L8CA 4YSDA 3ZIYA 4NNBA 3QDHA 4JFDB 3SCNA 3JVGC 1YX1A 2HLEB 1LQAA 2M83A 3MRDA 3WIHL 4MS8D 1UB3A 2JIXA 4F48A 1XX9C 3T0WA 2V2HA 3UVAA 1TPXC 5J1SC 4FQLH 1PKYA 3MV9A 2R1PA 5IW1B 3SB3A 1OAUH 3MJ9A 5J6SA 4N0FA 3DBNA 4I1RA 2HKHH 3RWEB 4JQXC 4TUOA 4YFLF 4ZL1A 3FU6A 1K9EA 2R23A 2FEJA 2VSKB 1ZHNB 4A7QA 3IVTA 2G2NA 5ABEA 1IC4L 3TIDA 3HZYA 2A9AA 3GEWB 1LTDA 4CNUA 4MD5B 3S83A 3PWAA 2GGHA 2A83A 1H6FA 1HJQA 5JA8B 4F1SA 5XIMA 4FG0A 4XNYH 3P14A 2YL8A 2MFNA 1H7PA 4J2MA 5D55A 4L1WA 3M07A 3P9MB 3SUWA 1S4IA 5IJVB 2MCAA 4HGKC 5C6TH 2ZWSA 3B1UA 3TA3B 3S3DB 2NCMA 1Q0XL 4HH9B 1N68A 4FEMA 2W65A 3GKWL 4KW2A 4QTHA 1GVYA 4NPJA 5T1KD 2EADA 6PTDA 2NX1A 2DZXA 3JS3A 4OM0H 1DLFH 2OMAA 3VMOA 1CGTA 3GRWL 3F6JA 3MKGA 4PQXA 3QDJA 3D09A 4FLSA 3KUMA 4W9DC 3IIVA 1G7MA 2IPWA 4DP9X 4KKQA 1SDYA 3ROLB 3CSPA 1QRNB 3R7MA 3CLMA 4NP4H 3FONB 1ZANH 4GMTL 3KJ6L 3R0MA 4RZ5A 1EDHA 4OOUA 2VLKB 2LOEA 4MNHA 2YBRA 4C58B 2XA8H 4TSAL 2I7GA 4K68A 1JI2A 3IIOA 2L5HA 3ERXA 4EDXA 4G1NA 1SM3L 1KTLB 1YKWA 1C93A 2BNRE 4Z18A 1F97A 4DWSA 5ICUA 1CFTA 3ZRCC 1NMBH 1HAUA 4O4WA 4N6RA 3BTNA 1LMKA 1JK8B 3LIZL 5D7SL 1EVUA 1Y18B 5HI4D 3VVVA 4R97C 5DZAA 4HFUL 3WLSA 3SQOH 1FVEB 5E6UB 4CGUB 3KGSA 3S5ZA 4ECLA 1ETZB 5LGYA 3UR7A 2WXRA 2BIPA 3ZL1A 1I75A 1T66C 3MV8B 1JNJA 3HHSB 2ZXWB 1I1WA 1Z9OA 4PRBB 4WNJA 1L5GA 3ESOA 3VYOA 3PL6C 2WV8A 2G41A 4HSAC 4HUKB 1DORA 3DSNA 3QAQA 4JJ5A 3RRXA 2MMXA 2WINB 1S3HA 3WIHA 3MRRB 3U4FA 2OODA 5J3HC 2YPKA 4H0LC 4M5YH 2YA2A 3D30A 3JXAA 1FQ0A 1M68A 3ZTNH 1PUDA 1MFDH 5F2FA 1ZLWK 4Y4HA 2WD0A 3DHFA 4PG9B 1UCWA 3EJCA 3U6WA 4XNDA 4YZFF 1ZA3B 4H3DA 1O5DT 2WWDA 4YN5A 1A5MC 4RXFA 4JY9A 1Z2KA 3LY0A 3TH6A 5DD5H 1ED3B 3TTSA 2GCYB 3FRPB 4GXVH 4NSKA 4XVTH 1L6FA 3OLGA 4QEHA 1E28B 2FB2A 3FU7A 4FQ2H 4P4KB 4WV1C 4OLYL 1EMTL 1PGRB 1WIUA 3LQZA 2CJUL 3VI2A 1CDGA 2L7EA 3VW3H 1MEWA 3HF3A 3D1MC 4FL4B 4KKBC 1HTYA 2G60H 1XV8A 1E1CA 1II4E 2AVFA 5FJTA 4I9WE 4AXWB 3CVHL 4C47A 1M1SA 5CMAA 3IETB 4POZC 1AK5A 5DUPL 3V4PB 2GDVA 1A4JA 5CKAA 