3QGVA

Crystal structure of a thermostable amylase variant
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
435
structure length
435
Chain Sequence
AKYSELEKGGVIMQAFYWDVPSGGIWWDTIRQKIPEWYDAGISAIWIPPASKGMGGAYSMGYDPYDFFDLGEYDQKGTVETRFGSKQELVNMINTAHAYGMKVIADIVINHRAGGDLEWNPFVNDYTWTDFSKVASGKYTANYLDFHPNELHAGDSGTFGGYPDICHDKSWDQYWLWASQESYAAYLRSIGIDAWRFDYVKGYAPWVVKDWLNWWGGWAVGEYWDTNVDAVLNWAYSSGAKVFDFALYYKMDEAFDNKNIPALVSALQNGQTVVSRDPFKAVTFVANHDTDIIWNKYPAYAFILTYEGQPTIFYRDYEEWLNKDKLKNLIWIHENLAGGSTDIVYYDNDELIFVRNGYGDKPGLITYINLGSSKAGRWVYVPKFAGACIHEYTGNLGGWVDKYVYSSGWVYLEAPAYDPANGQYGYSVWSYCGVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a highly mutated, thermostable \xCE\xB1-amylase variant
rcsb
molecule tags Hydrolase
molecule keywords Alpha amylase
total genus 154
structure length 435
sequence length 435
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2011-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3qgvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3qgvA01
2XVGA 1K9FA 4A4AA 1GJWA 2CESA 4D71A 3EMZA 2G3IA 1QHPA 1MFUA 1WPCA 1PBGA 2XVPA 4ATDA 4AD1A 4C7FA 4BQ4A 4D6HA 1S46A 1H41A 3NSMA 2BVDA 1FP8A 3UERA 4XV0A 5GQBA 3U7BA 5DT7A 2GJXA 1TQTA 4PUEA 1GUVA 2EPLX 1JZ7A 1OSEA 3A24A 1CDGA 1XC6A 1Q6DA 5A6JA 4TTGA 4AZCB 3L2LA 4L4OA 3TV8A 1PPIA 4GIAA 3AMGA 4YN5A 3TP4A 1KWGA 3K8KA 1R8LA 1E40A 3OIHA 2VT0A 2W92A 2F7QA 4AD4A 4D1IA 4GI8A 1KB3A 5EFDA 1H11A 2PBGA 3BAYA 5E1QA 2GDUA 3WNNA 1B2YA 4HPGA 3PBGA 5LA1A 2V38A 4JL1A 1T0OA 3QHOA 3VM7A 4TUFA 2ZUTA 2WMJA 4GQRA 3S6TA 2X09A 1U30A 1KR1A 2VZSA 3KLLA 1ECEA 3G6LA 1K6AA 1DEDA 4AXNA 1HNYA 2UY3A 2WM0A 4UQ9A 4GPNA 1GOKA 3PHAA 4LYRA 4M29A 4KRUA 5CLTA 3BLKA 5ABGA 3OLDA 3D5HA 4AZCA 2VX7A 4MNKA 3BLPX 2DH3A 3AYRA 1JZ3A 3AIWA 1J0HA 2BFGA 3VTRA 1TA3B 3AIQA 4E8CA 4M81A 2CHOA 4L4PA 4H2CA 2JEQA 4EAMA 2VR4A 3WBAA 3L4TA 1VBRA 4DM1A 4RE2A 2V3GA 3WQ6A 5DEZA 1OBAA 1UWSA 1VFFA 2ZXQA 3CUGA 4AD0A 3W81A 3CUIA 2OWXA 1C7TA 2J74A 5BRQA 3QHNA 1G94A 3AS0A 2AAAA 1J01A 1B9ZA 4W5UA 1LL4A 5A69A 4AC1X 3AICA 2XUCA 2ALWA 2WSKA 5DF0A 4W88A 2WCAA 4MAVA 3WH7A 1QHZA 2ZUMA 1JFHA 1FH8A 2CIPA 2FHFA 3BAIA 1XD0A 3O6AA 5A95A 2ZUWA 5FIPA 3CC1A 2O9RA 2XTKA 1J0JA 3OA5A 1UHVA 1ISWA 3BVTA 2XG9A 1A3HA 3BC9A 1LQ0A 1KGUA 1WZLA 3W53A 4KMQA 1HL8A 1JL8A 3MS8A 4EK7A 2XVKA 1GQJA 3VD3A 1UWTA 2WSPA 1ITCA 4FLSA 1UD4A 2YL9A 2WHLA 4JFWA 3VD5A 5D9MA 3FHAA 4FMVA 1HTYA 3IJ9A 1C90A 2G3JA 1BYDA 2YBUA 1K9TA 4J3VA 5KZ6A 2F7OA 2ZWZA 3VPLA 3WKZA 3WQ4A 3AMDA 1UD3A 1E6NA 2D3LA 3IK2A 3VIJA 4P8WA 5I5RA 4BA0A 1HJUA 3BVXA 2GUYA 5IHSA 1W3LA 1TVPA 4AZBA 4P7RA 3CZEA 3SCVA 5CSYA 3PZIA 2PI6A 3CGTA 3WEZA 4PBGA 2V3EA 3ECQA 2QV4A 1EOMA 4F9DA 4UQBA 2Y8VA 4XX6A 1BGGA 3CHEA 3CMGA 4OIFA 1B3XA 2DSKA 1O6IA 4ACZB 1BLIA 3EJTA 3WY2A 1BGAA 1DTUA 2NW0A 2XGIA 2CITA 2HVMA 3SCWA 3OZOA 2W61A 3N18A 4AMXA 1BYCA 1W32A 1C8QA 1R75A 3VIPA 2PC8A 1Z32X 2CBIA 3AXIA 1HJVA 1OM0A 4XZBA 3RILA 4JCMA 4FNTA 4MB5A 5IXEA 3B8SA 4U33A 2X0YA 3GXPA 4UQEA 4DM2A 3KLKA 2XFYA 3OLIA 3CUFA 3EJRA 2W91A 3AJ7A 5ABFA 5CPTA 1G9HA 2VRKA 3WDPP 4M80A 1MQPA 5A2CA 4UFMA 3L4VA 4XZWA 5E0FA 3DX1A 3G6MA 1OB0A 3WEMA 1RP8A 3DDGA 1UASA 4B3LA 4LGXA 1HKJA 1ZU8A 4MTVA 2Y2WA 1VEOA 1W3HA 3WUFA 1UR0A 1B90A 2B31A 1P6WA 1WB0A 2PWHA 3IANA 3N17A 1CLXA 3POCA 1QNRA 3ALGA 3GH5A 1XYFA 5LYRA 3ZQ9A 2MANA 1HKIA 2VI0A 1EGZA 5C70A 2BVTA 1YQ2A 4JKMA 1BG9A 2J7EA 1MW3A 4FLQA 1G01A 1HP5A 2E9BA 3MMUA 3SCSA 2EJ1A 5AC5A 5E6ZA 2XWEA 3L4ZA 4ZE5A 4FNSA 2W63A 3EDFA 1W9XA 2YA0A 2X2YA 4AW7A 4J3TA 1W9PA 1JDDA 5D9NA 2CKSA 2FDMA 2C8NA 1E6PA 4TXEA 3SUSA 1CXEA 2XM1A 3A22A 5TD4A 5A6LA 3A21A 4BQ3A 2JF7A 2WWDA 4PMQA 2WHJA 4A3YA 4KH2A 3RPMA 3TTSA 1W91A 2QMJA 1E0XA 4UOZA 3ARPA 1AQMA 4CD4A 1M03A 4UFJA 3L4WA 1C91A 1I1XA 2VJXA 2Y8KA 1XSKA 1HVXA 1XD1A 5EFFA 4JL2A 5ECUA 3ZJ7A 4OBRA 1FH9A 4HOXA 1CXLA 3VD7A 4MNJA 1R85A 4WKAA 5ABEA 4PCSA 2WKGA 4FLOA 2VX6A 2V5CA 1MFVA 4KRTA 3NDZA 1TQVA 3FAXA 3HZ3A 3VMPA 2VMFA 1UKSA 1CXHA 2VRJA 2WMKA 4HMDA 3KL0A 3PZQA 1UWIA 3FAWA 3AISA 2XN1A 3BCFA 4BQ2A 2XSBA 2WPGA 2BVYA 1LG1A 2VL4A 3WMCA 3AMCA 1XYZA 4W89A 7CGTA 4YHEA 2X2HA 3A4AA 1BF2A 1HJXA 3WH9A 3EJPA 4E2OA 3T09A 4BQ5A 4UTFA 3FHQA 1QVBA 4LX4A 6CGTA 1EHAA 1WDSA 3AROA 1HL9A 4MADA 1NOUA 2XPKA 4CCDA 4AMWA 1QPKA 1OD8A 1QWUA 4WSKA 2UWFA 1CYGA 1CBGA 3AQUA 1CGWA 2NT1A 3W26A 4QLLA 4WK9A 1OT2A 2V3DA 5AY7A 4Z2HA 1FFQA 4UR9A 1BVNP 5HPOA 2X1IA 4PMDA 2FH8A 3A47A 1G0CA 1BHGA 3WBEA 1KXHA 1GVIA 3PZUA 4IUGA 1ZJBA 2AMGA 2OSYA 1AMYA 4J7RA 3GXMA 5GPRA 5A8OA 2ZUVA 3VNZA 2CHNA 4OKDA 4OZOA 1CPUA 4Z2GA 3U5UA 2Y24A 1V6WA 1PZ3A 2GDVA 4MNMA 1W1YA 4P8VA 4WJXA 5HPCA 2PWEA 1GQIA 5E09A 1GONA 3BVUA 3GXDA 3VGFA 1J10A 3WDQA 2BY2A 4NRRA 3RM8A 4BS0A 1ZBWA 1GHSA 1JI1A 3W24A 2BXYA 3WIJA 1D2KA 2WZIA 1M01A 1OWQA 4W84A 2J7CA 3IAPA 4W8LA 3W25A 4MAZA 4UFHA 4BF7A 1XSJA 2DT1A 5BWFA 3CHDA 3RCNA 5ABFB 5JBFA 1NP2A 3BGAA 4HU8A 1W9UA 3AMKA 2EAEA 5HXMA 2WCSA 4JKLA 1BQCA 3AHYA 4U5KA 5DT5A 4V27A 4UZSA 3OBAA 3M07A 4W87A 3WQWA 2WNWA 1JZ4A 4V2XA 2WANA 3ZIZA 2DIJA 1IZKA 1V6XA 3TONA 2YKKA 3O9NA 3K4AA 1VENA 3N04A 2X2IA 1GJUA 4AISA 1QI4A 3SIMA 1KBBA 4QCEA 2YA2A 5EMYA 1HJWA 1V0LA 3O2LA 4X0NA 1UH4A 1JI2A 4PSRA 3VNYA 3BAWA 1RD6A 