3QH8A

Crystal structure of a beta-lactamase-like protein bound to amp from brucella melitensis, long wavelength synchrotron data
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
272
structure length
272
Chain Sequence
MTSPRNCLRFTLLGCGSSPGVPRINGDWGKCDPKNPKNRRRRASLLVERYDAEGNNTVVVIDTGPDFRMQMIDSGVHMLDAAVYTHPHADHIHGIDDLRTYVVDNGRLMDVYANRLTRNRLYDTFGYCFETPVGSSYPPILSMHDIAPETPFSIEGAGGAIRFEPFSQVHGDIESLGFRIGSVVYCTDVSAFPEQSLQYIKDADVLIIGALQYRPHPSHFSLGEALEWIEKLSPKRAILTHMHVPLDYETVMRETPHHVEPGYDGLRFEVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Beta-Lactamase-Like Protein bound to AMP from Brucella Melitensis, long wavelength synchrotron data
pubmed doi rcsb
source organism Brucella melitensis biovar abortus
molecule tags Hydrolase
molecule keywords Beta-lactamase-like
total genus 81
structure length 272
sequence length 272
ec nomenclature
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3qh8A00
5AHRA 2P97A 4EYBA 5ACTA 1ZKPA 1VJNA 5HIPA 3A4YA 2OHIA 4TZ9A 4TZFA 2ZWRA 3X30A 3AF5A 2BC2A 3T3NA 5EH9A 2Q0JA 4PVOA 5FQAA 2OHJA 3I11A 2XF4A 4EFZA 4H0DA 3IEKA 4UWOB 5LCHA 4PVTA 4KEQA 3I15A 3DHBA 4D1UA 3VQZA 4KEPA 5ACPA 4WD6A 5HH5A 1K07A 2WHGA 4ZO2A 5EW0A 1ZNBA 5AHOA 5HISA 4HL2A 1E5DA 4J5FA 2QDTA 2FHXA 5LCFA 5B1UA 4HKYA 2YNUA 4F6HA 4C1FA 4Z5YA 3SPUA 4TYTA 1WRAA 4F6ZA 2GCUA 5KILA 4AD9A 1YCGA 2VW8A 1YCFA 4C1GA 3IE2A 3I13A 4UA4A 2BG6A 2P1EA 3LVZA 4HL1A 2I7VA 1L9YA 4TZEA 5A0TA 4J5HA 2NZEA 4TYFA 3TP9A 4EYFA 2AZ4A 4GCWA 4Z7RA 4EY2A 1X8GA 5K4KA 5LSCA 4ZEJA 4B87A 2QINA 3IEMA 2FU7A 4EXSA 1JJTA 5KIKA 2BG8B 2BG7A 1HLKA 5AXRA 2BFKA 4NQ4A 3I0VA 2WRSA 2BFZB 3IOFA 2FU6A 3KL7A 4D1VA 4Z67A 2WYMC 2WYMA 3SFPA 5A87A 5K0WA 2XR1A 2YNTA 3Q6VA 4RM5A 2YCBA 4C1DA 2BG8A 3IOGA 3G1PA 5A5ZA 3IELA 1QH3A 5K4MA 2CBNA 3VPEA 2I7TA 3IE1A 4Z60A 4XWWA 2YZ3A 2YNWA 3PY6A 4Z5ZA 2FHXB 2P4ZA 3SRXA 4BZ3A 5ACQA 3FAIA 4AX1B 5AXOA 2A7MA 4NQ6A 3P2UA 4UAMA 5LLDA 2BIBA 3S0ZA 2YNVA 1M2XA 1ZTCA 3L6NA 4GYQA 4C1CA 4XWTA 5ACVA 3SW3A 2NZFA 1YCHA 4DILA 3KNRA 1DD6A 3X2YA 5ACSA 2ZNBA 4C09A 1DXKA 1BVTA 1SMLA 4YSBA 5K4NA 4NQ5A 1XTOA 5LM6A 5EHTA 2BG2A 2OHHA 5B3RA 2Q42A 2YNTB 4EXYA 1WUOA 5EWAA 4D1TA 2NYPA 3DH8A 4RL2A 1BC2A 4UBQA 1JJEA 4C1EA 2BFZA 5FQBA 3BK2A 2GFJA 3T9MA 3BK1A 3JXPA 2QJSA 1BMCA 5EVBA 3ADRA 