3QGVA

Crystal structure of a thermostable amylase variant
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
435
structure length
435
Chain Sequence
AKYSELEKGGVIMQAFYWDVPSGGIWWDTIRQKIPEWYDAGISAIWIPPASKGMGGAYSMGYDPYDFFDLGEYDQKGTVETRFGSKQELVNMINTAHAYGMKVIADIVINHRAGGDLEWNPFVNDYTWTDFSKVASGKYTANYLDFHPNELHAGDSGTFGGYPDICHDKSWDQYWLWASQESYAAYLRSIGIDAWRFDYVKGYAPWVVKDWLNWWGGWAVGEYWDTNVDAVLNWAYSSGAKVFDFALYYKMDEAFDNKNIPALVSALQNGQTVVSRDPFKAVTFVANHDTDIIWNKYPAYAFILTYEGQPTIFYRDYEEWLNKDKLKNLIWIHENLAGGSTDIVYYDNDELIFVRNGYGDKPGLITYINLGSSKAGRWVYVPKFAGACIHEYTGNLGGWVDKYVYSSGWVYLEAPAYDPANGQYGYSVWSYCGVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a highly mutated, thermostable \xCE\xB1-amylase variant
rcsb
molecule tags Hydrolase
molecule keywords Alpha amylase
total genus 154
structure length 435
sequence length 435
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2011-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3qgvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3qgvA01
1E56A 1GOWA 2J7GA 4GPNA 1SYTA 4J3TA 4JL1A 1HKMA 1WZMA 2YDQA 1B9ZA 3WQ6A 3BH4A 1LG1A 1OCQA 1PJ9A 2X0YA 2J4GA 2PWGA 3UETA 1BYDA 3WQ4A 3BAKA 5FL1A 3ZR5A 1H49A 2DT0A 2FHFA 1QNQA 1JAKA 5JBEA 5M3WA 1E3XA 1CENA 3H55A 4PSPA 2BNJA 1G5AA 1NWSA 2A3EA 5I78A 1ZJAA 3CMGA 1W3HA 4E2OA 2D2OA 1UQZA 4GQQA 1J0YA 4KMQA 4GKLA 1HJWA 3EDKA 1BG4A 2YA2A 5D9MA 1E70M 2YA0A 2G3NA 3WUBA 4QCEA 1E0XA 1JDDA 3ZO9A 4BQ5A 1W2PA 1QNPA 2E9BA 4ZENA 3AFBA 4PCTA 4PMYA 1PIGA 3THCA 5FOOA 3IJ7A 4C7GA 5BWFA 4UQDA 2UY2A 2WZEA 2YOCA 2J75A 4X0NA 4TTUA 4W89A 2D3NA 1SMDA 1QHZA 2EACA 1C8QA 5A6LA 2WYSA 5A94A 3AXHA 5E6ZA 4M81A 2WMFA 4L4PA 3K4AA 3L2LA 8CGTA 1XSJA 1E1EA 3WY1A 2WCAA 1OT1A 3ZQ9A 3KL5A 1VBRA 4W5UA 3VVGA 1JNDA 3BSHA 5HPOA 2F7RA 3AS1A 1H1NA 2CNCA 1CWYA 1R33A 3ZM8A 2D24A 1UWRA 5D4YA 2VL4A 3L4VA 1Q6DA 5CPQA 3ZJ8A 3WD2A 1YQ2A 3SUSA 5A2CA 1WZLA 3WMCA 3MSGA 1GOIA 4IPNB 3BAYA 3VX1A 3OZOA 2D1ZA 2AMGA 5F7UA 1TUXA 1VFUA 4V2XA 1I75A 3PZUA 3U57A 2V3FA 4GO9A 2FE0A 5AYBA 2CBUA 5HBFA 3BSGA 1CXKA 2VO5A 5GPRA 1X1NA 3VIFA 1VJSA 3DYOA 3NSMA 5ABGA 3WF3A 4GO8A 2PWDA 1PAMA 3W0KA 1OINA 4P7NA 4PYSA 4P8WA 1HWWA 2O9TA 4GI9A 3T2PA 4J3XA 1XH1A 3WNLA 3D52A 3K8LA 3BCDA 1AVAA 2WVTA 4B3KA 3TTOA 5CLTA 3CZKA 1UKSA 1V6VA 1WO2A 1E6SM 2PWEA 5AY7A 4URIA 5IDIA 1JYXA 1U30A 1UD4A 4B15A 1E15A 1ZS2A 4AMCA 4MB5A 4Q22A 4QAWA 4AMXA 4CN6A 2IGTA 3AYSA 3AZTA 1L0PA 1VFOA 1EGZA 2ZUTA 1EDQA 1GHRA 3L4TA 4YN5A 5BRQA 4WSJA 4HU0A 3DHUA 3L4UA 1DTUA 4TXEA 1JD7A 2VRJA 2WZHA 3WY2A 1JYNA 1QNOA 4HA4A 5IFPA 4D72A 1TQWA 2YFNA 2J8GA 4W7UA 2G41A 1JNEA 1E4NA 2OWXA 2DEPA 5DEZA 1C93A 2DQXA 3MANA 4AW7A 3KLLA 3WNOA 1CXEA 5A69A 3W38A 3VOCA 1AQHA 2HISA 3ZSTA 3OGSA 2JIEA 3QHNA 4MNJA 2W62A 2W5FA 1QPKA 3A4WA 1GQIA 3VIPA 1B31A 1J10A 2Z1SA 3BVVA 3TTYA 5GNZA 4AWEA 3ZOAA 5BYWA 1WE5A 4XZWA 2VR5A 4RE4A 1V02E 3VIJA 2F18A 3VM7A 3W27A 1VF8A 2JALA 1C91A 3I3DA 4AEFA 3DYPA 2ZXQA 1E6NA 2Y5EA 3W26A 3PZNA 1LQ0A 3SCOA 4YHGA 5BXRA 4M80A 2X05A 3QR3A 2NT1A 1HKIA 2J7EA 1UH4A 2XYLA 3RM9A 3T08A 1R34A 4GZJA 2GDVA 1H0IA 1QBAA 3J7HA 2E9LA 3VUPA 2GDUA 1XD0A 5I79A 1KR0A 1NP2A 2BY0A 1KCLA 1RPKA 4LYQA 2F1BA 4OKDA 3WF0A 2EADA 4QDMA 4MNLA 5CQ1A 3GM8A 1HP4A 2JEPA 3AHZA 3S2CA 4CCDA 3W29A 4OZOA 1ZU8A 4Z2HA 1W9UA 1FOBA 2CPUA 4NI3A 3IANA 1TQUA 1W9PA 1Y7VA 3SIMA 3HMCA 3EJRA 4JIEA 3L4WA 4D6CA 2W4XA 1XH0A 1DWGM 2YL8A 3KL3A 4HZ6A 3EJSA 4OGZA 1CEOA 1HJVA 2GK1A 2FYVA 3KL0A 3SUTA 4MB3A 3ZT6A 1BYAA 2G3JA 4DWSC 1E55A 1JYWA 3EJQA 4FNPA 1M03A 4F9DA 1KTCA 1E1FA 1E4IA 4P8XA 4B3LA 4UTFA 3WF2A 4WIWA 1TQSA 2Y2WA 3BLPX 4KGLA 1WDRA 4PMDA 1LWJA 1LWHA 2J77A 1OB0A 1BAGA 5E0CA 3NCOA 3SCTA 3W81A 1BVZA 3WEMA 3VSUA 1UR1A 1KGWA 2XM1A 4XUYA 3BMWA 1NH6A 1EIBA 3LPGA 3GXTA 3TONA 3OGVA 8A3HA 4X9YA 2XG9A 1E5JA 3DX3A 5A8NA 1EDGA 4HP5A 1UH2A 3A22A 4CVWA 1EQCA 3PBGA 4H04A 3BMVA 1FHLA 3BC9A 4P7OA 1K9EA 4H8VA 4OIFA 3WL0A 1J0HA 3SCSA 4TUFA 1SMAA 2WC7A 1KQYA 4MNMA 3HG2A 2XVLA 5FIPA 2ZX5A 1JD9A 2EBNA 4A3HA 1UHVA 3D50A 4MNKA 5EFDA 3ARVA 5FL0A 4GZEA 4U3CA 1H2JA 1CLVA 2X1IA 1H4PA 4CN4A 2WSKA 1AMYA 5CGMA 5CSYA 3VX0A 4U5KA 1LF1A 3PZOA 3HG5A 4AY1A 4UZSA 1LLOA 1V0NA 4Z2JA 2YKKA 1XH2A 2D23A 3DX1A 1JXJA 2WHJA 4UQEA 4B9YA 2E8YA 4PMOA 1J0JA 1IZKA 4HZ8A 1ZBKA 3M07A 1R85A 2OWWA 4DUWA 1KBBA 1BF2A 1KXTA 1DWAM 2JIWA 2WPGA 3KWXA 2BFGA 2CHOA 3DHPA 1WDPA 1ZBCA 1ISYA 4GIAA 3HN3A 4UQ9A 5I5RA 4W85A 1R46A 1MYRA 1GJWA 3B8SA 2E9MA 4JKMA 3MV11 1ITXA 5JUVA 1WZKA 4NXKA 4CU6A 3OLEA 4F8XA 2WVSA 4MADA 3POHA 4AZGA 1E5NA 3GTNA 4MAVA 5A6BA 3WUFA 3UG4A 1CXLA 3ARTA 2HVMA 4PMNA 1JF6A 3WDRA 2VT0A 1H0GA 2IXVA 1W9DM 4B9ZA 3W28A 1GUVA 4PN2A 4BA0A 4D6DA 2BS9A 3UR7A 5I3DA 5ABEA 3WIJA 1NWTA 1V6YA 4D6HA 4W8BA 1MXGA 1GHSA 5C71A 2V3EA 3M6DA 1HJQA 5EBAA 3S6TA 3MI6A 1C7SA 4FMVA 2AAAA 2YBUA 4CKQA 2PBOA 2OYKA 1UWQA 1QI3A 3OG2A 3RJYA 3GXFA 3IK2A 2XSBA 3PHAA 1F4AA 3EMZA 4PTWA 3ARQA 3CLWA 1M01A 4JHOA 1TCMA 1CXIA 3CHDA 4OOUA 3AIUA 1GOMA 1TFVA 3DYMA 4PMXA 2D0GA 1CGUA 1EHAA 1W1PA 1GONA 3RDKA 3M46A 1QHOA 4Q7NA 2WKLA 1E4LA 5BCAA 5ECUA 3ZJ6A 1JYVA 2G3IA 1UR8A 1GVYA 1TMQA 2DSUA 2D0HA 4W87A 1BPLB 5CZKA 1UD3A 3BCFA 1M53A 1I1WA 1H5VA 2XTKA 1QWUA 4QLKA 2X2IA 1DWFM 3GZAA 4DUVA 1LL4A 