4PMXA 5HDRA 3AYSA 6TAAA 4J28A 3WN6A 1MYRA 1SYTA 2DPEA 4AZ7A 4GO8A 3S2CA 1NQ6A 3WDHA 3K4DA 5C71A 4QLJA 3BUIA 3F4VA 3AXXA 3AIEA 3MKKA 4WIWA 3FNDA 1UYQA 2BY1A 1Q4NX 3GH4A 3BAJA 1E5NA 1D7FA 3D51A 1BTCA 5ABHA 3BUDA 3MUY1 4OBSA 3MANA 2XGBA 3TTOA 1VEMA 1W9BM 5A6BA 1NH6A 4YPJA 3VVGA 1UUQA 2D1ZA 4MPKA 4NZJA 1GQLA 3HU7A 3WELA 3D4ZA 5A8NA 1RP9A 1E71M 3UESA 1JZ8A 4DO5A 4N0RA 1IZJA 3LX9A 4AD5A 1CLVA 3DX0A 4NZCA 8CGTA 4UQCA 3DYMA 4GZJA 2WZHA 3W4RA 2YL8A 3ZM8A 4HMCA 3SCNA 1SMAA 2W5FA 2DEPA 1NARA 3UG3A 4QLKA 3UG4A 3GH7A 1CGYA 2BY3A 1G1YA 3BVVA 3ARSA 2VVNA 3VDBA 1I75A 2YLAA 2A3BA 1XH2A 3WDRA 1B3WA 2EO7A 1UKQA 2A3CA 2BHUA 3GNOA 2D0GA 2O9OA 3VDAA 3HG2A 3VGDA 4PRWA 1XCWA 3L2MA 3ARVA 4NX0A 2QLYA 1VIWA 1ODUA 4C7GA 3WQ8A 1UA3A 1W3JA 1OGBA 1JYXA 4P8XA 3GTNA 3W37A 2QF8A 3SUWA 1L0PA 4TVUA 1H0IA 1I1WA 5D8ZA 2WVVB 2YFOA 4J3WA 1DWFM 1XHGA 4NXSA 4HTYA 3MMWA 4LXFA 2W67A 3AS1A 2JIWA 4CD6A 2VQTA 2W62A 5IFTA 4CKQA 2OYKA 2DSWA 1AQ0A 2F7PA 3KL3A 1B30A 2CBJA 2QHAA 4ZXOA 4OOZA 3MUIA 3WEOA 4W7VA 3ZR5A 1JGIA 5E70A 2YDQA 1QI2A 1GORA 2PWFA 1JF5A 2VCBA 4DUWA 2JF6A 3N15A 1ITXA 4D6JA 1ZS2A 4M24A 4DWSD 2WVTA 1WP6A 4GXPA 3TOPA 3CHFA 3GBDA 4CU7A 2WW5A 1E6RA 1JFXA 3WD0A 5BXSA 4KGLA 3UCQA 2J7BA 4Y7EA 4LYQA 4NF7A 2OSWA 3MSDA 3PZMA 3VIGA 1CWYA 1JYWA 1SR0A 4W7UA 2CERA 1HKMA 4NXKA 2OLHA 4W8AA 5I2UA 4F66A 5CZKA 3VMNA 3VDHA 3HG5A 1V0KA 1WAWA 5LA0A 5CSUA 5FOOA 1B3YA 3D50A 1TQUA 1VEPA 1KXTA 2CCRA 1EQPA 4YHGA 2GK1B 2ZOXA 3N12A 3CUJA 1O7DC 3SURA 1CXFA 1EOKA 2BNJA 1AVAA 2IXUA 3RJXA 3K8MA 3MV01 4D6CA 1TE1A 3AS2A 5A3HA 4ACYA 1F4AA 3AI0A 3J7HA 1YHTA 3AIBA 1V3JA 2ZX6A 5D9OA 1BPLB 2OYMA 1CGVA 2GJRA 2XIBA 1E0WA 4OUEA 4QAWA 4J3UA 1VJZA 3DC0A 4PCTA 4Z2JA 4AEFA 3AOFA 3AZTA 3THCA 1JIBA 2C7FA 1DWHM 3AFBA 3SCRA 1EXPA 3VM5A 1E6QM 4AYGA 4H8UA 3GXNA 3RMEA 3AHVA 1UZ1A 1BSIA 3VILA 2VRQA 4AD3A 5JUVA 3W38A 1E1EA 4EKJA 1FOBA 3VGGA 4W86A 3I3DA 2D3NA 3WY4A 1C7SA 3FW6A 3F5JA 2VUYA 1WDRA 2BHYA 4CCCA 1UKPA 4PMVA 4B15A 4M1RA 5M3WA 5CPSA 2Y4SA 1KTBA 2O9TA 5IDIA 2A3AA 1QHOA 3CZNA 1SMDA 4D6FA 5M5DA 3CTTA 1KBKA 1V02E 1GOOA 4U3CA 3OLGA 1UR9A 3NUKA 3NSXA 2ZUSA 3APGA 3I3BA 1ZBCA 2BS9A 2WHMA 3GYCA 3ZOAA 4WKFA 1KXVA 4ATLA 4ZENA 4J27A 3W6LA 3PZOA 4CCEA 3VSTA 2DSZA 4WKHA 5A2AA 1E72M 3OGVA 4CVUA 4ATWA 4PTMA 1NM9A 1UD2A 2IUZA 5F7UA 1JF6A 1W2PA 1TMQA 4AD2A 3RIKA 1E3ZA 2ZE0A 3KEHA 2DT0A 4H7VA 3T0AA 1US2A 4FNUA 2WMGA 1WO2A 4LQ1A 3L4XA 3ARYA 3WFZA 2DDXA 4V28A 1OGSA 2ESCA 4UFLA 1PX4A 2WWCA 1E4LA 1W3KA 2WBGA 5AC4A 4WLCA 4D1JA 1R33A 4HMEA 3SCQA 5A6MA 1XH1A 4AEEA 5I77A 5E6YA 2AOSA 2OW7A 1EHNA 3VMOA 1LJYA 4GINA 2VC9A 3E1F1 5I3DA 3ZT7A 3NIYA 1OIMA 2UY4A 1FP9A 4LYPA 1CGTA 3ZT5A 4DUVA 4W85A 1V03A 5CG0A 5CQ1A 4UQAA 5CGMA 4AIEA 1E6XM 4PN2A 4CD5A 1HJSA 3AMLA 3WSUA 3WNOA 2DGAA 3SUVA 1FA2A 5I78A 1C3FA 3EDDA 2WXDM 1TG7A 4Q22A 3D52A 4RL3A 3BUPA 2UY5A 3UR8A 1NWTA 1DP0A 4H04A 3WQVA 1CZ1A 2XN2A 1GOWA 2VR5A 2WK2A 1CXIA 1EDTA 1VJSA 3LPGA 2VURA 1M7XA 4PMOA 2EACA 1UR4A 1J9YA 1OINA 3PZ9A 3WH6A 3DECA 1X6NA 3HG3A 3VDCA 1EDQA 3CV5A 4NSBA 4CD8A 2JFEX 1TCMA 3RJYA 3K8LA 1MW0A 1UZ4A 4HOZA 1GNXA 4HOWA 1XCXA 2CPUA 1IV8A 4N42A 2DQXA 1V3MA 5E9AA 1QNPA 2OYLA 1TA3A 3D3AA 1M04A 4JHOA 2ZUUA 1WE5A 2G4FA 4IISA 4TTUA 4HA1A 1AQHA 4CGTA 4GI6A 4HP5A 3ARZA 1JG9A 2GK1A 2ZXAA 1H49A 3HN3A 1PEZA 3RDKA 2ZUNA 5M17A 1UA7A 3ZJ6A 5EB8A 2E8YA 4XUYA 1TUXA 4P7NA 3BSHA 3WF0A 3WMBA 1DHKA 1E4MM 2J7FA 1ESWA 1H0GA 4TVDA 3F5LA 3WD3A 3WNLA 2FHBA 1VF8A 5A6SA 1JZ5A 2BHZA 4HZ8A 4D6EA 2DT3A 4A3HA 2TAAA 3PTMA 2GJPA 4PYSA 5M03A 2Z1SA 3UG5A 1FH7A 1X6LA 4CN4A 1E55A 3N13A 2D0FA 2J47A 3WL1A 2V3FA 4B9ZA 1EA9C 3VIHA 3H55A 3VGEA 4AZIA 1HX0A 5I79A 5AYIA 2O9PA 4JCLA 1J11A 3MUAA 1C92A 1E70M 4PMUA 2XN0A 2WMFA 3WNPA 4U2YA 3BAKA 3LPOA 1CIUA 4WSJA 2FH6A 6A3HA 5BCAA 5FD0A 3BXWA 4B9YA 1E6ZA 1NWRA 2ZX9A 4K68A 5D4YA 1MXDA 3CZKA 1BVZA 4M8UA 2EPMX 2E3ZA 3AIRA 3CUHA 5GNYA 2BV9A 1UKTA 2FHCA 3IJ8A 3VGHA 1XSIA 2WMHA 1Y7VA 3BLBA 5A8MA 3H53A 1KQZA 1CTNA 4U5IA 2EBNA 2J78A 4H8VA 2XFFA 5GNXA 1KCLA 3ZSSA 2E9MA 5JIPA 1HP4A 9CGTA 3MO4A 4IPNB 3OB8A 3T2PA 3ARUA 3VIKA 1ISVA 1J0ZA 2J79A 4PMZA 4PSPA 3WUBA 3PZTA 4AIOA 2WKLA 2DSUA 4Z2KA 2VZTA 1JDCA 3OGRA 5D9PA 4FK9A 1UOKA 3S5ZA 4GZEA 2OSXA 3EJSA 4DWSC 5BROA 5CLWA 3K1DA 5LA2A 1NWSA 2J7GA 5BXRA 1LL7A 2CKRA 4UOQA 1B3VA 2VX4A 1UQYA 1R34A 3HMCA 1ISXA 3NYDA 3VIMA 4UFKA 3ZJ8A 4BCEA 3ZSTA 4W5ZA 1HIZA 2DT2A 3WY1A 5BXTA 3VSUA 2VZUA 3TTQA 2GVYA 3ZO9A 1OIFA 3SUUA 1VRXA 1LWJA 1NP0A 1V0MA 4CU8A 1CXKA 1HT6A 4TX6A 4QCFA 3KZSA 1TR1A 5JBEA 1CNVA 3AHTA 2NSXA 3GXTA 5GNZA 1DWGM 2PWDA 1CENA 1H5VA 2X05A 1HWWA 1R86A 3T08A 4PTXA 1MW2A 2WC7A 1OGGA 5EBAA 4KWUA 1WCGA 1ODZA 3W28A 1UD6A 2J4GA 4D72A 2A3EA 3VGBA 3N11A 4NRSA 3A6OA 3AIVA 3CZLA 4UFIA 2J25A 3DHPA 3NSNA 2VZOA 4TOQA 2ZWYA 2J75A 4C7DA 1MXGA 4CN6A 1VFUA 4PMYA 2JE8A 4AZGA 3OG2A 1KCKA 1V08A 3A3HA 1V3HA 2EABA 3II1A 1EO5A 2WLYA 1XH0A 3BCDA 2OW6A 3LRLA 4ZFMA 4OJYA 3HG4A 4D6IA 3EMQA 2G41A 4P7OA 1PIFA 1U33A 3GZAA 3T2OA 1WDQA 4S3JA 3A5VA 1UR1A 1ZJAA 5BRPA 3FY1A 2WAGA 4BZYA 2VOTA 5D8WA 4ZXLA 1FHLA 1QOXA 1HXJA 2YBTA 3EJUA 2CXGA 3VOCA 2J8GA 4MJ2A 3WD2A 4GQQA 4HU0A 5I24A 4RE3A 1QW9A 1PX3A 3D4YA 2BY0A 1ISZA 2X0HA 1LL6A 3QR3A 1JDAA 2WVSA 2HISA 