3QH8A

Crystal structure of a beta-lactamase-like protein bound to amp from brucella melitensis, long wavelength synchrotron data
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
272
structure length
272
Chain Sequence
MTSPRNCLRFTLLGCGSSPGVPRINGDWGKCDPKNPKNRRRRASLLVERYDAEGNNTVVVIDTGPDFRMQMIDSGVHMLDAAVYTHPHADHIHGIDDLRTYVVDNGRLMDVYANRLTRNRLYDTFGYCFETPVGSSYPPILSMHDIAPETPFSIEGAGGAIRFEPFSQVHGDIESLGFRIGSVVYCTDVSAFPEQSLQYIKDADVLIIGALQYRPHPSHFSLGEALEWIEKLSPKRAILTHMHVPLDYETVMRETPHHVEPGYDGLRFEVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase-like
publication title Crystal structure of a Beta-Lactamase-Like Protein bound to AMP from Brucella Melitensis, long wavelength synchrotron data
pubmed doi rcsb
source organism Brucella melitensis biovar abortus
molecule tags Hydrolase
total genus 81
structure length 272
sequence length 272
ec nomenclature
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3qh8A00
4C1EA 2YNVA 4Z60A 3LVZA 3IEKA 5EWAA 4EYLA 4NQ4A 3SD9A 2QINA 4J5HA 4EYBA 3I15A 5AXOA 4UWRB 2ZO4A 3FCZA 1WUPA 3X2YA 4H0DA 1M2XA 4FR7A 5ACPA 2GCUA 3PY5A 2FHXB 5A87A 5ACXA 2DKFA 4V0HA 3RKKA 4AWYB 3F9OA 5K0WA 3BK1A 2YNUA 2ZZIA 2BG7A 5A5ZA 4GCWA 3S0ZA 3FAIA 5LE1A 4NQ6A 4UWPB 1BC2A 3PY6A 4GYUA 3VPEA 2BG6A 5K4KA 4ZO2A 4KEQA 3ZR9A 1BVTA 2NZFA 5ACUA 1DXKA 4WD6A 1A7TA 5K4NA 3I0VA 5AXRA 3X30A 2FHXA 4DIKA 1X8IA 4NQ2A 4UA4A 3IE1A 3AF5A 2YNVB 2GFKA 2WYMA 3X2XA 3MD7A 3IELA 1YCGA 3RKJA 1MQOA 1DD6A 1YCHA 5K4MA 1X8HA 4F6HA 2FU7A 3ESHA 1E5DA 1KO3A 2YNWA 2P97A 5A0VA 4C1CA 4FSBA 2HB9A 3JXPA 5EW0A 1BMCA 4EXSA 5ACVA 2I7VA 1KR3A 4UBQA 3KNSA 2Y8BA 2Q0JA 4RL2A 3VQZA 3ZWFA 5IQKA 3DH8A 4C09A 5FQBA 4D1TA 2FU9A 4D02A 3I11A 2R2DA 2BR6A 1ZNBA 2E7YA 2Y8AA 5ACQA 5KILA 5FQCA 3SRXA 1JJEA 4O98A 2NZEA 1JJTA 4YSKA 2BFKA 1KO2A 3ZQ4A 5LLDA 3ADRA 4TYTA 4FEKA 3IE2A 2FM6A 4AX1B 2ZNBA 4XWTA 4HKYA 5ACTA 2NXAA 1VMEA 2CBNA 4C1DA 5AHRA 2BTNA 1WW1A 2P4ZA 3IOGA 2VW8A 2Y87A 4C1HA 2FK6A 3SPUA 5KIKA 5EV6A 1WRAA 1XM8A 5B15A 3IOFA 4ZO3A 2YZ3A 5EH9A 4HL2A 2WHGA 5DPXA 1QH5A 3X2ZA 2Q42A 2XR1A 1VJNA 4TZBA 4P62A 3IE0A 5FQAA 2BMIA 4RBSA 3T3OA 2BG8A 4B87A 