1MG3C 3GRWA 2CKBL 3CVIL 4JN1L 3UH8A 4G8FA 4D0BA 2EGZA 3NEOA 5C0IB 5ICZA 4JFTA 5KVDL 1NDWA 3OIXA 1FFOB 3EO0A 2X70B 4F8PA 1IGMH 3G7TA 5DRCA 1JAKA 1T0MA 1U8QB 3T3ME 4Q4OA 3OLEA 1NCAL 1X5KA 4JJOA 2Y7MA 3S0CA 5B3NA 3SO7A 3LNGA 3QTPA 2O6FA 4LNVA 4B3LA 1HL5A 4JDZB 4BDVB 1A6TA 1A9BA 5FO7B 2TRYA 3S1UA 1OIMA 3UCRA 2Y72A 4ABWA 3SDAD 2F18A 3CXFA 1MH5A 3GMNA 4X4YB 1J8HE 4GIRA 5D37A 1ZLVH 5D2WA 1IWBA 3KZPA 4IS6A 3N43F 2BHYA 2A79A 2QKIC 1GQNA 4O2FB 3LIZA 5D2LB 1T4WA 2PU1A 1XLMA 3JZYA 4F7CB 2PTXA 4W93A 3H2AA 3OLDA 2Y07L 2A9CA 1RZPA 2JJTC 3TBYA 1P43A 3XINA 3A4JA 5T1KB 3CHSA 2ZTBA 1WCQA 2PTDA 5KYUA 4D6EA 4HSCX 5EOQL 3MJ7B 4UM9A 4KZEH 1T2QL 4E41E 4YXHH 4K36A 1MJ7H 4GPVA 1FVDA 4X9FA 2LTQB 4ODSH 2YPLD 1PKNA 4EN3A 2I5YL 3A5VA 2E56A 1XMEB 4D6FA 2Q3OA 2J1YA 1F45A 4P2QD 2AXFA 4HCRH 4NQDE 3VRJB 3AJXA 3WTYA 4MNQD 2TSBA 4OF5A 1J0YA 1HC1A 3G3LA 4BFKA 5JYLA 1CF1A 1U36A 4PJGE 4AL8L 5IQ9B 3RA7H 3LKPB 4KRLB 1T80A 2V2TA 2MQCA 4UNLA 3VFVB 4S23A 4CCZA 4B9CA 3DFYA 1WHOA 2N1TE 2FUTA 4L3CA 1B30A 2D03H 2NY6D 1E9OB 4R96B 1U9KA 4D8ZA 4FXRA 5HBBA 2IS7A 5GNYA 4WIQA 4UTHA 2KDYA 2PWUA 3BOXA 2CAKA 5BOPA 5C70A 1A6AA 2IQ9H 5AB2A 1G4RA 2VC2B 3BDXA 5DEJA 4F0KA 4UQEA 2O9PA 1Z44A 4I3RH 4BGLA 4YHKH 2IALB 3LD8C 2VXNA 3CVHA 4PJBF 3WBAA 3SRHA 3LEPA 2NXIA 4PBEA 2G0KA 5CEZD 2DVXA 3ELFA 3KH4A 25C8H 1WFOA 3FNKA 1MKFA 3ZQ9A 2NYYC 3HA1A 2CKBA 4PRPD 3MKCA 5CIPB 4HK5A 3R19A 3DUUB 3HAEA 2AK1H 4WY0F 4FHBD 2CDFA 1DR9A 4PB9L 2I57A 1JGIA 3A47A 5GZNA 5C07A 3ARYA 5HA7A 5EUOA 4Z3HA 4HD5A 4P5TC 2SEBA 3ESMA 4LW7A 3Q2NA 1XF2B 2CLHA 1RHHA 3DTXA 2PXYC 5CZ0A 3EDJA 1R1CA 3NOYA 4W8AA 4B9KC 4JG0H 4XNUH 1X44A 4WXYA 3S98A 1E6XM 4B5WA 1UOLA 2CO7B 3Q37A 1OAQH 3QUYD 3QWRD 4BA0A 2P24A 4QAMB 3CX5J 3I3EA 1ELSA 1JNEA 3KPOB 1E5AA 3DX9B 3TJ4A 4ZZFA 4UINL 1LWIA 2Z24A 1JGDB 3ZYIA 2R94A 4B4HA 6REQB 1A25A 3UXIA 3CQQA 3R7QA 3HI5H 3TA6A 4Q6IB 1KSRA 4ZMGA 2PO6B 5DUMH 4IX0A 3IMVA 1F41A 3UAJA 3COOA 2FGWL 3MI6A 3TEYA 4L8BB 3FFDA 3IKCA 3QRLA 4ZW7A 5E24E 1OD7A 