3QGVA

Crystal structure of a thermostable amylase variant
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
435
structure length
435
Chain Sequence
AKYSELEKGGVIMQAFYWDVPSGGIWWDTIRQKIPEWYDAGISAIWIPPASKGMGGAYSMGYDPYDFFDLGEYDQKGTVETRFGSKQELVNMINTAHAYGMKVIADIVINHRAGGDLEWNPFVNDYTWTDFSKVASGKYTANYLDFHPNELHAGDSGTFGGYPDICHDKSWDQYWLWASQESYAAYLRSIGIDAWRFDYVKGYAPWVVKDWLNWWGGWAVGEYWDTNVDAVLNWAYSSGAKVFDFALYYKMDEAFDNKNIPALVSALQNGQTVVSRDPFKAVTFVANHDTDIIWNKYPAYAFILTYEGQPTIFYRDYEEWLNKDKLKNLIWIHENLAGGSTDIVYYDNDELIFVRNGYGDKPGLITYINLGSSKAGRWVYVPKFAGACIHEYTGNLGGWVDKYVYSSGWVYLEAPAYDPANGQYGYSVWSYCGVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha amylase
publication title Structure of a highly mutated, thermostable \xCE\xB1-amylase variant
rcsb
molecule tags Hydrolase
total genus 154
structure length 435
sequence length 435
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2011-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3qgvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3qgvA01
2VZUA 4F9DA 4NXKA 1W3KA 1C7TA 1JZ7A 2Y8KA 1HVQA 1GJUA 4FLOA 5KEZA 1DEDA 1D2KA 3SUVA 4X9YA 3F5LA 3N13A 3UEQA 2BFGA 4NXSA 1UD8A 3VGGA 3CLWA 1JFHA 3BVWA 2F18A 4GI6A 3SURA 3M6DA 1E1FA 4AD0A 2ALWA 4J3WA 1U33A 1Q6DA 4ACZA 1D7FA 3OGSA 3AI0A 2O9TA 2V38A 5A3HA 1E3ZA 1UWQA 4QDMA 1H41A 2XGBA 3NSMA 5JBFA 5JUVA 4ZFMA 1PIFA 5EB8A 1JFXA 4M1RA 2PWGA 3S5ZA 4NZCA 4JFUA 1G5AA 2CBUA 3AYRA 3GXDA 3AIBA 3LX9A 3QR3A 1TVPA 5I3DA 3A6OA 4Y7EA 1V3IA 2FGLA 2QMKA 3WELA 5BXRA 1XH0A 4PMXA 4FNSA 4AEEA 1G1YA 2X2YA 5A1AA 3HG5A 1CGTA 2VRJA 3GXIA 4PMQA 1M03A 1TA3B 2XSAA 1MFVA 3IAQA 5C8BB 2YKKA 2MANA 5CGTA 2VX5A 4ZE4A 1J0JA 4J3SA 3DHUA 1X1NA 2VC9A 1O6IA 1E6PA 4TOQA 2Y24A 4ZEPA 2W62A 3TV8A 5D9PA 4MB5A 2E9LA 3WNKA 3MUY1 2WKLA 1BYBA 4PRWA 3BAYA 1CNVA 1CXEA 3OLGA 1JNEA 1J0YA 2W4XA 2BXYA 3FHQA 3AHVA 1XSJA 4EK7A 4HZ8A 1SMDA 3UG5A 4KMQA 3NYDA 1GQKA 4U5IA 1UD6A 3D3AA 1JI2A 4AZHA 2X1IA 5CLTA 1LL6A 2F1AA 3VPLA 2PBGA 2WZIA 3BMVA 3D51A 1U2YA 4OOZA 4H8HA 3T0BA 4D6HA 4D6JA 3WF3A 3WUBA 2B31A 3PZNA 4KRTA 2J62A 1BLIA 3PZ9A 4S3KA 2WCGA 4UQEA 4WLCA 4Q7NA 3GYCA 2VQTA 1AQ0A 2F61A 4F66A 5EFFA 1B3VA 3CHFA 3HJEA 4FLRA 5ABFB 5HXMA 4UFMA 3RM8A 2YL9A 3N17A 4XX6A 2NW0A 3RM9A 1UD2A 3J7HA 3IAPA 1UH3A 3OIHA 1R46A 1V6UA 2GDUA 3CZGA 3BVXA 3AMKA 3OB8A 3L4WA 1G01A 3EMCA 2BHUA 3ZR5A 3L4UA 4TTUA 1KWKA 3ARSA 4HA4A 1SR0A 1HXJA 1NOWA 3EJPA 1BYCA 1BYAA 1E5NA 4LX4A 4N42A 2F7OA 3MO4A 3AMCA 1UKOA 3EJTA 1LWHA 4YHGA 4P8UA 2F2HA 1UR0A 1V0KA 5DO8A 4B3LA 3WQ6A 1WZAA 3GM8A 4UQBA 3IK2A 1MW3A 4J3VA 1DWAM 1W9PA 3WDPP 4FK9A 4HU8A 4DWSD 4DM1A 3W37A 1CENA 4M56A 1V3KA 3WMCA 2ZX6A 3BUDA 1W9DM 4LYRA 4D71A 3WNNA 1MW2A 1JYXA 1TQSA 1QI5A 3RIKA 4P7NA 5CPTA 1TVNA 1KWGA 4GZIA 4JCMA 1GPFA 3SUWA 4QLLA 5A6SA 2X2IA 3A4AA 2VX4A 3H53A 1MQQA 1KGWA 3VMPA 1FH7A 1W9UA 4URIA 3BUIA 4AD4A 3T2PA 3EMQA 1BVZA 3HG4A 2DSVA 1KTBA 2X2JA 5I6SA 2VVNA 3VDAA 5IXEA 1R86A 2XWDA 1MXGA 1XD0A 2VURA 2X0YA 4UZUA 4AMCA 5CXPA 2J7DA 1TQTA 5I5RA 1WDQA 3TTYA 1NOUA 2XVLA 1FH8A 1W1PA 1UWUA 5LA2A 3VX0A 4XUYA 5IHRA 1UWIA 2EO7A 1EOKA 3AMLA 1OT1A 1CYGA 3VD3A 5EMYA 2ZOXA 4RE4A 3AZSA 1JZ8A 2WVVA 4CVUA 4W88A 3WH6A 1V6VA 4HP5A 1LL7A 1QNQA 3WFZA 1UWRA 3CHCA 2DSWA 2WHKA 2D0FA 7CGTA 3ARQA 1GCYA 3CUFA 1J11A 3ZJKA 4V28A 3QHOA 3SCWA 5CG0A 1A3HA 5F7UA 2D0GA 3ARPA 8A3HA 4TTGA 2C0HA 4EAMA 3D4ZA 2CBVA 3PBGA 5EBAA 1V0LA 2VT0A 1LG2A 1BAGA 2YLAA 1Q6EA 1UWSA 3S5YA 4UFKA 1BGAA 4JFSA 2XVGA 2ZXQA 4D1JA 3LXBA 4M81A 4HTYA 5ECUA 4MNKA 2WLYA 2V5CA 1XYZA 3D5HA 4D6IA 4MAVA 3WENA 4EKJA 4UQDA 3GNPA 4B9ZA 1WPCA 1Q6CA 1JXJA 1AQMA 4FNTA 4UQ9A 1K6AA 3CUGA 4JCLA 2DH3A 1OINA 2VO5A 3HU7A 4YHEA 3U7BA 2YLLA 4PSPA 1CXLA 4HA1A 3ALGA 4CGTA 4PCTA 1QW9A 5D9MA 1NWUA 4U2ZA 1CBGA 1WCGA 1X6LA 1K9FA 3O9NA 3GXFA 3WNPA 1V08A 2VJXA 1E70M 2WC4A 3WQVA 3WSUA 1UD4A 5BRPA 3PZQA 5LA0A 5CPSA 5IFTA 1OM0A 3WBAA 1M7XA 3PN8A 2WMIB 2WHMA 4W7UA 2W92A 1RPKA 5KZ6A 5A6BA 1L0PA 1W3LA 1N82A 1KXQA 3PZVA 3L4VA 3WF4A 4BA0A 1J01A 3U5YA 4PUDA 2WKGA 1MXDA 4U2YA 4DUXA 5A6JA 1UH2A 1WAWA 1UASA 4P7RA 1UZ4A 4JIEA 1VBRA 1B90A 1CGXA 1O7DC 4MPKA 1TQUA 4TX6A 1IT0A 4OKDA 5M3WA 1Z32X 1EO7A 1JZ6A 1FA2A 3ZT7A 1CZ1A 4CD7A 3GNRA 1CIUA 1R75A 2Q8XA 1GQIA 1JF6A 1JZ4A 1KQZA 1KXHA 1HIZA 3BAKA 3HMCA 2VCAA 2XWEA 3B8SA 3SUSA 4JFWA 1JYNA 4P8XA 2A3CA 1VFFA 4W93A 1Q6FA 3E1F1 2WHLA 3MS8A 3W4RA 2CERA 1PZ2A 4Z2LA 4B3KA 3TTQA 2WWCA 2WMGA 5IDIA 3VINA 5A2BA 1V3MA 4HPHA 2W66A 2D24A 3KLKA 4GXPA 4WKFA 1JF5A 2CYGA 3M07A 4MNMA 1WDRA 2WMFA 2HVMA 5FD0A 1M53A 1OGBA 2EPMX 3RPMA 2JF6A 2WPGA 3VD4A 1J0HA 4QFUA 3VSUA 2EADA 1H09A 2D0HA 1ZJBA 1VEOA 1HJWA 3LXAA 1B31A 1XH1A 3W82A 3AYSA 5IHSA 3ARWA 1HNYA 3L4TA 2ZWZA 3B9DA 2XN1A 2EQDA 3CPUA 2ZE0A 3EDFA 3DECA 1E4IA 2ZIDA 4C7DA 5A6AA 4P7QA 1EH9A 4WSJA 3VIPA 1AMYA 4YPJA 1TE1A 5D9NA 1GOMA 1E4LA 1TUXA 1KFWA 4L4OA 2DEPA 4OBSA 3WNLA 1OGSA 3GTNA 1ISVA 3VVGA 5A94A 3AS3A 4HOWA 4AZBA 1E72M 1C8XA 1V0MA 4AISA 1J0IA 2UWFA 5A6LA 1EHAA 1C93A 3L4XA 2NT1A 2CBIA 3W28A 2CETA 3IGUA 4OBRA 3OBAA 1E6SM 2EPNA 2PWEA 2EEXA 4PTMA 4BCEA 2PWFA 4AW7A 5DT7A 1VRXA 3ZJ8A 5I2UA 4UZSA 2NSXA 5BXTA 1MFUA 2WZEA 3KLLA 2VCBA 2OW7A 4MB4A 2J25A 5I78A 5GNYA 3WN6A 2JALA 3MSGA 