3EMQA 2EPOA 1JDCA 3NJ3A 3OBAA 3BVWA 1PX3A 3EDEA 3AIQA 1DEDA 3ZR6A 2O92A 3B9AA 5A6BD 2CITA 2WHMA 4P8VA 1B0IA 4DWSD 1WP6A 2GSJA 3ARUA 4AZ5A 2Y4SA 4JFTA 4Z2LA 1GW1A 1QNSA 5DF0A 2UY4A 1CXFA 1B3ZA 3CUFA 6CGTA 1NARA 1EXPA 1H09A 4KGJA 3S5ZA 4Z2GA 4M8UA 2FH8A 1AQ0A 4AXNA 3BUDA 5GNXA 4B16A 3WNKA 4LXFA 2VCCA 1JF5A 2J79A 7CGTA 3BAXA 3VGBA 5I0DA 4TOQA 2EXOA 2ZIDA 4IUGA 2OSWA 2IXUA 4D71A 3IAPA 1KFWA 2X2JA 2A3BA 2ZE0A 1W9XA 1MQPA 4HTYA 4ZXOA 1W32A 3CBWA 1PZ2A 3WDQA 3A24A 5I77A 1H11A 3H54A 1CPUA 4ACZA 1XCWA 1FHDA 3ARPA 3RILA 2VX6A 5D9PA 3W25A 5A95A 2V3DA 2VVNA 2O9PA 1NWRA 1EO5A 3AXIA 1TG7A 3RMEA 2W92A 3WEOA 2VZOA 1HXJA 3FHQA 4NRRA 4X0VA 3HU7A 1BG9A 4PSRA 2WMIB 2RGLA 2WMIA 3U5YA 2XVGA 2BHYA 2XGIA 3DX4A 3W4RA 1V03A 4J3WA 3VDBA 5FCZA 2DT1A 4L4OA 5AC4A 2VOTA 4NZFA 1G01A 3QOMA 3TV8A 1CDGA 2WMKA 1QBBA 2GUYA 3SCPA 2FHBA 5A6KA 3D51A 1GOKA 1ECEA 2G3MA 4R27A 1E72M 3WQ5A 4M1RA 1ZBVA 4W5ZA 5JIPA 2XN2A 3A47A 1MW3A 4J3SA 3VM5A 4AYGA 3RM4A 4J3VA 4PTVA 4ZE4A 5M5DA 3GXIA 2GJPA 2YL9A 4CU8A 4CUCA 1ESWA 3T09A 1ODZA 3BXWA 1R7OA 5A6JA 3MMWA 5AC5A 4HOXA 5BXPA 1D7FA 5A6AA 2PF0A 7A3HA 3WDHA 1PZ3A 3CC1A 2ZXBA 2VURA 4WSKA 2VCAA 4LX4A 1DWHM 1B90A 4LYPA 1J0ZA 3GBDA 4UOJA 3AIWA 3CUHA 3VGHA 4QCFA 1DWIM 2W91A 2VZSA 5DT7A 2CCRA 1MXDA 4GINA 3LXCA 1FP9A 3BUBA 3TTSA 1JFXA 5FD0A 4WKFA 2EJ1A 2ZX6A 3M7SA 4PTMA 4AISA 3UESA 4AD4A 2XVNA 3WY3A 2DSVA 3ALGA 1V02A 5DT5A 1JZ2A 2BHZA 1HVXA 4D6EA 2QLYA 3WNMA 1US3A 3AICA 4JHZA 4M29A 3VIOA 3FW6A 4NZCA 4D6IA 2ZX8A 4W8LA 1R87A 2F61A 2J74A 2QPUA 4TTGA 2VVSA 4P7QA 1B2YA 3VDAA 4GQRA 3UCQA 3CUGA 5KZ6A 2OWCA 5IHRA 3OLDA 1BGAA 4IISA 3SCUA 5CXPA 2BXZA 3NIYA 3DX2A 1QW8A 2EAEA 4M24A 3ZJ7A 2J78A 2XWEA 3NUKA 3VNZA 2YDRA 3WH7A 2E3ZA 2V5DA 1MQQA 4W93A 1V0KA 2DDXA 2XSAA 4F9JA 1K9DA 1QVBA 2EO7A 3VMNA 1K9FA 2GJXA 3EDJA 3GH7A 4QFUA 5CJ5A 1AQMA 2ZUWA 2WNWA 4PEEA 4Z2IA 1HXKA 2E40A 2CYGA 2YBTA 3ARYA 3WDPP 1BYCA 1VEMA 3MV01 1BSIA 2BXYA 4UFMA 1MQRA 3K8KA 1D3CA 4M56A 4UFKA 2ZUVA 5I23A 3WQ8A 4HA1A 5GQBA 2NT0A 3EYPA 1UKPA 1UD6A 3CHCA 3G6LA 3NDYA 3EDDA 3WF1A 1YHTA 1O7AA 4DO5A 1RH9A 4AMWA 1GQLA 3GNOA 3WQWA 3O9NA 1TZ7A 2FH6A 2GVYA 1DWJM 1N82A 4E8CA 1KWGA 2AOSA 4CGTA 1HX0A 4BQ3A 3T2OA 3GXMA 4PMVA 2OYLA 2XFRA 4S3JA 3THDA 3NDZA 1S46A 1SZNA 1E4MM 2C0HA 4PMZA 3WMBA 1JI2A 1TE1A 1TR1A 2GK1B 3EBVA 4DO6A 4ZE5A 5LA2A 1WDQA 2WB5A 3FN9A 3VDCA 1BLIA 4UNIA 5EMYA 4CD7A 3MU7A 2BVTA 1CGWA 1DP0A 1JZ4A 9CGTA 1PPIA 4PRWA 2E0PA 3BVTA 1E43A 3LX9A 2XJ7A 4ZEPA 1JZ7A 1KXHA 1UUQA 5CPTA 2CBVA 3IAQA 3PZIA 2PB1A 4UQCA 2YDSA 3T0BA 3RM8A 3MUIA 4FNRA 2FGLA 4UR9A 1BVNP 2ZOXA 4AIUA 1UD8A 2ESCA 4U2YA 4BZYA 2YL6A 2GJRA 1HF6A 2FGZA 5A2BA 1FFRA 3PZ9A 4FLRA 1XSIA 3DX0A 4UFJA 3D5HA 1V0LA 2V3GA 3GNRA 3PN8A 3POCA 1D2KA 4WKHA 4ML4A 4FLQA 3D4ZA 4UQAA 3AMCA 4HA3A 4AEEA 4CCCA 1UD2A 3ARRA 1V3IA 2WHKA 2X8RA 4OUEA 3N1AA 1ISVA 3AROA 2DGAA 4LPCA 1LJYA 6A3HA 1HT6A 4CD6A 1ZJBA 3CPUA 4W86A 1UZ1A 3PTKA 2ZUSA 4AIOA 1BTCA 3O6AA 4E4PA 3F5LA 4FNQA 1VFFA 1V6UA 4QLLA 2DT3A 4HMCA 3RCNA 5LA1A 1HIZA 2BHUA 5I2UA 2F2HA 1C8YA 4DO4A 1JGIA 3D3AA 5E0FA 4F66A 3OZPA 3OA5A 3PZVA 2OLHA 4NZJA 1UOKA 3DC0A 1M04A 3CO4A 2DT2A 3IJ8A 2W67A 1JG9A 3A21A 3A6OA 3WF4A 1UR0A 2CXGA 2DSKA 2WZIA 3T2QA 1UWTA 3K8MA 1WB0A 4LGXA 1QWNA 3HG3A 4UOZA 3G6MA 1OGBA 1U2YA 2D20A 1C7TA 1UH3A 1LG2A 1QOXA 2X09A 1X6LA 3NYDA 1TA3B 2F1AA 1ISWA 1B3WA 1Q6EA 1B3VA 1V3KA 3TA9A 4MDOA 4AZBA 4BQ4A 5JBDA 3A5VA 3AS2A 1IV8A 3U7BA 1QW9A 7TAAA 3GNPA 3LXBA 2WMGA 1VJZA 2XIBA 3EJTA 1EQPA 2QHAA 3GXDA 4NF7A 3AQUA 2PI6A 3BLKA 5CGTA 5LA0A 2RGMA 3LPFA 3CZ8A 3VD5A 1HP5A 3BUPA 2IUZA 3MSDA 1CGXA 3WMSA 4U2ZA 4MJ2A 2YLAA 2MANA 6TAAA 1OM0A 2CESA 1ZB5A 2J7HA 5M03A 4UQBA 4BCEA 4H2CA 1XRVA 1NP0A 4OBSA 4U5IA 4U31A 3A3HA 3I3BA 4KRTA 4PUDA 1P6WA 2OW6A 2ZUNA 1TA3A 4MB1A 3GXNA 4AZIA 4A3YA 1J12A 3BAIA 1FH9A 1HKKA 3VGFA 1J11A 2FHCA 2UY5A 4HOZA 1XD1A 2OSYA 4P7LA 2ZWYA 1L8NA 1JZ3A 3HG4A 4Z2KA 1HJUA 4CD4A 1EOKA 5D8ZA 2WVVA 2D3LA 2PC8A 3ARZA 1V08A 1F4HA 5BRPA 1TQTA 3OLIA 1V3HA 1PIFA 3AS0A 3L4ZA 3WH6A 4S3KA 2WHLA 2BY1A 2VCBA 1GZJA 1GCYA 1KXVA 1NM9A 1OD0A 3T0AA 4LQ1A 2OW7A 1CTNA 1MWOA 4EAMA 3F4VA 2JF6A 1CZ1A 4ZXLA 1FH8A 2XWDA 1E6ZA 4KRUA 4PUEA 5E09A 2VUYA 1HJXA 3W53A 5LYRA 4C7FA 4JKKA 2WBKA 5HDRA 3CGTA 3PZTA 1M7XA 3ECQA 1UQYA 1V6WA 4BQ2A 2WWDA 4LYRA 3ZIZA 2VQTA 2VMFA 1G9HA 2VR4A 5E6YA 1NOUA 3LMYA 1J0KA 4QLJA 2XVKA 3MMDA 2QF8A 4P8UA 1GQJA 3L4XA 1KGUA 2W61A 1GQKA 3CZGA 4WK9A 1OD8A 1RP8A 4JL2A 3ZMRA 2Y8VA 1JDAA 3A4AA 4WJXA 1FH7A 3BVUA 5HOSA 2JEQA 3RO8A 4HU8A 1KR1A 5A6MA 2ZX9A 4D6FA 2XIIA 3II1A 3AHYA 4W84A 4K68A 3SCNA 3AHTA 1X6NA 2QMJA 1Q6FA 3KEHA 2XGBA 2EPKX 3MKKA 2WSPA 4F79A 2UWFA 1IZJA 1QI0A 3W24A 1KTBA 1KGXA 3AMKA 3CTTA 2VX7A 3VD7A 2YFOA 5D8WA 2ZICA 3SCWA 1C92A 1XCXA 2A3AA 1WDSA 2ALWA 3T0DA 3CZJA 1E40A 3ARXA 3VIHA 2VZUA 1U33A 2E4TA 3CHFA 4OOZA 1UWUA 1BYBA 1KB3A 1R86A 3AHVA 1GNXA 1W9VA 3PZGA 3BGAA 4FNUA 4YPJA 3WSUA 1OGSA 1GVIA 2Y24A 1O6IA 1E6XM 5CG0A 2BY2A 3WKZA 1VRXA 4NSBA 4OBRA 1OIFA 5D9NA 2XM2A 2ZXDA 5E1QA 5A8MA 2A3HA 4JFWA 3VD3A 5JBFA 1I1XA 1VENA 1TVPA 4RL3A 1EA9C 1V3JA 3AIBA 3WFLA 4AIEA 4XB3A 1Q6CA 4U33A 4E8DA 2GJXB 3K1DA 4J7RA 4PCSA 2W63A 4JFSA 3L4YA 3VNYA 5C70A 1UR4A 1SR0A 1TQVA 1JAEA 