2A7MA 3SW3A 5HH6A 2GKLA 5HIOA 2WRSA 3IDZA 3P2UA 4YSBA 3SFPA 5ACRA 3IEMA 1XTOA 2BFZB 2FU8A 5EVDA 2OHJA 4C1GA 4AWZA 2BC2A 4CHLA 3H3EA 3R2UA 3RPCA 5HH4A 1ZTCA 4RAMA 3PG4A 1L9YA 2P1EA 4U4LA 3KL7A 4AX0B 5ACSA 3AJ3A 2GFJA 2P18A 2NYPA 4DILA 2UYXA 3BK2A 4Z5YA 3T9MA 3Q6VA 3DHBA 5EVKA 5B1UA 4D1VA 3QH8A 4RL0A 3SBLA 4C1FA 5LCFA 1VGNA 2BFZA 1ZKPA 5AHOA 1A8TA 2OHIA 1P9EA 5LSCA 3KNRA 2AIOA 4TZFA 5HH5A 4Z67A 4UAMA 3ZNBA 4J5FA 4TYFA 4RAWA 1HLKA 2M5DA 5LMCA 5LM6A 2BG8B 2QEDA 3DHAA 5AEBA 1QH3A 2YCBA 3BV6A 4BP0A 3G1PA 5EHTA 1K07A 2Q9UA 4D1WA 1YCFA 4JO0A 4YSLA 2BGAA 4UWOB 3A4YA 4XWWA 2M5CA 1Y44A 4Z5ZA 5EVBA 4F6ZA 2FU6A 4ZNBA 5HIQA 1DDKA 2I7XA 1X8GA 3I13A 3DHCA 4HL1A 2XF4A 3WXCA 4PVOA 3BC2A 2WYMC 4EYFA 5LCHA 2DOOA 4NQ5A 4TZEA 2AZ4A 1SMLA 4XUKA 4EXYA 4BZ3A 5HISA 2YNTB 4EY2A 4ZEJA 3AF6A 4D1UA 2ZWRA 2QDTA 2BG2A 2QJSA 5A0TA 2BFLA 5LCAA 3T3NA 2QDSA 4KEPA 4LE6A 4Z7RA 2GMNA 1WUOA 2BIBA 5ACWA 4TZ9A 2I7TA 2Q0IA 4RM5A 3TP9A 4Z6XA 5HIPA 4AD9A 3I14A 3L6NA 2H6AA 2OHHA 5EV8A 5B3RA 4PVTA 4GYQA 1JT1A 5LS3A 2YNTA 4UWSB 4EFZA 2WYLA 5AYAA
chains in the Genus database with same CATH superfamily
4C1EA 2YNVA 4AV7A 4Z60A 3LVZA 3IEKA 5EWAA 4EYLA 4NQ4A 3SD9A 2QINA 4J5HA 4EYBA 3I15A 5AXOA 4UWRB 2ZO4A 3FCZA 1WUPA 3X2YA 4H0DA 1M2XA 4FR7A 5ACPA 2GCUA 3PY5A 2FHXB 5A87A 5ACXA 2DKFA 4V0HA 3RKKA 4AWYB 3F9OA 5K0WA 3BK1A 2YNUA 2ZZIA 2BG7A 5A5ZA 4GCWA 2YHEA 3S0ZA 3FAIA 5LE1A 4NQ6A 4UWPB 1BC2A 3PY6A 4GYUA 3VPEA 2BG6A 5K4KA 4ZO2A 4KEQA 3ZR9A 1BVTA 2NZFA 5ACUA 1DXKA 4WD6A 1A7TA 2CFZA 5K4NA 3I0VA 5AXRA 3X30A 2FHXA 4DIKA 1X8IA 4NQ2A 4UA4A 3IE1A 3AF5A 2YNVB 2GFKA 2WYMA 4PDXA 3X2XA 3MD7A 3IELA 1YCGA 3RKJA 1MQOA 1DD6A 1YCHA 5K4MA 1X8HA 4F6HA 2FU7A 3ESHA 1E5DA 1KO3A 2YNWA 2P97A 5A0VA 4C1CA 4FSBA 2HB9A 3JXPA 5EW0A 1BMCA 4EXSA 5ACVA 2I7VA 1KR3A 4UBQA 3KNSA 2Y8BA 2Q0JA 4RL2A 3VQZA 3ZWFA 5IQKA 3DH8A 4C09A 5FQBA 4D1TA 2FU9A 4D02A 3I11A 2R2DA 2BR6A 1ZNBA 2E7YA 2Y8AA 5ACQA 5KILA 5FQCA 3SRXA 1JJEA 4O98A 2NZEA 1JJTA 4YSKA 2BFKA 1KO2A 3ZQ4A 5LLDA 3ADRA 4TYTA 4FEKA 3IE2A 2FM6A 4AX1B 2CG3A 2ZNBA 2CG2A 4XWTA 4HKYA 5ACTA 2NXAA 5AJLA 1VMEA 2CBNA 4C1DA 5AHRA 2BTNA 1WW1A 2P4ZA 3IOGA 