1V0NA 3A4XA 2J8FA 2VVSA 3ZT6A 3LMYA 4MDOA 2YDRA 2F1BA 1BAGA 3CO4A 1TQSA 3S5YA 5JIWA 3GNRA 5HOSA 5IHRA 2Y5EA 4FF5A 5IFPA 4AMCA 2E8ZA 1GZJA 3ZJKA 2CYGA 1HF6A 3LXCA 4DWSA 3BUQA 4P8UA 3WFLA 1RH9A 2OWWA 4F8XA 4FNPA 2GJXB 1H2JA 5I6SA 1KWKA 1HKKA 3LPFA 2XFRA 4WF7A 3POHA 1E3XA 2E9LA 1JZ6A 2EPOA 5FKYA 3FXYA 2PWGA 1MVYA 1R47A 4KGJA 3QGVA 4JFUA 4UNIA 1E15A 3GXIA 3QHMA 2VCCA 2WZEA 1E1FA 3DX2A 3GM8A 2CEQA 5I0DA 4PMNA 5A6AA 3WH8A 3I3EA 4IPLA 3T0BA 1SFSA 2XIIA 4Z2LA 5CJ5A 2D24A 4PUDA 1GOMA 1EDGA 4HZ6A 4CVWA 1E73M 2EPKX 1WZAA 1JAEA 3THDA 2CNCA 3ARQA 1E43A 1BYAA 2WBKA 2XSAA 1SZNA 1LG2A 1UWQA 4QDMA 1V3LA 3BVWA 3DYPA 3W29A 3LRMA 3VD4A 4QFUA 3WH5A 1ZBKA 4UZUA 3JUGA 4JZ5A 4QP0A 3M46A 3VIIA 3UETA 1R7OA 2D0HA 3W27A 4AWEA 4HZ7A 1QI5A 4U2ZA 1R46A 4JFSA 1ZL1A 4PMRA 2UY2A 5BYWA 5A1AA 1F4HA 3MV11 3A4WA 5CPQA 1J0KA 4XB3A 5CXPA 1JZ2A 1KR0A 4FLRA 1R87A 1UKOA 4M56A 2X8RA 3WD4A 3WF3A 1VFMA 1R7AA 2A3HA 3CHCA 2QPUA 2ZXDA 3BAXA 4HPHA 2CETA 4JAWA 1QWNA 3EBVA 1IT0A 1WKYA 4HA3A 4ACZA 2G3NA 1Q6EA 5AYBA 1RPKA 4EE9A 1QBAA 3DYOA 2ZX8A 3M7SA 3OGSA 3U7VA 3T2QA 3KE0A 1QBBA 3SCOA 3GDBA 3PZVA 3VU2A 1KTCA 2ZXBA 1K9DA 1GOIA 1JYNA 2WVUA 1XV8A 3SEPA 4Z2IA 2QPSA 1PAMA 3OLEA 4F79A 3WNKA 1J0IA 1W9DM 1E4NA 3AHXA 3VO0A 5DO8A 5A8PA 1NWUA 5A8QA 4MB4A 2DIEA 2FGZA 3B9DA 4TVCA 4AIUA 4JIEA 2ZX7A 3AZRA 2WB5A 3RO8A 1E56A 3IGUA 2GSJA 3L4UA 1H09A 4J3XA 1EQCA 1HVQA 2XWDA 1FFRA 3WD1A 4URIA 1GCYA 1B0IA 3W82A 1H4PA 4CN1A 5FL1A 4PTWA 1UQZA 4GI9A 1PZ2A 3VUPA 4GO9A 5DFAA 3LXBA 1BYBA 3UEQA 4UOJA 1JYVA 3BMWA 4CUCA 1JNDA 4P7LA 4MNLA 5CGTA 3WMSA 4NZFA 3U57A 1DWIM 3RM9A 5FCZA 1UG6A 3EDJA 3ZMRA 2E40A 3N1AA 3UR7A 3WF2A 4E4PA 1VBUA 3EJQA 2YLLA 1KFWA 2EEXA 1E4IA 2WMIB 1WZKA 1Q6GA 4NI3A 1W1PA 1QW8A 1HJQA 1GW1A 4RE4A 4DUXA 3CBWA 3WF4A 2VQUA 1L8NA 3WNMA 1V6VA 3TA9A 1W1TA 3DX3A 1GVYA 1O7AA 5HBFA 1KGWA 3AS3A 3OZPA 1W1VA 4H41A 1CGUA 2YOCA 2JALA 3DDFA 3VX1A 1BFNA 3B9AA 3NCOA 1C8XA 4PEEA 1TQWA 2RGLA 4E8DA 2FGLA 4UQDA 1C93A 3M6DA 3VSVA 4X0VA 5HNNA 1QNSA 5E0CA 4EANA 5A2BA 3EMCA 1J12A 1CEOA 1UWRA 4B3KA 1OCQA 4AZHA 1JAKA 1KQYA 5A6KA 4MDPA 1GOQA 3L4YA 1WZMA 2YL6A 3WL0A 1EO7A 5KEZA 1EH9A 2WC4A 1UH2A 2EQDA 1QI0A 3CZGA 3KWXA 3A23A 3MU7A 4S3KA 4AZ6A 2ZICA 4M82A 2YIHA 1Q6FA 1EIBA 5JBDA 3MSGA 1B31A 1TZ7A 4AZ5A 4PTVA 2WCGA 4R27A 1E5JA 2J62A 3CH9A 5BXPA 1H1NA 3MI6A 2XVLA 2EPNA 3RM4A 3VD9A 2W66A 2XYLA 2O92A 3KL5A 4CD7A 1MQQA 3K46A 4U3AA 3LPPA 4LPCA 4FNQA 1CECA 2PBOA 3EDEA 3ARRA 4HA4A 2D2OA 3H54A 8A3HA 2C0HA 1PIGA 1MW1A 3ARTA 2Q8XA 4OGZA 3DX4A 1UR8A 3AHZA 2F7RA 3ARWA 3WQ5A 1E9LA 1PS3A 3BH4A 3PZNA 1MQRA 1B1YA 1W2VA 2G3MA 2XJ7A 1CGXA 3LRKA 4R5EA 1QI3A 1ZB5A 1HN1A 3CZSA 4FNRA 1WNOA 3ALFA 2PB1A 3CIVA 3WY3A 3T0DA 1H3GA 1GPFA 2OWCA 4DO6A 1ZBVA 2JEPA 2YL5A 3ARXA 2QMKA 3WENA 1V6UA 1M53A 3NDYA 3SCUA 1X1NA 1NOFA 3SCTA 1UD5A 3WF1A 2IXVA 4W93A 1J0YA 3WDJA 1V02A 2YA1A 2W4XA 3NJ3A 1UR2A 1VAHA 2J77A 3VKKA 5A94A 4IM4A 4JFVA 5C8BB 1US3A 2F8QA 2X2JA 1QX1A 7TAAA 3LXAA 1VB9A 1WDPA 4AY1A 1JNEA 4JFTA 4J3SA 3HJEA 1BG4A 1N82A 4DWSB 2J7DA 1DWJM 2JIEA 3GBEA 2WLZA 1V3IA 3VIFA 3VINA 3W6MA 4F9JA 2YJQA 5FL0A 3EYPA 3TTYA 1PX8A 3QOMA 3W0KA 3IAQA 2CBUA 1JXKA 2F1AA 3IJ7A 3CPUA 4MB3A 2ZX5A 2DH2A 3AIUA 3WUGA 3MMDA 2IGTA 3N9KA 3BUBA 1TFVA 2WMIA 1LWHA 2WVVA 4UCFA 2ZIDA 1E0VA 2V5DA 2VO5A 4MJ4A 4Q7NA 4TX8A 2G8ZA 3WUEA 4GZIA 3DHUA 4W8BA 4H8HA 3GNPA 4DO4A 4D6DA 1XGZA 1GHRA 4P7QA 3CZ8A 1KXQA 3CMJA 1LLOA 2XM2A 3CZJA 4CU6A 2VNCA 3ZR6A 4AYSA 3B9EA 5I23A 5A6BD 1Q6CA 1QNQA 4JKKA 4ML4A 1NOWA 3FN9A 4D6GA 1D3CA 2VTFA 1UD8A 2GFTA 1V6YA 4MB1A 1LF1A 1W9VA 1J18A 2D22A 4W7WA 1FHDA 1PJ9A 3EDKA 3PTQA 2EADA 1G5AA 4ZE4A 1JD9A 2BXZA 2PF0A 3PN8A 4OOUA 2FE0A 2F18A 1UH3A 1JD7A 3AZSA 2WYSA 2DSVA 1A47A 2NT0A 2D23A 3PTKA 3PZGA 1ISYA 1UWUA 1V3KA 3F5KA 2CBVA 2YFNA 1MWOA 1C8YA 1U2YA 1DWAM 1HXKA 2EXOA 4U31A 2XHYA 3MUZ1 1JXJA 1K9EA 3WDIA 3BMVA 3SUTA 2Z1KA 2D73A 4B16A 2VX5A 2WC3A 3QOKA 3CLWA 2VCAA 2D20A 1E6SM 2J7HA 3U5YA 7A3HA 3GXFA 1QNOA 1GQKA 2FYVA 1OD0A 2E4TA 1B3ZA 3VIOA 2F2HA 1XRVA 2E0PA 4GKLA 2WHKA 2XVNA 2F61A 2RGMA 4ZEPA 2YDSA 5DMYA 4JHZA 4X9YA 3AXHA 3BSGA 3VX0A 1VFOA 2VZVA 1KGXA 3SCPA 1TVNA 1OT1A
chains in the Genus database with same CATH superfamily
3WGVB 2XVGA 1CL7H 3I74A 5E5MB 2QAFA 3SGUA 4IICA 2EYSA 4Q74A 4X98A 3S3GA 2VEFA 4D71A 5C0DA 3W1PA 3EMZA 4WNSA 1UM6L 3JBG7 5LHFA 2W1NA 2O5ZL 4AD1A 5I8EA 1YJDH 5CG7A 1A6ZB 3NM3A 4C7FA 1T2JA 1KENL 1CL7I 5IT2L 1IL1A 1KC5H 4P5MB 4OE7A 5HVWA 4XBSA 4OCMC 4HIIB 4NERA 1OHZA 1NMCC 2B3RA 3KYAA 4I3SL 4KQ4H 3S5LB 2Y5SA 3AM8C 5DT7A 3U7BA 5EG6C 1SN0A 1UZ6E 3PGFH 4PUEA 2WBWB 2PO6D 1FNGA 3P73B 3S0PA 1GUVA 1FHNA 3VXGA 3KP0A 3W74A 2OMTB 1OSEA 3A24A 2PETA 5KZMA 4XNZB 2K3TA 2ITFA 3U82B 1XC6A 5HJ3A 5LBSL 1Q6DA 5A6JA 3W7NA 3W1LA 4AZCB 4KRLB 5GZOC 4NQEB 4OI9A 2C34A 3UJIH 3AMGA 4XZ4A 3PJTA 2CSPA 3NPWA 3MSYA 2EIDA 4WZ9A 2XN9E 3CNYA 4KJYA 1E40A 2C9VA 1R8LA 1E67A 4H20H 3DGBA 3VK5A 4YE0A 4TSBL 3OIHA 4P61A 4IQJA 4GI8A 5FYKU 1H50A 3CHVA 2B20A 4B95C 1L9RA 1H11A 1RQHA 2GDUA 1KTDB 3H4WA 2KI6A 3KJ6L 1B0RB 4GH7B 3PBGA 3MJ9A 4X6DE 3FSVA 4ZXBB 4JL1A 2UZXA 4A2MA 1XLAA 3D3VB 3QHOA 3DXAE 1EDYA 3MA7A 1J05A 1UUMA 3L1EA 1MJ7L 2BP8A 5BOPA 4EVZA 1WK0A 5CIPH 4FXGB 