3VGEA 1E6RA 2QMKA 1EOMA 1UKOA 2Z1KA 4UZUA 3F5JA 1XHGA 1RD6A 2EPMX 3B9DA 1OGGA 2EEXA 1ITCA 1QHPA 1OBAA 2CKRA 1VFMA 4ACZB 3HJEA 3WL1A 2PBGA 2DH2A 1A47A 3AISA 3W6LA 5ABFA 3JUGA 3VMOA 5HXMA 3WNPA 3TTQA 2J7BA 3WEZA 1UYQA 4A4AA 4AD5A 1J18A 1V0MA 5DO8A 3AMLA 4J27A 1QNRA 4EE9A 3K46A 2UY3A 2VX5A 4H8UA 1R75A 5GNYA 1EH9A 4CD8A 3WH5A 1MFUA 1MW0A 1BGGA 2VC9A 3SCVA 5CLWA 1DHKA 3VMPA 3VTRA 5DMYA 5TD4A 3GYCA 3CZNA 1NOWA 4ACYA 4RE2A 1RP9A 4ATDA 5JIWA 2X0HA 4UFHA 4R5EA 3KLKA 1IT0A 2WC3A 3AYRA 4NX0A 2X2HA 3FAXA 1KQZA 3AOFA 3SURA 3WDJA 4CU7A 1G94A 2TAAA 4BF7A 3N12A 2YLLA 1NOFA 1VIWA 2EQDA 2CERA 3WUEA 1E6PA 4JCLA 3MUZ1 4FLOA 3AS3A 4AD0A 1VB9A 2WK2A 4Y7EA 4AD1A 3DECA 1WZAA 4TVCA 1BQCA 3ZSSA 4D6GA 1US2A 1V6XA 1W1VA 4PTXA 1VAHA 1WPCA 1E73M 1KCKA 2V5CA 1CIUA 1R47A 1V3MA 1Z32X 3AJ7A 3RIKA 3WELA 1UKTA 1C8XA 4UOQA 3LRLA 2WLYA 4PMRA 1OSEA 3LXAA 3CUIA 3U7VA 1UR2A 3IGUA 1R8LA 2YA1A 5CPSA 1JFHA 1E71M 3W37A 1ODUA 4BS0A 2VRKA 1UA7A 1JZ6A 1NWUA 4AD3A 3WENA 1E9LA 2PWHA 1B3YA 4MAZA 3AI0A 1B3XA 1Q6GA 2XVPA 3VD9A 3PTMA 4P7RA 3OB8A 3AZRA 3B9EA 4UFIA 2GFTA 4AZ7A 3SUWA 2J7FA 1LL6A 5A3HA 3SCQA 1ZBWA 4AZ6A 2WXDM 2EPLX 3EJUA 1UKQA 1QI2A 4EANA 4MPKA 4JZ5A 1R7AA 2YL5A 4YHEA 3L2MA 1UD5A 1PBGA 1KWKA 3CMJA 3CZLA 4ATLA 1W91A 3S5YA 3WFZA 3VKKA 2E8ZA 3GDBA 1E0VA 3ZT7A 4EKJA 1XC6A 4W8AA 2F7PA 2F7OA 1FP8A 3EJPA 2A3CA 3RPMA 4TX8A 2WANA 2WMHA 3N11A 5AYIA 3N13A 3BUQA 1HN1A 3MS8A 1J9YA 1XV8A 3GBEA 3LPPA 3WD0A 4JKLA 2DSZA 3CZEA 3KE0A 3TP4A 1W1TA 3AMDA 1O7DC 4DUXA 1J0IA 3LRKA 2ZUMA 3AMGA 3MO4A 4PMQA 2F8QA 2BVYA 3SUVA 4W88A 2WVVB 3AIVA 5C8BB 4XV0A 2VX4A 2D0FA 1KXQA 2PWFA 4RE3A 1W1YA 3VIKA 1CECA 1QX1A 3BLBA 1HNYA 1UWSA 1HL8A 1JIBA 2WAGA 1T0OA 4GI6A 1CLXA 1G0CA 3VIMA 3N04A 1E3ZA 2JF7A 1B30A 1OT2A 2OSXA 3SCRA 3UR8A 3ZT5A 2VNCA 2Y8KA 5FKYA 2J7CA 3H53A 3DDFA 1K6AA 2X2YA 3CIVA 4KH2A 3VIIA 1W3JA 2WMJA 4PBGA 3VO0A 2WVUA 2XPKA 3EDFA 4TX6A 2G4FA 4J3UA 4V27A 3ARSA 3MUAA 1CNVA 2VQUA 3K4DA 3SUUA 1C90A 5A6SA 4IPLA 3PZQA 4OJYA 3NSNA 4JFVA 4HOWA 2NSXA 1EO7A 4ATWA 4M82A 3WQVA 4CD5A 2XN1A 2WLZA 5ABHA 3LRMA 2F7QA 3OLGA 3LPOA 3AZSA 2EABA 1E6QM 3ARWA 4H41A 1ZL1A 2J62A 3W82A 1FFQA 5EB8A 5E9AA 4KWUA 4HPGA 2C8NA 3WN6A 1HKJA 1JL8A 5KEZA 3VD4A 2BY3A 1H3GA 1GJUA 1W3LA 1XGZA 3CUJA 2D73A 3MUY1 4PMUA 3U5UA 3MMUA 2ZX7A 3O2LA 3PTQA 3BAWA 4AC1X 2VTFA 3NSXA 4FNSA 3WBEA 2CBIA 2J8FA 3VINA 1XYZA 2XHYA 3ALFA 1BHGA 4W7WA 1ISXA 3HZ3A 1QI4A 2VZTA 3A4XA 3E1F1 4WF7A 4FK9A 3WUGA 1XSKA 3DDGA 1E0WA 1UA3A 3WH9A 4NRSA 1OIMA 1HTYA 4N0RA 1K9TA 1HJSA 5A2AA 2DIJA 4UCFA 4MJ4A 3D4YA 1JXKA 4HPHA 1SFSA 1GOOA 3APGA 3FNDA 1CGYA 3AXXA 1UASA 3WNNA 5DFAA 4FF5A 1GOQA 3N17A 2CEQA 1UR9A 1G1YA 4GXPA 5HNNA 4ZFMA 3I3EA 2YJQA 4CCEA 2WCSA 4DM1A 4DWSB 2JE8A 5BXTA 1PX4A 1OWQA 1UZ4A 4AYSA 2C7FA 2JFEX 4TVUA 5HPCA 3WY4A 5CSUA 3CHEA 4HMDA 1MFVA 1JZ8A 1PS3A 4AZHA 1CGTA 1CXHA 2G8ZA 3WBAA 4H8HA 4J28A 2CBJA 4N42A 3F5KA 2XUCA 1MVYA 5IXEA 3UEQA 4JCMA 3IJ9A 1Q4NX 3A23A 2BV9A 2CHNA 3OIHA 3WD1A 3VSTA 4V28A 1MW2A 3N9KA 1JZ5A 3SEPA 1C3FA 1BFNA 4D1JA 5IFTA 3WDIA 4HMEA 3QOKA 2WM0A 1QI5A 1WNOA 2XFYA 3WD4A 2NW0A 2DH3A 2XFFA 1WCGA 1W2VA 2ZWZA 3VGDA 3FAWA 2CIPA 4CVUA 3CV5A 2D22A 4UFLA 4WKAA 3FHAA 1HVQA 5I6SA 2J7DA 1PX8A 4JFUA 1J01A 4D1IA 2WCGA 4IM4A 3WH8A 3QGVA 3VGGA 2V38A 4FLSA 3VSVA 2XN0A 3W6MA 1ISZA 1H41A 4MDPA 4AZCB 1VBUA 4XX6A 2QPSA 3BUIA 2O9RA 3N18A 3VPLA 1JI1A 1XYFA 2FDMA 1HL9A 4QP0A 4AD2A 2CKSA 3GH5A 2WW5A 1FA2A 2DPEA 3PZMA 5A8QA 1V3LA 3BVXA 1CYGA 1GORA 2VI0A 3KZSA 1GPFA 2B31A 3UERA 1WAWA 5EFFA 4AZCA 5A1AA 3UG3A 4TVDA 4WLCA 5BROA 3RJXA 2CETA 4CN1A 3UG5A 3QHMA 5ABFB 1MW1A 4EK7A 4JAWA 5D9OA 2Q8XA 1EDTA 5A8PA 2BVDA 4NXSA 5IHSA 2WWCA 5E70A 2ZUUA 2J25A 3VDHA 1B1YA 1UG6A 2YIHA 1UWIA 2DSWA 5I24A 1KBKA 3QHOA 3FY1A 4DM2A 1TVNA 2DIEA 2WBGA 4MTVA 1A3HA 3CZSA 3AHXA 1NQ6A 5M17A 2W66A 4MB4A 1W9BM 3GXPA 3AIRA 4C7DA 2OYMA 4D6JA 3EMCA 2WC4A 2VJXA 2VRQA 3AIEA 3VILA 2VZVA 3OGRA 4XZBA 4GZIA 3ZJKA 2EPNA 3WD3A 3BAJA 1LL7A 2WKGA 3N15A 4DWSA 3CH9A 4HZ7A 4U3AA 4W7VA 1VEOA 2QV4A 2ZXAA 5A8OA 3GH4A 3FXYA 4H7VA 1PEZA 3VIGA 5BXSA 1VEPA 1CGVA 2O9OA 1EHNA 2J47A 4GI8A 1W3KA 3TOPA 1CBGA 4FNTA 1WKYA 3VU2A
chains in the Genus database with same CATH superfamily
2HAZA 1I7RB 3RZCD 2J7GA 3G1YA 4Q6IB 4GPNA 4KC3B 3DI1A 3FQTA 5I1JL 4JL1A 2RAMA 3R89A 3KS0H 1ETJA 5CBEA 5TPWL 2YDQA 4X4MA 3R13A 1J8HD 3DKJA 1HYSD 1DEEA 4ZUUB 1MWAA 2J4GA 2QVTA 3STZA 1OGPA 4ODWA 4V1DA 1XF5A 3CMOH 4K5PA 4N90D 1SO4A 4QMEA 1UTDA 1TJIH 1MFEL 1KT2B 1BYDA 2VDPB 3BAKA 4YZFE 1H49A 3SPCA 2DT0A 3PJUA 4N6FA 3DVGB 5A16B 3UF9A 3RVTD 2FHFA 1C12B 2O5ZH 1HKVA 5JQ9A 4WO0A 5DRNA 1E3XA 3FDWA 4ZMXA 1FDYA 2IANE 4U49A 3SBFA 1CE6A 2Q76A 4AI7A 3F4CA 5JIIA 1U92B 4GLRI 1TCRB 1A1OA 2DM2A 3VXOA 2BNJA 1G5AA 1NWSA 4S38A 5DHVH 8FABB 1R3VA 1SN5A 5EC1B 3G1DA 3Q43A 5H8MA 4PRNB 1ZJAA 5LGHH 1XGDA 1MLCB 2PTTA 4NWTH 1W54A 2HH0L 4N7QA 3WLWC 1BVLA 3OKLB 3BWUF 4NN5C 5E2WL 4F58L 5ICXB 3BO9A 4YUEL 4PJGA 4FJ6A 4LSRH 3T3PE 4F91B 1BG4A 1T3FA 5D9MA 2XC8A 2YUZA 2G3NA 4YSQA 1HGYA 1H50A 1IXPA 2NY4C 1FNGA 4JGDA 1E0XA 4OY9A 1CFQA 1LO5B 1S9WB 1XG3A 3KM1A 2X30A 5AKTA 3EA3A 1AKJB 4WGKA 3LCYA 4KO9A 4PV8A 2NVCA 5LXXA 5CPOA 4EBQH 1XFCA 4Z1YA 3HHSA 3A6CH 5FF6A 