4TLKA 4NEHB 3V2AR 2YKKA 3LYRA 4GQZA 1ZLEA 3O63A 1YDPB 2B3IA 4GYJA 2YWZA 5A5WA 5T91A 1JGUH 4LBRA 4HEMA 3GKWH 3DHUA 4LRTA 5AECA 1RJPA 2GTZB 3VFRB 3NA8A 1EL3A 2OWWA 2NVAA 1CS6A 4Y4KD 4UI2A 1U8LB 1E0VA 1RLCL 3UOAB 3P84A 4QHNB 4GBXB 5FJRA 4N20A 2Y7EA 2FUQA 2MPAH 4C6BA 4NAMA 3EYFA 2XN9A 3GXIA 4O50A 3VGFA 3BVJA 1JBJA 1WFTA 1Q38A 1RI8A 4HZ1A 4GFSA 1HP4A 3SDAB 4ZFGH 1Z3GH 1W9BM 4JFPA 4G6AD 5DD0L 4AAJA 3T09A 3WTTA 5C71A 3QUXA 1G7HA 2V2WA 4JUSA 4OVUA 2CLVA 2CWRA 2O30A 2Y5TB 4PUKA 4PI0A 4J3OD 1I3UA 3B97A 5K4XA 5AUMA 3WF2A 3EX1A 1EAOA 3AJ7A 4BCZA 1JCTA 4Q4EA 5BV7H 1MF2H 4MHHI 3FXYA 3B1TA 1QSED 3NCWA 3ID7A 1FC1A 3ZM8A 1ZENA 3T0TA 3LNFA 1T7XA 4IDLA 3CFIC 3QY6A 5A16A 1V0LA 4XIMA 1EPFA 4LOUC 2IIJA 3TVAA 5CP3A 1CUOA 1WOAA 4YFDB 2YPLB 1WB0A 5HWMA 2VRJA 4F2UA 2XSBA 3CAKA 1PYFA 3ZUCA 3ICJA 2CGYA 4H8VA 3M5YA 4M62H 4Z1DA 4YDMA 3HE6D 5J9PB 4L3EA 2PNDA 4NKMA 4G7EB 3S3PA 1Z9MA 4QDWA 5F1KC 1A14H 1V02A 1I9EA 4OF6A 1ET5A 1XAKA 1QTYT 4N22A 4S2SB 2BCKB 1A2YB 2V3DA 2VYRE 3MFFA 4K7VA 3N40P 4ZQPA 3GQYA 4LARL 2OS7A 1RPQA 4KJPD 1RZKC 2ZAGA 4YDJB 3QCVL 4HG4K 4R7XA 4XVUD 4HWNA 5GRVK 2ZTKA 3HQNA 1IARB 1CIDA 5E8OA 1GOKA 3OAZH 3PAJA 1LO4L 3WF1A 5D7IE 4QRTB 3G0SA 1UWSA 2JKJA 2VMJA 2E6QA 2EXOA 2YMOA 4I9MA 2KKQA 4AZ8B 2Y4SA 1B9BA 4AGOA 4HLZH 4GRWH 4IHCA 1OD0A 2HJLA 4Z6AT 4LU5H 5CINH 4S3AA 3EAKA 3X17A 5AVUB 1QOQA 2QJJA 3FB7A 3DMMC 2L7JA 3MBEA 2ZNXA 2XIOA 4M80A 3L4ZA 2PLCA 1HAWA 2EVGA 1BZEA 1D9EA 2IBGA 4P2OC 4DP5X 5BWAA 3U7WL 5GJSL 1QTWA 4B9ZA 3CB8A 4WI7A 4NCC2 3KLAB 4OF7A 3CUFA 4FQHB 3VXSD 3FFSA 4Y19E 4PJDF 5KVDH 4DM2A 2VQTA 3L5XL 2O72A 2OXHA 1Q9OB 3QUYB 5MEND 2QUMA 1PWLA 2E67A 3RWDB 3K2UL 1CQKA 3CV1A 2J79A 2BK8A 1RUKL 1KCRH 2HP4A 3I84A 4MLRA 4PHZA 4RNJA 2XFFA 4PMUA 3QW9A 2E7CA 2QVNA 1KPUA 4O8AA 3P40A 2JB6B 4FRWA 5L2JB 3X14B 1CD1A 3BE7A 2GTWB 4LCWD 1Q13A 3UPBA 2Y06H 4CN4A 3M7OA 4FYQA 2EE9A 5G4WA 2QIWA 1I7UA 4ZK8A 1NC2A 3JWNE 4HHGA 1VYRA 2F7FA 1IEXA 3LDBC 5TF1H 5L2KE 3FB8B 3X3FL 3ROOA 2Y07H 2V7NB 