4PV8B 3ZBMA 3NH7L 4K73A 1CK0H 5F0LB 3OKNB 5EIIG 4TTDD 3CQQA 3LI1A 5XINA 5LBSH 1I6NA 1CS6A 3PWUA 4W6YB 4M7ZC 3QIBB 2DEXX 4A6YB 3LNDA 4APQD 4MF4A 5C9KA 3G6LA 3V2AR 4ZA0A 2GPZA 3MRMA 1VR6A 5F3HB 4HKZA 3L9RA 1C9SA 2N56A 2FL5B 4P23B 1YEHL 1LO4L 3NAAL 2OK0L 5F7AA 1WD9A 1L6XA 1XTMA 4IBLT 43C9B 1ZDSA 3ZXWA 4YS4A 5I76A 3H7RA 1E8WA 5HYFA 5CLTA 4M7LT 3X11B 4W9ZA 3WKMH 3V0TA 3GWJA 4OLUH 1SFJA 1P7QA 4MNHA 3KPRA 1DFXA 1G7UA 3SFKA 5KSAD 3QHTC 1KV3A 5D7JD 1XF2B 3D5HA 4DLMA 4M1DH 5IEKA 4C1NA 1NDYA 3IVKA 1ZSXA 3ARFC 1KRCC 3GU9A 4PLNC 2OAAA 3TXZA 2VUKA 2CO7B 3AIWA 4E2DA 3N9GH 4PY7B 2OX1A 5HY9A 5SX4I 1DL7H 2NY2B 1DE6A 1HC1A 4XCYB 1GYLA 4OFPA 4E8CA 2VRAA 2YOAA 1TJHL 1TF4A 2HFFA 2PR9A 4U1IB 4H2CA 1T0MA 4E5XA 4JAMA 1PLGH 1CI3M 1EX5A 3JTTB 1HZKA 1GPWA 4PJBA 3UTQB 3XINA 1Y1DA 3VI3A 1V8HA 2XPZA 4UTBA 4RE2A 1ZPLA 2VW6A 5DRNB 5IGXL 1KBIA 4DI9A 5DEZA 1ZT1A 2AZAA 2V5YA 1OBAA 5F7NC 1SPDA 3UW6A 3MR9A 5JXED 4CVXB 2HLFC 3S98A 5HYQB 3LG3A 3JT2A 3PANA 1KFBA 3CUGA 4R3UA 1EAJA 4RFEB 4K3EH 4O4YH 1K8CA 5ICXA 1S2WA 4P23A 4E41E 5HHOB 1AJ2A 1DUZA 1DVXA 3AS0A 1R24B 4XMKL 4Z7WE 1S5MA 1ZHKB 1SJBA 3FUFA 1J01A 3GO2A 1KDJA 3HRZC 4BQBA 3IDXH 2CO6B 4OLWL 2CBOA 4MD5A 2QXWA 4TQIA 1Y6MR 2Z31C 3QW3A 1YMME 4XBPB 5GJPA 4F7CA 5B39B 3S46A 5K2ZA 3B43A 4IK7A 4MX7A 4WEMB 2XACC 1M7IA 4XNMB 5D72H 3MVSA 3MOBH 3EG9B 4X5XA 4UTAA 1BXBA 4TPRL 4UV7L 2GT9B 3FH8A 4RV8A 2MJWA 2WCAA 3LAFA 3O6FD 1D5ZB 3LRSB 4ODTH 2AAVA 1ZHNB 3NFPB 2VM9A 3TAKA 4FB7A 4JVWA 1WA0X 2PDWA 1A4KA 2QUTA 5EOCJ 4NZDA 3E80A 4EDXA 1TT6A 4AYID 1ZLVH 4F9PC 1VD6A 2OFJA 3WQPA 3NQ8A 1UCBH 3EWBX 3CC1A 1OAZH 3QCVH 2O9RA 1S78D 2NR6C 3CSTA 2Y6ZA 4YU1A 5SV3A 5I8CB 4HKBB 4X6FB 4MA3B 4P2OA 4UT6L 4WCYH 1ACYL 3BVTA 4Y5YB 5EIQA 5HYQA 5I75B 2XWTB 1JNLH 4BUQA 1A3HA 3BC9A 4K37A 4MY1A 1QUMA 5EF1A 3O41A 4PBDA 1KPRB 1INQB 4BKLB 5IROD 2EKSA 4NY2A 3EKLA 1LGVA 3QXDA 1J5DA 3W2KA 3R1GL 3G5XB 2NLYA 1HL8A 4NQXA 2EO1A 4LRSA 4NPYB 5FO7B 2VLMD 1RZFH 4U3SA 2PRHA 1YAZA 2XVKA 1L7TL 1LP9E 3U0PA 4Q3MA 3DHJA 3O2VH 1ITCA 3MXVH 4FG4A 4G8FA 4ADJA 3GKFA 5I1AA 1ZJIA 3LOWA 1RI8A 4WO4B 2PTTA 1C90A 2G3JA 4MJ6B 3L12A 1G7MB 3B5TA 4EO5A 4LTSA 1P5UB 2CZNA 2HJLA 1EUNA 1TTBA 3QUML 2I9TA 2PDGA 2IF7A 1D5ZA 3FRPB 3LRSA 1UOLA 4UT6H 3NP4A 4WCYL 2ZE3A 3CLFH 5D2NE 3AMDA 1UD3A 5C2XA 5T3XE 2ADJB 2D3LA 3T8XA 4MAUL 1D2PA 3IK2A 1VGAA 4Z7QB 3VIJA 2Y1ZA 1RK1A 2WJFA 5C0NC 5CBEB 3GGWB 3N06B 4N2HA 1G4EA 4HEMA 5JW4Q 4FALA 5DDHB 1VYSX 2FEEL 4LEBA 2AJVL 2Z24A 1ENUA 2GWGA 4TPRH 1IGCH 1YNLH 3CZEA 1SVZA 2EIEA 4NNYA 4UV7H 3E2VA 4Y9MA 5EU9A 3SCVA 5CSYA 5FEWA 2YD3A 4DP5X 4LEXH 1JK8A 4RAVA 4HAKA 2X4UA 4FI6A 3UP1A 5K9KA 5EU7E 4U3SB 3OKMB 4U6XA 2QV4A 2IH8A 2YLKA 2QADC 1INDL 5E6RB 4AMAA 4UQBA 3QJAA 3UPMA 1BGGA 4MJ5A 3T04D 4NWTH 2PP9A 3PDOB 5I8OL 4LUJA 1B3XA 4HF5L 3MRCA 3MRJA 1O6IA 4JJ5A 1S7RA 3IJDA 5HNTA 4AISA 4HZ6A 1MLCA 3FFDA 4JGNA 2P0IA 1CE6A 4YHYC 2V8LA 1IBDA 3EJTA 3IN2A 2JJSC 4WO4A 5L2JA 4G6FD 1NY1A 3E02A 1FL3A 4N20A 4X8JA 2PP7A 4I6KA 1A7PL 1AZRA 3GDLA 1Z9SB 2EIBA 5DJZA 2CMRL 5T5FH 3N18A 3OZOA 1XXFC 1BYCA 2WZ0A 4ONOA 4HT1L 1C8QA 1R75A 2J9ZA 4JFPB 4FFVD 1REQB 3VWJC 1EZLA 1FWEC 3N1GC 4NC1C 3AXIA 3BFQG 1Z9OA 1FIGL 3NK4A 4ICWA 4JKPH 5ALCL 2X6CA 5GGQH 3UBFA 3VFWB 4A1RA 1HJVA 2RH9A 3WTUA 1ONRA 3WZ0E 4D0DA 4JCMA 3FB7A 2LLNA 3FQXA 3L5WB 3DO7B 3C6CA 4MB5A 3CDFA 1KM0A 4ODHL 3HCVA 1UENA 3FTWA 4KNUA 2XI9A 3S34L 3UBXB 1KB5L 5ENWA 1AS6A 1E9IA 2X0YA 3GXPA 3NQ6A 3UC2A 2PODA 3VJ6B 2XFYA 3OLIA 4GXMA 5M1TA 1NKRA 4OZIB 1B0GA 1K4CB 2KZKA 3EYOB 4NJAL 2HVOA 5DMLA 1IJNA 5DN1A 5C7VA 2ORBH 4ZFZB 5HYSA 4OBTA 2FEEI 5F44A 3ITYA 5CPTA 3UTPD 4KH9A 3F5WB 1OTTD 1BZQK 1UT1A 4OGYH 2WKOA 4KT2A 1L2UA 3T2LA 3NRQA 5A2CA 1IAOB 1NGWA 5BNXD 3LCLA 1O94A 1Z9PA 4WIQA 3VFPA 3ZDYE 1OCBA 4P2VA 1NIDA 3DTDA 4XZWA 4JMXA 4V2BA 1DN0B 2R91A 3G6MA 3SRKA 3I9IA 4TV6A 1Z6KA 3DDGA 3LKQB 4LVHC 4RDBA 4WCJA 2E75C 2SEBA 2FUQA 4NO2A 1UASA 3ENLA 1A0DA 4ZMTA 2XLLA 1J5SA 5BUPA 4B3LA 1ZU8A 4IIFA 3VFMA 3CB8A 4MTVA 1S7UB 2F08A 1A2YB 1M3IA 1W3HA 1U95A 3QIBC 2G97A 4Z7OF 5JHDD 4MLJA 3RX4A 3W39B 4D0DB 4Q9RL 1OTSC 2BCMA 3DUUB 4JKNA 1X5FA 1KULA 4I9WE 5CJBA 2W8CA 2JKJA 2FT6A 3FN0H 4ODWA 3NQ2A 3NXFA 4YHIA 3KZ8A 1PBYA 2D69A 2PLJA 1OZMA 3FT2A 4LEQA 2ERJC 3VFVA 1Z69A 3V4VB 3KJ6H 3GH5A 2MANA 3VOHA 2XFXA 5T26A 2X4RB 1HKIA 1Y18A 3DSNA 2VI0A 4ZFZA 5HYSB 4YYFA 3N2OA 4M1BA 2GQ8A 4FLQA 3JV6A 4ECNA 4LP8A 1YDYA 2Q7YA 2CWNA 2J7EA 5C08E 1P48A 4F7MB 1AQFA 1TCDA 5KSUB 3UJIL 4AC4A 2WBJD 2G2NA 1OANA 4JE4B 2YJLA 4QO1A 5H37G 3SCSA 3DTUB 1QO3A 4G6JL 5LQBL 3CYVA 1MREH 1NGQH 3EDFA 1Z5YD 1SDYA 2XRAH 4F37K 2X2YA 1NKOA 4E4FA 3QZPA 2LTQB 1MJ8H 4I3RL 1E9OB 4K3DL 4KROC 4J3TA 1SSGA 4JO2L 1JDDA 3NO3A 3HN8A 5JVLA 4OFIA 4PJCB 5DYOB 3FEMA 4QHMA 2VM4A 2VR9A 5IT2H 3DFSA 5GRJH 1EXHA 4DFHA 1A2YA 3V75A 1QT1A 3AB0B 3APMA 1ZALA 1JR1A 2CLHA 1SNRA 2INFA 4UTCA 5MHSE 3Q58A 5DHXB 3A22A 3DUUA 2FEJA 4YAQA 3A21A 1NCAL 1OD9A 3MLXH 4OLXH 3TL5A 3S2MA 3N1FC 1UJ3C 2VO8A 2IPGA 4NO3A 4ZZFA 2AKZA 5I74B 3C6SA 1AZ1A 1M4KA 3TTSA 2WXQA 1Q66A 3VQ1C 1F61A 3SJNA 1R3KA 1BZ9B 1QR7A 3H6AA 1TUFA 3TLLA 2PPEA 4AQZA 2HSAA 4UOZA 4EN3C 4L64A 3ZUNC 2J27A 3LB0A 1YMMA 3LIZH 3UTPE 3EKZA 4NT0A 1I7RA 4KZ0A 4DESA 2VELA 5DZNA 4UFJA 