4PB9L 3BI9X 2JCCF 2YPLE 5AALA 5I73C 1BXBA 3ZE2B 4PCTA 1FVCB 4FMKA 3TFKD 4AQLA 1C29A 2CLRA 5HPMA 4RDQG 4H2HA 3TFCA 4UQDA 3DFQA 3RPKA 1O5DT 1OAKL 1VFAA 3LQMA 5BW6A 4GWEA 2H1XA 4YZWA 2ZZ6A 3R7MA 1XF1A 1N8WA 2WO4A 2WWNA 5EOCL 12E8H 1AGCB 2D3NA 5CEYA 1UBSA 4LANA 4WWKC 3K6OA 3E6HB 4OTKA 4TVPE 4X8GA 1KIUB 2XWCA 4H1LA 2EACA 3ZTNL 5BUAA 1CTOA 1C8QA 2WYSA 2CIKA 1V4YA 3D2UB 3RGVC 4NP4H 4OAWA 4Y5XA 5E6ZA 1LP9E 3VQ2C 1FUYA 3AADB 3EFOA 2V17H 4L4PA 4YHPB 1BGXL 1F73A 1ASQA 3L2LA 4CQCA 1ECYA 4K71B 3DARA 3PREA 1WAPA 2EIMB 4F15B 1KN2L 1OT1A 4XCYB 2WCAA 1ZZMA 5CIPH 3JW7A 3LM3A 1OB1B 1E9PA 3XIMA 2PAJA 2ZOTA 3T0EB 2JVUA 1EJOH 4P4KA 3STLA 4M1DH 2C1IA 4V33A 3VXMD 2L8AA 1XZWA 3LM7A 5F2GA 3VVGA 2QNEA 5BZDA 1JNDA 2Z7GA 2HFGL 4IGNA 4S3CA 2KX9A 1IL1A 3AS1A 1RJRA 1ASPA 1H1NA 1WS7A 3DVNB 3FU7B 4LLWB 2EE6A 1KIQB 1XLEA 3MJ8B 1CWYA 2Y25A 5EU9A 1UWRA 3ZTEA 3QI9B 2G5WA 1X5YA 2NW3A 4YTTA 2VL4A 1G6RA 3CVCA 1F6LL 3HFMH 5DS8A 2ROYA 2BSEA 3SZ6A 3UJJH 3TLLA 2WQRA 4GQ9L 4JDVA 4N0UB 4WZ9A 4Q6JA 3ARGC 2CZNA 5HR7A 2QCHA 2X0UA 3EPOA 4WY0A 5CZXC 1QMUA 1FZKA 4JREB 3NQ6A 4HT3A 4PL2A 3ARBB 4LCIH 5D02A 1W8SA 3SDCC 4N6EA 1T1ZA 3ZDXF 2Q9OA 4GG6B 4OV9A 3MSGA 4Z18A 2EINB 1GOIA 4QRNA 2Q8AH 1O9VA 3U6WA 2GBVA 3OZOA 4Q4PA 3EFDL 2CUAA 2E6FA 2BZNA 2YRPA 2F53E 4NWUL 5I3GA 5FHBL 3S3SA 1TPVA 3HJZA 1TFPA 2UXFA 2A83B 2NY0D 1XLIA 3PZUA 3P02A 1LP9A 2V3FA 3VFGL 4AUYA 1P0DA 4Z7QB 1KJ2B 2HTMA 1Q9KB 3EO0B 4Z7QE 5HBFA 3K30A 4QTHB 6PTDA 1CK0L 1FORL 2UXGA 4URTB 1MCDA 1DBKH 1QZNA 3BSGA 1CXKA 2VLRA 1IKNA 1I8AA 3PQYE 1OK8A 4YSPA 2AXGB 4PW4A 5E2UL 4WI6A 3DYOA 4GZ7A 4AWUA 1Q63A 4FQ1H 4XBPA 3EWXA 4J4PD 2R15A 1JGUH 2PDHA 5EPDA 1LO2L 1WAAA 1P7QD 1PAMA 4LLAA 5PCYA 1TNNA 5CEYB 1OINA 5DN1A 4CQDA 4QRAA 3TH6A 1E65A 4M5ZL 4P9HH 3KZSA 5KS9A 1HWWA 3EGSA 2VC2H 4JK0D 4KRMB 3T2PA 4J3XA 1K8YA 5JDSA 5A2IH 2OMWB 2WHVA 2WYHA 3WFBH 2WVTA 3OA3A 4JEQA 3HI1A 4XE5B 5CLTA 2L04A 2ZXGA 3CZKA 1JN6A 1B5TA 3O6ML 3TTOA 1CGSH 1UKSA 1V6VA 1IYXA 5D2TA 1D6VH 4TSCH 3FQ2A 4DGUA 3VNDA 1NSNL 2FIQA 1LEGB 1H3TA 2KZ1B 4WV1A 4YBLC 5LBSA 1O12A 4Q8PA 2JJWA 3KR3H 1QCWA 4OZHE 2Z1VA 5D1QC 1DQTA 2H6PA 4AJ0A 1G7IB 1RV6X 1ZOXA 3R7RA 1B54A 4US6A 1QJWA 3OKNA 4JY6B 4WI7A 4DP8X 4JY6A 4X6FA 2H9AB 5CUSH 1N3NB 4P5MA 4NKCA 1MUJB 3FB7A 4X4ZA 3LMJL 3SDXF 1G7PB 4PGBA 3ABRA 3KPSE 3DIFA 4I3RL 2V9UA 5EU5A 5JHDB 2FJFB 3TEXA 4F7PB 1S38A 3LLXA 4JN6A 4OFCA 5LBVA 1ZA3A 2HPOA 2OZ4L 1DDHB 3BQ5A 4JJHA 5GGQH 1JGEA 1SMOA 1VFOA 3T8XB 3C2SA 2APWA 4KK8D 4G7FA 4OV6F 4I7VA 3B9KC 4I1RA 4M61B 1GHRA 2Z1XA 2KC0A 3VXOB 3W2NA 5E8PB 3L7EB 3KBFA 4YN5A 1I1AA 2NQJA 1FWDC 3S96A 1U1JA 4HZ1A 1VPOL 4WSJA 5EIVA 1A1NA 3HE6B 3T4AA 4F7TB 5KTEH 4IFKB 3DHUA 3TQKA 1DTUA 3OZKA 3QSKB 2BHFA 1LE9A 2UZ9A 5HQEA 4M6ML 5C07D 2X0VA 4KWSA 1TT6A 2D3VA 3HPSA 1QFWM 4Y96A 1PLAA 3D0VA 1WBYA 5DJ2A 1QK2A 1KJ2H 1A5MC 1TQWA 5IW1B 3RWDA 2PP1A 1HXMA 4KQ0A 3KPRD 3ZXWA 5AKVA 4DHLA 1AXIB 1KYOK 1THAA 3QQ9C 2COQA 2FSEB 2O26U 5KS9F 3LTYA 4JS3A 4AITA 1FL6A 4AM0A 3BG3A 5FOBA 1C93A 2DQXA 1TMCB 1P4CA 3U46A 3BPNC 3KLLA 3FT2A 1EPFA 1U8CA 2GCYA 3KPQB 1GYLA 5A69A 3W38A 1ZQ5A 4KTDH 3OGCB 3NEVA 4TO8A 3QUXB 1ANUA 5GGTH 2C19A 3OGSA 4IIEA 4GUPB 4PZVA 2JIEA 3UVAA 2XQYK 4PJXE 5F93C 1NDMA 2VUKA 3QNZA 1CFNB 5EUOF 5IT2H 4J2XA 2W62A 2W5FA 4MWFA 3VIPA 5IR1A 4X99A 1FGNH 4UNVA 2Z1SA 3MUXA 3BVVA 4RDWA 4AWEA 3L3JB 3U0WH 3ZKXC 3OYXA 4WKXA 4XHQA 1ZGLB 2V5MA 2W79A 3VXUD 5KYWB 2G0WA 4LCCB 4LQFH 4RE4A 4FZ8H 1QRNA 1U42A 4JFXA 4F93B 2Z65C 5JUEH 2RFXA 4U1LB 3L3GA 2EGZA 2HK0A 2F18A 2Z27A 1M3IA 2V5YA 2JI3A 3FCPA 4UR7A 3QI9A 4KXBA 3VM7A 1GKRA 3FEMA 2DI8A 3O6LH 3MLYH 2JALA 2ZG2A 5FCSH 4FALA 1I7ZA 1YN6B 5DMKA 1IM3A 1MRCL 4JX5A 2WBXA 5EZPA 5D1ZC 3FCBA 2ICWJ 3VFWA 3QZEA 4GSQA 5IY5B 1BVKA 2BFVL 1YNQA 5IGXL 2YGVA 1JQVA 3L2NA 3QR3A 5E5RB 3OGOE 1CFSA 4UTTA 1QAWA 3ZYJA 2DJUA 4AMKH 1HKIA 4W9HC 2J7EA 1RCYA 2R8WA 3L2IA 1LL1A 4APQC 3RM9A 1MEHA 3DSNB 2HFFA 3MR9B 5GGRB 2GVGA 3ZBMA 4FR6A 2GDUA 5HVFB 3TFKC 3KBVA 3TCXA 3D2UA 1RJYA 5HHXL 3ZE2F 1QNVA 3VAVA 4HAFA 1M7IB 4L9LC 1N2RA 3GLCA 3QQ1A 2BY0A 4ZS6C 5BRZA 4HXBH 1I4FA 2YGQA 3IIZA 4HCFA 3MCNA 5JHDE 4OQTH 4AQEA 1XIMA 4QDMA 5CQ1A 2CDFB 1EDYA 2DM7A 4NO5B 4BQ8A 2XTJB 1A5FL 4S1DD 4Y9BA 1E9PB 2X1TA 3EA2A 3SQSA 3WHXB 3AHZA 1SDDA 5FUCE 3S2CA 3ZE2E 4F3FB 4KK5C 1FNEA 4HK0A 2R51A 2CHXA 4F9LC 3EJYD 5FA5A 4YTSA 2H3DA 4Z2HA 4H00A 4H7ZA 3GFZA 3GIVA 2X4UA 4X63A 4B5SA 4FAMA 3UP1A 2HXUA 4NI3A 3MV9E 1P6BA 2VAJA 4JN2A 4YHLL 5FM8A 5J0BA 1Y7VA 4NSKB 5HHPB 2GOUA 3SIMA 2XJKA 3F6JA 3TN5A 5JIKA 4OZIB 4ROPA 1KRCC 3EJRA 3F2DA 4X9BA 1E6JL 2BVQA 1NCHA 2H8PB 2NCMA 2NYYD 4QO1A 3DLQR 4U6YB 5DD6B 2H6PB 4KO6A 4YXKH 3S96B 1XGYH 3ZHFA 4AUUA 4E9SA 4TTDD 4D6CA 2W4XA 3EG9B 1F6AA 2VC6A 4M48L 3GUGA 4YSSA 5REQA 4UMSA 3AFLA 2B3IA 4H8PA 3B8IA 4HZ6A 3NPSB 3TNMA 4NQXB 1GZHA 4LAMA 3B3IA 1BQHA 3MLWH 3SCMA 4UT6H 2GK1A 1Q45A 2Q0ZX 2X1WL 4RQQB 2A99A 4DZBA 3DJZA 3MLXH 4XP6L 1WHOA 2G3JA 2LABA 3EFFA 2BNRE 1BXVA 3IDNB 3LH2L 4JM2C 4LEOB 4P06A 5MI0C 2OO0A 2QS8A 3E80A 4GYPA 1M03A 8TIMA 1KTCA 4KIEA 3U7YL 4P8XA 4Z3IA 2X7WA 4EAYA 3WCZA 3WF2A 1FCVA 4NU7A 2WJEA 3H2MA 3BH9B 3BLPX 1FUNA 3K2KA 3FZUC 1WDRA 3OKLA 5D70L 5C6PB 4ODWB 3LCLA 2I9TB 1MCSA 1LWHA 1T7YA 3AB0B 1EEQA 