1YXDA 2WZAA 1VFTA 5F4SA 1QRKA 2MPVA 1L3WA 2GHWB 4JZNA 1H5YA 1IKFL 2WW8A 4Y4KB 1F74A 1K77A 1BM3H 2Y7FA 2ZG1A 1E1FA 3RY5A 4YHPB 2C9UA 1T2QH 3I02B 3S2NA 4L1BA 5E5MA 3L3HB 3EOEA 4LIQH 3ARQA 3FYYA 3S8HA 4RIRA 5F6IC 1J01A 1A3RL 1I1FB 2EDBA 1KT2A 4KESA 5EZOH 2E7HA 1PF3A 1PTZA 2WUBL 5IVNA 3KRBA 2WAGA 2JALA 3H12A 3WJSA 1WFJA 2XQYA 4XP9L 1UC4A 1T20A 1CB7B 5HYJA 2ZP0T 2Y89A 2XWZA 3V5DB 1MCOL 1TJ1A 1KENL 1UT9A 4N1CA 3FCPA 3T0AA 4H13C 1QSEB 5HGDA 2YBVA 3WLRA 4NRYA 3DPBA 2OK0H 2LHAA 5JPMA 5J5DA 5I17B 1F90L 2UX6A 4WY7L 4JCWA 4EP8C 2R1WB 4DCQA 5IW6B 4GQGA 4ERAA 2CH8A 4LYPA 4UDTB 3ZPDA 1C8XA 3THML 5FA5A 3DZ1A 2WMIB 3AS1A 3KL0A 1IM3A 5I28A 3HG5A 4G3YL 3SQBA 2EICA 1UQSB 3CVCA 3OD3A 2EDFA 3I7QA 2ABAA 2VDKH 2HE8A 5E93A 1C08A 1BV8A 2JK5B 5JQ6H 4LSSL 1YBQB 3W5NA 1AO7A 5BU9A 5KVGL 4ZSOA 5MKGA 4RDQG 4LUIA 3L3GB 4LASL 5CP3H 3HG3A 3HNTL 3PZVA 4Z7NE 3FCTB 4YNYA 3FO0L 3OJ2C 2FDBP 4UFLA 3RI5F 5D1XC 3NSJA 4UU9B 2WO5A 4XZHA 4YC2C 2XLLA 4NZJA 4O2CB 4U7MA 1UKSA 4IDJH 5C0RL 2APBA 4G6MH 4JM4L 3PWPA 3F7YA 3OSKA 4R8WL 3ENLA 1OF8A 5BMFL 2YO3A 1KBWA 3HJZA 3WFBL 5I15L 1Z6KA 3KMDA 1VP5A 1EZUA 1XCXA 5L4JA 1TQSA 4NQCB 3IEAA 4FTVA 2J6XA 4L4TD 3APNA 1G4SA 3KPPB 2DQGL 5BRBA 4IKIA 3AU1A 2D2GA 1XLBA 5D9OA 3BFOA 4ZQRA 1ICQA 1NAKH 5JH2A 1M7IA 1AY1H 2DQFA 2XFGB 1RZMA 1MIMH 4JY6A 2GGJA 4FQ1H 3NQAA 4KDTC 5EFIA 4EI5C 4JRFA 4NUGH 1N4XL 2OFJA 3VFLA 1TRIA 2P8LA 1NAMB 3KHOA 2GFTA 3CFKB 5HQMA 4POUB 3V4UH 4C4KO 1O6IA 4O4VA 5AHLA 3VXSB 3VFTA 2H1LM 3CMFA 1TVHB 1SRDA 4LCYB 3UJEA 3WQDA 1V79A 5MENB 3SODB 1NIDA 1DBTA 3F5JA 1G5AA 1OY3B 5D7LE 2INEA 3QXAB 5HHNA 1SHMA 5HMDA 1OALA 3OXRB 4OFQA 1N7KA 4AKQA 4B91A 4PFMA 2XRAH 2R4RL 4GQ9H 4HCGA 4YL4A 4GRWF 3GK8H 2BP0A 1PG7X 4MMYB 4RFOL 2YCKX 4LCWB 3QFJE 2X7VA 5DD0H 4LVHC 4FI6A 1W9UA 3W01A 3E5PA 7CGTA 3FHEA 1KFBA 3LQLA 1F6FB 2V30A 2VDQB 1QHQA 2IG2L 5T1MA 3P81A 5I71C 4FFYH 1ADOA 3EGJA 3QQWA 2Z2UA 4QFUA 3R94A 2BM3A 4RFEA 4HS8H 2NW3A 3U9WA 4HA3A 4IP4A 2PTUA 4H1ZA 2BASA 1T1ZA 4I5RA 