2WWDA 1W3JA 1H4PA 2BXZA 1ZBKA 3AMDA 1ZBWA 1ODZA 1E3XA 3AS1A 3VD9A 3WL0A 5DF0A 3OGRA 3LMYA 1UH4A 1TZ7A 2D2OA 1I75A 2WMIA 3UERA 1CXHA 2XUCA 3POCA 2GUYA 4PMVA 1VAHA 3THCA 2XIBA 3WD3A 4CU6A 2G3IA 2O9RA 3B9AA 5HPOA 2J7GA 3RCNA 4PMDA 1KB3A 3KWXA 1MQRA 4QLKA 1UKTA 2WM0A 2QMJA 5JIPA 4TVDA 3LRMA 3MUIA 3N04A 4PEEA 3GBEA 1JNDA 3IANA 1OIMA 1PX8A 1W2PA 1E40A 4AIOA 3KL0A 2VX6A 4W84A 2V3GA 4EE9A 2ESCA 2HISA 2EJ1A 4BF7A 3CV5A 3ARXA 2YFNA 9CGTA 4PTXA 3D52A 2WLZA 1ISZA 1OWQA 2CEQA 3WH7A 1QI3A 3CC1A 3EJRA 4D1IA 1CEOA 1WZMA 1EQCA 1ISXA 5E0CA 3AOFA 3EDJA 2WMHA 1UZ1A 1DWJM 1DP0A 3W6MA 3QGVA 4J7RA 1NWSA 2W91A 3VUPA 4AD5A 2RGMA 3SCRA 1LWJA 4KWUA 3UG3A 3QHMA 4L4PA 4CD6A 3F5JA 4PSRA 5D9OA 1QI4A 4FNRA 5A6KA 4AEFA 1V02A 3VTRA 2WVSA 1HT6A 3VDBA 4B9YA 3GXTA 2EACA 1LG1A 1ZU8A 3POHA 3AICA 5LYRA 2W67A 4P7OA 6A3HA 2Z1SA 2YBUA 1BHGA 4H04A 2J7FA 4Z2IA 2JEPA 1G94A 4MJ2A 1OIFA 4FF5A 4LYPA 3O6AA 1LJYA 3AXHA 3TA9A 2YOCA 2EABA 2IXUA 3WF0A 5CLWA 4HZ6A 1CGYA 3QHNA 1AVAA 1R47A 4AZGA 2VZVA 4HZ7A 2YA1A 4CN4A 4W5ZA 3OLIA 1XCXA 2GVYA 3EJQA 1UHVA 2OYKA 1FH9A 3BAWA 4W5UA 1VB9A 3W26A 1C8QA 1Y7VA 3PZMA 4TUFA 2GK1B 1JGIA 4OJYA 4H8VA 3AISA 3MV01 1XSKA 3A24A 3OA5A 6CGTA 5D8ZA 1HL9A 2J75A 1B1YA 1CXFA 2D3NA 2WVTA 3L2LA 1V6YA 1CGVA 2XYLA 1XHGA 3KL5A 5A2AA 2DQXA 2JIWA 3CBWA 4ATLA 2GJRA 3RDKA 1ITXA 1FFQA 3PTMA 3DX2A 1R8LA 5I24A 5CPQA 4H2CA 3VDCA 2XHYA 5JBDA 1QI0A 2GFTA 3W25A 4AYGA 1XD1A 1CXIA 1V3LA 3ARVA 1HXKA 1VF8A 3WF1A 2WCAA 1C91A 3DX0A 1XCWA 2OYLA 4KRUA 4UOQA 2VX7A 1T0OA 1R34A 3FHAA 2BHYA 4QLJA 2X05A 4M82A 5M17A 3NSXA 2UY2A 2BVYA 4GINA 3IJ9A 2QF8A 3HG2A 4K68A 4WKHA 2CKSA 4AZ5A 3T0AA 3TOPA 1PS3A 2XPKA 1HF6A 1NP2A 3EDKA 3EDEA 3AXIA 1BPLB 2VUYA 3WQ5A 2WAGA 2V5DA 5D4YA 3AIQA 1KXTA 1H2JA 1QVBA 2BY2A 1EA9C 1AQHA 2Y4SA 3SUTA 2ZUWA 4Z2KA 4AD1A 1EDGA 3DC0A 4F79A 4LXFA 1EOMA 2DDXA 1K9TA 1BF2A 3A23A 1UOKA 1GOQA 3BCFA 1HP4A 4HPGA 1QHPA 3A21A 3O2LA 4JFVA 5FL0A 1B3ZA 3WDJA 4CUCA 4CCDA 4HOXA 4GQQA 2XFFA 2D1ZA 1UA3A 4FMVA 1H0GA 4UQCA 2DH2A 3W53A 2JF7A 3OZPA 4XZWA 1VBUA 1WNOA 2J8FA 3NJ3A 2G4FA 3CZJA 4NF7A 3T2QA 3WH8A 3M46A 3CUJA 1GNXA 1MQPA 1OD0A 1TA3A 1CTNA 2CKRA 4U3CA 2C7FA 1BG9A 2G3NA 1UR9A 1GHRA 3BLBA 2E8YA 3CZEA 3N18A 3F5KA 4AC1X 2YA0A 5E6YA 4GI9A 3WL1A 1C90A 3CUHA 5A2CA 2A3BA 2UY4A 3SCUA 3VX1A 4W7WA 2ZUTA 3AIRA 3LPOA 3U7VA 3MKKA 2WZHA 3VD7A 3BAJA 4CN1A 3VSTA 2O92A 4WSKA 2OSXA 3SCQA 2BY1A 1QNSA 4CD5A 4E8CA 1QHZA 2QPUA 2VQUA 4PMNA 4J3TA 1EDTA 2PC8A 1KGXA 3HZ3A 3GNOA 3BGAA 1C92A 3DDFA 2NT0A 4W86A 2YL8A 4B15A 1XGZA 2WSPA 4PCSA 1QI2A 3NDYA 3WDRA 2VRKA 1WE5A 2XN0A 1KCKA 3S6TA 5FKYA 1JI1A 4FLQA 2WSKA 1SYTA 3BC9A 1GORA 4ZENA 4UFLA 1H1NA 1ZB5A 4LGXA 3WDIA 3ZMRA 2X8RA 5ABFA 1H11A 3VKKA 3AQUA 3MMUA 4DUVA 1QPKA 1KBKA 2OW6A 3VIFA 3AMGA 1FHLA 4GO9A 2XJ7A 2PWDA 4CKQA 4JAWA 3WH5A 3BCDA 4A4AA 2J4GA 4AMWA 1OGGA 1WKYA 1OSEA 4MNJA 1MYRA 4OZOA 1R87A 5A8MA 3AHXA 3VIGA 3ZSTA 3A22A 1H49A 1E56A 4U31A 3VU2A 3BVVA 5FOOA 4LQ1A 1OBAA 2G8ZA 3QOKA 4E4PA 3ZQ9A 4MADA 4RE2A 3N9KA 2IGTA 3TTOA 1E15A 1KGUA 1LQ0A 2DT1A 1E43A 3ECQA 4W85A 3A47A 3BSHA 2YFOA 3W27A 2FE0A 5A8PA 3G6MA 3GXMA 4DO4A 4U3AA 4QAWA 8CGTA 1KR0A 4WF7A 4GZJA 3U57A 2Z1KA 2PWHA 4PN2A 3WDHA 4DWSB 1VFUA 3DYPA 2D73A 1FHDA 1ZJAA 3ZJ6A 2DGAA 3NCOA 4U33A 4ACZB 2FGZA 5HDRA 2J7BA 2V3FA 1VJZA 1NQ6A 3VM5A 1X6NA 2ZUMA 1IV8A 4Z2GA 3OGVA 1ZBVA 5LA1A 1V6XA 3WD1A 3M7SA 3WMBA 5FL1A 2G3JA 1HP5A 2J77A 1E71M 1J0ZA 4BQ3A 4D6DA 3W81A 3WEOA 1PZ3A 2UY5A 4IISA 1JZ3A 2V3DA 3SCOA 4DWSC 1CXKA 1F4HA 1GZJA 5DT5A 4NZFA 2J47A 4J3UA 1WZKA 4WK9A 2UY3A 3WKZA 1VEPA 2BY3A 3WD4A 2E9BA 2VTFA 1E6ZA 2YBTA 3ARUA 3MUAA 5CZKA 4FLSA 3WFLA 4PMRA 1XSIA 2J7CA 4JFTA 2GJPA 4HMCA 3WUFA 1UQYA 1KBBA 2XIIA 1PBGA 3UETA 3UR7A 2CITA 4PMYA 5BRQA 4UFIA 1TQVA 1US3A 3EJSA 2J7EA 2YA2A 2XTKA 4B16A 3SUUA 1E4NA 4C7GA 3UR8A 4XZBA 1GQLA 2XVPA 4QCFA 1JAKA 3BAIA 1PEZA 1WB0A 1TQWA 4AZCB 1JXKA 1RH9A 1BSIA 2XFYA 3FNDA 5C70A 1VJSA 3OZOA 4D6FA 1TMQA 1XH2A 3AFBA 3DX3A 1E6XM 2D23A 4AMXA 1EDQA 2QV4A 3CHEA 1OT2A 1M04A 2ZXAA 2OWCA 2D3LA 1G9HA 4P8WA 4NRSA 5D8WA 1ISYA 3ZT5A 1W9BM 3VGBA 5I23A 1CLXA 3CZNA 4UQAA 3D50A 1BVNP 3W29A 2VR5A 4M29A 5CQ1A 3ZM8A 1KQYA 5I79A 4R27A 2XM1A 1TFVA 1Q4NX 2ZXDA 1UUQA 1NP0A 1W32A 1JYWA 1JDAA 1V3JA 2X2HA 3APGA 2OWWA 2FH6A 4DM2A 1JIBA 1ZL1A 1W2VA 4M80A 2ZUSA 3WUGA 4AWEA 2CHNA 1GONA 1XRVA 4CD4A 2O9PA 4PYSA 4W87A 1E1EA 2WMKA 4PBGA 4GQRA 1BGGA 2OSWA 1CGWA 2IUZA 3WNOA 2WVUA 4PTVA 4XB3A 2EXOA 3AROA 1KXVA 3CH9A 4J3XA 4MB3A 1R33A 1JZ2A 4ATWA 3WQWA 2DIJA 5CGMA 1BTCA 2WHJA 5A8QA 3SCNA 3K1DA 3AS2A 3AZRA 5A6BD 1PX4A 3KL3A 1QBAA 3AHTA 3LRKA 1V6WA 3PZOA 1CDGA 1VIWA 4NSBA 1VEMA 3GH7A 3DX4A 4ML4A 3AJ7A 5HOSA 2WK2A 5AC5A 4LYQA 1H0IA 5HNNA 4XV0A 2ZX9A 4ACYA 2E0PA 3DYOA 2XM2A 3OLEA 2ZX7A 1PAMA 4J27A 1RP9A 6TAAA 3W24A 2X09A 3CMJA 1J0KA 2AMGA 4MDOA 3VGDA 1DWIM 4WKAA 4UOZA 4DWSA 2WC7A 4DO6A 4MB1A 2VZTA 3SEPA 1QHOA 2XSBA 1U30A 2W61A 2WC3A 1MW1A 3WY1A 3CZLA 4ZXLA 2F8QA 5ABEA 1W9XA 4CU8A 3K4AA 3MU7A 3ZJ7A 5E70A 4E2OA 4BS0A 1GOWA 1QW8A 1YHTA 3VGHA 2BHZA 4CU7A 5TD4A 3PHAA 3VIIA 4NX0A 3AIWA 1E6QM 3VIMA 4MNLA 4DUWA 1H3GA 3UG4A 3PZIA 2E3ZA 1MW0A 2F7QA 3WF2A 3W6LA 1J9YA 3FN9A 5A8NA 3AIUA 3K4DA 5M5DA 5CSYA 2CPUA 4Z2HA 