4AWYB 2DKFA 1Y44A 4ZO3A 3DHCA 2BMIA 3ZR9A 4YSLA 4TZBA 4CHLA 4XUKA 2M5DA 3I14A 2H6AA 4D1WA 1P9EA 1X8IA 4GYUA 1A8TA 3H3EA 5LCAA 1JT1A 3FCZA 2FK6A 2BTNA 4DIKA 5LE1A 3RKKA 3T3OA 3RKJA 2E7YA 1KR3A 1VMEA 5HIQA 3ZQ4A 4V0HA 2Q0IA 5EV6A 1WW1A 4JO0A 1DDKA 4FSBA 3SD9A 3X2XA 2M5CA 5FQCA 4P62A 1XM8A 5EVDA 1X8HA 5HH6A 2Y8AA 4Z6XA 1WUPA 5EV8A 3X2ZA 2NXAA 2P18A 2FM6A 4AWZA 4FEKA 3KNSA 1QH5A 2FU9A 4AX0B 1KO2A 3MD7A 3R2UA 1KO3A 4BP0A 5AYAA 2DOOA 2YNVB 1MQOA 3ZNBA 3BC2A 2Q9UA 3WXCA 5ACXA 2AIOA 2GMNA 5AEBA 5HIOA 5A0VA 5B15A 2Y87A 3ESHA 4ZNBA 3DHAA 3ZWFA 2QDSA 3AF6A 1A7TA 2ZO4A 3BV6A 2BR6A 2HB9A 4NQ2A 4U4LA 4UWSB 4UWPB 5LS3A 1VGNA 4EYLA 3IDZA 4UWRB 4RBSA 4RAMA 5HH4A 3F9OA 2BFLA 2FU8A 4LE6A 5ACRA 5ACUA 4RAWA 2UYXA 3RPCA 5LMCA 2BGAA 4RL0A 5DPXA 3PG4A 3IE0A 4D02A 3QH8A 2GKLA 3SBLA 4YSKA 5EVKA 4C1HA 2GFKA 2WYLA 2QEDA 2Y8BA 2R2DA 2ZZIA 3AJ3A 5ACWA 3PY5A 4FR7A 4O98A 5IQKA 2I7XA
chains in the Genus database with same CATH superfamily
5AHRA 2P97A 4EYBA 5ACTA 1ZKPA 4AV7A 1VJNA 5HIPA 3A4YA 2OHIA 4TZ9A 4TZFA 2ZWRA 3X30A 5AJLA 3AF5A 2BC2A 3T3NA 5EH9A 2Q0JA 4PVOA 5FQAA 2OHJA 3I11A 2XF4A 4EFZA 4H0DA 3IEKA 4UWOB 5LCHA 4PVTA 4KEQA 3I15A 3DHBA 4D1UA 3VQZA 4KEPA 5ACPA 4WD6A 5HH5A 1K07A 2WHGA 4ZO2A 5EW0A 1ZNBA 5AHOA 5HISA 4HL2A 1E5DA 4J5FA 2QDTA 2FHXA 5LCFA 5B1UA 4HKYA 2YNUA 4F6HA 4C1FA 4Z5YA 3SPUA 4TYTA 1WRAA 4F6ZA 2GCUA 5KILA 4AD9A 1YCGA 2VW8A 1YCFA 4C1GA 3IE2A 3I13A 4UA4A 2BG6A 2P1EA 3LVZA 4HL1A 2I7VA 1L9YA 4TZEA 5A0TA 4J5HA 2NZEA 4TYFA 3TP9A 4EYFA 2AZ4A 2CG3A 4GCWA 4Z7RA 4EY2A 1X8GA 5K4KA 5LSCA 4ZEJA 4B87A 2QINA 3IEMA 2FU7A 4EXSA 1JJTA 5KIKA 2BG8B 2BG7A 1HLKA 5AXRA 2BFKA 4NQ4A 3I0VA 2WRSA 2BFZB 3IOFA 2FU6A 3KL7A 4D1VA 4Z67A 2WYMC 2WYMA 3SFPA 5A87A 5K0WA 2XR1A 2YNTA 3Q6VA 4RM5A 2YCBA 4C1DA 2BG8A 3IOGA 3G1PA 5A5ZA 3IELA 1QH3A 5K4MA 2CBNA 3VPEA 2I7TA 3IE1A 4Z60A 4XWWA 2YZ3A 2YNWA 3PY6A 4Z5ZA 5AIJA 2FHXB 2P4ZA 3SRXA 4BZ3A 5ACQA 3FAIA 4AX1B 5AXOA 2A7MA 4NQ6A 5A23A 3P2UA 4UAMA 5LLDA 4AXHA 2BIBA 3S0ZA 2YNVA 1M2XA 1ZTCA 3L6NA 4GYQA 4C1CA 4XWTA 5ACVA 3SW3A 2NZFA 1YCHA 4DILA 3KNRA 1DD6A 3X2YA 5ACSA 2ZNBA 4C09A 1DXKA 1BVTA 1SMLA 4YSBA 5K4NA 4NQ5A 1XTOA 5LM6A 5EHTA 2BG2A 2OHHA 5B3RA 2Q42A 2YNTB 4EXYA 1WUOA 5EWAA 4D1TA 2NYPA 3DH8A 4RL2A 1BC2A 4UBQA 1JJEA 4C1EA 2BFZA 5FQBA 3BK2A 