1T04A 4Y5XC 4D6GA 2BS8A 2LVEA 3CZUB 2XWEA 4HFWB 1RZ8A 4F33A 4FR6A 3FTUA 3CIWA 3P73B 3VD5A 4RMTA 3HGOA 4TVSa 4XZMX 4ACPA 1Y5VA 4JANA 4QNEA 2ZRYA 3AY2A 5T1LB 3DVGB 4O1CA 3GR7A 2BSRA 4PS3A 3QQDB 2F53E 2RQEA 3CXHK 5DC0A 2ZP8A 3PP4H 4Z0XA 1G4PA 1QO5A 2E9MA 1JZ6A 4D0CB 5DHXB 4JEJA 3PZUA 3QIBD 3WUFA 3O2VL 3KD4A 4ELMA 1XHHA 3IDUA 1TA3A 4MKTA 4E9LA 4L4VB 3PUGA 3DI1A 2QNEA 3BVVA 3KPRB 1EGMA 3TBVB 3RPBA 1TG7A 1TVDA 4YSOA 1FZKB 3B9EA 4PJIB 3MMUA 3HLAB 1XCTA 4QO1B 2FBOJ 4MDIB 1XYLA 1GKEA 4ANWA 5AD0A 3LNIA 4HWUA 1L9SA 1MREH 2X6AA 3G04A 2X4RB 3L4CA 1YPZA 5HD8D 2ZE0A 1A22B 4BK5C 3XISA 1U3HD 2WC7A 3GJFH 2R8SH 4QNWA 1GXEA 5GGVL 3KBVA 4I0PA 4M7ZB 2JF1A 5AALA 5JZ7D 3ZLHA 1TKKA 4ZFZA 4YTSA 3H23A 4XH2B 3BUVA 2ZUQB 4XZ9A 3QEQE 5LGJB 1HHJB 4Y5VC 3WU1A 3ZRFC 1ZVSA 4PWHA 2E47A 3ZE1E 4P5RA 1XGEA 3FRUA 3OKLB 1P84J 5ADPH 2C1OB 4JOMA 1QNIA 3I6LE 1NKRA 2ZZ2A 1KW1A 3C75A 2IXVA 2GJPA 2PFHA 4CQBA 3ULVD 4OUUB 2JQAA 1XLAA 4WKZB 5E4AA 1YNPA 4F9PC 3EDFA 2G5BB 2HXUA 4B5EA 1X5GA 2AZUA 3C60B 3BKCH 3V9EA 4G8IA 4L4TB 4MCYB 1BQSA 1RUKH 3O0RH 1ZA6B 3SDCA 3KYMB 1RVKA 4QQ3A 4D9QD 4XVSL 3F5WA 2YW4A 2G95A 5J1AB 1H3GA 3ULUL 2FO1A 3VDAA 4MJ4A 5GRWA 3IM1A 1MI5D 3MJ8A 4MBRA 1EHLL 3UZEA 4YAQA 5B1CA 5I1GL 3WZ0E 1FIEA 1RVFL 3RXZA 3HS0C 1UZ1A 3OG3A 1OCRB 3HE7C 2ACRA 4N0CC 2WK2A 4O19A 2XIBA 4LFYA 1A4MA 2G0WA 3VDHA 4XAFA 3EOYG 1HH9A 1JPKA 4HT3A 4OCXH 5MEQB 2FHFA 5CJNA 1H62A 3AAZA 1W31A 3UJFA 1LL1A 3QORA 3WBEA 2OTDA 2G2RB 1AGDA 4Z1AA 1AJ2A 2IMRA 2XY1A 3SDYL 4F1ZA 3WO8A 4CN6A 2B3RA 1XF3A 3W6YA 1H5BB 3A4XA 3MUGA 4JY4A 4WX2A 4CBZA 4O0QA 1OCWH 4DZ8B 2NWSA 3PCYA 5MEPB 3AMDA 1UM5H 4O1DA 3P8IA 4I88A 5DHEA 1US0A 3O3DA 4HP5A 4MHHG 3QJVB 2XDHA 1GW1A 1JCMP 3I9AA 2R6OA 4IQHA 5D5MF 1C9SA 1FWHC 4GPNA 2NY1C 3MV11 4RE4A 3BAJA 4JZJA 2XZAH 3SB0A 1A3RH 4PJEB 4PAZA 2WLYA 4PW3A 3LV3A 3HW7A 3RUGF 2I60L 3MA7B 4OIFA 3UTPD 3E7JA 5F1VA 3WYRA 4HHLA 4XP9H 1UR8A 4QYAA 5EEUA 5LKNA 4URKA 1A9EA 4JEQA 1F18A 4GOSA 3TO4C 4PLOB 4OQVA 1MCOH 3IJ8A 2J9ZA 