2VW8A 2Y87A 4C1HA 2FK6A 3SPUA 5KIKA 5EV6A 1WRAA 1XM8A 5B15A 3IOFA 4ZO3A 2YZ3A 5EH9A 4HL2A 2WHGA 5DPXA 1QH5A 5A23A 3X2ZA 2Q42A 2XR1A 1VJNA 4TZBA 4P62A 3IE0A 2CFUA 5FQAA 2BMIA 4RBSA 3T3OA 2BG8A 4B87A 2A7MA 3SW3A 5HH6A 2GKLA 5HIOA 2WRSA 3IDZA 3P2UA 4YSBA 3SFPA 5ACRA 3IEMA 1XTOA 2BFZB 2FU8A 5EVDA 2OHJA 4C1GA 4AWZA 2BC2A 4CHLA 3H3EA 3R2UA 3RPCA 5HH4A 5AIJA 1ZTCA 4RAMA 3PG4A 1L9YA 2P1EA 4U4LA 3KL7A 4AX0B 5ACSA 3AJ3A 2GFJA 2P18A 2NYPA 4NURA 4DILA 2UYXA 3BK2A 4Z5YA 3T9MA 3Q6VA 3DHBA 5EVKA 5B1UA 4D1VA 3QH8A 4RL0A 3SBLA 4C1FA 5LCFA 1VGNA 2BFZA 1ZKPA 5AHOA 1A8TA 2OHIA 1P9EA 5LSCA 3KNRA 2AIOA 4TZFA 5HH5A 4Z67A 4UAMA 3ZNBA 4J5FA 4TYFA 4RAWA 1HLKA 2M5DA 5LMCA 5LM6A 2BG8B 2QEDA 3DHAA 5AEBA 1QH3A 2YCBA 3BV6A 4BP0A 3G1PA 5EHTA 1K07A 2Q9UA 4D1WA 1YCFA 4JO0A 4YSLA 2BGAA 4UWOB 3A4YA 4XWWA 2M5CA 1Y44A 4Z5ZA 5EVBA 4F6ZA 2FU6A 4ZNBA 5HIQA 1DDKA 2I7XA 1X8GA 3I13A 3DHCA 4HL1A 2XF4A 3WXCA 4PVOA 3BC2A 2WYMC 4EYFA 5LCHA 2DOOA 4NQ5A 4TZEA 2AZ4A 1SMLA 4XUKA 4EXYA 4BZ3A 5HISA 2YNTB 4EY2A 4ZEJA 3AF6A 4D1UA 2ZWRA 2QDTA 2BG2A 2QJSA 5A0TA 2BFLA 5LCAA 3T3NA 2QDSA 4KEPA 4LE6A 4Z7RA 2GMNA 4AXHA 1WUOA 2BIBA 5ACWA 4TZ9A 2I7TA 2Q0IA 4RM5A 3TP9A 4Z6XA 5HIPA 4AD9A 3I14A 3L6NA 2H6AA 2OHHA 5EV8A 5B3RA 4PVTA 4GYQA 1JT1A 5LS3A 2YNTA 4UWSB 4EFZA 2WYLA 5AYAA
chains in the Genus database with same CATH topology
4C1EA 2YNVA 4Z60A 3LVZA 3IEKA 5EWAA 4EYLA 4NQ4A 3SD9A 2QINA 4J5HA 4EYBA 3I15A 5AXOA 4UWRB 2ZO4A 3FCZA 1WUPA 3X2YA 4H0DA 1M2XA 4FR7A 5ACPA 2GCUA 3PY5A 2FHXB 5A87A 5ACXA 2DKFA 4V0HA 3RKKA 4AWYB 3F9OA 5K0WA 3BK1A 2YNUA 2ZZIA 2BG7A 5A5ZA 4GCWA 3S0ZA 3FAIA 5LE1A 4NQ6A 4UWPB 1BC2A 3PY6A 4GYUA 3VPEA 2BG6A 5K4KA 4ZO2A 4KEQA 3ZR9A 1BVTA 2NZFA 5ACUA 1DXKA 4WD6A 1A7TA 5K4NA 3I0VA 5AXRA 3X30A 2FHXA 4DIKA 1X8IA 4NQ2A 4UA4A 3IE1A 3AF5A 2YNVB 2GFKA 2WYMA 3X2XA 3MD7A 3IELA 1YCGA 3RKJA 1MQOA 1DD6A 1YCHA 5K4MA 1X8HA 4F6HA 2FU7A 3ESHA 1E5DA 1KO3A 2YNWA 2P97A 5A0VA 4C1CA 4FSBA 2HB9A 3JXPA 5EW0A 1BMCA 4EXSA 5ACVA 2I7VA 1KR3A 4UBQA 3KNSA 2Y8BA 2Q0JA 4RL2A 3VQZA 3ZWFA 5IQKA 3DH8A 4C09A 5FQBA 4D1TA 2FU9A 4D02A 3I11A 2R2DA 2BR6A 1ZNBA 2E7YA 2Y8AA 5ACQA 5KILA 