3FQUB 3OR6A 4PJ9A 5F7LB 1PE1A 2N7AA 3U30B 3NCOA 3SCTA 3W81A 1F90L 2WXRA 3QWOA 4IRZL 1BVZA 2QADD 4FI8A 4UTAL 4B2DA 2ZZ3A 3WYZA 2F9BT 3OKKA 5KS9B 3DETC 4TQPA 5JHLA 2XM1A 3JR2A 3OYZA 5F2LA 5DRXB 3PQYB 4I1NB 4E2VA 1CFBA 1EIBA 3GXTA 3TONA 2Y70A 4X9YA 3DX3A 2H41A 4V2BA 12E8L 1P7KA 3QEQD 5LWYH 3D3FA 2ADIA 5L9DL 3BLEA 5EA9A 2ICCA 4JDZB 1I3UA 1KGJA 2IWFA 3G5ZB 4RZCB 5DVNA 5INCA 5I8CB 4G9FA 4YYCA 2YK1L 5DUMH 2FJKA 2XIQA 3WAJA 1EQCA 1PVHA 2B77A 4I0PD 1TEYA 2N7SA 3SR7A 4DELA 5A7EA 3OJVC 2YPVL 4H8VA 1L9NA 3O0LA 1DEEB 5F1IB 2J6EL 3WL0A 2VW7A 5ACMA 3NSDA 1R3TA 4LB8A 1SMAA 1IGTA 4A2EA 4YS4A 2AABH 5FGCE 5AG9A 5GZOD 3GSUB 1KQYA 1TPFA 2AL1A 1N4XL 3LDBC 1ADWA 3PWPD 2ZX5A 2OX5B 3SB0A 3H2EA 5C6MA 4R84A 3NZHL 1UHVA 4MNKA 2P8PA 1CB7B 1A6AA 2AEOA 3P14A 3QMSA 3CH8A 4N9BA 4GZEA 3KBSA 3WS3A 1H4PA 1PKMA 4PJCF 5DQJA 5DLLA 2L5HA 1OG6A 2FB2A 1BZDA 4I77H 1SLUA 3NAVA 5CGMA 5CSYA 1SXZA 2XICA 5LIXX 3S1WA 4HKZB 2FTYA 4QRUA 3L1EA 2PC4A 4XBSA 1C08B 2O5YH 3QYMA 3WI9A 2ZCLL 3ECBA 1DPMA 2QCEA 3MO7A 4O0QA 2JKJA 3DGGA 3E8UH 3KEDA 1BX2B 2YKKA 1L2UA 1OP5K 2XWBB 1QWGA 2QKIB 3VUSA 4D2JA 2AK4A 2XSXA 5L2KB 3FUNA 4LBEB 4UQEA 5IF0B 2Y7OA 4B9YA 3T8LA 2CLFA 4KNQA 3DX5A 3KAAA 4K71C 1SFDA 3AACA 1MUCA 1R3YA 4HZ8A 5KSAD 1R85A 2EDFA 3CIWA 5K1JA 3QUMH 2ITCA 1M2VA 5F1NB 4ACPA 4NWUH 4HOMA 1NEYA 4MGGA 2DTML 3B2VH 2EC9U 3KW7A 1EX1A 5CC6A 2PDIA 2AQPA 1DWAM 4IQJA 4A35A 3MRLB 4NNPL 3WFHA 4RBPK 3LN5A 4N8PA 2JIWA 4MYAA 2NZ9D 2DS4A 1WD8A 3EIFA 2NLJB 3BP7A 1ETZB 1NCAH 3NTCH 3QJFA 3QIWB 2O6EA 3QIUD 5FKPB 3DHPA 1AYOA 4WRHA 3CM4A 4YWIA 5ICYA 2OG9A 2Q10A 3QYCA 3B7SA 4GIAA 4AKQA 5I5RA 3ABXA 3TSMA 3BWAB 5CD5C 1R46A 3QDJE 1GJWA 3VKCA 3GMPB 3C60D 1S5IL 2E9MA 5CAHA 4M93B 4JG1H 3W7QA 4P5SA 1NLBL 5JUVA 5T3ZL 3M1BB 4NXKA 2JIXB 3OEXA 2BIIA 3PE9A 4X7SL 3GIZH 1OY0A 1UA6H 2Z3FA 4IIDA 5LHEA 2JKSA 3SDCB 2DQIH 2L7UA 4M6AA 1FYTE 3OKMB 1AH3A 4L1XA 2GHWB 5D1ZB 1HNFA 3GTNA 4C4KO 1OWRM 4HW6A 5JHMA 4PCPA 3WUFA 3G0XA 3UG4A 3UZZA 2G3ZA 1CXLA 4WI0A 2HVNA 1AE6L 4NKIH 3N1MC 4J4PA 4RRPA 5BW7A 4PMNA 3FT4A 4YHOL 3UWWA 1M05B 3DZ1A 4FFVC 1OLZA 4GSDL 3DOSA 4I89A 1SBSL 1RFDH 3T6XA 4AGMA 3K2IA 4YQXL 4J39A 3VFMB 5C09D 4YIWA 2Y3NA 2R39A 1H19A 3KPTA 3O8XD 1FSKC 1IM3D 4GAFB 4PRIA 4XH2B 1GUVA 3NVTA 4PN2A 4D6DA 2NY7H 1F3JB 1KYDA 2AV7B 2B2XH 1C12A 2BNRD 2FBOJ 3QWQB 4PIBA 4DN4L 1SFJA 3QPYA 2WWKO 2JF1A 3QXWA 4JGMA 4APXA 3PBWA 4JNYA 1S5WA 5ABEA 1JRCA 2EE0A 1BAFL 4CDGC 4IQDA 3ABKB 2PZ0A 4KHTL 5AB0A 4D6HA 2CZEA 1MIML 3CQJA 3D69A 4DTGL 4FQCL 4QYOA 5TE7H 4PUNA 4PRNA 1D5ZB 1FO0L 3IETB 3QH3B 4HV8A 1O5QA 2WB1A 3FN3A 1GHSA 1SN0A 3G6JE 1TREA 1XIHA 2YXGA 2V3EA 3HRZB 1TNMA 2O72A 5HDBE 2R14A 3F7JA 5AZEH 1HINL 1WCQA 4EP8C 4G8GA 5BNXD 4YE4L 1A4CA 1DQWA 1FCGA 3E7JA 2INEA 3L48A 3ZX1A 2QKIA 4BV1A 2WM1A 1YC8A 4OT7A 5H6HA 4FMVA 2NPLX 1JPIA 1GL4B 5LNGA 3QIBA 3UC0L 2FB3A 4HQQH 4FPSA 4XMZA 4WJG3 5IBUG 5CKAA 1G87A 2FRGP 1T66C 3IFOA 4R0LB 3KBHE 3OG2A 4A37A 3RTQB 2DEXX 4PBWD 4ADTA 5EMUA 2IDTA 2W5PA 4XXCC 4XGZB 4GG6E 4NJGA 4HGKC 3I4EA 1I1AD 1C5DA 1F4AA 5KVFE 1ZEAL 4PTWA 2BB0A 4RW5A 1GVRA 2BVPB 3QDJB 1UB6A 2EXYD 2I17A 1MCEA 3KYNB 4YHKH 1TCMA 1IAIM 3LRSB 2XX0A 2EUZA 2O5XH 4PYSA 2ZADA 3I10A 4C6LA 1HZKA 3NJFA 3RUGF 2G4GA 2JCCE 4DETA 1TFVA 1PFCA 1CGUA 1EHAA 2D0GA 3EUUA 3FTWA 1NBQA 4LC6A 5AVZB 3SKNB 2XXMB 2OOFA 1FDLH 3QULB 4JM4L 4LHUG 3WKML 4Q7NA 3RDKA 2WKLA 1RIVH 3IMSA 4JUSA 4PJBA 5IHHA 4GSXA 4ZO6A 1IEHA 2QCCA 1BG1A 5ECUA 1ULVA 3QK0A 3TO4D 3N43B 4DW2L 2JKXA 4MZIA 2G3IA 2HK1A 3FX4A 3FTXA 2ZFAA 3IJEB 3GTFA 1GVYA 3FCUB 3ZUNC 3RTQA 4AVJA 3PG9A 2VXSH 5DS8B 5DURD 3N06B 4OLWL 2DSUA 3HM7A 3AREC 4GRSA 2VDHA 4Z7OE 4LSVL 2PCYA 1CBVH 1XDTT 1RPXA 1FFOB 5IG7B 1B3IA 2R0WL 1FWTA 2NXYB 1H1YA 2AMXA 5CZKA 1YE4A 3AQZA 3F84A 2R4SH 1I1WA 1MHEB 4FHKA 1GGUA 2E28A 2IFFH 3RDJA 1H5VA 4QG6A 2J4WH 3RQ3A 4ODSH 2XZ7A 3GZAA 3B2UD 2VIRA 5C0BE 3Q6FB 4B9GA 4FFYL 1LL4A 2YRBA 1EMTH 1IBFA 2ZSVA 3LVEA 2F6UA 3OBAA 1RHCA 1PX3A 1V6TA 3NFUA 3AIQA 4YK4C 1DEDA 4JZJA 5B22A 3UBGA 5E8DL 2O92A 2XDFA 4CC1A 2Z2AA 2ZAIA 1HU8A 3VXUA 4CADA 2I5GA 1JPST 3APYA 3EFOB 3PPHA 4P8VA 2PETA 3TZNA 3OAUL 1JHLH 3SDAA 2OZ0A 1H63A 2GJ6B 3NG3A 4RUBA 3L5JA 2WV8A 2MOGA 2WZAA 4AZ5A 1NBVH 1SN2A 3NJLA 4JFTA 4WENB 4CILA 2PEVA 4TV5A 1H15B 4QNEA 5CG7A 2VYOA 4JQVA 3WJWA 1AUSL 1YYLH 2WGNB 3N5AA 1SJXA 4NENA 1H3PL 1U95B 3GSVA 3CV2A 2LE9A 4GRWE 3Q8CA 1TPH1 3S7GA 1NARA 2CO3A 4F2ME 1F6PA 1S1RA 2BZDA 4UQ2A 5IOPA 4KGJA 3BWZA 1H09A 4G71B 4UQ2B 4Y7MA 3NJNA 2FH8A 5IOPB 3ROLB 2WJDA 4UXDA 4Z2GA 4UTUA 3SECA 3GB7A 1U1UA 1ZHLB 1UUSA 3QZBA 2DLFH 5EOQL 5L4MA 4ZOBA 3U46B 3MOQA 3M0IA 3W9ZA 4EDXB 3BLIA 1HESA 1L9RA 2J79A 1QSFD 2P88A 3E6FB 3M8OL 3NPWA 3T6VA 4YNYA 2XN9B 4OV5B 5A3ID 1V5XA 3CNYA 1II4E 1WF5A 2M83A 4U6VL 4YEFA 4UOW1 2XI9A 3V1HA 2DQHL 3QDGA 5TDPA 1DCLA 3ID7A 4TOQA 4LBAA 3ZTJH 1A7PL 2DZUA 3EX2A 4DUOA 1T5WA 1HZHH 2GZXA 3PG8A 5CEWA 3C8DA 4PP2A 3QBTB 2G95A 3KP1A 2DEYX 2IXUA 4KK9C 1KFWA 2B1AL 2R2BB 5KYYA 4OM1H 5D7SL 4LIQH 3QFGA 5J1SC 3P93A 2IMRA 3CV1A 3CDGA 4FNLH 3GLAA 3NXLA 4RMVA 1GPOH 5FESA 2ZE0A 4GE8A 2F54E 3OHXA 1RK5A 4BFRA 1GGIH 4UT6L 3W23A 5JOFB 3C09B 3CFNA 2E6AA 4YBHA 3CBWA 1F7BA 2PPFA 4JTTA 2AGJH 4LNVA 4PB0H 2DZWA 2CG9X 3MTWA 4G5ZL 