4NT0A 2XVKA 3P3YA 5CZKA 4JTUA 4RGNE 1Q63A 4CVZB 5E03A 4DVRH 4Z78A 3ET9F 5FECB 1J8VA 4LNCA 5IQMA 4OZIF 1TPVA 1JPFB 4OOZA 4QM1A 1DBBH 4AQAB 4UTFA 4LSVL 4BQ9A 2JFEX 2ENQA 2VFDA 4U10A 4QRRB 2BZDA 3SE9H 4DP6X 3ITXA 4G3YH 4LMQI 4H8QA 3A67L 4MWAA 4WFED 2YD9A 4FFTA 2A9NH 5GIRB 4Z7VE 4LSSH 4DZBB 1OB1A 4HOZA 4ZW3A 2PRMA 3AU0A 2I17A 4LZKA 5IB5A 5E0CA 5F7DB 4OCRL 3Q1EA 3JTTA 4LASH 3QIBB 1CB4A 2DN7A 3KRSA 4LLWA 2OO6A 4PJXE 1EO8L 2VXSL 4U6VH 4M6AA 2CWNA 1FFPA 3ZWSA 4I89A 3QPXL 1HINL 1HL8A 4WK2B 2YHGA 1A5CA 2I32A 5D1ZC 1D8WA 3LN4A 1NAL1 3LCXA 3L4UA 3A5FA 5C0RH 4Z3TA 4ZXOA 3BLBA 4IIDA 2BTMA 3UZQB 1TREA 3O9WD 2X4OA 1ZB5A 5C0NC 1U8KA 3SPGA 3LMZA 2AABL 1ODUA 5U4NA 1MDAA 5LAXA 1BQ5A 2ZWKA 2HN7B 3N14A 1GY1A 3Q6GL 1IFGA 3NJJA 1CXHA 2FT8A 1BVWA 3OQRA 3HURA 1WA2X 2JCWA 4M7KL 4M1GL 5E1AA 1T21B 2CNYA 3AMKA 3A4FA 5MEOB 3HM7A 3ARZA 4LUTB 4N8PA 4YDIL 5ISZD 2QVIA 1FG2A 4FI4A 5D96B 3V0EA 3OR7A 2JIEA 1XZ0B 3W84A 4JFEA 2IPKB 4A05A 1CG9B 3HC3L 1LYQA 5LXGH 3VC5A 5KAQF 1U91B 4LCCC 1QBAA 3UXLA 4NAFA 3HCVA 4C7DA 4I3SL 5I77A 4WW1A 3L7FB 2O5NA 4KK6C 3D69A 3S5YA 4WAFA 2Z91A 3CUPA 3MSRA 2X2YA 2C7UB 5IHHA 2R2CA 3NQVA 1EK3A 3RU8H 3FYOA 1NCCH 3KOFA 3SD2A 3SIKA 3OG6B 4EVNA 3QDMD 4W89A 4KKNA 5C1MB 5EMJA 1XBYA 2PWHA 1EGVA 5AHEA 3VI3B 3W76A 4XHQA 3NXFA 5DEFA 4J23A 3WTXA 5B39B 4LB3A 2R7EB 4U1GB 4MDOA 2IW0A 2DJSA 1F00I 4R3SB 3VQ2C 1OEPA 3NWRA 3GSXB 3K0YA 1WJ3A 5I1LA 5TH2B 5CJOL 4GXWA 1FDJA 1E3XA 3C5ZA 1O0VA 1OGAD 3OKDA 1TE1A 2FSDA 5FYJE 1VFMA 3TAOA 1NBZB 4I9JA 3VXMD 2QELA 3P67A 1PAMA 5EF3A 3PPCA 3P54A 4K3HA 3RNKA 4R26H 4M82A 4NYLB 3TNOA 4A68A 1RK1A 3LZPA 3JWDH 3WUEA 4AGNA 4WU7A 2EDTA 5I82A 1JUFB 4MD4B 1FGVH 5E99L 3OBKA 4NQSB 4WCJA 3AAMA 3LGGA 5DZJA 1QBMH 2AV1B 6CGTA 1J88A 4G2AA 5J6GB 1VRXA 3SY0A 4JKPL 1KPRB 2PDYA 4Z7OB 5DXWA 4GG9A 4IBSA 1QO3B 3FFCB 3Q45A 3LSCA 2E5CA 3GS6A 2GITB 3GSQA 4C4KT 5IFPA 4C6FA 4MMXA 4PGDA 4HQVA 1UHVA 3PG2A 2CGRL 5I09A 1XF0A 1WA3A 1F3JB 1S9VA 1O60A 4LBUA 4XP5L 2GJXA 1YYCA 2DKMA 