5FQCA 3SRXA 1JJEA 4O98A 2NZEA 1JJTA 4YSKA 2BFKA 1KO2A 3ZQ4A 5LLDA 3ADRA 4TYTA 4FEKA 3IE2A 2FM6A 4AX1B 2ZNBA 4XWTA 4HKYA 5ACTA 2NXAA 1VMEA 2CBNA 4C1DA 5AHRA 2BTNA 1WW1A 2P4ZA 3IOGA 2VW8A 2Y87A 4C1HA 2FK6A 3SPUA 5KIKA 5EV6A 1WRAA 1XM8A 5B15A 3IOFA 4ZO3A 2YZ3A 5EH9A 4HL2A 2WHGA 5DPXA 1QH5A 3X2ZA 2Q42A 2XR1A 1VJNA 4TZBA 4P62A 3IE0A 5FQAA 2BMIA 4RBSA 3T3OA 2BG8A 4B87A 2A7MA 3SW3A 5HH6A 2GKLA 5HIOA 2WRSA 3IDZA 3P2UA 4YSBA 3SFPA 5ACRA 3IEMA 1XTOA 2BFZB 2FU8A 5EVDA 2OHJA 4C1GA 4AWZA 2BC2A 4CHLA 3H3EA 3R2UA 3RPCA 5HH4A 1ZTCA 4RAMA 3PG4A 1L9YA 2P1EA 4U4LA 3KL7A 4AX0B 5ACSA 3AJ3A 2GFJA 2P18A 2NYPA 4DILA 2UYXA 3BK2A 4Z5YA 3T9MA 3Q6VA 3DHBA 5EVKA 5B1UA 4D1VA 3QH8A 4RL0A 3SBLA 4C1FA 5LCFA 1VGNA 2BFZA 1ZKPA 5AHOA 1A8TA 2OHIA 1P9EA 5LSCA 3KNRA 2AIOA 4TZFA 5HH5A 4Z67A 4UAMA 3ZNBA 4J5FA 4TYFA 4RAWA 1HLKA 2M5DA 5LMCA 5LM6A 2BG8B 2QEDA 3DHAA 5AEBA 1QH3A 2YCBA 3BV6A 4BP0A 3G1PA 5EHTA 1K07A 2Q9UA 4D1WA 1YCFA 4JO0A 4YSLA 2BGAA 4UWOB 3A4YA 4XWWA 2M5CA 1Y44A 4Z5ZA 5EVBA 4F6ZA 2FU6A 4ZNBA 5HIQA 1DDKA 2I7XA 1X8GA 3I13A 3DHCA 4HL1A 2XF4A 3WXCA 4PVOA 3BC2A 2WYMC 4EYFA 5LCHA 2DOOA 4NQ5A 4TZEA 2AZ4A 1SMLA 4XUKA 4EXYA 4BZ3A 5HISA 2YNTB 4EY2A 4ZEJA 3AF6A 4D1UA 2ZWRA 2QDTA 2BG2A 2QJSA 5A0TA 2BFLA 5LCAA 3T3NA 2QDSA 4KEPA 4LE6A 4Z7RA 2GMNA 1WUOA 2BIBA 5ACWA 4TZ9A 2I7TA 2Q0IA 4RM5A 3TP9A 4Z6XA 5HIPA 4AD9A 3I14A 3L6NA 2H6AA 2OHHA 5EV8A 5B3RA 4PVTA 4GYQA 1JT1A 5LS3A 2YNTA 4UWSB 4EFZA 2WYLA 5AYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C1E A;  2YNV A;  4Z60 A;  3LVZ A;  3IEK A;  5EWA A;  4EYL A;  4NQ4 A;  3SD9 A;  2QIN A;  4J5H A;  4EYB A;  3I15 A;  5AXO A;  4UWR B;  2ZO4 A;  3FCZ A;  1WUP A;  3X2Y A;  4H0D A;  1M2X A;  4FR7 A;  5ACP A;  2GCU A;  3PY5 A;  2FHX B;  5A87 A;  5ACX A;  2DKF A;  4V0H A;  3RKK A;  4AWY B;  3F9O A;  5K0W A;  3BK1 A;  2YNU A;  2ZZI A;  2BG7 A;  5A5Z A;  4GCW A;  3S0Z A;  3FAI A;  5LE1 A;  4NQ6 A;  4UWP B;  1BC2 A;  3PY6 A;  4GYU A;  3VPE A;  2BG6 A;  5K4K A;  4ZO2 A;  4KEQ A;  3ZR9 A;  1BVT A;  2NZF A;  5ACU A;  1DXK A;  4WD6 A;  1A7T A;  5K4N A;  3I0V A;  5AXR A;  3X30 A;  2FHX A;  4DIK A;  1X8I A;  