4LNCA 4PRAB 1YE4A 3LMJL 1I1XA 4U05A 4WFEE 5DZOA 5MHSD 1Q3NA 3MUHL 3K1GA 5J1AB 1N18A 2O4EA 2AVGA 5BJTB 3H24A 4I7WA 2TRSA 3RWDA 1LE9B 3L08A 2YPLE 2FSEB 3D18A 3A67L 3V9EA 4OBRA 2B15A 5JMRA 1FH9A 2FTYA 2WQAA 4TSCL 1KYOK 3GIVB 5IVNA 5I17A 2C15A 1WUFA 1JXDA 2ZSVA 3MUGB 3ZYIA 2G2RB 1R85A 1T7LA 4WKAA 3RNDA 3T8QA 3WQFA 5EPMB 4NLHA 4KRTA 1RLWA 3NDZA 3BGFB 4X6CA 5INDB 3ZL4L 1TQVA 2VMFA 3HZ3A 1ZENA 1I9EA 4LAZA 4D9PA 4B6ZA 2BW5A 4HMDA 2ACUA 4UR8A 5AZEH 1F4WL 4P9ML 3N55A 4J23A 2NY0C 1U5HA 3AISA 2QKIC 2IS7A 1XR8B 4PJXF 4BQ2A 4JY4B 1VHPA 2BVYA 3H2WA 4HEPA 4PWJA 2OR7A 1ILUA 3TIEA 1IT8A 2JJVA 1LG1A 3ETBJ 1CURA 4JFOA 4YFEA 1K70A 4HBQA 1PKLA 3HN5A 4JE0A 7CGTA 4W89A 3G1RA 4IOTA 1KTJA 1ZAJA 2X2HA 3G6JB 4K3JH 2ZWLT 3L0GA 3A4AA 3C6SB 3K4WA 1BWLA 4H83A 4S2BA 3GVWA 3WH9A 1HNFA 2VN5A 4MA7H 2HKFL 1U41A 5EOTB 3EJPA 4X7TA 1FVDB 3T09A 4E2OA 1YCSA 4UTFA 2PO6C 5DD6B 1H7WA 1F4YL 2ATPA 3QIUD 1KJ3H 1FSKC 2GW5A 1WJ3A 1QVBA 1T7YA 4K2UL 3WQEA 2QVIA 4DCQA 1HL9A 5GGRY 2ZXCA 3CN1A 4IIZA 1C8VA 4MADA 1MG3C 2HKAA 4K23H 1OIOA 2QF7A 5D5MA 2APVA 3DIVA 4FQJH 2YGYA 4KEVA 4K94C 5EMKA 3BH8A 4B5WA 5TIMA 5MKGB 3DGRA 1DVZA 3SGDH 2UWFA 2Y7QA 1DVFB 2DQJH 5I17B 2AXFA 3M5XA 2WTRB 5EFIA 2IBZX 3MUGA 1R5IB 4TRPH 1W1A1 5F1VA 4X4ZA 4PREB 1VFAB 5AAPA 2F8OA 2R4RL 3W26A 1OT2A 4IMKC 2F1EA 2KBGA 3DA0A 5L8KB 5AY7A 5IHUH 1N6VA 2FD6L 4ODBD 3DVGB 2Q5BA 4XNQB 3W71A 1KTRL 1FFOA 1G0YR 1QYGL 3CFEA 3CQKA 2CDFB 4PMDA 1C5CL 1U93A 1XLLA 2RDTA 3A47A 4PWKA 1BQKA 5JTWA 1BHGA 3ARGD 3WBEA 1K7XA 1KXHA 4PLOB 4DPRA 2TRYA 4LFYA 4Q6IB 3P74A 5F6HJ 4OV5B 1XVSA 2OSYA 1AMYA 3SYCA 2VFIA 4J7RA 3GXMA 3H6JA 3MNWB 4K7FA 4WWKB 1XIWB 1RXLA 2H2PC 2ZUVA 2QKSA 4NN6B 3ZDXE 4QQ3A 4JW3A 4P4KD 4X7TB 1QLEL 4BUGA 1FDZA 3W7OA 2Y24A 2A2IA 4KNSA 4ORGB 3CH0A 3LCWA 3UEZA 1KEML 1P5VB 4JGUA 1MFEL 3IF1A 1W1YA 1VACB 3T1FA 2C0AA 3SO3C 3CTLA 2GGIA 1GPOL 4LHUD 4WJXA 5IM7B 1D6VH 3DJZA 3RL1B 1GQIA 2ZRYA 1XF4A 3N6HA 4XZNX 2VCOA 4MFEA 4ABVA 1BQLH 4FG6C 1CLZL 43C9A 3WDQA 2BY2A 2GCYB 3L3OC 4E9QA 1VBJA 2EHHA 1XBZA 3RZWA 5HYJD 3T6XA 1QRNB 5EOCH 2V9DA 4Z77A 2XZ9A 4BS0A 3SE3A 1GHSA 3VXNB 2WIIB 5I66A 4U1LA 9XIMA 1KRAC 2BXYA 4MIMA 1JOIA 5AOKA 5G2HA 1IEAA 2B9AA 1HHGA 2WZIA 2CLLA 1H5BC 4MNHB 4CNSA 4QWWC 3SJVE 3E6FB 1OWQA 2FVMA 3IT8D 5I9QC 1B0WA 3W25A 4MAZA 5LNGA 1N6QH 1GS6X 2MOQA 3R8GA 1YADA 4UFHA 3RG6A 2CHWA 1XSJA 4CMHB 4AVOA 3MFGB 4WVRA 1QSEB 4WRLA 2BTMA 4N6EA 2P28B 3I68A 1XXDC 4I9TA 2EH8L 1M9SA 3RCNA 4Y9EA 1AODA 4HJSA 2NY1D 2WHVA 2Z91A 2XA8L 3CXHJ 3IXAB 5TDOB 4G8EA 3SN0A 2V7HA 4X9FA 2Y0FA 3EOLA 3FC8A 3ELAT 3WE1A 1WAAF 4D2NA 3DJSA 4Y4KC 3KPLA 4H44C 1XKJA 3N34A 1AO7D 1YKWA 3AHYA 5FECB 3O8AA 1SR9A 4V27A 2Y8UA 2PMQA 5DU7A 3CHRA 4PRPA 5FUCC 1ZLUH 3OBAA 5ID1A 3HI1A 3M07A 1FSKB 1RZ7L 2G5BA 4LGRB 3OQEA 4FG6D 2VDPL 5LGHL 2J57A 4Q2ZB 2HEJA 3WJSA 1VACA 4NUJA 3GS7A 3WFBH 2EE0A 3CVCA 1N4XH 5CF3A 1IVTA 4HCLA 3ZIZA 2DY2A 1ZSDA 3CFQA 3UAJC 1TYGA 2W59A 2JI2A 4TL4A 3RHWF 5JIMA 4TSAH 3MCKB 2H6UA 1DBAH 2V82A 3ITTA 1Z66A 1WBJA 3VTMA 2N0MA 2C3GA 2QQKH 4YFDB 2CGRL 4YK4B 3DETC 3VI4B 3KWUA 3W6YA 4CW1A 2CLRA 2UXGA 2X2IA 1QNZH 5FS5A 3ZIMA 2AQSA 3SIMA 5M2FX 5EMYA 1V0LA 3QFDB 2DM7A 1M7IB 4RGNC 1EMTH 4PSRA 3VNYA 1FWTA 3NVDA 3HMWH 4PMXA 2WO2B 5KVFL 1ECYA 2P5WB 3NTYA 2C3VB 3C5JA 1OL0A 4J28A 3WN6A 4MLRA 4QDPA 5LIWX 3ZQWA 3SM0A 2OI9B 4WXZA 2IMNA 4GO8A 3JR2A 4BDVB 3L3IB 1OF2B 2X4TB 1NQ6A 1S78C 2NR6D 1V7NL 2H41A 3QAZB 3E8UL 1MSSA 1B4TA 3C2VA 4KFNA 4MOZA 4QLJA 1PIIA 2VDKH 3BUIA 1CFVH 1MZYA 3F00A 3MRLB 1F58H 3FNDA 5E6IB 3ULUF 1XQ4A 3KTXA 4WIWA 3NCMA 3Q44A 4B91A 1DIDA 4DN4H 4ILSA 3LZNA 4H2AA 3VNLA 2C13A 5FGBA 4LVBA 3QUKA 1TZOA 1FDLH 4MD4A 1RVKA 4JTTA 3DERA 3OVPA 3PWLB 3HB3D 1MKFA 5CZTA 5LGXA 4ZDHB 4UQ3A 3G3DA 3P7YA 4LCVA 3MRPA 3BAJA 2A1YA 1E5NA 4PUMA 3MCKA 1D7FA 1DVUA 5J6SA 3GHTA 3TH6A 4QSHA 4DJEC 1E0TA 2E5DA 4NM4H 1PSCA 1J8HA 2E56A 3IDMA 5DHYB 4JM4L 4DP9X 4UOW1 3LNPA 3TNNB 5JW4M 4XMXA 4IBQA 2FNBA 5DXYA 4W9FC 3TTOA 3AB0C 1EFZA 4NZ5A 3PFMA 4WK0B 1BWVA 2ZG1A 1KN4L 1HWHB 3MQIA 1TQCC 4RX4D 1UUQA 2D1ZA 4ZMVA 4J3OF 3WFEH 3M1ZA 1MPAL 5CIPB 3TK7A 1RPQA 3D4ZA 3QPQD 4EIUA 3S96A 5IHWA 1K4GA 3L1FA 4RZ6A 1E71M 3CSGA 3RGVD 1JZ8A 4PUKA 4WFGD 5MEQA 3NA4A 2F84A 4AD5A 3UGVA 4M43L 3SGEI 1J86A 4DAGL 3JW7A 1LT8A 2EC8A 4YDLC 2VDQB 1U8IA 4TNEA 5ID0B 2ICEB 3NACH 5ITFB 3TBWA 1KUMA 2YPLB 2AQVA 3PFUA 1P4BH 5E6IA 4O1DA 4HHLA 4KX8A 1SQMA 4DKFL 3NBNA 2IKGA 3BIAX 4MJZA 2YL8A 1T2XA 4L48A 3UJTL 1YEWA 3AG2B 4D9LL 1KCRH 1MRQA 4KFOA 3SCNA 3NG5A 2C1OA 1SMAA 5B1BB 3WJZA 3QC6X 4XPFH 3MYPA 4APQC 4PH8A 2W5FA 4OZFH 4XRCA 3TSDA 5HGDB 4L4LA 3UG4A 1XF0A 3TV3H 4EACA 3DUGA 5HJLA 1YX1A 3ARSA 3BWUF 2APBA 4K39A 4JFED 2Q6WA 4XOAA 2QHLA 3FT9A 4PBVC 2JKSA 3W9EB 3B7TA 3C2RA 4AEOA 3WDRA 5HDLA 1MCWM 1WVZA 4FGMA 1RPUA 4YSDA 1UZ6F 2A3CA 4LWWA 3CX2A 2CLEA 5B3NA 4IIEA 4OVXA 3QQ4A 3W9ZA 3FRUB 4HKPA 2O9OA 3HG2A 1U8OB 3ARVA 3N43B 2WLHA 3BSZH 4F2TA 5GRUH 1KBLA 2Y07H 3PGDA 2QLYA 4X9BA 4C6NA 3U4EB 1BEYL 2PPFA 1VIWA 2WYZA 1IGFL 3M7OA 4XP5L 5KVFE 1QAWA 4XP9H 2YZ5A 5IG7B 1VESA 1MQ8A 1MCBA 1GS7A 5AG9A 3MT1A 4JIPA 5ICYB 2R1NA 2PTVA 1JYXA 3FF7A 4D8AA 3W37A 3SUWA 5JPNB 2BX7A 4EIVA 1F1AA 5I19H 4TVUA 4ZMZA 4W9LC 4NO5A 5L4FA 2WVVB 3WJMB 1XF5B 