5ABHA 2VR4A 1B9ZA 3A3HA 1NOFA 4JL1A 3GBDA 1LLOA 1ZS2A 3WH9A 2OLHA 2OSYA 2WVVB 2DT0A 2E40A 4GKLA 3B9EA 1W1VA 3DHPA 4OUEA 4RL3A 2TAAA 3OLDA 4IPLA 5AY7A 1C8YA 1WO2A 2WANA 1ODUA 2ZWYA 1BG4A 5BWFA 2QLYA 1JZ5A 4WJXA 1V02E 2VCCA 3KEHA 2BS9A 3T09A 1VFOA 1ECEA 1E5JA 1EXPA 1ZBCA 2ZXBA 2JIEA 4AZCA 2VNCA 1CECA 2DPEA 5BXSA 1HKMA 2J8GA 4W7VA 4RE3A 4GI8A 3VNZA 3ARTA 2WXDM 4KGLA 2ZX8A 3VSVA 1DHKA 3LPFA 1K9DA 3AHYA 1S46A 1QX1A 1R7OA 2W63A 3FAWA 1DWHM 4TVUA 3EYPA 2FHBA 1US2A 3VO0A 3CZSA 4U5KA 1QNPA 3D4YA 2A3HA 1UWTA 3EDDA 1LL4A 1RD6A 1UR2A 1CLVA 2GDVA 1O7AA 2EPKX 2AAAA 2PF0A 3TONA 4IPNB 2GJXB 2OYMA 3CMGA 2PI6A 3WUEA 1GUVA 1UR1A 1YQ2A 5M03A 4D6EA 1E0XA 1P6WA 1OCQA 1KTCA 1QOXA 2DSKA 3MMDA 3BXWA 3CIVA 2BVTA 4JHZA 3SCPA 2V3EA 1EQPA 2JFEX 3N11A 3K8KA 5DFAA 1E55A 3WY3A 5GQBA 3FXYA 3N1AA 3VMOA 1WP6A 2DSUA 3CO4A 4F9JA 4GZEA 1PX3A 4M8UA 2ZUUA 1J18A 4N0RA 4UFHA 4Q22A 3MANA 2AOSA 3GH4A 3VD5A 4S3JA 4OOUA 5FCZA 1UQZA 3K8LA 3HN3A 3VIKA 1CPUA 1GOOA 1HL8A 3LPPA 4GIAA 4UTFA 4HU0A 4NI3A 1H5VA 3PTQA 1V03A 4EANA 1ESWA 3DYMA 1UG6A 4JKMA 2QPSA 3MSDA 1UR4A 3LRLA 1CWYA 4QP0A 7TAAA 1E4MM 1UKQA 1VENA 1Q6GA 3WY4A 4AIUA 4HMDA 2CNCA 1JD7A 4MJ4A 3L2MA 2FHCA 2CXGA 5BCAA 3OG2A 1GVYA 2G3MA 1HKJA 3PTKA 5E6ZA 1NM9A 2J7HA 3WBEA 4AY1A 1J10A 2EBNA 3N15A 5E1QA 3CZ8A 4HA3A 4TXEA 2EPLX 1HJXA 1HJQA 2XGIA 4X0NA 3AS0A 4TVCA 4PUEA 1IZJA 1GW1A 3SIMA 2G41A 4FNPA 3F4VA 3RM4A 4E8DA 1TCMA 5HPCA 4W8LA 1XYFA 1KR1A 2YDQA 4PMZA 2WB5A 3PZGA 1BFNA 2YIHA 1OD8A 4NZJA 2YDSA 1EO5A 2CESA 4DO5A 5JBEA 5BXPA 3RILA 1EGZA 3ZIZA 3FW6A 2CHOA 4H8UA 3MV11 1E9LA 3VIOA 3NDZA 2F7RA 3GH5A 4JKKA 4UR9A 1GHSA 3A5VA 5FIPA 3T08A 2GSJA 4HOZA 2Y5EA 3T0DA 3N12A 2A3AA 5I77A 4BQ5A 2WBGA 1QWUA 1JD9A 2RGLA 2FDMA 3H54A 4KGJA 1B0IA 1R7AA 1QBBA 1HJUA 2D20A 1UA7A 3AIEA 3ZR6A 4TX8A 2IXVA 1SZNA 1FP8A 5AYBA 3VM7A 2QHAA 3ALFA 3BUBA 4D6GA 1TG7A 1XV8A 3PZUA 1WDPA 2WBKA 1DWGM 4J28A 3AIVA 5HBFA 2W5FA 1CGUA 3K46A 1E73M 3BSGA 2CBJA 2Y2WA 3GDBA 3RJYA 2YDRA 1KCLA 1FFRA 3ARZA 4HMEA 3BAXA 3MUZ1 2EPOA 5CJ5A 2GK1A 3MMWA 1HTYA 2ZUVA 1SMAA 1B3WA 4JHOA 3DX1A 1V0NA 2E8ZA 3BVUA 1EIBA 4P8VA 3FAXA 3LPGA 3AXXA 3FY1A 2BY0A 2VZSA 3NSNA 1E6RA 3WNMA 1HKKA 3WIJA 1GQJA 1UKSA 2CCRA 3ARRA 3QOMA 2VRQA 3CZKA 1HVXA 4NRRA 1ISWA 3EBVA 1ITCA 1EHNA 3H55A 4PMOA 3WDQA 1MVYA 2D22A 1RP8A 5A8OA 2FYVA 2GJXA 3WD2A 2VI0A 2PBOA 4FNQA 1W9VA 3MI6A 3GXPA 3JUGA 4AD3A 2E9MA 2OWXA 1HJVA 5GPRA 3EJUA 4W89A 2BNJA 1B2YA 3KE0A 1HN1A 1GOKA 2BVDA 4YN5A 3VNYA 2O9OA 2XVKA 3K8MA 3A4XA 4PMUA 2BV9A 3CTTA 4IUGA 2VVSA 1LF1A 3CUIA 1WDSA 1B3XA 3BVTA 3GXNA 1B30A 1JDDA 1F4AA 3VIHA 4BQ2A 1B3YA 3I3EA 4V2XA 3I3DA 5E0FA 2ZUNA 1XC6A 4X0VA 5BYWA 1HJSA 3WQ8A 1VFMA 5GNZA 3BUPA 5ABGA 2FH8A 3SCTA 2J78A 4H7VA 3ZSSA 3SCSA 1L8NA 1UD5A 4P7LA 3W0KA 1WZLA 2ZX5A 5E9AA 2J74A 2VOTA 1OB0A 3IJ7A 4AIEA 4C7FA 1DTUA 5EFDA 4H41A 3THDA 5DEZA 2WW5A 2EAEA 5GNXA 2WNWA 3KZSA 1UR8A 4W8BA 3BUQA 4ATDA 2C8NA 2DIEA 1JYVA 3WD0A 1UD3A 3ZOAA 1E0VA 4UOJA 4CD8A 4BZYA 3S2CA 7A3HA 2Y8VA 1JG9A 5CSUA 1GJWA 4GO8A 1NWRA 4CVWA 1DWFM 1TR1A 3VOCA 1V3HA 1W1TA 4F8XA 3II1A 1UYQA 3A4WA 4AZ6A 1UKPA 3PZTA 2FHFA 2ZICA 3GZAA 1M01A 1IZKA 1D3CA 4WIWA 1HWWA 4AYSA 1NH6A 4FNUA 3BLPX 3NUKA 2XVNA 2VMFA 5A69A 3VGFA 3BMWA 2E4TA 4OGZA 2YL5A 2J79A 2JEQA 1FP9A 3I3BA 3RJXA 4A3HA 5DMYA 1QNRA 3VILA 4QCEA 4MDPA 1W3HA 3G6LA 1HX0A 3WEMA 3ZO9A 1JL8A 1I1XA 4ZXOA 4AZIA 4M24A 3VIJA 1MWOA 1A47A 2XG9A 4D72A 4D6CA 2X0HA 1JAEA 4CCCA 2XFRA 4IM4A 2YL6A 3SCVA 3AHZA 1R85A 1QNOA 1C7SA 3VDHA 5BROA 1BQCA 4W8AA 4ZE5A 4OIFA 3WEZA 4JL2A 1J12A 2DSZA 4KH2A 3U5UA 2VL4A 3NIYA 3UCQA 2PB1A 5A6MA 1W1YA 1E6NA 4MTVA 4UFJA 3T2OA 4JZ5A 3IJ8A 1K9EA 2DT3A 3RMEA 3WMSA 3TP4A 5I0DA 4UNIA 3L4YA 1GOIA 1C3FA 2VZOA 4AZ7A 3W38A 2A3EA 1W91A 1PJ9A 3VGEA 2DT2A 2F1BA 1G0CA 4AD2A 4LPCA 4GPNA 2F7PA 5E09A 5AC4A 1SFSA 1NARA 4CCEA 3UESA 4Z2JA 2JE8A 5A95A 1JDCA 1FOBA 1QWNA 1GVIA 2WYSA 4UCFA 4PTWA 2CIPA 3EMZA 1I1WA 5AYIA 2YJQA 4MAZA 3CGTA 2WCSA 1E0WA 3LXCA 3VMNA 3ZT6A 5IFPA 4V27A 4BQ4A 1PIGA 3L4ZA 4JKLA 2XN2A 3ARYA 3BH4A 3AZTA 3RO8A 3CHDA 4CN6A 1HKIA 4AXNA 3HG3A 4A3YA 1PPIA 3BLKA 5JIWA 3DDGA 2WMJA 3WY2A 5C71A 3WQ4A 1BYDA 3TTSA 1NWTA 4R5EA
chains in the Genus database with same CATH superfamily
1IM9A 1JZ7A 2IGFL 2VGBA 3EX6A 1JPSL 5IVXA 4Y90A 1HVQA 1XIBA 2JQMA 4QTFA 4YJZL 4PS4H 1USQA 1S7WB 3MVIA 1MREH 4OTXL 1R3KA 1L9TA 4KJYB 2GSHA 5JQ6L 3SDCC 1U3HB 4GHRA 1AE6L 1DEEA 1RSCA 4X4KA 2EGZA 3OMAB 1U33A 1Q3NA 2CLZB 1SN2A 2EXYC 1KF9B 1E3ZA 2PWGA 2H0PA 4XCYB 2D2CC 3VI4B 4GJ1A 3K72B 3MR9B 4YDZA 3T8VA 4YS4A 3QZ6A 3VC5A 3MRDA 4NPYB 4LPTA 4DVBB 2WNXA 2OLAA 1Q9WA 1TVHA 3PV6B 1KIUB 4P05A 1EEXA 4D94A 4LIQL 1PDZA 1TMCB 1E6PA 3TJHC 1UXMA 1ZDQA 1BWWA 1OAKH 1PTDA 3QEHB 4WENB 5F1KC 1JGDB 2Z0IA 3RUGB 2B0MA 1OGAA 1UD6A 5C0ND 4JFQB 3HLAB 2LAAA 5CLTA 1B0RB 1WAAF 3VW3L 3KWTA 4LP5A 2IADA 4LARH 1AO7E 4XP9L 3SGDH 1TJIH 3PUEA 4LF3A 4EF8A 4KVCH 2X3CA 2G0WA 4U1KA 1R6WA 2YL9A 1PWMA 3QXAA 4P46D 5I02A 2R1PA 4QHRA 4U6VL 1YC7A 2N7SA 4G7YL 5PTDA 2Y7MA 1DVFD 4KMTL 2HT2D 3GEFA 3DG7A 5D6DA 2YZRA 4K94H 1MELA 4JN1H 2PPDA 3L16A 3P11H 1T83A 2P10A 2IXQB 1EEUA 2NVAA 3SJ3A 3KRSA 5IY5B 3CJPA 1LEKB 2PDHA 4HUMB 1XLBA 3X3FH 3VTTA 1K8YA 5ADOH 4EI5A 4Z7VB 