4NQ2 A;  4UA4 A;  3IE1 A;  3AF5 A;  2YNV B;  2GFK A;  2WYM A;  3X2X A;  3MD7 A;  3IEL A;  1YCG A;  3RKJ A;  1MQO A;  1DD6 A;  1YCH A;  5K4M A;  1X8H A;  4F6H A;  2FU7 A;  3ESH A;  1E5D A;  1KO3 A;  2YNW A;  2P97 A;  5A0V A;  4C1C A;  4FSB A;  2HB9 A;  3JXP A;  5EW0 A;  1BMC A;  4EXS A;  5ACV A;  2I7V A;  1KR3 A;  4UBQ A;  3KNS A;  2Y8B A;  2Q0J A;  4RL2 A;  3VQZ A;  3ZWF A;  5IQK A;  3DH8 A;  4C09 A;  5FQB A;  4D1T A;  2FU9 A;  4D02 A;  3I11 A;  2R2D A;  2BR6 A;  1ZNB A;  2E7Y A;  2Y8A A;  5ACQ A;  5KIL A;  5FQC A;  3SRX A;  1JJE A;  4O98 A;  2NZE A;  1JJT A;  4YSK A;  2BFK A;  1KO2 A;  3ZQ4 A;  5LLD A;  3ADR A;  4TYT A;  4FEK A;  3IE2 A;  2FM6 A;  4AX1 B;  2ZNB A;  4XWT A;  4HKY A;  5ACT A;  2NXA A;  1VME A;  2CBN A;  4C1D A;  5AHR A;  2BTN A;  1WW1 A;  2P4Z A;  3IOG A;  2VW8 A;  2Y87 A;  4C1H A;  2FK6 A;  3SPU A;  5KIK A;  5EV6 A;  1WRA A;  1XM8 A;  5B15 A;  3IOF A;  4ZO3 A;  2YZ3 A;  5EH9 A;  4HL2 A;  2WHG A;  5DPX A;  1QH5 A;  3X2Z A;  2Q42 A;  2XR1 A;  1VJN A;  4TZB A;  4P62 A;  3IE0 A;  5FQA A;  2BMI A;  4RBS A;  3T3O A;  2BG8 A;  4B87 A;  2A7M A;  3SW3 A;  5HH6 A;  2GKL A;  5HIO A;  2WRS A;  3IDZ A;  3P2U A;  4YSB A;  3SFP A;  5ACR A;  3IEM A;  1XTO A;  2BFZ B;  2FU8 A;  5EVD A;  2OHJ A;  4C1G A;  4AWZ A;  2BC2 A;  4CHL A;  3H3E A;  3R2U A;  3RPC A;  5HH4 A;  1ZTC A;  4RAM A;  3PG4 A;  1L9Y A;  2P1E A;  4U4L A;  3KL7 A;  4AX0 B;  5ACS A;  3AJ3 A;  2GFJ A;  2P18 A;  2NYP A;  4DIL A;  2UYX A;  3BK2 A;  4Z5Y A;  3T9M A;  3Q6V A;  3DHB A;  5EVK A;  5B1U A;  4D1V A;  3QH8 A;  4RL0 A;  3SBL A;  4C1F A;  5LCF A;  1VGN A;  2BFZ A;  1ZKP A;  5AHO A;  1A8T A;  2OHI A;  1P9E A;  5LSC A;  3KNR A;  2AIO A;  4TZF A;  5HH5 A;  4Z67 A;  4UAM A;  3ZNB A;  4J5F A;  4TYF A;  4RAW A;  1HLK A;  2M5D A;  5LMC A;  5LM6 A;  2BG8 B;  2QED A;  3DHA A;  5AEB A;  1QH3 A;  2YCB A;  3BV6 A;  4BP0 A;  3G1P A;  5EHT A;  1K07 A;  2Q9U A;  4D1W A;  1YCF A;  4JO0 A;  4YSL A;  2BGA A;  4UWO B;  3A4Y A;  4XWW A;  2M5C A;  1Y44 A;  4Z5Z A;  5EVB A;  4F6Z A;  2FU6 A;  4ZNB A;  5HIQ A;  1DDK A;  2I7X A;  1X8G A;  3I13 A;  3DHC A;  