3B83A 1I3UA 4NRZB 1HFBA 1XHGA 4HTYA 4AZ8B 3FDKA 2H47C 4LSSH 5BZDB 3RCMA 3SGZA 2DQDL 4BA8A 2JV6A 3AS1A 1AQDA 5CN1A 2FO4B 5AYUH 1DTNA 4XRCB 1PD6A 1LEIB 1JULA 1MI3A 1WUEA 3O3RA 4IJCA 3S9ZA 5D6DA 1X7QB 2AJZA 2BHFA 1L5GB 4M7SA 3B3DA 2ZOLB 3VXOB 4CKQA 5CCJA 1VGEH 1XQLA 5D4JA 2EE2A 2GUBA 1AQ0A 3KL3A 3KVMA 2QHAA 4XZUB 4ZXOA 4FCHA 1TWIA 4Y4HB 1VIZA 4P05A 1PFCA 4OCYL 4UILH 1KV8A 2FJKA 4QE5A 4E9LA 3CJJA 3E0WA 4KK6C 5CN3A 1UUOA 4XBKA 5ES4B 4F37F 3PU7A 3EO1A 5ISZD 1JGIA 3RGHA 4F91B 3G6DL 4N2KA 4IRZH 2NXZC 1LO0L 1YEKL 2XYBA 2YXWA 1TWSA 2VCBA 2A1WL 3VZXA 5T3XD 3G5ZA 3ZE1E 4U0RB 4QSFA 4IEFA 5DC0A 1EX1A 1JNNH 3DI2B 2YSSB 5EO0A 2CA3A 3L7FB 4TUOB 4HJJL 5I0XA 2A83A 4M7ZB 3GBDA 4ANWA 2WW5A 1NEZG 3GRWH 1OC7A 3HS8A 3WIFB 3AW5A 3L3DB 4WKZA 1JFXA 4HS6B 4UB0H 1UC5A 4IZGA 4Y4KA 4A8IA 1IB5A 4LLMA 3PULA 4QGYA 1SW0A 4Q4EA 2G5WA 1V7ML 5BXSA 2R51A 3V4VA 4NIRA 2AQ2A 1LILA 1EBAA 4Y7EA 4XN7A 1K7EA 1TVBA 5FA3A 1WOAA 2E09A 3S37X 6REQA 5HMEA 12E8H 5DUML 4I4WA 1JYWA 1Q13A 5J1SC 3PZMA 3E49A 2L3BA 3GSOB 4MS8D 4W7UA 2NV9A 5F6IC 1SF3A 2CERA 3H2NA 4XVSL 3K2MC 2MNWA 2RDWA 4W8AA 5D04C 1WWBX 4F66A 5KINA 1S5HA 3VMNA 3C0LA 1EL3A 1YYLH 5J4MA 3VI3B 3UTZB 1H5BA 3VDHA 2AJYL 4WJ5B 3VH8B 3HG5A 4IHBA 5KSBA 5KBPA 3VNJA 5LDSA 2P5EE 4ZZ9A 4WTWA 4ZW7A 4BV1A 3U3HA 4R90L 2J2ZA 2QVFB 2H9GA 2I5YH 2E25A 5IVOA 5FOOA 1B3YA 4ZT1A 1MHHB 3MHZA 3L5AA 1JGEB 2RDUA 5FV2A 3MRDA 1B88A 3OKOB 1I2RA 3DGDA 4PJCA 3O05A 4EXAA 4M5TA 5CLZA 2BNQE 4NUGL 3AALA 4KKAD 3RA7H 3FOLA 4HK7A 2YGQA 5D1XB 4PYGA 5EN2B 1W31A 1VBHA 3T4AA 4EXQA 1ME9A 4LNRB 4A66A 3DCPA 1IEWA 3VWKD 1C9DA 3N12A 1GH7A 4FFYL 1R3SA 5KYUB 1S2TA 3HPXA 4ECLA 1QFWL 2Q0ZX 3AT0A 4E2BA 1AVAA 3IMWA 4KKBC 4M93B 4JIHA 3T8LA 4UT6A 2AJ3B 3HC4L 3K8MA 5EU5B 3T77A 1ALDA 2XZQL 3BDYH 3LQAH 4D6CA 1IHIA 2Q76A 3AS2A 5FCSH 2FGWL 3AI0A 1YHTA 5DMMA 1GT8A 3X1GA 1AA1B 1WS8A 2XZQH 3LQAL 4MMZC 4LCSA 2DEWX 2O1AA 1I1AC 1CGVA 3UG8A 3MNVA 2GJRA 3QUGA 5DTFA 5I26A 4JY5L 4ENZA 1NC2A 1SPQA 1YPFA 3L7EB 2OMXA 2MCG1 5CR1A 3KM8A 5L6UA 5BJTA 4ZTYA 3RWDB 5DFTA 2I5IA 3DC0A 4PCTA 1P1ZB 4S1RH 3WIIH 1UJTA 2YEZB 4Z2JA 25C8H 1KLGB 2ZG3A 4KMLB 4J6RL 4P5TB 3RA7L 4RDYA 5BRBA 5EO1B 4FEZA 4M7LL 1LTDA 3AZTA 2NCMA 4TTDC 2YD0A 1QRNE 2WP3T 1EJUC 1I9RL 1TETL 4G9FA 3S6DA 3ZTCC 2E28A 5HI3C 2XBZA 3SCRA 4AQ1C 4PMEA 1E6QM 4QM1A 2Z0UA 3D25B 4L7ZA 1F4XL 4H8UA 4ZSOE 4TULL 3EFDL 1AJZA 4R90H 1Y07A 2QPXA 2CALA 1UZ1A 5BOEA 4AE1A 3CFBB 4J8QA 4KUZH 3OKLB 4MMXC 1FE8H 3ZZSA 4CQ8A 4ZB2A 4ZFQA 4FQ2H 3U9IA 5IW1A 3W38A 3WUWB 1E1EA 1C8PA 3QDJE 3QO0B 4FYSA 4PB9L 3C2YA 4HZLA 4QHNB 4N22A 1T89C 5DEGB 1BAFH 4TNGA 1Z1WA 1CVRA 2BOLA 4PJ8C 4PRHD 4D94A 5EWIH 1MIML 2HFGH 2XPGA 3LZ5A 4IIGA 4AH7A 1QSED 3UYOD 1SUXA 4EXBA 1DSFL 2VUYA 3QS3A 3KNBA 4Y88A 5E8PA 5KS9B 5BW7A 4A7VA 3P5ZA 3LCHA 1G7VA 4PMVA 4B15A 1KG0B 1X4ZA 1TPFA 2AQWA 3MLYL 1NMBL 3WEZA 5LXEA 1GSMA 2J6EH 1AJ0A 4XISA 2O9TA 1N10A 5IDIA 3MV9A 3W1NA 3HRZB 3QZMA 1W6WA 2QKIA 3MZGB 3GRIA 1FFPA 1RZJH 3VWJD 2AABL 4ETQB 4HJJH 1YEJL 3N19B 3CTTA 5C9JA 1KBKA 3HC0A 4D0CB 1SO6A 5ANME 6ENLA 3UWZA 1EEUA 3AT9A 1U8JB 4IQEA 3BKCL 4JTAA 3OLGA 1FQ0A 3QIWD 4LARH 1ZLWH 1IWPA 3APGA 3S83A 1FAIH 2A6KA 4UINH 1UT9A 4XAWL 3CVDA 3CDZA 4XZHA 2WHMA 1LWIA 3DBXB 5C7ZA 3KLAA 3ZOAA 2F58H 2F8VA 4FTVE 5JXEC 3HHRB 4JX5A 4RZCB 5A43C 4J27A 4ZQRA 1IM9B 3UWQA 3WLOA 5D32A 5EUOB 3SBRA 2O6EA 2EDTA 4WKHA 3OJ2C 1H8OA 4OZHB 4GA8A 4ATWA 3WFCH 2A6LA 1S7RB 4HD5A 5C3TA 4HWZB 1GGYA 1JF6A 1INEH 2Z4QA 3WAJA 3RIKA 5KSAA 1GR7A 2F5BL 4GYBA 3CVHL 3Q8EA 3KPTA 4WFFD 2EZ0D 4LSSL 5LLIC 2DT0A 4XGZA 4WOQA 1RLCL 4DGVH 1KM4A 3V4PH 4L80A 2HV5A 1WO2A 2A38A 3OTTA 4RDQF 5D9SB 1DJQA 5JQHC 3UWWA 1IL1B 1D5RA 4P5MA 2DDXA 1IBGH 4M62H 3QPEA 4JTKA 3KCOA 1XZ0B 2XJKA 3FB7B 3TBVB 3DO7A 3BIBX 1BBDL 3HPLB 4UFLA 5AB3A 3ML9A 1D7CA 2DZTA 4Z7UA 5F96L 2WMPB 4QXTB 3ZMEA 1R33A 4HMEA 1SBSL 5H35B 1J9QA 5MENB 4QRSB 3F84A 1KPUB 1BOGA 3AUWB 3HB3B 2Q7AA 4YR6A 3UAEA 3EYOA 1FLTX 3VMOA 1NCBL 4PJ5D 3DIFB 2GGHA 2X0VA 3E0LA 3L5HA 3IARA 5FJPA 2XGZA 1BAWA 4NP4H 4G7VL 4A04A 2C1PB 4KO9A 1BQGA 2Y6SC 1ZANH 1JUFB 3HBGA 1E8YA 3P0YH 2Z3FA 3CQJA 1G0XA 2VUNA 2ZZ2A 5DJYB 5CR8A 1GKOA 4UB9A 1M42A 4G6KH 4LDLB 4NFDA 3ZT5A 3ETBF 3JWOC 4YN3A 1AQKL 1NFIB 1SJXA 2CK0H 5C0BE 4A67A 2UZYB 2L5HA 2YRZA 4A7SA 2YZRA 1L9TA 3AQZA 3QG7H 2DJLA 4H1ZA 2DZBA 1FNEA 5DS8A 6PTDA 3KPLB 3EWZA 2CRZA 1XGQA 5HGBB 4AIEA 2NY4C 1HI6A 5D2NB 3NFUA 1T6WA 1Q6OA 3W7PA 4U6VL 2CIKA 1O5RA 4KMTH 4PR4A 3RWEB 4PGBA 1WWWX 3ARDA 1HJSA 4CD5A 3BP5A 2V5KA 3R11A 3FSUA 1NCJA 1U95B 4NQEE 3ZTJG 5K5YA 8FABB 4HX1A 1TPB1 1XLMA 4HIXH 2AC0A 5AVZB 1C3FA 4DGUA 3DEQA 5I78A 2YAPA 4DFIA 3GI9H 1R0AH 2PW2A 4HJFA 1UQSB 3UAFA 4Q8OA 5A2LH 1WT5A 2BRRH 1IR2A 1V8EA 5GS1C 1RJQA 3VFVB 1NWTA 3WN5A 1KPUA 3MLTA 3WK2A 1CZ1A 3WQVA 1CX9A 1GOWA 4JEQA 1I7UA 4XMPL 3WS6A 2PYEB 1U5JA 2WK2A 2BIHA 2ACSA 4LB3A 3PJSB 1BVOA 3MRHB 4GRLB 1KZYA 2VLRA 3H2PA 3LHPL 5D1ZC 3VKJA 1NIUA 2C1HA 3OB0H 2VURA 2FR4A 2C1PA 2EACA 1AAJA 1JV5A 1J9YA 3IU3A 1A7OL 4W6WB 1ROWA 1E9ZB 1HSBB 1XPYA 2I07A 1KBWA 1LP9B 1KRMA 4N9GB 1WBHA 3TIMA 1EDQA 4GG8B 5F9OH 2FNWA 4NSBA 3V35A 1KW1A 2HS6A 1NEYA 3O06A 2DQMA 2VN7A 3G9VA 3SSJA 3QRFM 1H8LA 1SRDA 3G22A 4KQNA 2DWSA 2ZCLL 3ETTA 2D2HA 3TBBA 