4C59B 4HU8A 3LKNA 1EX1A 2E67A 1CENA 3C8KA 4FFYH 4CC4C 4X50A 2NV2A 2HJFA 3VXPA 3G8EA 3N19B 1NJ9B 4AEHH 3B6SB 3MWAA 4K37A 4N9OB 1G7PA 4XO3A 3QEUB 4O14A 5TGBB 3BUIA 3HZVA 5LDSA 1EQWA 5CJBA 1QABA 2NYZA 1AC0A 5I6SA 4QF1A 1WD8A 1H3PH 2C4FT 4Y4FD 3FF7A 4JFHE 3LS5H 3VFMA 5D2NA 1ES0B 4PUKA 2Z35B 1Z9OA 5EPMA 5LA2A 3TA3A 1TXKA 4UIOA 1JZ8A 4OCRH 1LL7A 1UJ3C 3UZJA 4J3OH 1YEJL 3CFKB 2DM7A 4I77H 4JDYA 3RNKA 4HXAH 2ENJA 1C9SA 1LO4L 4NYYA 3QHZH 4DP2X 3L5MA 3FJLA 1GPOL 3UG8A 1B54A 5EO9B 3VWJD 4QXTA 5DX7A 4RPPA 2FNBA 2O26U 4D6IA 3B9VA 1BKSA 3QH3A 5ESVA 4BELD 4UMSA 2GTWB 1G7UA 5AC8A 4YDKH 1C9WA 1UJQA 4D0CA 2GGHA 1HUVA 3T4YB 4MZ3A 4KXAA 4HLZH 1F58L 4KQ0A 5DD1L 2X70B 3SYOA 1MJJB 2JKJA 2HA1A 3MX0B 4ZZ9A 4TUKH 2L3BA 5IMOB 2EEFA 4W7UA 1G9EA 3HQOA 1AR1C 3NOIA 3BEWB 3L4VA 3GTXA 3WF4A 3LEVL 2V5MA 3V3WA 3ZZQA 2RA1A 3RDTA 5SWUA 4WHCA 5I73B 1V51A 4BFRA 3OJDA 2ENQA 3TT3L 4Q9QH 2NX5A 5T1MB 3ULVH 3PG8A 1A5MC 1QOQA 3IXAA 1O7DC 3PQYA 1R3LA 5I74B 2I57A 4ZMTA 1EANA 4UU9B 2YXVA 2C3XA 2OMNA 4YEFA 3DFHA 4GRLA 3NQ2A 3FNKA 5F71A 2O30A 4F7CA 5DZPA 5E6IA 1A25A 1EHKB 1ET5A 2CC0A 1O5DT 4IOFC 1NOLA 2XCMC 4PRHE 3QJZA 2V2HA 3QORD 2IH8A 3ULVC 5MEQB 1ND0B 3UBXA 2VDGA 2EPMX 5B1CA 1GOXA 3RPMA 1BYOA 1KV5A 1J0HA 2W8CA 2Z8RA 1OF0A 2D0HA 4LB3A 3TK7A 2XRAL 2Q87A 3KPNA 2V9TA 4YSEA 4NZDA 1XVSA 4GT7A 1MPAH 3LHPH 1QUMA 3S5LB 2G9HA 2UY7B 4P23A 3MKGA 2ZIDA 1TUXA 1CLZH 4L4OA 2EH7L 1WWWX 4R4BA 1GC1H 4C56B 2VFGA 1KC5H 1NU5A 4YBLC 3V16A 3KDMB 2ITDB 2IOMA 3N6QA 1KENH 2H0FA 2ENSA 3Q44A 5CGYD 3GHBH 3G5XA 3GSNL 3KLLA 3ZDXF 4JFZL 3MJ8B 2O1AA 5BNKA 4QEHA 3KTCA 3QIWD 5FAJA 3OGRA 2P50A 3QB7C 3CYJA 1KYOJ 3PG2A 1N3NA 1JV2B 4X7FC 4PY8J 1W56A 1W5NA 1PV8A 2O9RA 1KLFA 1MKFA 1YNKL 3S1WA 1GC1C 4PGCA 2YPLD 2OT1A 1OCBA 4G7SB 4D9QD 3NGBC 4G1NA 3HFYA 4AIOA 3KL0A 1H1YA 1WFOA 2PDGA 5I1GL 3S8HA 1MCQA 4CA4A 4EPSA 5SWZA 4S3EA 1VFBB 4D1IA 1FVCA 4CILA 2OMTA 3W9DA 4DZHA 4N2KA 4JFYB 1BWMA 3OBEA 4KUZL 4NUJA 5E1IA 4B9YA 3POHA 3S36H 1LG1A 5DHEA 1BJ1H 5B38A 2EP6A 1GZHC 5BS0E 1OIFA 1WS7A 2JMRA 1LZOA 3FZUD 4QE5A 3OVRA 2IFFL 2P49B 3QHNA 5JPNA 4TV3A 3G6DL 2VLKE 5BRBA 1DYSA 3UTTD 4N2NA 4IGNA 3MQTA 3A24A 3I6KA 2BIHA 4D0BA 3DROB 3E5PA 1CGVA 2FO8A 1KPUA 2EJAA 3OOQA 2WLIB 2NWSA 5GRJL 4HEPA 4Z7OE 4FI6A 4B9CA 4QJ3B 1GIGL 3CC5A 3KPPA 3ARVA 3HRPA 4YK4C 1BF6A 4MNGA 4H3DA 4ORZC 3U2SA 2QELA 1NGQL 3PSWA 3IDYC 1AXTL 2JKSA 3MGTA 4N22A 2IW0A 3B7RL 5HP5A 1PS3A 4HBCL 4PJEE 1AG0A 2P3ZA 1Y1UA 4HPJA 3R7QA 4IRSB 4LP8A 2Y5JA 1DCEA 2CDEB 3D33A 1EDGA 3GSRB 3HG1E 3PP3H 4N1EA 3A4JA 5LWYL 3VFUA 4HBQA 1J96A 4YHYC 3O0FA 4PJCA 5IBTL 4MYPA 4NAQA 2WJFA 2HN7B 3T65A 3JVGA 4XZWA 4EPEC 4GP4B 2VWSA 3VG0L 4XBEL 1F6PA 1EUUA 1XGQB 3T2QA 5TDPB 3QZWB 1T21A 1YPZF 4UUIA 4MHHG 1H1ZA 3J2PA 2CKRA 5CWSB 3BLBA 2EDXA 2EE0A 4IBYA 4ZMOA 3D5OF 1M9SA 4Y8AA 2J66A 4W7WA 1VACA 1WA1X 5EUKB 1AG1O 4K3HA 4CN1A 3VSTA 2W0UA 1QHZA 3URQA 4N86A 4Y9PA 3ZLFA 1KGXA 4A39A 5FF2A 4YNYB 3BZFB 5GSVA 3K30A 3BIBX 1RV6X 4PS8A 1E51A 5FKYA 3KGTA 3IVTA 1VKXB 2NV9A 1K2DB 2KDGA 1AFVL 3BFWA 1MCEA 3P9LB 2A6LA 4DRSA 3SRKA 1V6TA 3JTSB 3A22A 3BISA 5ERWB 3BPOB 4GKSA 3SRFA 5FOOA 3QEQE 4IU2A 2WLMA 3B43A 1B9KA 3IN2A 1J4EA 4NJAL 5IQMA 4H0IA 3L68A 2AXJA 4IJ3C 1UR3M 3COOA 2DPKA 4UDUA 4OCSL 1CFNB 2YD3A 3KVKA 3DBXA 4OD2B 3OR6B 3GHRA 5DC4B 4GUHA 1JVOA 5L4MA 3WLJA 1CQKA 5DVLA 2IAMA 3KVLA 5FA5A 2Y1ZA 5FXCH 1SFTA 2J47A 3LTYA 2CGZA 2UY3A 4R7WA 2KBGA 2MHAA 2IOOA 1U3NA 4WVXA 4L80A 5I8KL 3S37H 4P4KB 1OAXH 4K9JA 4FR6A 1TQVA 1US3A 4LRNL 2ZSWA 5IQNA 2IO5A 3HB3D 1S9XA 3OX8B 5TIMA 5JYMA 4C7GA 4H13C 4FALA 4QCFA 1JAKA 2PXYC 3FUNA 3ELAT 1UOWA 3QPKA 4RMSA 3Q2CA 1PZBA 3GKWL 2VR9A 2DVXA 1E6XM 2D23A 4OF5A 1TTUA 1KM0A 5B8CB 4PYHA 1PVHA 1W9BM 4LHUG 4NQEE 5FEXA 1YYCA 4D3CL 1TFVA 3GT6A 5D02A 2GI0A 1OADA 2VLJE 5FEPA 4US5D 1NCIA 3D85A 3WTYA 4WI0B 5EZJA 1VIZA 4O15A 1ZPLA 2W0PA 4MZYA 4BCZA 2CKBL 5HHPA 32C2B 4QRQA 2HFEA 3EB3A 2G75B 2FVMA 1ZE3C 1G7HA 4O4VA 9PCYA 2EXOA 4YXKL 3W2NA 3C0LA 2HTKD 4UTJA 2A7PA 3WBWA 4EI6B 4DTGL 1Z48A 5A6BD 2NXZB 4GG8B 3NZ8B 1V6WA 3NT0A 5F9DC 1VEMA 5JHLA 4NO3A 4I3SL 3VFCA 1XIWD 1A6WH 1MRCH 3DYOA 4K71B 1SJEA 4PGEA 2YRZA 2RJGA 3W24A 5E4EB 3DUSB 3S1XA 2PCXA 4CQ8A 1URIA 4ENED 3HI6H 5J11B 2X4OA 4F58L 1U95A 3O9WD 1KFKA 3BVNA 3RDJA 3H2QA 3I4EA 2VXUL 5HGAB 4GGBA 5CC6A 5FK9A 4XP6L 5CC5A 1W72A 1NIDA 4PBFA 4WO0A 1YHTA 3KDPB 1NTDA 5INDB 4TQEH 3I6TA 4NX0A 4Z5RB 3ATYA 1S7TA 3UBXI 3FT3A 3NQ8A 3W6LA 4PJXA 4BKLB 4LUIA 3MJWA 1AD0B 4Z2HA 5KVMC 5FM4A 4JL1A 3NZ1A 2C7UA 2ERJB 2F19L 2PPAA 3P93A 5A7EA 5I1CH 3UA4A 3WUWG 2OLHA 4PJDB 4HIPA 1DIDA 4LSBA 4L1DA 2R0ZH 5DY3A 3DHPA 3WTUA 2XZQH 3S35X 1WO2A 2P1FA 1KV7A 5AW3B 3S8FB 3PFUA 3V5KB 4NAFB 3VU1A 4N0FA 1US2A 3V0DA 2HJPA 4G8GB 1EBGA 1E67A 5HI4D 3T05A 2GDVA 4HUWA 2ROYA 2W65A 3BKJH 1E2VA 3CMGA 3WUEA 4AV0A 1OCQA 4O12A 2ZOWA 2FATL 4JHZA 3FL7A 2V81A 4WFGD 3WL9A 3N1AA 4PGBB 3LUTA 4NC2B 3IDGA 4MMZA 3P3BA 1UXSB 3W39A 5I75B 3AREA 3HS0C 4WI7A 4PH8A 3V5FA 1FL3A 2CKBA 1UQZA 1SHSA 5AW5B 3KM8A 4OZ4B 1I8UA 1YNPA 3RZWA 4XNZB 3RB5A 5FECB 2NY5H 3NIGE 1N4XH 1JNJA 4A35A 1S7UA 3CV1A 2J4WL 4P2OA 5IFAH 1GHFH 5CD3A 4JM4H 2CXGA 5FUZL 5C7XH 3MGAA 3OQ3B 2FZDA 3TX9A 4Q2ZA 3TZFA 1SLUA 4RRPA 2QKIB 1HJXA 3SQRA 