2GFJA 3T9MA 3BK1A 3JXPA 2QJSA 1BMCA 5EVBA 3ADRA 4AWYB 2DKFA 1Y44A 4ZO3A 3DHCA 2BMIA 3ZR9A 4YSLA 4TZBA 4CHLA 4XUKA 2M5DA 3I14A 2H6AA 4D1WA 1P9EA 1X8IA 4GYUA 1A8TA 3H3EA 5LCAA 1JT1A 2CFUA 3FCZA 2FK6A 2BTNA 4DIKA 5LE1A 3RKKA 3T3OA 3RKJA 2E7YA 1KR3A 1VMEA 2CG2A 5HIQA 3ZQ4A 4V0HA 2Q0IA 5EV6A 1WW1A 4JO0A 1DDKA 4FSBA 3SD9A 3X2XA 2M5CA 5FQCA 4P62A 1XM8A 5EVDA 1X8HA 5HH6A 2Y8AA 4Z6XA 1WUPA 5EV8A 3X2ZA 2NXAA 2P18A 2FM6A 4AWZA 4FEKA 3KNSA 1QH5A 2FU9A 4AX0B 1KO2A 3MD7A 3R2UA 1KO3A 4BP0A 5AYAA 2DOOA 2YNVB 1MQOA 3ZNBA 3BC2A 2Q9UA 3WXCA 5ACXA 2AIOA 2GMNA 5AEBA 5HIOA 5A0VA 5B15A 2Y87A 3ESHA 4ZNBA 3DHAA 2YHEA 3ZWFA 2QDSA 3AF6A 1A7TA 2ZO4A 3BV6A 2BR6A 2HB9A 4NQ2A 4U4LA 4UWSB 4UWPB 5LS3A 1VGNA 4EYLA 4PDXA 3IDZA 4NURA 4RBSA 4UWRB 4RAMA 5HH4A 3F9OA 2BFLA 2FU8A 4LE6A 2CFZA 5ACRA 5ACUA 4RAWA 2UYXA 3RPCA 5LMCA 2BGAA 4RL0A 5DPXA 3PG4A 3IE0A 4D02A 3QH8A 2GKLA 3SBLA 4YSKA 5EVKA 4C1HA 2GFKA 2WYLA 2QEDA 2Y8BA 2R2DA 2ZZIA 3AJ3A 5ACWA 3PY5A 4FR7A 4O98A 5IQKA 2I7XA
chains in the Genus database with same CATH topology
5AHRA 2P97A 4EYBA 5ACTA 1ZKPA 1VJNA 5HIPA 3A4YA 2OHIA 4TZ9A 4TZFA 2ZWRA 3X30A 3AF5A 2BC2A 3T3NA 5EH9A 2Q0JA 4PVOA 5FQAA 2OHJA 3I11A 2XF4A 4EFZA 4H0DA 3IEKA 4UWOB 5LCHA 4PVTA 4KEQA 3I15A 3DHBA 4D1UA 3VQZA 4KEPA 5ACPA 4WD6A 5HH5A 1K07A 2WHGA 4ZO2A 5EW0A 1ZNBA 5AHOA 5HISA 4HL2A 1E5DA 4J5FA 2QDTA 2FHXA 5LCFA 5B1UA 4HKYA 2YNUA 4F6HA 4C1FA 4Z5YA 3SPUA 4TYTA 1WRAA 4F6ZA 2GCUA 5KILA 4AD9A 1YCGA 2VW8A 1YCFA 4C1GA 3IE2A 3I13A 4UA4A 2BG6A 2P1EA 3LVZA 4HL1A 2I7VA 1L9YA 4TZEA 5A0TA 4J5HA 2NZEA 4TYFA 3TP9A 4EYFA 2AZ4A 4GCWA 4Z7RA 4EY2A 1X8GA 5K4KA 5LSCA 4ZEJA 4B87A 2QINA 3IEMA 2FU7A 4EXSA 1JJTA 5KIKA 2BG8B 2BG7A 1HLKA 5AXRA 2BFKA 4NQ4A 3I0VA 2WRSA 2BFZB 3IOFA 2FU6A 3KL7A 4D1VA 4Z67A 2WYMC 2WYMA 3SFPA 5A87A 5K0WA 2XR1A 2YNTA 3Q6VA 4RM5A 2YCBA 4C1DA 2BG8A 3IOGA 3G1PA 5A5ZA 3IELA 1QH3A 5K4MA 2CBNA 3VPEA 2I7TA 3IE1A 4Z60A 4XWWA 2YZ3A 2YNWA 3PY6A 4Z5ZA 2FHXB 2P4ZA 3SRXA 4BZ3A 5ACQA 3FAIA 4AX1B 5AXOA 2A7MA 4NQ6A 3P2UA 4UAMA 5LLDA 2BIBA 3S0ZA 2YNVA 1M2XA 1ZTCA 3L6NA 4GYQA 4C1CA 4XWTA 5ACVA 3SW3A 2NZFA 1YCHA 4DILA 3KNRA 1DD6A 3X2YA 5ACSA 2ZNBA 4C09A 1DXKA 1BVTA 1SMLA 4YSBA 5K4NA 4NQ5A 1XTOA 5LM6A 5EHTA 2BG2A 2OHHA 5B3RA 2Q42A 2YNTB 4EXYA 1WUOA 5EWAA 4D1TA 2NYPA 3DH8A 