1SM3L 4J39A 3T1GA 5I18H 1IGJA 1RZ8B 1L0QA 4HH8A 5LGYA 4BK5A 1V3MA 2BNUB 2C9QA 5I1HH 1J2BA 5BZXA 5HP5A 2VERN 5CGYC 3R10A 3D3AA 5L2KB 1AC6A 1R9YA 4AFYA 2YGPA 3VE9A 4CVXA 2WUCH 1WE5A 5EU6D 3SDYL 3VWJA 3O3BB 1AIZA 2HXTA 3UYRL 2K9FB 3GNXA 1V7NH 4KOBA 3DUHA 3T4YA 5LGJB 1Y1UA 2ZUYA 4YOKA 2IH3A 4GOAA 3SQRA 5JW3L 3FK4A 4HP5A 3X1EA 3HW7A 3UWVA 2F54B 4HIEB 5H8MA 4GRLC 1LEGB 2JJSA 2BSRA 2C79A 4WHCA 3IDMB 4I88A 1YY8A 3B9KD 1EMTL 5F89A 3ZJ6A 2E8YA 1ZY9A 5D7KE 2UY7A 3LN3A 2OCCB 2YPVH 4UM8A 3LK6A 4JO5A 1GYAA 4RK8A 4GCAA 3FQUA 2H9AA 1DHKA 3LLXA 3L95B 3QB7C 3VCRA 1UWEH 1E4KA 4HK6A 4K8RD 1OCRB 1PKOA 4LCCA 1UBSA 5LXGH 2DIAA 3F83A 1HYSD 1KM5A 4GY4A 3MV8D 4CJ1A 5L9DL 3FUIA 3LEXB 2PUQT 1PL9A 3U6WA 4EPDC 2OODA 4XO9A 1VPYA 4XNUL 2QJNA 1J8RA 4HHWA 4JO8A 3C5ZA 2CW6A 2VDPH 5CLYA 3FS2A 4W9EC 2PXYD 3QZAA 5CGQA 1JUEA 1R38A 3UMTA 4NZTL 5B7MA 5L2KA 2CO3A 2PXYB 1J9CT 4H1LG 3NIFB 1L6FA 2BHZA 4HAGA 4P2RA 3WXWL 5JUEH 3BJ91 3D3VD 5DMGC 2K8MA 3TEZA 1JPHA 3WLMA 2XWTA 2QYGA 3C5QA 4A3HA 4A8LA 4UDUB 2A3LA 1G5GA 5M03A 4ZX4A 4PYSA 1S9XB 3FT0A 1E4WL 3PNWB 4G6AD 4HHHA 1LJMA 1FH7A 3C9NB 2YAEA 5TF1H 2WNQA 1EEYA 2IH3B 3MRRB 1R3JA 2D0FA 1YNPA 3WL1A 4YBQC 1U5VA 3S8FB 3M7FB 5HI4C 4M9PA 1IM3D 1HX0A 3N6JA 3S2JA 3KLQA 5AYIA 1AYOA 3R25A 4M19A 2O9PA 2PFHA 3T6WA 1H7OA 2VKXA 4JCLA 4IBVA 4EF3A 4QAIA 3HQ1A 1DQDL 4XHJD 2FYYB 2VXTH 5IR1B 4ANKA 1BYPA 3LB6D 2P45B 3MYJB 4FJZA 2NUXA 3TCEA 2IALB 2NUWA 1A5KC 3G18A 2W65B 1NGXB 1CIUA 5EOCL 2OV0A 1SFDA 2H6OA 1G7LA 4Y1AA 2HJFB 3T2NH 5LKNA 2GOUA 2FH6A 2AANA 5JOPE 4Y2DD 3BXWA 3P0WA 2L0DA 5F70A 4K68A 4YDVB 1MXDA 1HAWA 3QJHB 2I5GA 5I1DB 1I82A 5EU6E 1CB7B 3W7LA 3AIRA 3VI2A 5BU9A 1QXLA 5J57B 5GNYA 3D12B 1KN2L 3GHPA 2OMTA 2FHCA 4MZRA 1KNOA 3VGHA 5CKSA 4G8IB 4ZFGL 3R06A 4YJZL 5DRZA 4YDIL 5JU6A 3VKCA 3WKPA 2DWXA 4NBZB 4YFLF 3BLBA 4MZ8A 3QH3B 3H53A 5A8MA 1XF5A 3BZGA 4TQTA 4M61B 2J78A 3ELQA 4Y5XC 4EP8C 1LP6A 2E9MA 2VXQA 1HP4A 1KTLB 1KGCD 5GGRA 4QROA 5ECGA 3BLOA 3PAJA 3NIDB 3O45B 4F2BA 4HKJB 3HPZA 2DTMH 4ZFFA 1ISVA 1J0ZA 3NJKA 4IS6B 2X6AA 3MNWA 4N8VG 1VF5C 1PMYA 1B0RA 3CCHA 4PSPA 3WUBA 3PZTA 3GB7A 5BO0D 4AIOA 3FV9A 3GDMA 4GAJL 4UMCA 2Y7OA 4XWOC 1E5AA 3F7LA 3IJIA 3KCJA 4Z2KA 1AW2A 1KIPB 1U4FA 1Q0XL 3V0EA 3WX7A 5D9PA 2AQRA 4AJ0A 3B2DC 2H6PB 4FK9A 4L8CB 3ZR4A 4HTBA 4JJOA 2RAMA 1UOKA 5IM7A 1CQYA 2R1LA 4JD4A 1Y5WA 4JG1L 1ZE3H 4ZSOA 2W9MA 4DWSC 4R9HA 4RMSA 4RQQB 1HO1A 5BROA 2E9IA 1FZJB 3SDCD 2X41A 4GY7A 2K0RA 4ZUSB 3UAJD 5JPMC 3NSCA 3GR7A 3IJ6A 4C58B 1SYSA 1QRNA 3K1DA 4FQJL 5I75C 5JQ6L 4O0ZA 5D1XC 3QUMB 1TKKA 3EWYA 1HE7A 5EL1A 2CKRA 1FLRH 4UOQA 3TBYB 7FABH 1B3VA 1T5AA 2FL5A 2GVJA 4MHHI 4KKXA 1HHKB 3RDTB 4MCZB 1VFSA 3O0FA 1A49A 5KZEA 1RUPL 3VIMA 3OJDA 5IQLA 5ABAA 3ECUA 5EORH 4PHZA 3T0WA 3TROA 1RJLB 3Q43A 4Z0XB 1EAPA 1TVBB 4LSRH 4BR1A 1SBBA 2DQFA 4EZJA 1EFQA 4KHTH 3VFOB 3WIHA 5KWYC 4HGXA 5EO9A 2ISSA 4QJ4B 2Z8SA 4HC1A 2GVYA 3ZO9A 1SZGA 3F5WA 3SUUA 4X7CC 1NP0A 3WUZA 3IIPA 1FNFA 3MRGB 4PS4H 1H5BB 2R83A 1RURH 4HUCA 4Y4FC 4CU8A 1HT6A 5GGVY 3DXAA 3PHQA 3SPVA 3QRLA 3ALPA 3QQDA 1FV1A 5CJQH 1PS9A 1TR1A 3DG7A 2G5BB 4O0QA 5JBEA 1J5OL 1BOYA 1SEBB 2NSXA 1DJNA 3SKMA 3MBFA 2IC2A 2PWDA 4QDGA 1GY1A 4X5WA 3V0JA 5B8CC 4N2FA 5IJVB 3P11L 1IFHH 1FKXA 1OZTG 2YAFA 4ODSL 5E95B 1JQXA 3HBPA 3T6CA 1MCOL 1WKFA 1HEJC 1D5BA 2UY6A 5BZWB 5IBTL 1DXIA 5DQDL 4FZEH 5EA9A 1HINH 1G7PB 4DJED 3RWHB 2PTZA 2EJAA 1AGEB 1Q72H 3ATZA 3AXKA 1U8PB 3ULUC 3QFDA 1FAKT 3A3XA 4RWHA 1WCGA 5FYJH 3X3FL 3DIDA 2CDGA 4JEJA 4LSUL 5LJYH 4Y96A 5LKYA 4L05A 5FPIA 2CO6A 3EJYD 4UUIA 4HLZH 1Q7MA 3RF9A 3N11A 4IU2A 2GJZA 4JX0A 3GIQA 2A7RA 4NRSA 2C9SA 1CGSL 3BOLA 1K8IA 3O0RL 5I1GL 1E27A 4KEMA 4UFIA 2J25A 1EZUA 4IMAA 5GISL 2VZOA 4JFFB 1OK8A 5LIKX 3RFAA 2ZWYA 1I7ZA 1EUTA 1MXGA 2EDBA 4CN6A 3NSJA 2O6CA 5I1IL 1VFUA 5AVUB 5BRZD 1W8OA 1WGOA 2JE8A 4ONGH 1W72L 3RZCB 2A9DA 4O53A 1MJUH 3OG2A 1KCKA 1MFAH 3C12A 3TM6A 3E2RA 3QQNA 5DK0B 2OI9C 4G59C 1NJ9B 2VJ0A 3RRQA 2ROYA 1QO2A 3AY4C 1TEGA 2H3KA 1CFNA 4LRNH 4KXDA 1EO5A 1RXOB 2QVTA 3RY4A 1PDYA 1XH0A 5MEOB 4IHCA 2OW6A 4N68A 3QEHB 5DK2A 2V2WB 3HG4A 2VYRE 4XI5C 4Y5YA 4H88L 4ZUVB 1QNRA 3F4CA 3WBYA 4AM0A 4PIBA 1HEZB 2J73A 4BFIB 5IW1B 3ERPA 4LBEB 3VOIA 3QDJB 1N2RA 2ISDA 5AAMA 1RIVL 2PS2A 2Y36L 1FTXA 3UWYA 2WJZA 2OMWB 2MWCA 3A5VA 3BSZA 4WDIB 2E6PA 1UR1A 3HS0A 3QN3A 4C6CA 1UW9A 3HR6A 1CT8B 1CE1L 4LPXA 5BRPA 3FY1A 1OX6A 2HP4A 3STFA 1S3KL 2F9RA 3ZYJA 5MEQB 1G6RA 4CDHA 4ZXLA 1WKEA 1N2VA 2H45A 2NY5C 1E27B 1QOXA 3GTTA 5BMXA 1CN4A 2XXFA 1UADC 5I6MA 1KY7A 4CCZA 3UFIA 2WGNB 2HT2C 5B1JC 4LSDA 4OZFA 5LG1A 3HV8A 5F8RC 3IKCB 3EJUA 5AC6A 4BD4A 4GUOA 3MCLL 3HLAB 5FYKD 3SDXB 1S7QB 4PCNA 3M0JA 4Z8FL 2G0LA 3RAJL 2QUMA 4DJFA 5IOPB 1OGAE 1PX3A 2QDDA 4JREB 1AD0A 1TZZA 4DHLA 3DK0A 4L4VB 1XF3B 4OTKA 3ATFA 5ECJE 2X6VA 4M5YH 4AT6A 1W3IA 1BVLB 3QR3A 1AHKA 5CSBA 5HGAB 3CASA 1V0NA 3MV9D 5DD1H 3A4XA 3LGDA 3LMYA 2VKZG 3S47A 1OE3A 2YDRA 2F1BA 3M17B 4G11A 5J7CC 1TQSA 2K6ZA 4KKCD 2XZCH 1QEWB 5IROC 4QHUA 5J13B 2B7NA 4AX7A 1FYTE 5HOSA 4FF5A 4WY7H 4NOBA 1GGOA 3C0QA 15C8H 1EPFA 3RY6C 1FIEA 2E8ZA 2OTWB 3ZJKA 1O6SB 4X98B 1QJWA 2ORBL 1O75A 2DIKA 2W5PA 3HIJA 4NJAH 3FTGB 4BZ1A 4H8QA 4LCUA 1OPOA 1E2WA 1X9LA 1CDIA 1KB5A 