1MUJB 4FNPA 1Q4WA 3E8UH 4XC3H 4RIRA 3RVXD 1SRDA 1UZ8B 4GG6B 2NY5C 2PYFB 2BPBA 4OT7A 2UYLA 4A8IA 4P5KA 3VI2A 3CEPA 4G8IB 1AGFA 2HRWA 2QFPA 1RY7B 1XLGA 1TOXA 4ZXBB 3IU4L 3SKNB 1PMYA 5BOOA 1UM4L 3EIFA 2WQDA 4ZTYA 2WP3T 4HCIA 4F27A 3STBA 2LLEA 4JFXA 2X6AA 3ZRCC 3BKYH 3VM7A 3ALFA 1G43A 3F5WB 1MCHA 4D6GA 2HVOA 5F44A 4RGOH 1DWGM 1CGUA 4HTBA 2Y2WA 5I1HH 3RJYA 1KCLA 2CKNA 5EB9A 3R19A 5TPWL 4NP7A 4NN6B 2A0NA 3DO4A 3ESMA 4I18C 5D71L 3S48A 4ZS6C 4JGNA 4YEEA 1M1XA 4F7EA 5TFSH 2IMRA 1W9VA 2XG5B 3JUGA 2WW8A 4AD3A 4NQQA 2Y9RT 1I2NA 3EJUA 4N90E 1QLRA 1B2YA 2O6DA 1GKEA 4Q7IA 2IKHA 3OEXA 2IEPA 3IJSB 2LV4A 4M7JH 4U49A 4C1NB 1AUSL 3P3TA 2WKOA 1UZ6F 3R43A 1G4RA 1J6PA 4BFEA 1NCWL 5EYWA 1QNVA 5U4NA 3WK3A 4KKRA 4QT5B 3SCSA 4N2YA 5T1KD 5GJSH 5A8GA 4LY4A 1TPFA 3VXNA 4XNDA 5GNXA 4WJKB 4C6PA 4ATDA 1QNZL 2Z8SA 1M7UA 3ZOAA 1B2WH 4BZYA 1ECZA 3P4LA 5KOMC 1H8NA 1TO5A 1U8OB 1PY0A 4KKBC 2WTPA 5C8JA 1Z7AA 3GXUB 3LV5A 3QC0A 4H9ZA 1LHZA 2BC4B 3GZAA 3V4UH 4ODTL 3NQMA 4F9PA 4JPGA 1RL1A 2CK0L 3P30H 4S38A 4LCCC 5HVFB 2YL5A 3KDNA 3SDAC 4HHMA 2CDGA 1BZOA 2Q3RA 2GBTA 3WEMA 1NFDA 3O3BB 1VQTA 4F7PB 4WY7L 5IHWA 1A7PL 5D05A 3KGRA 5C09D 1QHQA 4MSWB 1SPQA 2VL4A 1TPWA 1PHWA 3BSZA 4FLHA 5D4QA 2B2XL 3TP4A 5IW6A 2PP0A 2P76A 1I82A 1W91A 1TG8A 3VGEA 2QCCA 1E5YA 1P7QD 4XNXL 2C3WA 4YDJB 3B7UX 4YL9A 2ZZ6A 5HULA 1BQLL 4K39A 1BF5A 5E2TL 4B95C 3CAQA 3WJZA 4EO5A 1OZMA 4MD0A 4XO6A 1RHFA 2AFNA 2BZDA 1JCJA 1HKIA 4A3YA 1U21A 3UDWC 2QGDA 1UWEL 1P1VA 2IH1A 1S2TA 2PDLA 1L5GA 2V17H 3RTQA 3QKEA 3HNVH 3ZBMA 4HPNA 2R23A 1GJUA 3GLCA 5CC3A 3H4FA 3N13A 4YHIA 4NXSA 2NY6B 1CD9B 1TUFA 4BEUA 5FUOL 4BFIA 1JFHA 3DO7A 4XUGA 4EDXB 3DFNA 3VVWA 1UT1A 2XTJD 4NJGA 2ISVA 2C9SA 2XXGA 3VXTA 4W4OC 4G5DA 1A14L 1BFOB 2XGBA 1GYWA 4CQ9A 4C4BA 5EB8A 1P5UA 4ZPVA 4YSQA 3QV8A 2ISSA 1RBAA 4H00A 2CBUA 5K4XA 3CFDB 4HUCA 2ZP8A 1LLZA 1NCBL 2DKSA 3RLHA 1XUZA 1NGPH 1X4XA 4ZQPA 3BPWA 1OO2A 2ZZ1A 3EB4A 4X8JA 4PMQA 1TA3B 3DA0A 2F58L 3W0WD 2GG1A 3CLEH 5CGTA 1ONWA 2PCPA 2F8XC 3LN4A 1XBDA 1X5IA 3AALA 4JX5A 3BAYA 3I7QA 4ZQNA 1A65A 4N4QA 2ONEA 4ZFOL 1GGCL 3GVVA 2F53D 1BKHA 1PLGL 2A5HA 4F15B 1VHPA 5DWUH 4H2AA 3TNOA 5ABZA 3VPLA 1WWAX 3F12B 3FEMA 1RUML 1BJMA 4D6JA 1FZOB 4JO4H 3WF3A 1MCCA 4MVBC 3SY0B 4RUBA 4M5TA 4UDTA 1XBVA 4QE1A 4UQEA 3BG9A 3B8TA 4DESA 3C12A 1O5RA 2EEBA 4PJIE 4NKIL 4WWNA 5CD5D 2Q01A 4BHUA 2INZA 3MLZH 4TQTA 1UEMA 4PCYA 1QJWA 3B3DA 2BWIA 4WK2B 4XH2A 1R46A 2OPCA 2HLAB 4LEXL 5BUGA 4NO0A 4XNYH 1MWAH 4NQCD 1HI6A 4TTUA 1KCRH 2NX9A 5DJAB 3PTDA 1H9VA 4ADIA 5EU5B 1UKOA 1PZ5A 1ZJHA 5IB2A 1CB4A 1QLEB 2Y7OA 4Y1SA 3LQGA 3N40P 4JRXE 3SKMB 1WZAA 1US0A 4UQBA 5JU6A 3OYZA 4FQXC 4I6VA 2HG5A 1AGEA 3W37A 4JO3L 2Q8AH 3NQDA 1P9MC 2J72A 4HK6A 3S9ZA 1UQSB 3IN0A 4QIUA 5BVPL 2BK8A 4ZYKA 3VCLB 2QDGA 3IJHA 4R7OA 3H6AA 3ZDWA 3FYYA 1BVZA 3O6KL 3QV6A 4YHZL 3KP1A 2PCFB 4IBLT 4MWFB 5DBUA 4Y6GA 5IUCA 3NJIA 1MZRA 1MXGA 4K7PY 1QQDA 1TQTA 3CN2A 2E9IA 3UIYA 3UZVA 3MV8D 4CBZA 5J1AB 3Q13A 3QEGL 1NIEA 4AYFB 1YY9D 3J8F7 1EOKA 1OT1A 8TIMA 1J8SA 2A83A 1UUOA 4NGHL 2ARJB 3WH6A 5H8UA 5HYSA 4U1LB 4ZB5A 2OZ4H 1XB3A 4UM8B 5FYJU 7CGTA 3RVTC 2Z25A 3F6JA 2R8SH 3MZNA 3UFYA 4UFKA 5A2IH 3U0TA 4JFSA 4IFRA 4B96A 3CN0A 3LDBC 2DZVA 1UWGL 5DDHB 5EA9A 1IEQA 2Z64C 4HFWA 4Z7UF 1MDLA 4KCVA 3N43B 4X6CB 1U8NA 4K5OA 5LCVL 3GQYA 1YKWA 2B5IC 4MCYA 1KTJA 4HJUA 2DH3A 2CA3A 1O6SA 3ES8A 4LLUA 3TU9A 1KG0A 2YGQA 4KK5C 3CZUB 1OFQA 4U2ZA 1S5IL 3ARGB 3S35L 4YQXL 4X80L 3FOLB 5I8EB 1V08A 2OP4L 2X44D 4DAGL 2KLSA 5D7LD 4BJLA 2LGNA 1I9RH 2Y7LA 3WBAA 4LAJH 1ED3A 1L0PA 5I1EL 1RBLA 3E96A 4Y89A 4IMKA 1YYML 4KEMA 4OZFB 3QHTC 2QVKA 3ZYOA 4PTDA 4GUPA 4ODSL 2J8HA 5L6YL 1VBRA 4AL8H 2YBRB 1S78D 4PRPA 4KI5F 1OB1A 2ORBH 1OARL 2ZZUT 4UZGA 1YECH 5EZLB 1CZ1A 4U6HB 5BOFA 3V4PL 1L3NA 1I7UA 1SEQH 2ZAIA 1N0XL 1R3IH 3HMCA 3ZIYA 2XWEA 1QAWA 2WMPA 3SUSA 1Y5XA 3GRWA 3CX5J 2A3CA 5FA3A 3QZEA 2YD8A 4GRMB 1S2CA 1FRGL 1V7NL 2BERA 4QHUA 2RAMA 2O6FA 4XVUC 1MLBB 3LS9A 2LTQC 4AL8C 1NLDL 3WFBL 2HVMA 4HUVB 4HGMA 3S34L 2XSXA 3HCVB 3U9PH 4LLMA 3WE6A 3GNNA 2AQ2A 4X5XA 1ZJBA 4I6KA 3CXOA 1YADA 4L1SA 1N2VA 4W9ZA 1K4CB 1ZVSB 3QO1A 2B08A 3OPSA 2AL2B 5E5CA 2FK9A 2ZWZA 3B9DA 5SX4H 1RUKH 3S5OA 3DECA 4GH3A 1Y1DA 1NDTA 3VIPA 4YPJA 5D9NA 2QCDA 2DEPA 4ERGA 4YHKL 3SSZA 5T3ZD 4GBXC 4M8VA 5C9JB 1J0IA 5E0QA 1OABA 3L5HA 3ZIMA 4Q6IA 4WJEA 2CETA 4Q4RA 4AW7A 1FH5H 3OGOE 1HGYA 5JXEA 3P77B 4U1SA 1C29A 5IOBA 2R2EB 2XC8A 3U2JA 1EEQA 4L5FL 3U7YH 1M65A 4DJFA 3IETB 3KMDA 6PCYA 3QFJA 3R79A 5GNYA 5DJDA 3ELQA 4TMCA 4KFPA 4YLWA 3NP4A 1ZBWA 1HSAA 3HVNA 5D7IF 5TH2B 3TBCA 4ZMLA 3LHTA 5JOFB 1NSNL 4PMDA 1DE4A 3RPIB 1UKTA 2QMJA 3TEUA 5JIPA 3ZXWA 1OIMA 3EF4A 4R85A 3WTTA 2OZ3A 3WTSA 1EMTL 4NO2B 4LY8A 4G8AC 4I3GA 1XX9C 4EE9A 3KXQA 5F7FA 3M44A 2HISA 2L4OA 2HJLA 3DIDA 4PTXA 3IU3A 1QA9B 5KSUA 2ATPB 2UZIL 3DX7B 4UIMB 3Q94A 3QNFA 3EDJA 4XO9A 3IT8D 4BUQA 3SCRA 1YEGL 5D9OA 3X11A 2EDJA 4M61B 3VDBA 3RWCA 1RA0A 2MOQA 3RGVD 3ECVA 3UPRA 2VLMD 3N4AA 3MRLB 3FKKA 1HHIA 5I6XB 4XWOC 1SO3A 2WXFA 3QUXB 1KEML 4MCZB 4C8XA 4S3FA 5BV7B 2F6UA 3PP3K 2YA1A 3M0LA 3EYUH 4DBUA 1VB9A 3LEYL 1Y7VA 1NANH 2B8OT 1U8PB 4Q9RH 3L3IA 2DORA 3TSMA 1HQRA 1ITXA 4NUMA 4LDOB 1H0DA 4WRHA 3PNRB 2J13A 4OFPA 