4HL1 A;  2XF4 A;  3WXC A;  4PVO A;  3BC2 A;  2WYM C;  4EYF A;  5LCH A;  2DOO A;  4NQ5 A;  4TZE A;  2AZ4 A;  1SML A;  4XUK A;  4EXY A;  4BZ3 A;  5HIS A;  2YNT B;  4EY2 A;  4ZEJ A;  3AF6 A;  4D1U A;  2ZWR A;  2QDT A;  2BG2 A;  2QJS A;  5A0T A;  2BFL A;  5LCA A;  3T3N A;  2QDS A;  4KEP A;  4LE6 A;  4Z7R A;  2GMN A;  1WUO A;  2BIB A;  5ACW A;  4TZ9 A;  2I7T A;  2Q0I A;  4RM5 A;  3TP9 A;  4Z6X A;  5HIP A;  4AD9 A;  3I14 A;  3L6N A;  2H6A A;  2OHH A;  5EV8 A;  5B3R A;  4PVT A;  4GYQ A;  1JT1 A;  5LS3 A;  2YNT A;  4UWS B;  4EFZ A;  2WYL A;  5AYA A; 
#chains in the Genus database with same CATH topology
 4C1E A;  2YNV A;  4AV7 A;  4Z60 A;  3LVZ A;  3IEK A;  5EWA A;  4EYL A;  4NQ4 A;  3SD9 A;  2QIN A;  4J5H A;  4EYB A;  3I15 A;  5AXO A;  4UWR B;  2ZO4 A;  3FCZ A;  1WUP A;  3X2Y A;  4H0D A;  1M2X A;  4FR7 A;  5ACP A;  2GCU A;  3PY5 A;  2FHX B;  5A87 A;  5ACX A;  2DKF A;  4V0H A;  3RKK A;  4AWY B;  3F9O A;  5K0W A;  3BK1 A;  2YNU A;  2ZZI A;  2BG7 A;  5A5Z A;  4GCW A;  2YHE A;  3S0Z A;  3FAI A;  5LE1 A;  4NQ6 A;  4UWP B;  1BC2 A;  3PY6 A;  4GYU A;  3VPE A;  2BG6 A;  5K4K A;  4ZO2 A;  4KEQ A;  3ZR9 A;  1BVT A;  2NZF A;  5ACU A;  1DXK A;  4WD6 A;  1A7T A;  2CFZ A;  5K4N A;  3I0V A;  5AXR A;  3X30 A;  2FHX A;  4DIK A;  1X8I A;  4NQ2 A;  4UA4 A;  3IE1 A;  3AF5 A;  2YNV B;  2GFK A;  2WYM A;  4PDX A;  3X2X A;  3MD7 A;  3IEL A;  1YCG A;  3RKJ A;  1MQO A;  1DD6 A;  1YCH A;  5K4M A;  1X8H A;  4F6H A;  2FU7 A;  3ESH A;  1E5D A;  1KO3 A;  2YNW A;  2P97 A;  5A0V A;  4C1C A;  4FSB A;  2HB9 A;  3JXP A;  5EW0 A;  1BMC A;  4EXS A;  5ACV A;  2I7V A;  1KR3 A;  4UBQ A;  3KNS A;  2Y8B A;  2Q0J A;  4RL2 A;  3VQZ A;  3ZWF A;  5IQK A;  3DH8 A;  4C09 A;  5FQB A;  4D1T A;  2FU9 A;  4D02 A;  3I11 A;  2R2D A;  2BR6 A;  1ZNB A;  2E7Y A;  2Y8A A;  5ACQ A;  5KIL A;  5FQC A;  3SRX A;  1JJE A;  4O98 A;  2NZE A;  1JJT A;  4YSK A;  2BFK A;  1KO2 A;  3ZQ4 A;  5LLD A;  3ADR A;  4TYT A;  4FEK A;  3IE2 A;  2FM6 A;  4AX1 B;  2CG3 A;  2ZNB A;  2CG2 A;  4XWT A;  4HKY A;  5ACT A;  2NXA A;  5AJL A;  1VME A;  2CBN A;  4C1D A;  5AHR A;  2BTN A;  1WW1 