1CPUA 2R1YB 3WJYA 3MGTA 5ISZA 4EX4A 1XIIA 4AU0A 1TTBA 1DVJA 1ZT1B 1IKOP 2JJTA 5IQ7L 2P9RA 2P49B 3W25A 1OAZH 1Y5VA 4FQXB 3N14A 4IPJA 2ISDA 2BWGA 4QYAA 4JZNB 2O9PA 4JTDA 1E5BA 1NEZB 4YLQT 3UROR 4A22A 5E9NA 3WS3B 1TG7A 2HXAA 4CMHC 1R4XA 4V1DE 3ZKMC 3WEOA 5ITFA 2J3SA 2BSTB 3AISA 3ZHNA 1HXJA 4JRYA 5CR8A 5AZ1A 5BOOA 2W9LA 3HE6C 4DAGH 1KYUA 4GOAA 4RWYH 3G9VA 2WMIB 4R3UA 5BU6A 4I0CC 3LH8A 2PW1B 1VADA 5AYXA 3MLTB 5L0QB 1NGWA 3ANYA 3NO5A 3ZDXB 3P9LB 3KNBA 1TLKA 2R0KL 3LKOB 2ZOKA 3QUZC 4G1MB 4J3WA 3RIFK 1D9KD 4H26A 2XFFA 1D8CA 2VLKE 1CFMA 3UY8A 3PRZA 4X6CA 3BUTA 1WKYA 1UP3A 3BP6B 3BP4B 3ZXAC 1UT1A 5HHVL 4PRPE 4LBUA 2WMKA 2FTWA 2NCEA 4IG2A 4JN1H 3MRQA 2YD0A 2EXWC 4G9FD 1HXYA 3SCPA 2CDEB 3KPQA 4NN5B 5A6KA 4NRXA 4ODVL 2LU4A 4PU2A 2RIKA 3L3IA 4OB5H 5KSVA 3D2TA 3FQRB 3QEQA 1GGYA 4M43L 4O5LH 5CP3A 1ECEA 2AL2A 3W2JA 3Q01A 3VG9C 4F9LA 4RNFA 3V35A 3FQUA 1Q9OB 3BZ4B 3OR6B 5EBLA 3BK0A 4I7UA 3P9MB 4LY4A 1KC5L 3KBEA 3Q8AA 4MZRA 4M8QB 5IESH 1LM1A 2LFEA 1S2EA 2QV2A 4O58H 1VPXA 2D2GA 2AQTA 4Z7VF 4R85A 4KDVA 3I7QA 2R91A 3IGAA 3G04B 5H94A 5BJTA 3S4TA 2GJPA 4HK3N 5DYFA 4CU8A 1YSOA 4RX4D 1PWLA 2H9AA 2OR2A 3L7RA 2VHLA 2Y61A 1ZGDA 2RFXB 4U1LA 4CUCA 2APTA 3KVMA 5JW4Q 5MKGA 2NY4D 3T09A 4J3ZA 1PDYA 5A6JA 2DY2A 3CX5K 1QUPA 4CGUB 1NMAH 1CTMA 3L7EA 1PKQA 4Y4HC 4XNDA 2NZLA 3NPUA 3ZLHA 4HOXA 4KPLA 4LTSA 1MCHA 1D7FA 1TJHL 1DBBL 3BFOA 3MXWH 3GMNB 5EF0A 4IMGA 5A6AA 2N7BA 3ITXA 1F1AA 3WDHA 4D9QD 2ZYRA 4U1NA 1NDMB 1Q0XH 3QNZB 3SE6A 1XAKA 2ZXBA 3IDYB 3L5WA 4PPTA 5I1AB 1BQSA 2I07B 3FUEA 4WSKA 3F7VB 1PJWA 4QHUB 1DWHM 2VURA 4MCZB 2VCAA 2DBLH 3RVXD 3EYQD 4IHCA 2MH4A 1G7PA 3CCHB 3NIGB 4PGBB 4WGVB 4UOJA 3IDGB 4HJTA 5E9DE 7FABL 3NEOA 5C0JB 3AIWA 2EDOA 5F3BA 3CUHA 3GDTA 4QCFA 3ZR4A 2R2BA 4ECNA 5KYYB 4POCA 2AP2A 4M7ZB 3VH8G 1IGWA 5DT7A 4YGVA 2CCRA 1MXDA 1ZT4A 4A2SA 3IS0X 5AVVB 3E2RA 4LH8A 3TNOA 1FZJA 2ZX6A 4Y5XB 2PYFB 1ZXQA 2NOYA 3TVMC 4EI5C 1K03A 4AISA 4B3ZA 2X44D 2I27N 4OCSH 4UM9A 1CD0A 1CG9A 3DXAB 3DBXA 3LOWA 3WY3A 4URKA 2DSVA 2XVNA 3ITCA 3MCLH 3TROA 3V7MA 3WLIA 1J4EA 1A8ZA 1HS6A 1YEIH 3G5VA 4MS8C 1LE9B 1ZSDA 3VU1A 4ECLA 3LY0A 4KK6D 1OP5H 3L9EA 3AICA 4JHZA 1W3TA 3NQ7A 4KERA 4NZCA 5LIWX 2CWXA 1Q1PA 2X28A 2RD0A 3P0YH 4LGPB 2XX1A 1R87A 4C6PA 1S9YA 2J74A 3UTSB 3QO0B 4I7WA 4IJBA 1B2YA 4F24A 2VFFA 1A4MA 4H01A 3UCQA 1U5HA 4WDWA 2YC1A 1AE6H 4HAKA 4NKIL 3TJHD 1NWOA 1RKRA 5HHNA 15C8L 2HS8A 2IXQB 1ZT7A 2JKIS 3QAZC 1DJNA 4FABH 4G8TA 1PKQB 1NCNA 1TVBB 4EUPA 3RZCA 1B0RA 1SZFA 5EY5A 5B7EA 5C08E 1U36A 3KJ4C 3SE9H 4WRLA 1INDL 1N8ZA 1XMEB 2RA1A 4JLRA 1KY7A 2YGNA 4O02A 2H5UA 4DF2A 3M7WA 3W71A 1OD7A 1I8KB 1E42A 2XWEA 3IFNL 3QQDB 5DZNA 3ULUF 4AOFA 1A66A 4MCZA 4M8QA 1S7SA 4P46A 3V9FA 1XLLA 2E3ZA 3L68A 3RWHB 4CA4A 4LF1A 2OYPA 3B0UX 1KV8A 4W93A 3BZEB 4UT9L 1V0KA 2XSAA 4IJ3B 2BSRA 2AJXL 4C6IA 1WRFA 3P0GB 5F9AC 4BFFA 3JTBA 5KJRH 3EJJX 2IOMA 1K9DA 4OD1L 4MA7H 2SODB 5JH1A 2EO7A 1EJRC 1Y18A 4P9HL 5T1KA 4QNWA 4RGMB 2QCMA 4QFUA 1XLGA 1L6GA 2GQAA 1MHPH 3FVMA 3FFDA 5CZRA 4XNYH 3PWNB 3GUTA 1Z3NA 2WNWA 1H0DB 4UINH 4P99A 2R24A 3G5YA 5HMEA 3EUDA 2WQSA 3GMLB 1PLBA 3R06A 4MA3A 2HEJA 1CGSL 2ON3A 4X7CC 4HNNA 1RJLA 2CWNA 1MFMA 5MP6H 5ICZA 1MFNA 4O54A 5MEND 4PS4L 1JNNH 1SNRA 1BYCA 2PDCA 3KPSB 3RFZA 4EF3A 3UWQA 4UFMA 1IFHH 3H8NA 1Z9AA 5FCZA 4UTCA 3K8KA 4G6AD 4KQ3H 1ZLWK 3K81A 3WSQH 4MGXA 5CHNA 3MRQB 1TJ0A 2TMDA 2VMCA 4QXUL 5K9QI 4LPVA 4MA1B 3KVPA 5D1QB 4HPOH 5D7IB 4M56A 4FZEL 2GHZA 1DQLH 2ERJC 3FSOA 4HPYL 2E7MA 3ZHDA 3EYOA 4NUGH 3ICJA 3H9YA 5E5UB 1SW0A 5HINA 4HIIA 1WH0A 5EZJA 2OT0A 5AQ0A 3QLDA 4RV8A 1WG3A 3VE9A 1KCUH 3E2HB 3S35L 1TTUA 1UKPA 1UD6A 4IDJL 3CHCA 4MKVA 4IMAA 1A4KB 3WNJA 3WF1A 3ILPB 1SHXA 2BSLA 4Z3HA 5E6IA 2YQ2A 1HE8A 5HI3C 4HAGA 4OGAC 4WK2B 3S0PA 4AEHL 4AMWA 4YO0B 3SO3C 4UTIA 6PAZA 5GIRA 4MD4B 3TNNB 2ADFH 2FX7H 2DQMA 2ITFA 4ROQA 3WLHA 4N68A 4BZ2L 2PCQA 2RCSH 3NCJL 3DEQA 1RVFL 2XYCA 3HMWL 5DT1H 1ONQA 3TO4A 1FVCA 1YYCA 1QKZL 3K4ZA 4C56E 4AZ8B 2AJSH 1HX0A 1IGFL 3N6YA 4BQ3A 5E1AA 3GXMA 4AB4A 4N0CC 1DJSA 4AE1A 3B0XA 2XACC 4KY1L 1G6RH 5FW6A 3CHSA 4L6DA 4S3JA 4CSSA 3THDA 1N26A 4Y16B 3SDAC 5LJYH 3NDZA 1SZNA 1E4MM 1LJMA 4PAZA 4JPIB 4HCIA 1JI2A 1GAFL 4ZD3H 5ADPL 1TE1A 4G1EB 1TR1A 2GLKA 3MO1B 3CL7A 1N9PA 5LA2A 2NDGA 1AZVA 3WMQA 1F8IA 2WB5A 3ZKMD 1H9VA 2CLKA 4ODBD 2F5BH 4P0DA 4RDBA 5D72H 3S4SG 3HI1B 4MLRA 5EMYA 3RRAA 3V18A 4PJ7A 1BF5A 3SW6A 3EO9L 2D9QB 2BVTA 1AQHA 3VAEA 1D5BA 4I4WB 1DP0A 5JIQA 1TE6A 3O3BB 5FHAH 4W6WB 1XRTA 4QIRA 4YBQD 3D30A 3PV6B 2MTAA 1HJBC 1OCNA 4LCUA 2ISVA 5EOQH 2E0PA 2HMID 2MJWA 3UEZA 2DI7A 2CRYA 4L2LA 5DGRA 4YNGA 2DN7A 4HUWB 1ES0A 4ZEPA 3U6XS 4A21A 3D18B 3MI3A 3E2VA 5HNUA 5GGSB 5IFAL 5GGRA 5CPTA 4FOKA 3IAQA 3PZIA 3VXMA 5EEWA 3CSBA 5DVMA 3C5ZB 2BZ7A 5EU6E 3PANA 4LLQA 4PRRA 2CBPA 4GC3A 2H1PH 1ACCA 2BOCA 4OFKA 3N1PC 5D7JA 3T0BA 4KIRA 3U25A 1QSFA 3R6IA 2OR8A 3MOAH 4GRWF 4Q6IA 5FC9A 2H2SD 5EMJA 5C7VA 1C1EH 3DNKA 1Z2KA 1B9BA 2W0FB 1GPOL 5ALCH 3WQCA 4AL8C 1INQA 3K6IA 4LHUD 5F0MB 4GG6A 3QAQA 3KVKA 1OK4A 4B5TA 2VMEA 3EEZA 5DD3H 1O4UA 4XN9A 5K9XA 4OTXL 4WEBH 3S6DA 1DSFH 1MPAL 4PHZA 1XCFA 2HFEB 4DX3A 2SFPA 4UFJA 2V4LA 1GYNA 4DXKA 3HE7D 5T5FA 3OWRA 1BSLA 3GNRA 1NWPA 4GYPC 2EO1A 3EHBD 