2GVYA 1MELA 3CXOA 4R5TA 4LGRB 3GG1A 3S0PA 3GBMH 5CG7A 3CIVA 2PTYA 3AABA 3DURA 1TUXA 5GGVH 4HAKA 3Q05A 1EV2E 1Z9SA 4GAYB 3RBSA 4B5NA 4OWGA 4OBTA 1F6PA 4IX2A 3ABMB 1WFMA 3WFEH 4H26A 3QUZA 3TN0D 3BEWA 1JPTH 3C9NB 3TW6A 4IGBD 1ADQL 1KCUL 5BXPA 4PLJD 3APGA 1N10A 4LHUA 1Q6RA 3QZWB 1TJHH 4MG4A 3P4LA 7PAZA 2XGBA 1XLGA 2AS5M 4WO4B 4RZ4A 2VDNH 4MXQC 5LG6A 4TU1A 3O9WB 1FNHA 1QLRA 3HFML 1KJMB 2QXWA 4H6RA 3AYVA 3OGCA 1W6LA 5TBOA 4MXWH 2HTKC 3GT6A 5I1DB 5IEHA 4UT6H 3Q5TA 4JRXB 4XVSH 1UM4H 1I7RB 4HK0B 5KTEH 1NGXB 1KJVA 2WC4A 1EHLH 1JZ7A 3SPVA 2VXUH 3X13B 3FSZA 1EHNA 1U58A 4MCNA 1W0MA 2WQWA 8FABB 5JQHC 3BGMB 1GOMA 2YL9A 1S3KL 3V0WH 1D5IH 5KW9H 4UR9A 2PYFB 1PLGL 1OHLA 3WDPP 2J6WA 3KYOB 1CK0H 1AI1H 2UY6A 2QSQA 2X5PA 4NI3A 4G7SB 2PSNA 2ISFA 2PPAA 2WNZA 4U1HA 4JNYA 3S5LA 4ZGYA 3D3VA 3IJHA 5ISZB 3LNDA 1EAPA 1ACZA 3NR0A 3RX3A 5E5UB 1NWOA 1U8CB 2G5UA 2JLPA 5SWZA 1FC2D 2WYSA 4XX6A 3ZWTA 5HWNA 2BVOB 4NNPL 1OYAA 2ZJSL 2H6UA 3ABRA 4LRSA 1TJIL 4UTMA 3NCYS 5BZDA 1K8IA 2IDQA 3QGKC 1BEYL 5F3HB 1IAMA 2N01B 2BOBA 5KYYB 3KVQA 2JJSA 2EE6A 2ZOOA 4B7LA 3WS6A 2V37A 3STGA 2NUPB 5C0CA 3RO8A 3QDMB 1AG0A 3JWNC 3MNVA 3BVXA 1QQDB 4PJCB 1UW9A 3WD0A 1ZTXE 3MRBB 2Z00A 5D32A 4NO2B 4U1IB 5TK4A 3MUXA 2DBJA 2I9EA 4QSFA 3N29A 4BH7B 4UXDA 1LP6A 4JM2C 4OZGA 3K8LA 3CUJA 3RVVC 5F9DC 3STPA 1ZGLB 4D8OA 5A8NA 2UX7A 2WJ7A 2BFGA 5EUKA 1HZHL 5TE6L 2CWXA 2WLHA 3VXMB 4YDVB 2WIIA 4N90E 3G6AB 4XE5B 1VHPA 3LVEA 4P8WA 3L95A 1C1EL 2VW6A 3CSBA 3UIYA 3SQMA 4HALA 3KYAA 1DWFM 5F7FA 2A77L 2H8XA 3WDQA 1HE7A 2ESVB 1F58L 3NN8A 5GISL 1I7TB 4S2BA 4IIZA 5HMFA 3A67H 1L6SA 1DQJB 5GRXG 3QIUA 2XBDA 3MCOA 1XRSA 5E6IC 4Z95L 3QULB 1ADQA 2XSKA 1IGJB 1QXLA 3ZHLA 5BOEA 3ONCA 4PP2B 3QH3B 1NQBA 3QJAA 2VXSH 5IROC 4K94C 1U5VA 1CXEA 1KYFA 1KNOB 2F8IA 3WSQH 1CVSC 5C3IA 1BAGA 3C6SB 3QI9A 2ISSA 5HQLA 3PHOA 3H21A 4F2MA 1FI8C 3CHDA 3FQRA 4Q8UA 4Q8NA 2QVTA 2EEBA 1OIOA 3QRBA 5IHUL 3X1GA 5CCHE 2PCFB 2PCPA 43CAB 2P26A 3TU6A 5DJCA 3GB6A 1GZQB 3ZJ8A 5JW5B 