A;  2P4Z A;  3IOG A;  2VW8 A;  2Y87 A;  4C1H A;  2FK6 A;  3SPU A;  5KIK A;  5EV6 A;  1WRA A;  1XM8 A;  5B15 A;  3IOF A;  4ZO3 A;  2YZ3 A;  5EH9 A;  4HL2 A;  2WHG A;  5DPX A;  1QH5 A;  5A23 A;  3X2Z A;  2Q42 A;  2XR1 A;  1VJN A;  4TZB A;  4P62 A;  3IE0 A;  2CFU A;  5FQA A;  2BMI A;  4RBS A;  3T3O A;  2BG8 A;  4B87 A;  2A7M A;  3SW3 A;  5HH6 A;  2GKL A;  5HIO A;  2WRS A;  3IDZ A;  3P2U A;  4YSB A;  3SFP A;  5ACR A;  3IEM A;  1XTO A;  2BFZ B;  2FU8 A;  5EVD A;  2OHJ A;  4C1G A;  4AWZ A;  2BC2 A;  4CHL A;  3H3E A;  3R2U A;  3RPC A;  5HH4 A;  5AIJ A;  1ZTC A;  4RAM A;  3PG4 A;  1L9Y A;  2P1E A;  4U4L A;  3KL7 A;  4AX0 B;  5ACS A;  3AJ3 A;  2GFJ A;  2P18 A;  2NYP A;  4NUR A;  4DIL A;  2UYX A;  3BK2 A;  4Z5Y A;  3T9M A;  3Q6V A;  3DHB A;  5EVK A;  5B1U A;  4D1V A;  3QH8 A;  4RL0 A;  3SBL A;  4C1F A;  5LCF A;  1VGN A;  2BFZ A;  1ZKP A;  5AHO A;  1A8T A;  2OHI A;  1P9E A;  5LSC A;  3KNR A;  2AIO A;  4TZF A;  5HH5 A;  4Z67 A;  4UAM A;  3ZNB A;  4J5F A;  4TYF A;  4RAW A;  1HLK A;  2M5D A;  5LMC A;  5LM6 A;  2BG8 B;  2QED A;  3DHA A;  5AEB A;  1QH3 A;  2YCB A;  3BV6 A;  4BP0 A;  3G1P A;  5EHT A;  1K07 A;  2Q9U A;  4D1W A;  1YCF A;  4JO0 A;  4YSL A;  2BGA A;  4UWO B;  3A4Y A;  4XWW A;  2M5C A;  1Y44 A;  4Z5Z A;  5EVB A;  4F6Z A;  2FU6 A;  4ZNB A;  5HIQ A;  1DDK A;  2I7X A;  1X8G A;  3I13 A;  3DHC A;  4HL1 A;  2XF4 A;  3WXC A;  4PVO A;  3BC2 A;  2WYM C;  4EYF A;  5LCH A;  2DOO A;  4NQ5 A;  4TZE A;  2AZ4 A;  1SML A;  4XUK A;  4EXY A;  4BZ3 A;  5HIS A;  2YNT B;  4EY2 A;  4ZEJ A;  3AF6 A;  4D1U A;  2ZWR A;  2QDT A;  2BG2 A;  2QJS A;  5A0T A;  2BFL A;  5LCA A;  3T3N A;  2QDS A;  4KEP A;  4LE6 A;  4Z7R A;  2GMN A;  4AXH A;  1WUO A;  2BIB A;  5ACW A;  4TZ9 A;  2I7T A;  2Q0I A;  4RM5 A;  3TP9 A;  4Z6X A;  5HIP A;  4AD9 A;  3I14 A;  3L6N A;  2H6A A;  2OHH A;  5EV8 A;  5B3R A;  4PVT A;  4GYQ A;  1JT1 A;  5LS3 A;  2YNT A;  4UWS B;  4EFZ A;  2WYL A;  5AYA A; 
#chains in the Genus database with same CATH homology