4NZTL 2XKUA 4EUPG 3HV9A 4HYRA 2GGEA 2KT6A 4K3DH 4JY8A 5TGBA 2RDXA 4ML4A 4FLQA 4QHMB 2VC5A 3LCFA 1G0DA 3QNYB 4P4KD 5C0BD 3AMCA 2EYRB 4ZFFA 4AEEA 3GI8H 1UD2A 4CDHA 3WIFB 4CCCA 1X7QB 1EO8L 1P4LA 2CLVA 3S37H 2WLJA 3V10A 3MYZA 2WHKA 5I1IL 5DSCA 2KHAA 4KI5C 3HZMA 5HGBB 3VI4F 1HQ4B 2D7QA 5KVEE 3HAEB 3V6FA 3AROA 3L13A 4IF2A 1HO4A 4FP8L 3SKNA 4F58H 4U1GB 5LO7A 3BJFA 1CVRA 5LGZA 5HNTA 3MLVL 2OJZL 3B7YA 4L05A 1ITBB 1SJEB 1ZJBA 3WS6C 1RY7B 1Q7ZA 5DCDA 4KBXA 5FF7A 5DURB 3OAZK 3W9EA 3BP4A 4HS8H 1KLGB 4BK4A 2C9AA 1NTDA 1BTCA 5AHLA 3O6AA 4E4PA 4H8WL 2E27H 2G3FA 3SGJC 3F5LA 3HKZA 5AZ2L 4L7ZA 3TN0A 1UWFA 1VFFA 2WYTA 3FS9A 5LNVA 2DT3A 2VRAA 3M45A 5JNYB 5LNDA 1FNHA 4RGNC 4BEUA 5TFSL 4BK8A 3G6DH 2ZUYA 1QQDB 6ENLA 3DA0A 4WK4B 1HIZA 4K3ZA 3KCWA 4Q4OA 4XN7A 2F2HA 2BPBA 2VMJA 5AC7A 4DO4A 1JGIA 3A12A 1HKFA 1AAJA 1YEFL 1ZDQA 3K80A 5CCGE 3F58H 4LW7A 2XA8L 4L80A 4M43H 3OZPA 1SRDA 3OKKB 2OLHA 4M6NL 1I6NA 2E7HA 4CCZA 3BZJA 2EH7H 3DC0A 3V0GA 3GJEA 4N2CA 1LD9A 3OOQA 2GIYA 2HG5B 1I2PA 1VYSX 3JWNH 5D1XE 3IJ8A 2DT2A 1JG9A 2BRRH 4L4TA 1JJUA 3A6OA 3TO4C 4IU2A 1UR0A 2CXGA 1EHKB 2AVGA 3T2QA 1JBJA 5GXBB 1KBPA 1I9CB 4MZ8A 2XHNA 2OSLA 3WIHA 2L0DA 3UBPC 3MRNB 1H7PA 3M0YA 3Q1EA 3QZWA 4DQOH 1V54B 2PTDA 4LGXA 3TCLB 4C5YA 3DUSB 3G6MA 1OGBA 2DQJL 1HEZA 1U2YA 2WN2A 2P3YA 4N86A 4JHWH 3QEHA 5IQOA 3QFJB 5CN1A 1X6LA 3A67L 4NJHA 3EOBB 5C0AB 3GUWA 4HJJH 4O51A 3SOBH 3AO0A 1BFOB 3OKEA 2EDXA 1NGZA 3FOLB 5BOJA 4UC5A 5XIMA 4Y2WA 1JPSH 4Z78A 2VWTA 4JFDA 2WXLA 1WEJL 5HVWA 4OGQC 4UIKH 3VFRA 5FDWB 4F8NA 2Y63A 5JBDA 2JGQA 1YECL 2VDQH 4OLEA 3AS2A 1IV8A 2IPTH 3AM8C 4F0SA 4XP4H 4U6YA 3LXBA 3QJVB 3BIAX 4C59B 4RDVA 1KEMH 2X4RB 1VJZA 3QM3A 3SGEI 4D8AA 4NF7A 3H7UA 4RNRB 3SJVB 1UXSA 2PI6A 3UIYA 5CGTA 3T0XA 4E41D 5T3ZE 1ADSA 5LN8A 4MDRA 4DJMA 1PCWA 4XWUA 2YX0A 4N2BA 1XR9B 3NEHA 3KRUA 4L29A 3BUPA 3OBKA 2YOAA 4ASTA 4WTXA 4I8YA 4HUNB 3MSDA 4MXVF 4DAIA 1TQCC 1ILSA 3RVUD 1XGQA 4K8HA 3OB0H 3S3PA 4WHDA 5HYIA 1TXKA 3UWUA 5J3HD 3IDMB 4P49A 3X12B 4MJ2A 4AT6A 2ALDA 3GVVA 4DP6X 2ZYFA 2OMXA 1AS7A 2YXFA 4P3CH 1OM0A 4GQBA 4U4MA 2F8IA 5M03A 4UQBA 5EV7A 4A05A 4BCEA 1XYLA 4H2CA 1XRVA 3A0OA 4U7SA 4OBSA 4KKNA 4KQ4H 4U5IA 4U31A 1NCDH 2EKSB 4Y1SA 3IU3B 3KOWA 3FNKA 5T3XH 3DX8B 2FO8A 4H20L 3DGGB 4KMTH 5IBTL 4BRJA 2PBOA 2YW3A 3MYJB 3CHVA 3P84A 1SYSB 4XPAH 1I31A 4QXTA 2BS8A 3FN0H 5DEFB 3DJ9A 4HUCA 5I8OH 3IFPA 4FKKA 1HKKA 4YDNA 2IDQA 3F5WA 4BFIB 2UZYA 3BH8B 3QFJE 4BFNA 2FPVA 4ZQCA 1VACA 3HPXA 1G9NL 2E67A 1SJCA 1TQBC 3IS4A 3IN2A 3QUKB 2UY5A 4HOZA 4OZHA 1FHGA 1HC1A 2OLSA 3P4LA 3L5XL 4BEIA 5F7MC 3DO4A 3NQBA 3N50A 4WCYH 4PVNA 1YNTA 5CD3B 3OZYA 1UA6L 4QNPF 2R0LL 3U1QA 2HRPL 4BH7A 1T66D 3GSUA 5F9JA 1FWWA 2RGSA 3GI9H 4PJIF 1XPGA 3FO1A 1YEJL 1ELSA 4RW3A 1Y65A 2R23A 2VQ4A 3ZLFA 2YPLD 4DHGA 4YDKL 1JV5A 3SE8H 5BV7B 1KIUA 4H1LB 4Y4HA 4DP4X 3U2OA 4GC4A 1CLYL 4PJ5B 5JOPD 5TF1L 1LK3H 4PJ5E 5D6CB 3WH6A 3PWPE 3BOXA 2D7TH 2Q5BA 2WHLA 3E3HA 1PZSA 3M44A 4NAFA 5M1TA 3GT6A 5D7IA 2BY1A 4IRJA 3VG0H 5IJKA 2A5UA 3E38A 3QYQA 2IDUA 1EAPA 3ATDA 4K3EH 4KUCF 5TDNB 1XAUA 3P74A 4I5XA 4JN7A 4FXTA 4X80H 5E6IC 4JPWH 2ZQ0A 3T0AA 3U3HA 3D48R 1R3HB 3U9PH 4AKOA 4MJJA 1R9FA 2F8XC 3OG4B 2ICWB 2Z91A 4M6PA 3TU9A 4TV3A 4HTBA 4F7MA 1GEHA 1FH8A 4PV8B 2XWDA 2YD9A 3IFOB 4L4VD 3TESA 4QHNB 1YDVA 2F9RA 3OMIB 4QG9A 4Y4FC 4KRUA 2QGHA 5GGRY 1KRAC 3KYOB 4HGWB 1LO0L 2INFA 2FQDA 2R94A 4WGHA 5HDRA 1CZ8H 4K9EL 3QXVA 4OCRH 4P48A 1M7XA 3X1EA 3QZLA 2YPKA 2QQQA 4P2YA 5DRWA 3LS5L 5FO9A 3UMTA 1S3RA 2WWDA 4NQEE 3LBOA 4M4RB 4Y5YB 1DVFD 3UCCA 2CBQA 3ZIZA 5E6YA 4Q9QL 1ZGLP 1ZVSA 1KFAL 3UXDA 3C0QA 2VDRL 5F7AA 1J0KA 3O3DB 2PPAA 4GY1A 2ZYIA 3IKKA 4X9GA 5HGAA 3DC8A 2AJSL 2YAOA 3NCEB 2HE5A 1S9XA 2W61A 4YHKL 4H8NA 4LLYB 5F8QC 4F7PA 1OD8A 3G3DA 3HA1A 3OHIA 2A4ZA 2A1WH 1R1CA 1RUQH 4IJ3C 4JL2A 4WFGE 3X3GL 1XCQA 5LXGH 1SJHB 4GVFA 4Y8AA 5FO8A 2ESVA 3D09A 1J1OH 2Y8VA 3A4AA 1Q8MA 3O4LA 3GSOA 1FH7A 2YR1A 5FUCC 4KKXA 3EXSA 3G22A 2JCCA 5T1LD 4JM4H 3WKMH 3L5MA 2TSYA 2JEQA 1EGMA 4HEPA 3ORWA 4WJ8A 4PRDB 2EIZB 3RO8A 3AU6A 2BODX 3RZCB 2G60L 3FT3A 3FJTA 3H3PH 5D8JL 2DW7A 5HAOA 4D6FA 1JZJA 3CT2A 4WI0B 4GRWH 5ELIA 1Z42A 1OVDA 4KVPA 5DJDA 5C9UA 1XW8A 3D87B 3Q5YA 3T77A 4K68A 4C6NA 4XI5D 1E6OL 3AHTA 3HBLA 2NTSP 1FNAA 1EA0A 2AERT 1Z3GL 1NL0L 4CNPA 3BRGC 3ZKXB 5ILTH 1TPUA 3C5JB 3V4LA 1NIBA 1Q6FA 4E2DA 1OYAA 2X6BA 3B9KD 43C9A 3MKKA 2Z92A 2WSPA 3EGSB 1AW5A 1IZJA 3BAEL 2NQDA 5LQBH 5KVFH 1QI0A 2V2HA 3CWGA 3MZ2A 1KTBA 4ANWA 3GMPA 2C5DC 1KGXA 2BNRB 2OJPA 3O0KA 5FYLL 4AYEC 4RDYA 1E2ZA 3HTLX 3HGJA 2VX7A 2OMZB 4MZ2A 3VD7A 2ZICA 1DBJL 5HJ3A 3V0JA 3SCWA 4G6ML 1F6YA 1HCFX 5H1WA 5TH2A 3PGDB 5F6IB 4W9KC 2IG2L 2A3AA 3IFLH 3IDXH 2E7FA 3RWEA 2ATKA 2BP0B 2D31B 4LOCA 3BISA 4PJAA 3ARXA 4QXWA 2K4AA 1ODAA 2CBOA 4YVNA 1SDDB 4F3FA 5DRZB 5C7XH 1RHHA 4A39A 1N6QH 3AALA 2E9GA 4GYJA 4HMNA 1SXSA 5JHAA 4FQHA 4D8LA 1UWUA 2GB2A 4P9ML 5D7LD 3FHEA 4L1BA 5GS0L 4X7FC 2PMQA 3MTRA 1G67A 1NANH 1ZK9A 3HG0A 4OU3A 5GS0C 1TZIB 1WV2A 4W9JC 1QLRB 3GPSA 3BV4A 3TUUA 3O4LE 3V4BA 1DN0B 1TJIL 2R4RL 5DUPH 3THMH 3FV9A 1EBPA 5FAJA 1Y5WA 5JIHA 4UB0L 1OGSA 1X9RA 2PU1A 3VKDA 3FFDB 5CG0A 3IVSA 3TT1L 4MNHA 4RMRA 4QRUB 1OIFA 4JS7A 2G9HA 5D9NA 2FVMA 