4RL2A 1BC2A 4UBQA 1JJEA 4C1EA 2BFZA 5FQBA 3BK2A 2GFJA 3T9MA 3BK1A 3JXPA 2QJSA 1BMCA 5EVBA 3ADRA 4AWYB 2DKFA 1Y44A 4ZO3A 3DHCA 2BMIA 3ZR9A 4YSLA 4TZBA 4CHLA 4XUKA 2M5DA 3I14A 2H6AA 4D1WA 1P9EA 1X8IA 4GYUA 1A8TA 3H3EA 5LCAA 1JT1A 3FCZA 2FK6A 2BTNA 4DIKA 5LE1A 3RKKA 3T3OA 3RKJA 2E7YA 1KR3A 1VMEA 5HIQA 3ZQ4A 4V0HA 2Q0IA 5EV6A 1WW1A 4JO0A 1DDKA 4FSBA 3SD9A 3X2XA 2M5CA 5FQCA 4P62A 1XM8A 5EVDA 1X8HA 5HH6A 2Y8AA 4Z6XA 1WUPA 5EV8A 3X2ZA 2NXAA 2P18A 2FM6A 4AWZA 4FEKA 3KNSA 1QH5A 2FU9A 4AX0B 1KO2A 3MD7A 3R2UA 1KO3A 4BP0A 5AYAA 2DOOA 2YNVB 1MQOA 3ZNBA 3BC2A 2Q9UA 3WXCA 5ACXA 2AIOA 2GMNA 5AEBA 5HIOA 5A0VA 5B15A 2Y87A 3ESHA 4ZNBA 3DHAA 3ZWFA 2QDSA 3AF6A 1A7TA 2ZO4A 3BV6A 2BR6A 2HB9A 4NQ2A 4U4LA 4UWSB 4UWPB 5LS3A 1VGNA 4EYLA 3IDZA 4UWRB 4RBSA 4RAMA 5HH4A 3F9OA 2BFLA 2FU8A 4LE6A 5ACRA 5ACUA 4RAWA 2UYXA 3RPCA 5LMCA 2BGAA 4RL0A 5DPXA 3PG4A 3IE0A 4D02A 3QH8A 2GKLA 3SBLA 4YSKA 5EVKA 4C1HA 2GFKA 2WYLA 2QEDA 2Y8BA 2R2DA 2ZZIA 3AJ3A 5ACWA 3PY5A 4FR7A 4O98A 5IQKA 2I7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AHR A;  2P97 A;  4EYB A;  5ACT A;  1ZKP A;  1VJN A;  5HIP A;  3A4Y A;  2OHI A;  4TZ9 A;  4TZF A;  2ZWR A;  3X30 A;  3AF5 A;  2BC2 A;  3T3N A;  5EH9 A;  2Q0J A;  4PVO A;  5FQA A;  2OHJ A;  3I11 A;  2XF4 A;  4EFZ A;  4H0D A;  3IEK A;  4UWO B;  5LCH A;  4PVT A;  4KEQ A;  3I15 A;  3DHB A;  4D1U A;  3VQZ A;  4KEP A;  5ACP A;  4WD6 A;  5HH5 A;  1K07 A;  2WHG A;  4ZO2 A;  5EW0 A;  1ZNB A;  5AHO A;  5HIS A;  4HL2 A;  1E5D A;  4J5F A;  2QDT A;  2FHX A;  5LCF A;  5B1U A;  4HKY A;  2YNU A;  4F6H A;  4C1F A;  4Z5Y A;  3SPU A;  4TYT A;  1WRA A;  4F6Z A;  2GCU A;  5KIL A;  4AD9 A;  1YCG A;  2VW8 A;  1YCF A;  4C1G A;  3IE2 A;  3I13 A;  4UA4 A;  2BG6 A;  2P1E A;  3LVZ A;  4HL1 A;  2I7V A;  1L9Y A;  4TZE A;  5A0T A;  4J5H A;  2NZE A;  4TYF A;  3TP9 A;  4EYF A;  2AZ4 A;  4GCW A;  4Z7R A;  4EY2 A;  1X8G A;  5K4K A;  5LSC A;  4ZEJ A;  4B87 A;  2QIN A;  3IEM A;  2FU7 A;  4EXS A;  1JJT A;  5KIK A;  2BG8 B;  2BG7 A;  1HLK A;  5AXR A;  2BFK A;  4NQ4 A;  3I0V A;  2WRS A;  2BFZ B;  3IOF A;  2FU6 A;  3KL7 A;  4D1V A;  4Z67 A;  2WYM C;  2WYM A;  3SFP A;  5A87 A;  5K0W A;  2XR1 A;  2YNT A;  3Q6V A;  4RM5 A;  2YCB A;  4C1D A;  2BG8 A;  3IOG A;  3G1P A;  5A5Z A;  3IEL