2B7QA 3LKOB 1QI0A 4GSXA 3W25A 2KZHA 1R5IB 5REQB 5C2UB 3SIKA 2Y6ZA 3F58L 1TEYA 2AK1L 1L6GA 4UOQA 5HYQA 3K0YA 5DI8B 4WI4A 4DEWA 3O11A 4HG4K 2FL5B 4Q8NA 4CNUA 4NRZA 4EP8C 4JE0A 1J2BA 4GLRI 2OQYA 5IM7B 3C08H 2AJXH 3IPEA 3QCUH 2VUYA 1NDGB 1DJXA 5AVWB 5KVEH 2V2XB 4H25A 3FQXB 2IPFA 5FO7B 1KTDA 1RJLA 5D1QE 3L66A 1X7SA 4LXFA 2R0KL 2BNQB 3SDXF 3F4DA 2FECL 2J9YA 2QGCA 3GIVB 5F0PB 1KN2H 1W3IA 2V0TA 3APYA 4GQQA 3V95A 4UTMA 3IE9A 1CVSC 1MMFA 3WN5C 3P0YL 3OZPA 5GGRA 4U6XA 4PJ8D 1NBQA 4EVNB 1Q6OA 4DI8A 1ELSA 4W9LC 2HXAA 1AGBB 3B37A 2VWEE 3VOGA 4F2UA 1CFQA 2AJUH 3MC5A 1IB5A 5D7SH 1XLJA 3D39D 4NX5A 4BQ6A 1NEZG 3TH6A 1KELH 1GYNA 3I6LD 5LNEA 4CNIA 1XDLA 3V6FA 4K7YA 3SCUA 3LPOA 2AQPA 3CHXA 2RIKA 1TWIA 4K8RH 1TRIA 4C91A 1AI1H 2EINB 5AC7A 3STCA 2VQUA 1IZCA 2J20A 2PC8A 3MPCA 4BHUI 3QUKB 3HM7A 4FX5A 5FYKH 2Q0ZX 5C6TH 4W86A 2B59B 5HPMB 2CLRB 2VOMA 3NDYA 2VRKA 1KJ2L 1MDRA 4A7GF 3JWOL 5IMKB 2YAOA 1D3HA 4GSDH 3QGAC 1ADQL 5B1JA 2BLFA 2PWDA 5LKYA 3LCXA 1X9UA 1LBMA 1MYRA 1XM3A 1J9SA 3BHBA 1U5JA 4K8RC 3EO9L 4UYPA 4HALA 3B5GA 4LL9A 4ORIA 1PZ1A 1OBAA 2G8ZA 1Z1WA 1OTTD 4F8QA 2IBBA 2EIEA 4RE2A 3U0PB 3TTOA 3O6LL 4YHNA 2DU2A 2R1YA 5L2KB 4AUJA 1KBGL 5JW4R 4JAMA 4TL4A 1S3KL 3DUUB 4B6ZA 1I9EA 4QAWA 4U3AA 3BJ91 4LVNB 1MUWA 5EF3A 2NNRA 5FF0A 4JREC 3EJZD 4JTDA 1TKKA 4WY0A 5D1XD 2DGAA 4OV4A 4IFOA 2PDWA 1OGTB 4KTEL 3NFPA 4L9DA 3IK4A 3DGBA 2Q8ZA 3I65A 4Q8WA 4Y4HC 3THMH 1OOWA 3C8HA 2PR9A 2V5SA 1OCCB 4KMLB 4HCRA 3WFDL 2O5YL 1TJ1A 3W1NA 2OMUB 3H9HB 3RAJL 2VGLM 3QVQA 4A7TA 2ZZ7A 3VGAB 1E6ZA 5JZ7D 3WKQA 2LU7A 2R1WA 2NXGA 4LSQL 5C7HA 3WUFA 2XIIA 1PBGA 3EOYG 2DYPB 3QWRD 3E6FB 5L7XH 1W16A 3QUML 4NJJA 5GGVY 5IHHA 1UA6L 4RLIA 4FXRA 1RAKA 4AZCB 2X1XR 3KPSA 5KG9A 2AQTA 4AU0A 3K5RA 3UABA 5JR1L 3NZHH 4V1DE 2OQLA 1OE1A 3HI1A 1LXMA 4KKXA 2FVNA 4U1GB 3RZCD 1KQYA 2WYZA 2ZXDA 3LH9A 3VXUE 3G0SA 2ED9A 2E5BA 1W2VA 4Y5YA 1N6VA 4CD4A 5CEYB 1GVOA 5IK3B 1BGGA 3GRBA 5IREA 4I5XA 4DY1A 3WLLA 3VRIB 3H4GA 1A5BA 1Z7JA 3OXSB 1NFAA 1JZ2A 4MXWH 4G9FD 1DJIA 3DFPA 4XC1H 3K1DA 3KPLB 2B7DT 4HB7A 3AQYA 1ADQA 1TUPA 2VEIA 5DRWA 1DV7A 1IC5L 4YE4H 4M1GH 3Q8FA 1WCQA 1MXSA 3FUFA 4G6AC 3NPZB 1EZ2A 2Y69B 4K3ZA 2VE6A 5I18H 4UUJB 2C1GA 3AAZB 4HKXA 1A1NA 1LO0H 1N5AB 2LR4A 5AKVA 3TCLB 1U30A 3DJTA 5LBVA 1SJMA 5IIEB 2QDDA 4UIKH 3RFZA 1EXBA 4Q8VA 4RQQB 5DJXB 4X6EA 1F76A 5TE7L 5IEHB 3IIOA 3AIWA 3BUYA 4DUWA 3IAGC 4KJQC 1M2OA 5I3IA 5D7JD 2GYSA 2WBJD 2HTLC 1EAPA 3O41A 4QPEA 3FN9A 4HLEA 1BQHA 1S3RA 5M7QA 3MOAL 3GBDA 1TEGA 4FFVC 5PCYA 3C5ZB 4DJED 1D3GA 4JM2C 3IFNL 4UV7L 3CVIH 1NKGA 1ZBCA 1VCAA 2DPEA 2Z00A 5CN3A 3AG2B 3RJOA 3QUMA 4AGQA 4R3UA 4GI8A 3OR7B 3S3JA 2P47B 3USZA 4MY8A 3FTZA 4YBQC 4N2CA 2QDVA 5C0BE 1LL4A 3MJYA 1O7AA 2KX9A 1PLCA 2OYMA 2QSTA 3LLDA 5D2XA 1OX4A 5AUMA 3U4BH 4JLRB 2WUCH 3MLVL 3WY3A 2OS7A 3ZZ1A 3JUZA 4N0RA 4GXVL 3M0MA 1GRWA 1X5LA 1GKOA 1CICA 4FDWA 3EPMA 4GIAA 2AJZB 3ES6A 1UMLA 2C15A 4L1TA 2P0OA 7TAAA 3MRMA 4WWKD 4JQ4A 2AKRB 3WHXB 4DQAA 1T89C 1RZ8A 1A6TA 3HA1A 1YBQB 1OALA 1KSRA 3KDOA 1IAKA 3O8XB 4ORMA 1F4YH 4U6YB 4P5SA 3NPSC 5I1AA 1RH8A 2YD6A 4ZQTA 1KR1A 1LEIB 4FQIL 5CHNB 1NWPA 1BIIB 2Z6IA 3RU8H 2ZXCA 3NA9L 2X6MA 1D5XB 4DJMA 5ICUA 2G2PA 3FSUA 1RK1A 2KT6A 2EDWA 1FDLL 1P2CB 5CLXA 5FIPA 4NCC2 3K5XA 3SO7A 4FI4A 1OK8A 2Y5EA 1WT5A 3JTBA 1YRRA 2YK1L 2DUAA 2HAZA 4PJ7B 1KRCC 1BDYA 4KY1H 4OZHB 4KGJA 3TIDA 3Q67A 3AIEA 5I28A 5L2JB 1F97A 1T6BX 2UX6A 5IMMB 1P4LA 5C09A 2QJHA 1JSYA 1ME9A 3GY1A 4X4XA 3SN4A 2VIRB 2GK1A 3GLAA 3HHSA 5LQBL 3RIFF 5DLMH 2ZCHL 2BY0A 1A7RH 2ICES 1RV8A 5ACMA 3SCMB 5H2BA 2OOGA 4ZRGA 4UTWC 3UL4A 1CCZA 5IB1B 3N34A 4Y1AA 2ZXWB 1CF8L 4MRCA 1XF4B 5D4HA 3M1ZA 1I7RA 1MSPA 1HL5A 2NY1C 3CG8A 4TPRH 1QEWB 3B1UA 5DK0B 1IM9B 5AYQA 1WUFA 1B4RA 2AJSL 2RQEA 4X98A 1WOAA 4JRYE 5L88L 2JBMA 1LWRA 4F40A 3V4VB 4UILL 4M48H 3QUZD 2IDQA 3EGSA 4YFLI 2ZUNA 4P3DA 3FT9A 1DEEB 1MCPL 1MZZA 4NVTA 4P7LA 3M0XA 1GKRA 2E27L 4K7PX 5DK3A 4TR9A 3B7TA 4G6FD 5D72H 3H2CA 1ID2A 1ZT7B 1UR8A 4L9LA 1P0BA 3QEZA 4Z7OF 1KCSH 4TSCH 4WV1A 1PLBA 3MKCA 4DEUA 3N2OA 4L37B 1GJWA 2D2HA 1MSSA 4YUEL 5DHVB 1Q9WB 1TVHB 4AZ6A 4QNPE 1BAFL 3TN0C 2C0AA 3Q65A 1HWWA 4YHML 1SM3L 4DNHA 1QFWI 3VGFA 1E27A 4YMPA 4ZG1A 1O95A 1RQ5A 1TQBB 4A22A 3GU1A 1TZHB 4PJEF 3PPFA 2P46B 4EBQH 1RUAL 1SOSA 3VILA 1XGTA 2XPYA 1NFPA 4D72A 3ZTCC 2VGFA 3FYIB 4APQD 1IXOA 4OIFA 1QKZL 4ABVA 2NUTA 3LZQA 2V68A 1HHGA 4QHLA 5I0DA 1DDHA 4U1KB 4I7UA 3S4TA 3VQMA 5CKGA 2N0MA 3QDGE 2YS4A 2Q3AA 3AXMA 3MCLH 3PNWB 3QXAB 1SFSA 3B9KB 1FOBA 2FZ9A 2QCEA 4EN3A 1XLKA 2QUTA 3EMZA 3QI9D 2O5XL 1AXSA 2ODHA 1I8JA 4NCDA 3NCCB 3FUDA 4LUSB 4F7KA 3HG3A 4O2EA 1SFJA 4GMSH 2QULA 3QDAA 3P3YA 1SXNA 3WQ4A 4QRBA 4PWJA 2Y7EA 3D4CA 4H1LA 1AHKA 1OX5A 1W8GA 3SJVE 3PR2A 5HWJA 4XO7A 2CCLA 3O7UA 3MRQB 3LKNB 1XGPB 1W0VA 1F3XA 2FNWA 4R4FL 4UQ3A 2HJFB 4C1KA 5E2UH 4AD0A 1IILE 5DS2A 2HPTA 4J3WA 2YN5A 1Z9MA 1ORSA 5J0BA 5KSVB 3AY4A 1TENA 1CYXA 1Q94A 1QP1A 4CVZA 4F8NA 4TRPL 2DD8H 2OZTA 1BXXA 4QF1B 3WI9A 2FBRA 3NP3A 2PP7A 3UEZA 3NZGA 1ZCCA 2AJVH 5D2NB 4HJJH 1F4XH 1EC7A 3TA3B 5CEZH 3WMQA 4JE4B 3LAFA 3E2VA 2W62A 3PP7A 1OCZB 3W2KA 1LLWA 4A68A 3OSVA 1QBMH 4LDCA 1N68A 3RNKB 4WTZG 4JQAA 3DX6A 3T6CA 3HR6A 3K7UA 2X1IA 1G69A 3QQ4B 2J8TA 