4X2PA 1T5AA 4BH7B 4OHQA 5D38A 1S8DB 4XO3A 2KYIA 2ZXDA 4IIZA 3MUCA 4N2LA 1GK8A 3QPEA 4JQ1A 4CMMA 2ZZUT 1BVNT 1F05A 1I3VA 1Y8BA 5A8MA 3SFWA 4HCRL 4L56A 3PHSA 3BZEA 4IBWA 4W9CC 4YSTA 1HWHB 2DDQL 5JQ6H 3B40A 1AK5A 3EB4A 3S1GA 1OFDA 2CFFA 5E6UB 4JJ5B 4PGEB 4DK6A 2G96A 2WXOA 1SF3A 1LO4H 2OQYA 3AIBA 5E2VH 2V8ZA 3NDOA 3HHRB 4ZTEA 5HNRA 2JKEA 3T1FA 1QSFB 4E8DA 3EO1B 3EWDA 4PVBA 5HI4D 2GY7B 2GJXB 1HXYB 3E3QE 5DDHB 3KOFA 2IPUG 3BVNB 3RNKA 3GIQA 3NFPA 4K7VA 3J07A 4JFSA 3SKUD 2A3TA 3AWNA 3LN9A 3T5WA 1FHNA 2DV6A 3HLKA 3RWEB 2BDNH 5AECA 3GF8A 1OAXL 3LQAC 1DFBL 1QSEB 3HC3H 3SE4C 4N4YB 1PDZA 3NL5A 4B4FA 2FGBA 4XOCA 4DP0X 3TWBA 5D2LB 3T0EC 4DN3L 4NVTA 2MWCA 4DAFA 4BCYA 3QUHA 3RF9A 4MX7B 4G82A 4AYDC 3DTUB 3MODL 3F5JA 2ZUQC 1YG9A 2HRHA 2IMMA 4G3YH 4KITB 4PJFA 2CO7A 3PFRA 1XHGA 1PZ1A 3TBBA 1TFHA 3GU9A 4GH3A 1BM7A 5F6HJ 1OTSC 4WY7L 3PNWA 1SBBA 4EI5A 4JFFB 4JRYB 4IXXA 3PJWA 2EEXA 1G6VK 4A2FA 2LQRA 5FEXA 5E23A 2FZNA 4AF0B 2Y7FA 1DCEA 1T22A 4HWZA 2X2GA 3RLGA 1MAMH 1ORQB 1V5JA 3MV8E 2CDGB 3OM3B 2BSBA 3LIZH 4GKZA 4PB3A 1WBYB 5DJ2B 3ZPDA 3PABA 2F6XA 3WK3A 3S9ZA 1F5ZA 4BJHA 5FGRA 3W6LA 3WF0A 2BJML 1N3NA 3JV0A 4P5MB 1H3UA 1KY6A 5FKAB 5HXMA 2EC8A 1QEXA 2GUOB 2C9XA 1UYQA 2GSEA 3M47A 1J1XH 1J18A 4OGAD 5KJ7E 1RIUH 1BV8A 5D5MB 2YD5A 4R90L 1BMZA 3BYYA 4XBGA 2KPNA 1KB9K 3P77A 3P2VA 4J27A 1NELA 4AX6A 4EKXA 2VDOB 1J88A 5EC1A 3NRFA 2VDRB 4MD0B 2ADGB 1HQRA 4G6JL 5C0FB 2ZVRA 1N12A 1V7YA 2YCEA 4FIQA 1XF4B 4WFEE 4UTKA 3O6KL 3LEXA 2FX8L 3QEHB 3Q44A 1R75A 4XMKL 4Y19E 3TDFA 1A4KA 1TTRA 4LSSH 3WH5A 3CH1B 1MFUA 1DBTA 1R17A 5GGUA 3BLFA 4NLAA 2QQNL 1XCQB 3WCYA 1THFD 3GU2A 3KS5A 3V5HA 3UMNA 5CNHA 1OHQA 2AEIT 1UGKA 1WLHA 5JW3L 3VMPA 1KM2A 1MI5B 2F7IA 1MEIA 2AZAA 1HI6B 3G18A 1K70A 2V67A 5CZTA 1RZ7H 4KK6C 5AVTB 4YLCA 3CK0L 4WW2C 2FVLA 4ACYA 4JBSA 3RX5A 3JV5A 4MQ7A 4U3SB 4FQJH 4WUUD 3KJ6H 2FQEA 5CLZA 3RTQD 3K2GA 5I3IA 5JIWA 4JRWA 1EP2A 2X0HA 3PSVA 4UFHA 4ZQTA 3CFKB 3TQVA 4C6QA 1OC7A 3C5SA 1IT0A 1WBXB 2X2HA 4NX0A 4B60A 1E4WH 1KQZA 3OSVA 3WDJA 4ODUB 4QS5A 2OQJA 3MVSA 2CR0A 1SM3H 5IBUB 5ID0A 1PGRB 2HT3C 1YNYA 2YLLA 2UY7A 1MDLA 4LE8A 1XG4A 4FXJA 2CERA 2NLIA 1E6PA 5C0CA 3MUZ1 4ADSA 2QT3A 5AHIA 3EJYC 5HYSA 3VGAC 2UZIL 1XYMA 5DJXB 1QU4A 4Y4KD 4KNUA 2DAVA 2BK8A 3BXNB 1A8JH 1Y18B 3CHOA 2EXTA 1I1RA 2H3NA 5T1KB 1A6VH 4IW4C 4JPGA 1OGAA 1ZMYA 3L0GA 4EZMA 5K9KA 5TDNA 4KKPA 1BQCA 3WFBL 1O5RA 3A6CL 4H19A 3WBXA 1ZLVK 1US2A 1V6XA 3N34A 3FL7A 2I9UA 1QABA 1D6VL 3P8IA 4F7CA 4NO0B 1WPCA 5KSUB 2CK0L 2AXJA 4C1NA 4NZ1A 4LMQE 3AJ7A 5CINH 4QRSA 5BV7L 1RAMA 5B7FA 2EVHA 1OABA 1G1OA 4B9CA 1L4IA 3NA9H 5IF0A 1TIMA 3I9PA 3VFTB 1UPMB 2NW2B 4DY1A 2B08A 2KERA 2R0LH 2XOTA 3TBYA 2EHHA 3FT0A 1HHJA 3FUHA 1O5XA 3LMJH 4FHJA 4BH8A 3IJIA 4QGTA 4YYFA 3ABMB 3LXAA 4MCYB 1R6WA 1J05A 3QEGH 4UV7H 1S7QA 2DZEA 4HSCX 4HYVA 1R8LA 4NYUA 1RK0A 3D4CA 4NDMA 4YLBA 5IKCB 4HKZA 3W37A 3OQ8A 3MLSL 3L3HA 3DFHA 4GW4A 2VRKA 1JZ6A 3R4IA 5FI8A 3FDGA 4K7YA 3LV5A 4P4KB 4RISH 3STLB 2EIDA 3BWUC 4I9WE 3RY4A 4ZMTA 2QHRH 5I15L 5KTEL 3IAGC 1EX0A 1CWVA 1B3XA 3VD9A 4JB9H 1YDPA 2VAAB 3PTMA 3OB8A 3QGAC 3RHGA 4D7PA 2HFTA 3QZWG 4O8RA 2CE6A 2ZE3A 2ADJB 2NY5H 4AC4A 5G2HA 3SUWA 4NP9A 3MFFB 1MFCL 1YDYA 4AZ6A 3WAKA 3WTWA 4AQ1A 4JDTH 1T5XB 5KYUB 3QS2A 5DCCA 3GRWL 3EJUA 1IKNC 1UKQA 5HHOD 1C5DB 4NM4H 1QI2A 4N4QA 3ASOB 3CZFB 5I6XB 5E24E 1WCBA 3QIUC 4OF6A 2VM9A 1R7AA 5E08L 4PRBB 1DIOA 3GMQA 1OCOB 4I8DA 5LVEA 4ES9A 4DCQB 3IIPA 1IGIL 5CD5D 1ES0B 2DZVA 3D39B 4EWND 3ZQXA 3CMJA 3RGTA 2H26A 3KBPA 4Y4FD 3QCVL 1EGJA 5EO9B 2P45B 4L4LA 4ONGH 1IGCL 1F2JA 2PLTA 5CIPA 5D7KE 3FQNB 4FI6A 3O45B 4HT1H 4Q3MA 4AL8H 2CW6A 4XD6A 2E68A 4XAYA 5KSBB 4TLUA 3GHTA 3RVTC 1H6UA 1SUJA 3CZUB 2J73A 3KGTA 4DIXA 3CFBA 4QYOB 3QWNA 5CZSA 1PY4A 2A1WL 1XC6A 3QT2A 4PRDA 2WAHA 1OOWA 3OC8A 1TETH 4PJEE 3G5XA 1Z0MA 4Q4EA 2WANA 3B6SB 4H1LH 1SFHA 4E5XA 2FGWL 3QJUB 3WXWH 4MZ1A 3B2UC 1UT9A 4YSEA 2WMHA 3QWRA 4CNTA 5JIDA 1YEGH 1GWJA 2FX9L 4S1QL 3N13A 3BUQA 4FYQA 1UB3A 2DZBA 3DDMA 4IP4A 4MYXA 2CLLA 4PLKC 4PRIB 4XHJC 3QRGH 1KACB 2R1MA 1J9YA 5DJ8A 1UADC 1VRSA 4IQHA 2OFQA 4Q4QA 3T8QA 3LPPA 4HK3J 2G2RB 2ESVD 5ERWB 5FCUH 1RJCA 2GTZB 2BP8B 4MDJA 2FNWA 5KW9L 3GJEB 4NC1C 2AFNA 3TP4A 2A85A 2A6JB 3NSFA 5I1KL 4XD4A 2BZCA 3AMDA 4QEHA 5AWNL 1QSEE 1RZMA 4ZG1A 2XZAH 1K4GA 1I7RA 2DQDL 1IE5A 3CVIL 4JHAL 4JX4A 2IOIA 3BAEH 5DJCA 3LRKA 5LQBL 4XD5A 3FRPG 3RLSA 1X7FA 2ZUMA 1V7MH 1IE4A 3GMMB 4KRLB 3MO4A 4CNUA 4J8QA 1IMHC 1Q6LA 5AB1A 2JH2A 4PJ8B 1PW3A 1UJ3C 1UURA 4JPKH 4IKJA 5C8BB 3GG7A 3LKOA 3ZKND 2VITB 2CH8A 1OSYA 2F58H 4HHLA 1T20B 1TWDA 4CC4C 1KXQA 3PC0A 4K2SA 2XFGB 4JIQA 1WICA 3MFFA 1CECA 1ORSB 2YD6A 1QX1A 4YHIB 4ONFH 3S8FB 2J6XA 4QT5B 3L65A 5EORL 5IIEB 3EB3A 1NDZA 2EG8A 1M2VB 4JO1H 2K4WA 3TWCH 4ENEC 5CLYA 1CLXA 5J1AB 1COBA 1BJMA 3KPRA 3T04D 2V82A 1M7DB 1L9OA 1K4CB 4CVZA 3BRDA 4AQEB 3UZWA 3RWJA 5MEQB 5HI5C 4ZS7L 1AZNA 3H0TA 3NR0A 4YLWA 4K1GA 3JWNC 1BECA 1PYWA 5FKYA 4OZFG 2QCLA 4CNNA 3F7PC 2X6VA 1B6UA 5JXQA 3ZDZB 5D7LA 4XAKD 1FRGH 2VDLH 2WQWA 3DDFA 2X2YA 3AB0C 3ECVA 4X5XA 5IVOA 4YS1A 3MR9A 1W3JA 5GGTA 3RIAK 4Y1AA 3QDAA 5CJOH 2J27A 2HT2C 2ALAA 3CO8A 1HHJB 5H8DA 5IBLD 4P2OA 1GKQA 4V27A 4AQZA 3M41A 4KFOA 1JV2B 5EO1A 1C