A;  1QH3 A;  5K4M A;  2CBN A;  3VPE A;  2I7T A;  3IE1 A;  4Z60 A;  4XWW A;  2YZ3 A;  2YNW A;  3PY6 A;  4Z5Z A;  2FHX B;  2P4Z A;  3SRX A;  4BZ3 A;  5ACQ A;  3FAI A;  4AX1 B;  5AXO A;  2A7M A;  4NQ6 A;  3P2U A;  4UAM A;  5LLD A;  2BIB A;  3S0Z A;  2YNV A;  1M2X A;  1ZTC A;  3L6N A;  4GYQ A;  4C1C A;  4XWT A;  5ACV A;  3SW3 A;  2NZF A;  1YCH A;  4DIL A;  3KNR A;  1DD6 A;  3X2Y A;  5ACS A;  2ZNB A;  4C09 A;  1DXK A;  1BVT A;  1SML A;  4YSB A;  5K4N A;  4NQ5 A;  1XTO A;  5LM6 A;  5EHT A;  2BG2 A;  2OHH A;  5B3R A;  2Q42 A;  2YNT B;  4EXY A;  1WUO A;  5EWA A;  4D1T A;  2NYP A;  3DH8 A;  4RL2 A;  1BC2 A;  4UBQ A;  1JJE A;  4C1E A;  2BFZ A;  5FQB A;  3BK2 A;  2GFJ A;  3T9M A;  3BK1 A;  3JXP A;  2QJS A;  1BMC A;  5EVB A;  3ADR A;  4AWY B;  2DKF A;  1Y44 A;  4ZO3 A;  3DHC A;  2BMI A;  3ZR9 A;  4YSL A;  4TZB A;  4CHL A;  4XUK A;  2M5D A;  3I14 A;  2H6A A;  4D1W A;  1P9E A;  1X8I A;  4GYU A;  1A8T A;  3H3E A;  5LCA A;  1JT1 A;  3FCZ A;  2FK6 A;  2BTN A;  4DIK A;  5LE1 A;  3RKK A;  3T3O A;  3RKJ A;  2E7Y A;  1KR3 A;  1VME A;  5HIQ A;  3ZQ4 A;  4V0H A;  2Q0I A;  5EV6 A;  1WW1 A;  4JO0 A;  1DDK A;  4FSB A;  3SD9 A;  3X2X A;  2M5C A;  5FQC A;  4P62 A;  1XM8 A;  5EVD A;  1X8H A;  5HH6 A;  2Y8A A;  4Z6X A;  1WUP A;  5EV8 A;  3X2Z A;  2NXA A;  2P18 A;  2FM6 A;  4AWZ A;  4FEK A;  3KNS A;  1QH5 A;  2FU9 A;  4AX0 B;  1KO2 A;  3MD7 A;  3R2U A;  1KO3 A;  4BP0 A;  5AYA A;  2DOO A;  2YNV B;  1MQO A;  3ZNB A;  3BC2 A;  2Q9U A;  3WXC A;  5ACX A;  2AIO A;  2GMN A;  5AEB A;  5HIO A;  5A0V A;  5B15 A;  2Y87 A;  3ESH A;  4ZNB A;  3DHA A;  3ZWF A;  2QDS A;  3AF6 A;  1A7T A;  2ZO4 A;  3BV6 A;  2BR6 A;  2HB9 A;  4NQ2 A;  4U4L A;  4UWS B;  4UWP B;  5LS3 A;  1VGN A;  4EYL A;  3IDZ A;  4UWR B;  4RBS A;  4RAM A;  5HH4 A;  3F9O A;  2BFL A;  2FU8 A;  4LE6 A;  5ACR A;  5ACU A;  4RAW A;  2UYX A;  3RPC A;  5LMC A;  2BGA A;  4RL0 A;  5DPX A;  3PG4 A;  3IE0 A;  4D02 A;  3QH8 A;  2GKL A;  3SBL A;  4YSK A;  5EVK A;  4C1H A;  2GFK A;  2WYL A;  2QED A;  2Y8B A;  2R2D A;  2ZZI A;  3AJ3 A;  5ACW A;  3PY5 A;  4FR7 A;  4O98 A;  5IQK A;  2I7X A; 
#chains in the Genus database with same CATH topology