4AVNA 1D6EB 3OMIB 3KLQA 3C8KB 5E08L 1OAYL 2HKFH 3B7SA 1UOZA 1X7SA 4YBQD 1OT1A 3MJYA 3WK0A 3RHGA 3U5UA 1UR1A 4HBCH 1WF5A 1GPOH 3MRQA 1CQYA 1PJ9A 3CUIA 3TAKA 3TN0B 2XHYA 2CLKA 4BIKA 2IH3A 3TYGL 2Y6ZA 2X16A 5KSBA 4IGBB 4Q8OA 3GNOA 2HT2C 2W80C 2Z8SA 3F2BA 4OZOA 4HZ8A 3GSNL 4LLAA 4RXGA 2OZ4L 1POJA 4R84A 2J13A 4TX9A 4XAGA 3HC3H 4HWBL 3RG1C 3MYJA 5KMYA 5GGTL 4KI5E 3BQVA 3S6OA 4I3SH 4P7OA 4ZO6A 4DYJA 5HUOA 4YVUA 4KJWD 4LSBA 5D1QA 4U5IA 1GH7A 1PHWA 5FFOA 4QF1A 2R56L 2YPVL 2EO7A 3SPJA 5KVFH 2YRLA 5T33H 3GSOB 2H0PA 3AITA 2BVQB 4E8GA 1XIHA 4NQED 3DDFA 4U6YB 5K1JA 4KWUA 1TZGH 1V8HA 4XPTL 4BFIA 1R86A 3TV8A 5C08D 4DUXA 5EIVA 2C71A 3IRZA 3NK3A 4J4PD 5HY9B 1J5SA 1KBKA 4YPGA 4B3EA 4N68A 3MNWB 2XV3A 3JTBA 1RHFA 4FNLL 1P4LA 1D9KD 3HR6A 4MRCA 5IB3B 1A64A 2X1WL 5MERA 5EBMA 1RCXB 3F2LA 1N8ZB 1INDL 2WCGA 1ERNA 4NJAH 3C0LA 3TZVD 4R7WA 1EBGA 1I85A 1DEEB 5HDBE 1KIUB 4ZNCD 1R3SA 5C0BE 2ON3A 3FT4A 3EGDB 3GNDA 4Z42C 1GGYA 3CZNA 3RZCC 5CGTA 5E99H 4F27A 2GGGA 3QFEA 4HUUB 1LRQA 1JPSH 2ZUSA 2EUXA 3APFA 3IJEB 2YQBA 2FVMA 5ECGA 3WDIA 1IAKB 4L37B 3ZDZF 3UZZA 3MRHA 4X83A 3A4WA 2J5LC 2Z35B 3BWUC 3J7HA 4Z7WE 4PSRA 3QV6A 1FORH 4RZCA 1MUJB 3W70A 2P43B 4M6QA 4P9MH 3ECQA 3QHOA 3GYCA 3BW9B 4AISA 3MJ9H 3V0VB 1NM4A 5DHVB 3W29A 3I74A 4MAYA 1RP8A 1AQKL 1A6WL 4NQXA 3U2CA 3O3UN 2ARWA 4KK9D 4E5XA 4XISA 3ARBC 1R9FA 1XR2A 2BXVA 3EBVA 3W0WE 4ZPVA 1W1TA 1LORA 4UBDD 1BQCA 4JDVB 3K74B 4LDLB 3WEXB 1KGCD 1B4TA 3ARDC 5EC1B 3P0VL 5EIIA 4F3FB 3IJLA 4Q9RL 2VO8A 5IHZA 4PY8J 3NCJH 3A12A 1K03A 3ZL2A 1UVQB 3B8DA 2E4TA 2Y25A 3R79A 5INDA 4IOTA 5KBLA 3GSNA 4MYAA 1PCSA 4QRFA 5E9AA 3PBWA 3RNDA 2OZ4A 4GKTA 3JWOC 3LEVH 4HWBA 1QI2A 5GGTA 2DDQH 1T5WA 2C8NA 1AXTH 3N1FC 3VD9A 4J1UA 4AQEA 2YLKA 3PPEA 1VFLA 3AWFA 4G7VH 4HU8A 1P7HL 1UD5A 1EJUC 1VBGA 2PDLA 2JCCB 3K6IA 2C0AA 1Z8AA 1YG9A 1NEPA 1LEIA 2OMXA 2YPVA 4JY5H 3EUUA 4NHCL 5BO0D 3P82A 4E42A 1CYGA 4X5WB 3AXKA 1V3LA 4KFNA 4Q56A 1JHLL 5DRNB 3BGJA 3PSVA 4AC4A 1XG4A 1QSFD 2ICEC 3C0SA 3FQ2A