4RA0C 2ICWB 5T3ZL 2XINA 2BWGA 4R2GC 4H8HA 1M41A 1X38A 4YCPA 3ALWA 4WWID 5ESQB 4MDIA 5BOZG 4JHMA 3QH3B 1SZFA 1RZKC 3FJ6A 3HOGA 6FABH 1QG3A 2ADIA 3LNDA 4G70B 4D0CB 2CHXA 2WWKO 2CUMA 3RM8A 5IB3B 1MFEL 2XQ0A 2GEQA 4NZUH 2WJZA 1LP6A 1CDBA 5E1GA 3G6JE 2FWLB 2VEMA 3I4KA 2YAHA 4G6KH 2XQYK 3LM7A 1TYEB 1NOWA 1ZHNA 4KBPA 1R24B 1FPTL 1HH6A 4IGBB 5KAQF 2NY7L 4GIEA 1QFUL 2A9NH 4X61A 3ABLB 5D8JL 4W9TA 2JQXA 3IGFA 2QVTA 2J6WA 4DM1A 3Q6GH 4ONGH 4X2PA 1LM1A 3IXAB 3NRQA 4XBPA 5DURD 3S6DA 3GSNA 3PQYB 1R3LB 2BINA 4H0GA 4LU5H 2NTFA 2P88A 2DEYX 3E3QE 5ICZA 2JQZA 1TVNA 4M6ML 1Q7QA 3O05A 5EOCL 1CU4H 4GRLB 5MP6L 2Y85A 2DEXX 3QQDA 1YTDA 5E6IB 4IRJD 1AHMA 3ZKQD 4JJHA 2YQ3A 3WXVL 3BW9B 4P2RE 4HWZA 3HG4A 2XIOA 2R24A 1QPQA 5I0XA 1IC7H 4Q8QA 2V2CA 2HNEA 4UZUA 3SI9A 4I2XE 1XDTT 4BWLA 1NGZA 4N8CH 3UBXB 1H3UA 2ZCLL 2XV0A 4BK5C 2YKLL 1H7NA 3XINA 3HR5B 1XYLA 4QHPA 1TSHA 4GVFA 3NDZE 5JNYA 3HEIB 3OKMA 2XFWA 1EEPA 1JGLH 1V0LA 5SV3A 1GYCA 3DPBB 3IE4A 1EB3A 3RUGE 1VBGA 1GTNA 4XXCC 2CRYA 3H2NA 4R4BB 3VRLE 3D5HA 4B9ZA 1AQMA 1IBBA 3BJSA 4AF0A 5I5MA 2YLLA 1ECQA 1F00I 2XWBB 3U1SL 1A80A 3G5XB 5HDOA 3HVDA 1QNIA 1U8IA 1YYLH 1AC6A 1QSFD 4LHUD 4X3ZA 1N3NB 2NY3D 3TJ4A 1W3LA 2UVEA 3LNGA 1XYCA 4KHTH 4PGCB 2O5ZH 4I9AA 4OIIH 3TYCA 4EX4A 1OW0C 3HIZA 4NDMA 3VXRD 4Y7OC 1F3WA 4N6QA 3AITA 3QRGL 1CN4A 1SXSA 4MPKA 3SGKC 1IT0A 3L45A 4JB9H 5C08D 3QA3B 1B4TA 2D7OA 1JF6A 5SWZB 3ZYJA 1GW9A 4OLZL 1KXHA 2PPFA 3BANA 4KO7A 4Q8PA 1FVCB 4PHZA 4HFUH 4XMZA 1WK0A 1IM3A 4MAUH 1IXNA 2WAHA 2WHLA 4NUJB 4XBGB 4ONHA 4Z2LA 1EKOA 4OB5L 5HHVH 2BSTA 3ARDD 1IWAA 1NBZA 3D3VD 3NIGF 4GXPA 4O5LL 3O6FD 5K39A 1GS6X 1WDRA 2HWGA 4JO1H 2A9MH 2RB8A 4MJMA 3L81A 5D33A 3T0WA 2POZA 1O6VA 1ZE3H 2YXFA 2DJMA 5JPNB 1XYBA 5AAPA 4J35A 4H0HB 4D0BB 3ARWA 2XN1A 3S0PA 4TF4A 2AF2A 1I4FA 4BZ1L 2D7TH 3R1GL 3SE8H 4V33A 1ISVA 1JF1A 4HOWA 4E42A 4G3YH 4AISA 1EGJL 2DN7A 3L4XA 3W86A 1KGJA 2JTYA 1IRAY 4PLJD 4C54A 3W1XA 4PTMA 2V7HA 3FU5A 3UAAA 4FXKA 5E5RB 1MF2L 5DR5H 4N1CA 4A8RA 5DQDH 3U2SB 4G6CA 4JJOA 3O4LD 1FIEA 2ZYSA 5F9WB 3MGTB 3BLEA 5K5YA 5HAOA 2Y6SD 2HVJB 1RPUA 4O2FA 1N26A 1UH4A 3TO4A 3X3GL 3LD8C 4NNYA 2XUCA 5HI3D 4XZNX 2G3IA 1KTNA 5HPOA 1ADOA 5AHEA 4MA3B 4QLKA 5AVTB 1XG4A 1SUXA 1AACA 4UTUA 5IF0A 1FF5A 1QTSA 4W9CC 2GABA 2WO2B 1PX8A 1RVGA 4L4VD 2V3GA 4MA8H 5FPIA 3IEAA 5CINH 1Z8AA 1ONXA 2R83A 3GW3A 4M6PA 1SXCA 4HUXB 3WH7A 1T21B 2BIOA 3PUDA 2Z8VC 3JZ7A 2I9EA 4FJZA 2P9RA 4N9GA 1F4WL 4LLWB 2OTDA 4PY7A 3FX4A 2DM3A 1VACB 5AQ0A 1Z0MA 2EC9U 4K7PL 2DEWX 3JWDL 1P69B 4GB9A 4QXUL 3STFA 4HPXA 2FDBP 1FWSA 3WF0A 3CV2A 1T20A 3L5IA 1A6VL 3HE6C 5GSVB 1W8EA 4X9FA 1FH9A 2CO2A 2R1XA 4JKWA 1BXNA 3W9ZA 3EOAB 5EEZA 3QV9A 1CXFA 1ZA3A 3OQ8A 3KL5A 2R0LH 4R7DA 3V10A 1JNLL 5CPQA 2E6DA 4YSTA 3MQIA 4IQJA 1A5LC 4GKSB 2F1EA 4HUNB 4FXGB 4IU2B 2NXYD 3CPLA 3R1ZA 2IPWA 3FFSA 4BZ1A 2VX7A 2A7NA 5I26A 3QCTH 4C56E 3R8QA 5GIRA 1J1PL 1O9WA 3EYOB 3NSXA 1DFXA 1LE9A 3HG2A 2W59A 4K36A 2JJSA 4ZAKC 1LP9B 4XP1H 4KU1A 4KKLD 3EDEA 5CZVH 3EWWA 3R4DA 3MMTA 4YR6B 3R8HA 1J1XL 3DBXB 3UGEA 1P1MA 1QVBA 3W23A 2GCYA 2NXHA 1MRFH 1QUPA 2K9FB 4QUOA 3DC0A 4HXBL 4RGNB 4RNIA 1UOKA 1MVFA 3A21A 2A6NA 4MZIA 1LO3H 4Y9FA 4XPAH 2MHAB 3QYMA 2QAFA 2PW2A 5DT1L 1DQTA 4DT2A 3MROA 4DXVA 4QXGL 4NF7A 2AJ3A 5EMJA 4LCUA 5KVDE 4UR8A 3QIUA 3T8MA 3QYNA 2OZ0A 1YXYA 2ZSWB 1S9XB 3NQAA 1O60A 4PGDB 2C3GA 2GJNA 2P28B 1PCWA 1WIPA 2YXMA 3P0GB 2PUZA 3GUWA 3CIWA 5CMAA 3B5TA 5A16A 2GK0A 3VD7A 2Z91A 4BFGA 2HZHA 1QNSA 4CD5A 3P4NA 1SO6A 3QPYA 4G72B 2VLLB 3IPBA 3T4AA 4KDTC 3HZ3A 3FTUA 3H4WA 3SPVA 4U4BA 5HGGS 1FIGH 3M5ZA 2V5TA 4H20L 1B6DA 3C9NA 2M8XA 4FLQA 3DFOA 4ZENA 2H2SC 5HHPB 4QRQB 4OLYH 2HFEB 2OQJA 3PWNB 2QL1A 3S2LA 1RCXB 1OSEA 4MNJA 4RMBA 1B3OA 4G9DB 4K7FB 5KZEA 5L0QB 2YHGA 2EILB 4RR4A 2EZ0D 2OX5A 2IQ9L 2VW7A 1YEEH 4NO3B 2DT1A 1J8VA 1CVRA 1NJJA 1KXVC 3VE9A 4WQOA 3TF4A 2A9AA 4HN4A 3UROR 4HMNA 1FWEC 3GXMA 1EPFA 5IBUB 3U57A 3ZKMD 3ATEA 2X4OB 2IOIA 1FDJA 1GOHA 3OTTA 3VVVA 1ZJAA 5KS9E 5I71C 2VQ1A 3SKJL 4PJIF 4KEZA 2J7BA 1Z0NA 3IDNA 4RZ4A 1W72B 3UTPD 1MZYA 3NVDA 1N0LB 2QR0A 5FL1A 1N5YH 1UM6H 2G3JA 1OAUH 3WE1A 4D6DA 3FTGA 3WEOA 4FO4A 3FT3B 1JZ3A 4FX6M 4TV5A 5HWNA 1MFCH 4PJXB 2ZKWA 1Q2RA 3ARUA 2XLLA 2YC1A 4HAGA 5HGDB 4FLSA 1KTKE 2DOCA 2H1PH 2JSFA 5C6WH 1KBBA 2O4EA 3UETA 2PNDA 3QXBA 3EJSA 4G8EA 2PURA 1TRDA 5B7YA 4LESA 1EXGA 2IPGA 4UTKA 2YD7A 3MFFB 3PUCA 1ML1A 1DN0B 1PEZA 3G04A 3T07A 3FNDA 1WCBB 5LNWA 1P7KB 2V2WA 2TODA 1TMQA 1JZIA 2VLRD 3IBEA 4N0FB 3KOFA 1SO4A 2OWCA 3ZKXC 4MDJA 1ISYA 3M17A 3ZS4A 3DZ1A 4KETA 3FT2A 4HUWB 4G1EA 4JYEA 3ZVHA 1JDAA 5HMDA 4L2LA 1V3JA 2Y5TA 5D4IA 1RHCA 4AWEA 5D09A 4RZCA 3SZ8A 1FSKB 2O9PA 5C0IA 4C6CA 1RULL 4MMZB 4V11A 3TN4A 1ETZA 4P46A 4K1GA 1KLGA 1MRDH 3Q1SH 4ORGB 4KO6A 5IROC 3W39B 5D2YA 3AREB 1XLMA 5CGMA 2QFRA 4TNEA 1DVFA 4JQ1A 4GKZA 2WZTA 1OD9A 1TZZA 3W83A 3L7FA 1CDGA 1P48A 4IGHA 1CX9A 3CFIC 1P1XA 1FL5A 4O0ZA 3OLEA 2ZX7A 5AHMA 2O7SA 4YO0B 1J0KA 1YNTA 3FO2A 4O28A 4WKAA 4ZNEE 2Q8BH 4Q2ZB 2XSBA 3NWRA 4Z3EA 1JS4A 2VDRB 5ABEA 3FCSB 3CH0A 2XH2A 4RBPH 1RZJL 4KK8C 2UYLB 5LIYX 4P5KB 1B4JH 4QM1A 1AGFB 1J5CA 4W9DC 1KBPA 4A38A 3MO7A 3QZOA 4R90L 3ERXA 4Y4FA 1DBBH 3H2OA 1DXIA 5TK4A 2A73B 3IIXA 3H3PL 3PIQA 