 5AHR A;  2P97 A;  4EYB A;  5ACT A;  1ZKP A;  4AV7 A;  1VJN A;  5HIP A;  3A4Y A;  2OHI A;  4TZ9 A;  4TZF A;  2ZWR A;  3X30 A;  5AJL A;  3AF5 A;  2BC2 A;  3T3N A;  5EH9 A;  2Q0J A;  4PVO A;  5FQA A;  2OHJ A;  3I11 A;  2XF4 A;  4EFZ A;  4H0D A;  3IEK A;  4UWO B;  5LCH A;  4PVT A;  4KEQ A;  3I15 A;  3DHB A;  4D1U A;  3VQZ A;  4KEP A;  5ACP A;  4WD6 A;  5HH5 A;  1K07 A;  2WHG A;  4ZO2 A;  5EW0 A;  1ZNB A;  5AHO A;  5HIS A;  4HL2 A;  1E5D A;  4J5F A;  2QDT A;  2FHX A;  5LCF A;  5B1U A;  4HKY A;  2YNU A;  4F6H A;  4C1F A;  4Z5Y A;  3SPU A;  4TYT A;  1WRA A;  4F6Z A;  2GCU A;  5KIL A;  4AD9 A;  1YCG A;  2VW8 A;  1YCF A;  4C1G A;  3IE2 A;  3I13 A;  4UA4 A;  2BG6 A;  2P1E A;  3LVZ A;  4HL1 A;  2I7V A;  1L9Y A;  4TZE A;  5A0T A;  4J5H A;  2NZE A;  4TYF A;  3TP9 A;  4EYF A;  2AZ4 A;  2CG3 A;  4GCW A;  4Z7R A;  4EY2 A;  1X8G A;  5K4K A;  5LSC A;  4ZEJ A;  4B87 A;  2QIN A;  3IEM A;  2FU7 A;  4EXS A;  1JJT A;  5KIK A;  2BG8 B;  2BG7 A;  1HLK A;  5AXR A;  2BFK A;  4NQ4 A;  3I0V A;  2WRS A;  2BFZ B;  3IOF A;  2FU6 A;  3KL7 A;  4D1V A;  4Z67 A;  2WYM C;  2WYM A;  3SFP A;  5A87 A;  5K0W A;  2XR1 A;  2YNT A;  3Q6V A;  4RM5 A;  2YCB A;  4C1D A;  2BG8 A;  3IOG A;  3G1P A;  5A5Z A;  3IEL A;  1QH3 A;  5K4M A;  2CBN A;  3VPE A;  2I7T A;  3IE1 A;  4Z60 A;  4XWW A;  2YZ3 A;  2YNW A;  3PY6 A;  4Z5Z A;  5AIJ A;  2FHX B;  2P4Z A;  3SRX A;  4BZ3 A;  5ACQ A;  3FAI A;  4AX1 B;  5AXO A;  2A7M A;  4NQ6 A;  5A23 A;  3P2U A;  4UAM A;  5LLD A;  4AXH A;  2BIB A;  3S0Z A;  2YNV A;  1M2X A;  1ZTC A;  3L6N A;  4GYQ A;  4C1C A;  4XWT A;  5ACV A;  3SW3 A;  2NZF A;  1YCH A;  4DIL A;  3KNR A;  1DD6 A;  3X2Y A;  5ACS A;  2ZNB A;  4C09 A;  1DXK A;  1BVT A;  1SML A;  4YSB A;  5K4N A;  4NQ5 A;  1XTO A;  5LM6 A;  5EHT A;  2BG2 A;  2OHH A;  5B3R A;  2Q42 A;  2YNT B;  4EXY A;  1WUO A;  5EWA A;  4D1T A;  2NYP A;  3DH8 A;  4RL2 A;  1BC2 A;  4UBQ A;  1JJE A;  4C1E A;  2BFZ A;  5FQB A;  3BK2 A;  2GFJ A;  3T9M A;  3BK1 A;  3JXP A;  2QJS A;  1BMC A;  5EVB A;  3ADR A;  4AWY B;  2DKF A;  1Y44 A;  4ZO3 A;  3DHC A;  2BMI A;  3ZR9 A;  4YSL A;  4TZB A;  4CHL A;  4XUK A;  2M5D A;  3I14 A;  2H6A A;  4D1W A;  1P9E A;  1X8I A;  4GYU A;  1A8T A;  3H3E A;  5LCA A;  1JT1 A;  2CFU A;  3FCZ A;  2FK6 A;  2BTN A;  4DIK A;  5LE1 A;  3RKK A;  3T3O A;  3RKJ A;  2E7Y A;  1KR3 A;  1VME A;  