3LXCA 4JFZL 2F9BT 4JHAH 4LSPH 4PWFA 3DWTA 3MRCB 3AWOA 4P8UA 2DD8H 2DLFH 4F57L 4L8DA 1PV8A 1UBPC 2OWWA 1DJGA 2ZDRA 4FNPA 4Y2DA 3VAVA 4GPVA 4LHQB 3LN5A 4ORMA 3WUGA 2JCCF 2XFRA 2X28A 3F7JA 5K39A 4YSEA 3IGSA 2Z7YA 4QRQB 3QZOA 3GFZA 1A8JH 2WO4A 4JN1H 4TS6A 1T5WB 3W7HA 2NQLA 4XKYB 5H35A 5DUPH 1UT2A 2B81A 2PD5A 4HT1H 5E2VL 2X40A 5DHVH 1T1WB 4K9EH 3ZMNA 2PP3A 4HVBA 1V6TA 5DD0L 5BZDA 3I50L 5I1CH 4BKNA 4IOFD 2WLJA 1R47A 2GJ6E 2YAQA 1CB4A 2PZNA 4R8WL 3QGVA 3DRQB 1GVOA 3CQHA 4BSVB 1P4CA 4G70B 1IQDA 1SJMA 2IPFA 5E8NA 5D1ZB 3VJ6A 3N6QA 1DBKH 3VNMA 1Q90A 5CJ8A 3OAUL 5FGCE 1TKWB 1ZTXH 3DX2A 1PSKL 4GXUM 3EO0A 4M6NH 4GG6B 4DF0A 4YL4A 4FKEA 4A3RA 4W70A 1OTUC 2OMUA 4IU3A 3E6HA 1BVNT 5AVQB 3GW0A 5DJAB 4PMNA 4V1DB 4XC1H 2R69L 2ED6A 1SHMA 5GS2D 5A6AA 2LT9A 4ONVA 3I3EA 4IPLA 4WI5A 1P2CB 2DTSA 3HNVH 3MJ7A 1IFGA 4MLSA 3SHSA 4FCAA 5JHMA 5DVNA 3NG3A 1V5XA 4E9YA 4PJ7A 3MJWA 1GOMA 2D24A 2VWSA 2BNRA 4KTEH 5E4AA 5C07A 3VXUA 1JAEA 4CVWA 5FYKE 5GJMA 1T22B 3KPPB 3RXZA 5FF4A 4MZYA 3EOBA 1NGYA 4KKBD 1OE2A 2WBKA 5AW0B 1CZ8H 1H5YA 4UTTA 2XSAA 3QEZA 3SD2A 3SDCB 4C54A 3N2BA 3I85A 4QDMA 3CLFL 5KBMA 4JHBA 3QJSB 1B4LA 1Q7ZA 2GCYA 3H2FA 3JWOL 4XMLL 3A4JA 4FZIA 4GE8A 3U36A 5D38A 4YTRA 2F5AH 2PNDA 4HK3N 4N0FA 2PYEA 1JHTB 4JZ5A 2OB3A 2ZZUT 3BL3A 4QP0A 3ABXA 4RCAA 4YSOA 1O5PA 1P7BA 1TVHA 1DUYB 3I6KB 4ESKA 3W27A 2YN5A 4MFDA 1SY6H 4BSVA 3D34A 4AJWA 2CZEA 1L9SA 1I1AD 2C5DC 2H2SC 3O0KA 3HGOA 1LP9A 2ZJSL 1L7TH 2NQ9A 1A53A 3EGJA 3FVMA 5E00B 1F97A 4LLAA 2XX1A 1FYHB 5A1AA 3KRBA 3MV11 4NOFA 3USBA 1C1EL 4LCWA 1BF6A 3EOSA 2WWOA 3UFYA 1J0KA 3G6AA 4M3KB 1RUKL 4FLRA 1R87A 1UKOA 3F03K 5H8UA 2BB0A 4UR7A 4M56A 3I9GL 3OZKA 4JFQB 5K9XA 5IB1A 5IOBA 3F7KA 3EFOA 1FBIH 4OUUB 3P62A 4JDTH 3WD5L 4L9LC 3CHCA 3UBPC 2AV7B 2VSMB 2ZXDA 1AO7B 4WJKB 4JDZB 4PTTB 1A3WA 4HPHA 4MWAA 3PPEA 2CETA 1ZT7B 3SD5A 2NLIA 1OAZL 4Z0BH 3ITLA 2VKWA 3JVFC 5CEXA 3C2AH 2EUZA 4TUKH 5XIMA 1T4WA 4ACZA 1Z7AA 3T78A 3W07A 3KBVA 3IVSA 4XK2A 4WK4B 3TA6A 3HFML 1QLFB 1QBAA 2NY2D 5GS0C 4UTAL 5AUMA 5IEHB 1UB3A 4ZMGA 1U58B 1CFSA 1TITA 2ZX8A 4HUWA 5A6IA 5KMYA 2BVQB 2F19H 2H3DA 3WQDA 3MOBL 4HDIB 1E0OB 2BMKA 2EO9A 3M0IA 1KTCA 1LEKB 1K9DA 5D30A 3GG1A 2WVUA 5GZNA 1OFBA 4QYAA 2GOKA 5DTFB 3RU8X 1MQKL 3C60D 4L3EA 5HHQA 1FBAA 4Q6IC 3PQYA 5FO8A 4Z23A 5HYJB 2E6YA 1L3NA 4X99A 2CKNA 5IK3B 4F79A 3FYPA 3B5GA 4TNWK 1DCEA 1R30A 3QIWC 5JW4N 5E00A 2ZYFA 3C5JB 4KDWA 3Q2DA 5FACA 5KZDA 5FW7A 2GGGA 4YXHL 2HG0A 1HDMA 2NY3B 3NVQA 4F7PA 3B2XA 5I28A 5IV2B 5EBMA 4PS7A 2R56H 5DO8A 5A8PA 1RZIA 2Q3XA 3C87A 4GKSA 3B2VL 2FSEA 3VE0A 3ULSB 2FX8H 4GEIA 5ADPL 1IEIA 3WFAA 2ZX7A 3BO9A 3U30B 1JWMB 3GI8H 4OLVL 3OGCB 5FAJA 2F8IA 4FHBD 1IXNA 1XIJA 4C59B 3O41B 3VI4E 4KCTA 3L3GB 1E28A 4HZLB 3KYNA 4MZIA 2FKPA 1GZQA 4FAMA 4J3XA 1FFRA 3I6LD 1AZVA 5HHNA 4ZDHA 4B3EA 2HA1A 1EEYB 4ZQTA 1B0IA 3W82A 2EH7L 1IO4C 1T80A 2JQXA 4WUKH 3KYOB 3C09C 4JIIX 1U58A 1I1AB 4GG9A 5BU6A 1PZ2A 1KJMA 3ZYZA 2OJZH 5DCDA 1SLUA 2JJTC 4GO9A 1OTUD 3UF9A 5C55A 3LXBA 2Q6ZA 3UTSA 1L6YA 1GGBH 4Z18A 4AQAB 4TX9A 1ML1A 3B9KB 4PRBA 3UEQA 1RU9H 2FYYA 2LHAA 5T1LD 3OR7A 3IM1A 3WKML 4ELME 5B7FA 3HEIB 4JFYB 4CUCA 5C9JB 3RTQD 1AR2A 4UXDA 2BP5M 3S96B 2W95A 4UTTC 3AG1B 3F05A 3U57A 3BGFC 1TZHA 1CDCA 4WK2B 5FF3A 2OK0H 4PL2A 1LO4H 3NAAH 4TQEL 1UG6A 4C6BA 2B7DT 1S4IA 3CDZB 3U2IA 2J8TA 1JGUH 1RY7B 2MNUA 3IV8A 3BGMB 5EU6B 5AD0B 4O54A 4S3EA 4EIGB 3EJQA 4TQEH 1UIOA 4G2AA 1O5QA 4GNJA 2QVHA 4PWEA 1WV7T 2D7TH 4RMVA 4OCXL 3RU6A 2WMIB 2ENJA 2NZ9D 4OZHA 3U46B 1A6WL 2CJUL 4LU0A 1CD0A 1P69B 4U1SB 5AYTA 3REVB 5CCKL 2CJSA 4ZX6A 1A5MC 3QMTA 1E90A 4Y16B 3W1ZA 5DC9B 3BN9D 3CVHA 3G5YA 4ISVA 3EYFA 3WTXA 4NHUB 3OXRA 1NCWH 1IEBB 1T7XA 2UWEB 4NDMA 1KGCE 4WSGA 5I74C 3EXJA 1UZDA 3MHGA 3WF4A 2J56A 1FVEB 4PB3A 5HAOA 3VCNA 3GBNH 4EXKA 3TVAA 3U6XA 1WFNA 5F6IB 3KAOA 2Q9OA 3DX3A 1DQTA 5J12B 1CI1A 5HBFA 4G1EA 4R7VA 4GQ9H 4QRPA 1QO5A 4XNXH 3N44B 4FNLH 1J8KA 1KDIA 4JFYA 3SDCC 5KZCB 2R2EA 5B8CA 1W1VA 1CGUA 3ICJA 2JALA 2NY0D 1WBXA 4WWID 3NCOA 2RH0A 5E03A 2QULA 2FBJL 2FGLA 2OELA 2X1QA 4UQDA 5IMOB 3VSVA 2OBGA 4X0VA 2GC7C 3IMRA 4NSKA 1H1YA 3PAVA 3OJGA 4KQ4L 3TBYA 2EE3A 5E0CA 1QHQA 3D0LB 4Y19D 3RWFA 3TMLA 2NXZB 5GS0H 3ORJA 1AOHA 3QUYB 4ZAKB 4NI8A 3NO1A 3J2PA 1ASQA 1OSYA 1CEOA 1UWRA 3TE9A 3WJMA 4AGPA 1KCXA 4AZHA 2R1PA 4U49A 4WWKD 4Z77B 2X38A 3KBMA 4QS5A 1X9QA 1OB1B 3CFIC 3TR9A 1EWDA 2BXVA 1MQKH 4A8RA 4KKNA 4IG2A 2BFVH 5D7IA 4OZ4B 3CVHB 1G67A 4G7EB 3C60C 5C2BH 4PEKA 1I8KA 4MDPA 5BOJA 2B7PA 2VEMA 1CI5A 3PSVA 3IMBA 2WV8A 5ESQB 4AI7A 5KYXA 3BKYH 2YL6A 2MQCA 3MRGA 3DMMC 3EX2A 1T0NB 2QQNL 3QFWA 3QRHA 2RAGA 1BGXH 1NFAA 4KX7A 4P04A 5I16B 3MU7A 4HXAH 4DJFC 3LKPA 1JPIA 1U3YA 4AZ6A 3FHEA 1YNTB 4Z0BL 5EULV 3DN5A 3GTVA 1S7WB 2RA1A 5JPNC 2WP3O 3CU1A 4PJHA 4IJ3C 4OLZL 3Q2NA 1TZ7A 3GF8A 3COOA 2PTDA 3LU2A 4GGBA 1BQHG 3FNKA 2J62A 3CH9A 2WLIB 3C5XA 3U1PA 3V55A 1XLHA 2BSLA 2EUXA 5EC1A 3LV6A 3C5SA 2Q01A 3GHEL 1QZNA 1RUKH 4N1EA 3MI6A 1QTWA 4D8PB 5AB0A 3K81A 4Q8UA 2IXQA 3TSBA 3VD9A 1E2VA 1WZ1L 2F53A 4HS6A 2AAMA 2W66A 3H7UA 4PJGE 3PS7A 3TMQA 2XYLA 3MSPA 1BIIA 4S3GA 3K46A 4N4PA 4U3AA 2ZJSH 4Q4PA 5G4NA 4US5D 1AH1A 1CECA 2QEZA 3L54A 2PBOA 2KQMA 2DZPA 3GSOA 1POJA 2Z6IA 4Y5YC 4H