1KB9K 1K02A 4C55A 3QUYD 1URZA 4HJ1A 3A3WA 2WANA 4CBPA 5BWFA 1HIMH 2QVNA 3TBTB 2JIEA 4WJ8A 2P26A 3FH7A 3I9PA 4K3DH 2EECA 2R7EA 2ZC8A 1A4CA 5I0WA 3AHYA 1QX1A 2P5PA 4OGAD 2DQTL 5XIAA 3VWJA 1UWTA 3CD4A 3HAEH 2AK4B 1NBYA 4PRDA 4LL1A 3W1ZA 4D6EA 3WJMA 3FTWA 1QLRB 2OI9C 1HDMA 2ZRYA 3FXYA 2Z65C 1PX3A 1QO3B 1FBAA 5LIXX 3DBSA 1YMYA 4L4TD 1CDUA 3GFYA 3HN3A 3JYBA 3ALPA 3VIKA 4Q52A 1GOOA 1WYIA 1HL8A 4UTFA 5C0AB 2DV0A 5BPPA 1H5VA 5FF7A 1ESWA 2J1YA 4L3ED 3RRAA 4GW1B 1UC5A 2PW1A 2CNCA 3T04D 2C91A 4G7EA 2GHZA 1SFHA 1O1HA 5BCAA 1VZGA 2BVPA 1AZ2A 3SE3A 1YQVL 2CHDA 3GG8A 4O02H 3P80A 3AS0A 3MACH 3NZSA 4PUEA 3SIMA 4KJWC 1TCMA 5ENWA 3EJYD 2O5NA 3I6RA 2WJDA 2WZMA 2IWFA 2CHOA 4KRLB 2Z7GA 3EXLA 3CXDL 3A5VA 5F1IA 2EYSB 1CJYA 4IW4C 4HOZA 2JB6A 1NFDB 4E0RB 1IQWL 2Y3AA 3CCHB 1B0IA 2Q6ZA 3QORA 3TVAA 3JV5A 3WLWD 4TMBA 3A6CH 3LXUX 2Z8WC 4YLBA 3WIFA 4KUCD 4PRNA 4LSPH 2HT3C 1HL2A 2AEQL 3KTXA 5GGVL 2CBJA 2DQJL 3C61A 1S5NA 3RWGB 3SFKA 3IWVA 2MNWA 3BVUA 3E6EA 5DA4A 4R4ND 4ZOCA 4ABQA 5TQ0H 1Z9AA 3S8WA 3WNMA 3IFLL 4ZFOA 1NCAL 4RISL 3F7LA 1X5MA 2EYRA 4AYBA 4ZI8A 1MVYA 4PB0H 5ITFB 3GB7A 4G8GE 3G18A 5LLIC 1J8HE 1Q63A 4FNQA 3MI6A 5HTSA 2JKTM 1J48A 2CXEA 3A4FA 5ALCH 1A53A 4PV1C 1L5GB 5FKAA 4WO4C 3RTQB 1AJ2A 4PODA 1G1OA 2APBA 1WEJL 2CK2A 1A7QH 1WDSA 3NR0A 1GY2A 1WHOA 4BFIB 1Q0YH 3FQNB 3WV0A 5L9DH 5E0FA 3DO7B 1AS8A 1E6JL 3QIWA 4M6NH 4S39A 3EEGA 2WXJA 5DMGC 1QWGA 1FWWA 5EU4A 4UWMA 4H7VA 3ZSSA 3U2EA 4H4NA 4C83B 1NGXA 3VXTB 4XMLL 4G83A 4OUOA 1Z9NA 1P5UB 4MQXD 5DEZA 4O18A 3KZSA 1KFJA 3DSNA 2YPLA 2JLLA 2GJJA 1E0VA 2Z34A 3NACH 3VXQA 1C1EH 5MI0B 3GM0A 1RK6A 4NPJA 3DWTA 3WEXB 3PZTA 1S7VA 2XVNA 2IAND 3BMWA 3K2UL 1XIGA 5FGCE 5KANI 1FUNA 1PU0A 2DQIL 4QCEA 4HJIA 1W3HA 2QGEA 1A9BB 3EXJA 4YYFA 4CCCA 1C12A 3EW3B 2XFRA 1BQGA 2GY5A 3AHZA 1EFXD 2JXMA 2WTOA 4W8AA 5C0CD 2FTAA 3WIIL 1CR9L 2DSZA 1QDSA 3UAEA 3UCQA 2VDOB 4MTVA 4QRRB 4JFEB 1VLWA 5HMEA 5T5NG 4YDLB 1ZT1B 4AM0B 3UTTA 4AEIH 4RFOL 1E9OA 3WJJA 1U93B 2CZNA 3KXFB 4F0LA 1S8DB 3MODH 4NO0B 4KI5C 4V27A 3PY9A 1J05B 2GGEA 1ZTXL 1PPIA 5CN2A 1CBVL 5LCVA 4PRBB 5IB2B 3BJLA 4R5EA 2NQCA 1G1KA 2XKNA 1DEDA 2DTMH 3CQJA 4X9YA 1MZHA 1AGEB 3A67H 3IMRA 4NHCL 2QJMA 1L4IA 2FX7H 4DF1A 3SGJA 4X6DF 3C2AL 4MA7L 2AEPL 1UT2A 4ZUVA 4CVXA 3FB5A 4Y5XA 1X4ZA 5EBWA 4ZFZA 3IJHB 3LCYA 2OB3A 4RZ5A 2YEVB 4M1RA 3VYPA 3NO5A 2B39A 2PO6D 3H7LA 4AGMA 1TZGL 5BOPA 4OVXA 1QQDB 2JKNA 4MQTB 1VYSX 4D9LL 1M03A 5FW8A 4AVNA 1IFHL 4J3SA 5C9UA 3T71A 4R26H 3V4PA 3R0NA 4OCWL 5B7ZA 5HYSB 1GGBH 2E9LA 5D70H 3CDGB 5INCA 2WNKA 3KLHC 1XSJA 1B4LA 1OYBA 1XLHA 3IVKB 4J3OD 3U0TB 3HRZA 3K6IA 4JY6A 3VH8A 2VHLA 2F1AA 4XVJL 1XHHA 4XNMA 1EEZA 1C8PA 1RIHL 3H7BA 3WUBA 4HFWB 1EDYA 1RU9H 3V0IA 4NWTL 1XJBA 4MCYB 4X4MA 2CUHA 3N6JA 4PJBE 3GYCA 4QS5A 3ZE2B 5EFFA 1IR1A 4O50A 5JQHC 5J13B 4HWEL 2CU9A 4AUBA 4KWOA 3UTQB 4CNOA 1KWKA 2XNAA 2VFHA 4MBRA 4DKDC 1ED3B 2BOLA 2J6EH 4QROA 4IQDA 1V7ML 3CH1A 5JIKA 3HI5H 2BIIA 1UB6B 3F64A 2VDKL 1XIJA 5I1IL 1D8WA 3CFJA 1PHQA 4LAUA 4L1WA 1D9KB 2BW5A 3NH7L 4QI3A 1K8IB 4DQOL 4X4YA 1SR9A 3GZQA 4PRPB 3FU7B 4D71A 3NJKA 5EO1B 4P7NA 4LVOC 1KWGA 4E5XG 4Z1BA 3DMMD 4H9VA 2RDWA 4FYQA 3A4AA 1V5XA 1SBSH 2O72A 2AI0L 4I4WA 4PQXA 3T2PA 1N8ZA 2CRMA 2NZ9D 4ML9A 2Y5SA 2BW4A 2WY3B 4J3OG 2JI2A 5DHXB 3T44A 1XL9A 4QHUB 4OLXH 1M7DB 3LQAL 1D5MB 1IAIL 1GYMA 2OLDA 1U2CA 2HNHA 1MFBH 2EO7A 3QCVL 4G7RB 2XN9E 4JBRA 4L7ZA 4W70A 2AGJL 4GABA 3N2BA 4F3FB 1I1FB 5F7UA 8A3HA 3C52A 3S42A 2VT0A 4GBDA 4LZKA 1UWSA 4BH7B 2A21A 4U4MA 2AQOA 3RX8A 2GLKA 3H9SB 4HLZG 4X9IA 1ZCRA 1CFVL 2H5UA 4HTYA 4QDGA 3LQZA 4NHVA 2WSRA 3D6GA 4EKJA 2ZZ4A 2YRPA 4Z23A 2VD9A 4B60A 3QHFL 3FUKA 4Q6IB 3KYKL 4PR4A 1P7TA 4NYLA 4US5A 2XZAH 4U7KA 2GDQA 4RW5A 3BEVA 5D9MA 2A85A 2NXIA 1KZQA 2VDPB 5JHMA 4A6YL 3BT2L 3ZVIA 1CURA 5DJDB 5IV2B 3KCWA 3O4LA 1SLVA 3K4ZA 3IIVA 4PRIE 1T6MA 2LQRA 2J7LA 4OM1L 4OZGE 4DH2A 1HAWA 4UTIA 2AQNA 5A6BA 1KXQA 2NY2C 4OFKA 1DE4B 4E2DA 3ZN6A 4NERA 1TFPA 1IGJA 1ZS8A 3R0DA 2Y36H 1SOXA 1XIWA 4HC1L 2JQAA 1EJ6A 1GEHA 2AZUA 5F8QC 4EOWL 5D5MA 5GJMA 1Y5WA 3EX4A 3RNDA 4QHMA 2BNRD 4DP4X 3O9WA 1KFEA 1RJRA 1L6YA 2HLFD 1R75A 5KSUB 1KYDA 4NBYB 3BAKA 2V5LA 3ABZA 2VCAA 3BI9X 3X11B 1YTKA 2DQDL 3RWCB 4A67A 2WQAA 4NZRL 3VINA 4M51A 3UPRB 1JF5A 2CYGA 1HHIB 4Z95L 2OL3H 4Q97A 1OGBA 2YZ8A 2H3NA 1JGVL 1MIMH 4ELME 3VD4A 3UXKA 1HILA 1N8WA 2FJFA 2XQBH 5DFVD 5M95B 1S7XA 5I06A 4LVGA 3LV3B 1KB9J 1KJVA 3L3IB 1TQCB 3G77A 5GJNA 3FU8A 1W0YT 5DUBA 3LCGA 1H0DB 2D31A 4FHAA 3L3OC 1OFAA 2BZ7A 4NWUL 1NMBH 4D9RD 1V0MA 3KJ4B 2RTTA 2BG5A 2W0LA 1O6TA 1RVFH 4M9OA 4MCMA 5HYQB 2PWFA 2O0TA 3KHQA 3TEZA 2UZYA 4DCQA 2QVFB 4M6AA 4NRZB 1KJ2A 4ZODA 2VCBA 4PUBL 1M7OA 4B5XA 1XDJA 3QJXA 3TJXA 5HMSA 1G84A 3W7RA 3UNTA 5JW4M 1ZQ5A 2REQB 2WJ5A 4UM9D 1ULVA 1YEDA 2LLLA 2D2OA 3I74A 2XXCB 3TQVA 3AQZA 1CIDA 4A6YA 4H25B 3BZJA 4I89A 3P5ZA 1KTDB 2PU0A 3FOKA 1RJLB 1JUBA 3RGHA 3ZE0E 5I3HA 3ENLA 4AIXA 1KGCE 3MRHA 3FK4A 3N04A 4JTJA 4M1BA 2X4RA 3E0IA 3WLOA 3AADB 2ZFAA 1KD0A 2C18A 1PKQA 3MA9H 3FONB 5GGRB 1JHKH 4B50A 4U6XB 1CWVA 2F9RA 4M43L 3NZUA 3ARXA 2XJLA 4HC1A 4KHXL 2WLZA 3DIFB 3EJRA 3TN3A 1CEOA 1WZMA 2H6PA 4HCLA 3DX9A 3WO4B 2BSBA 1CFQB 4FP8L 3QMSA 3VUPA 4JBSA 4HSHA 2FRGP 1JCMP