2CG2 A;  5HIQ A;  3ZQ4 A;  4V0H A;  2Q0I A;  5EV6 A;  1WW1 A;  4JO0 A;  1DDK A;  4FSB A;  3SD9 A;  3X2X A;  2M5C A;  5FQC A;  4P62 A;  1XM8 A;  5EVD A;  1X8H A;  5HH6 A;  2Y8A A;  4Z6X A;  1WUP A;  5EV8 A;  3X2Z A;  2NXA A;  2P18 A;  2FM6 A;  4AWZ A;  4FEK A;  3KNS A;  1QH5 A;  2FU9 A;  4AX0 B;  1KO2 A;  3MD7 A;  3R2U A;  1KO3 A;  4BP0 A;  5AYA A;  2DOO A;  2YNV B;  1MQO A;  3ZNB A;  3BC2 A;  2Q9U A;  3WXC A;  5ACX A;  2AIO A;  2GMN A;  5AEB A;  5HIO A;  5A0V A;  5B15 A;  2Y87 A;  3ESH A;  4ZNB A;  3DHA A;  2YHE A;  3ZWF A;  2QDS A;  3AF6 A;  1A7T A;  2ZO4 A;  3BV6 A;  2BR6 A;  2HB9 A;  4NQ2 A;  4U4L A;  4UWS B;  4UWP B;  5LS3 A;  1VGN A;  4EYL A;  4PDX A;  3IDZ A;  4NUR A;  4RBS A;  4UWR B;  4RAM A;  5HH4 A;  3F9O A;  2BFL A;  2FU8 A;  4LE6 A;  2CFZ A;  5ACR A;  5ACU A;  4RAW A;  2UYX A;  3RPC A;  5LMC A;  2BGA A;  4RL0 A;  5DPX A;  3PG4 A;  3IE0 A;  4D02 A;  3QH8 A;  2GKL A;  3SBL A;  4YSK A;  5EVK A;  4C1H A;  2GFK A;  2WYL A;  2QED A;  2Y8B A;  2R2D A;  2ZZI A;  3AJ3 A;  5ACW A;  3PY5 A;  4FR7 A;  4O98 A;  5IQK A;  2I7X A; 
#chains in the Genus database with same CATH homology
 5AHR A;  2P97 A;  4EYB A;  5ACT A;  1ZKP A;  1VJN A;  5HIP A;  3A4Y A;  2OHI A;  4TZ9 A;  4TZF A;  2ZWR A;  3X30 A;  3AF5 A;  2BC2 A;  3T3N A;  5EH9 A;  2Q0J A;  4PVO A;  5FQA A;  2OHJ A;  3I11 A;  2XF4 A;  4EFZ A;  4H0D A;  3IEK A;  4UWO B;  5LCH A;  4PVT A;  4KEQ A;  3I15 A;  3DHB A;  4D1U A;  3VQZ A;  4KEP A;  5ACP A;  4WD6 A;  5HH5 A;  1K07 A;  2WHG A;  4ZO2 A;  5EW0 A;  1ZNB A;  5AHO A;  5HIS A;  4HL2 A;  1E5D A;  4J5F A;  2QDT A;  2FHX A;  5LCF A;  5B1U A;  4HKY A;  2YNU A;  4F6H A;  4C1F A;  4Z5Y A;  3SPU A;  4TYT A;  1WRA A;  4F6Z A;  2GCU A;  5KIL A;  4AD9 A;  1YCG A;  2VW8 A;  1YCF A;  4C1G A;  3IE2 A;  3I13 A;  4UA4 A;  2BG6 A;  2P1E A;  3LVZ A;  4HL1 A;  2I7V A;  1L9Y A;  4TZE A;  5A0T A;  4J5H A;  2NZE A;  4TYF A;  3TP9 A;  4EYF A;  2AZ4 A;  4GCW A;  4Z7R A;  4EY2 A;  1X8G A;  5K4K A;  5LSC A;  4ZEJ A;  4B87 A;  2QIN A;  3IEM A;  2FU7 A;  4EXS A;  1JJT A;  5KIK A;  2BG8 B;  2BG7 A;  1HLK A;  5AXR A;  2BFK A;  4NQ4 A;  3I0V A;  2WRS A;  2BFZ B;  3IOF A;  2FU6 A;  3KL7 A;  4D1V A;  4Z67 A;  2WYM C;  2WYM A;  3SFP A;  5A87 A;  5K0W A;  2XR1 A;  2YNT A;  3Q6V A;  4RM5 A;  2YCB A;  4C1D A;  2BG8 A;  3IOG A;  3G1P A;  5A5Z A;  3IEL A;  1QH3 A;  5K4M A;  2CBN A;  3VPE A;  2I7T A;  3IE1 A;  4Z60 A;  4XWW A;  2YZ3 A;  2YNW A;  3PY6 A;  4Z5Z A;  2FHX B;  2P4Z A;  3SRX A;  4BZ3 A;  5ACQ A;  3FAI A;  4AX1 B;  5AXO A;  2A7M A;  4NQ6 A;  3P2U A;  4UAM A;  5LLD A;  2BIB A;  3S0Z A;  2YNV A;  1M2X A;  1ZTC A;  3L6N A;  4GYQ A;  4C1C A;  4XWT A;  5ACV A;  3SW3 A;  2NZF A;  1YCH A;  4DIL A;  3KNR A;  1DD6 A;  3X2Y A;  5ACS A;  2ZNB A;  4C09 A;  1DXK A;  1BVT A;  1SML A;  4YSB A;  5K4N A;  4NQ5 A;  1XTO A;  5LM6 A;  5EHT A;  2BG2 A;  2OHH A;  5B3R A;  2Q42 A;  2YNT B;  4EXY A;  1WUO A;  5EWA A;  4D1T A;  2NYP A;  3DH8 A;  4RL2 A;  1BC2 A;  4UBQ A;  1JJE A;  4C1E A;  2BFZ A;  5FQB A;  3BK2 A;  2GFJ A;  3T9M A;  3BK1 A;  3JXP A;  2QJS A;  1BMC A;  5EVB A;  3ADR A;  4AWY B;  2DKF A;  1Y44 A;  4ZO3 A;  3DHC A;  2BMI A;  3ZR9 A;  4YSL A;  4TZB A;  4CHL A;  4XUK A;  2M5D A;  3I14 A;  2H6A A;  4D1W A;  1P9E A;  1X8I A;  4GYU A;  1A8T A;  3H3E A;  5LCA A;  1JT1 A;  3FCZ A;  2FK6 A;  2BTN A;  4DIK A;  5LE1 A;  3RKK A;  3T3O A;  3RKJ A;  2E7Y A;  1KR3 A;  1VME A;  5HIQ A;  3ZQ4 A;  4V0H A;  2Q0I A;  5EV6 A;  1WW1 A;  4JO0 A;  1DDK A;  4FSB A;  3SD9 A;  3X2X A;  2M5C A;  5FQC A;  4P62 A;  1XM8 A;  5EVD A;  1X8H A;  5HH6 A;  2Y8A A;  4Z6X A;  1WUP A;  5EV8 A;  3X2Z A;  2NXA A;  2P18 A;  2FM6 A;  4AWZ A;  4FEK A;  3KNS A;  1QH5 A;  2FU9 A;  4AX0 B;  1KO2 A;  3MD7 A;  3R2U A;  1KO3 A;  4BP0 A;  5AYA A;  2DOO A;  2YNV B;  1MQO A;  3ZNB A;  3BC2 A;  2Q9U A;  3WXC A;  5ACX A;  2AIO A;  2GMN A;  5AEB A;  5HIO A;  5A0V A;  5B15 A;  2Y87 A;  3ESH A;  4ZNB A;  3DHA A;  3ZWF A;  2QDS A;  3AF6 A;  1A7T A;  2ZO4 A;  3BV6 A;  2BR6 A;  2HB9 A;  4NQ2 A;  4U4L A;  4UWS B;  4UWP B;  5LS3 A;  1VGN A;  4EYL A;  3IDZ A;  4UWR B;  4RBS A;  4RAM A;  5HH4 A;  3F9O A;  2BFL A;  2FU8 A;  4LE6 A;  5ACR A;  5ACU A;  4RAW A;  2UYX A;  3RPC A;  5LMC A;  2BGA A;  4RL0 A;  5DPX A;  3PG4 A;  3IE0 A;  4D02 A;  3QH8 A;  2GKL A;  3SBL A;  4YSK A;  5EVK A;  4C1H A;  2GFK A;  2WYL A;  2QED A;  2Y8B A;  2R2D A;  2ZZI A;  3AJ3 A;  5ACW A;  3PY5 A;  4FR7 A;  4O98 A;  5IQK A;  2I7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...