 4C1E A;  2YNV A;  4Z60 A;  3LVZ A;  3IEK A;  5EWA A;  4EYL A;  4NQ4 A;  3SD9 A;  2QIN A;  4J5H A;  4EYB A;  3I15 A;  5AXO A;  4UWR B;  2ZO4 A;  3FCZ A;  1WUP A;  3X2Y A;  4H0D A;  1M2X A;  4FR7 A;  5ACP A;  2GCU A;  3PY5 A;  2FHX B;  5A87 A;  5ACX A;  2DKF A;  4V0H A;  3RKK A;  4AWY B;  3F9O A;  5K0W A;  3BK1 A;  2YNU A;  2ZZI A;  2BG7 A;  5A5Z A;  4GCW A;  3S0Z A;  3FAI A;  5LE1 A;  4NQ6 A;  4UWP B;  1BC2 A;  3PY6 A;  4GYU A;  3VPE A;  2BG6 A;  5K4K A;  4ZO2 A;  4KEQ A;  3ZR9 A;  1BVT A;  2NZF A;  5ACU A;  1DXK A;  4WD6 A;  1A7T A;  5K4N A;  3I0V A;  5AXR A;  3X30 A;  2FHX A;  4DIK A;  1X8I A;  4NQ2 A;  4UA4 A;  3IE1 A;  3AF5 A;  2YNV B;  2GFK A;  2WYM A;  3X2X A;  3MD7 A;  3IEL A;  1YCG A;  3RKJ A;  1MQO A;  1DD6 A;  1YCH A;  5K4M A;  1X8H A;  4F6H A;  2FU7 A;  3ESH A;  1E5D A;  1KO3 A;  2YNW A;  2P97 A;  5A0V A;  4C1C A;  4FSB A;  2HB9 A;  3JXP A;  5EW0 A;  1BMC A;  4EXS A;  5ACV A;  2I7V A;  1KR3 A;  4UBQ A;  3KNS A;  2Y8B A;  2Q0J A;  4RL2 A;  3VQZ A;  3ZWF A;  5IQK A;  3DH8 A;  4C09 A;  5FQB A;  4D1T A;  2FU9 A;  4D02 A;  3I11 A;  2R2D A;  2BR6 A;  1ZNB A;  2E7Y A;  2Y8A A;  5ACQ A;  5KIL A;  5FQC A;  3SRX A;  1JJE A;  4O98 A;  2NZE A;  1JJT A;  4YSK A;  2BFK A;  1KO2 A;  3ZQ4 A;  5LLD A;  3ADR A;  4TYT A;  4FEK A;  3IE2 A;  2FM6 A;  4AX1 B;  2ZNB A;  4XWT A;  4HKY A;  5ACT A;  2NXA A;  1VME A;  2CBN A;  4C1D A;  5AHR A;  2BTN A;  1WW1 A;  2P4Z A;  3IOG A;  2VW8 A;  2Y87 A;  4C1H A;  2FK6 A;  3SPU A;  5KIK A;  5EV6 A;  1WRA A;  1XM8 A;  5B15 A;  3IOF A;  4ZO3 A;  2YZ3 A;  5EH9 A;  4HL2 A;  2WHG A;  5DPX A;  1QH5 A;  3X2Z A;  2Q42 A;  2XR1 A;  1VJN A;  4TZB A;  4P62 A;  3IE0 A;  5FQA A;  2BMI A;  4RBS A;  3T3O A;  2BG8 A;  4B87 A;  2A7M A;  3SW3 A;  5HH6 A;  2GKL A;  5HIO A;  2WRS A;  3IDZ A;  3P2U A;  4YSB A;  3SFP A;  5ACR A;  3IEM A;  1XTO A;  2BFZ B;  2FU8 A;  5EVD A;  2OHJ A;  4C1G A;  4AWZ A;  2BC2 A;  4CHL A;  3H3E A;  3R2U A;  3RPC A;  5HH4 A;  1ZTC A;  4RAM A;  3PG4 A;  1L9Y A;  2P1E A;  4U4L A;  3KL7 A;  4AX0 B;  5ACS A;  3AJ3 A;  2GFJ A;  2P18 A;  2NYP A;  4DIL A;  2UYX A;  3BK2 A;  4Z5Y A;  3T9M A;  3Q6V A;  3DHB A;  5EVK A;  5B1U A;  4D1V A;  3QH8 A;  4RL0 A;  3SBL A;  4C1F A;  5LCF A;  1VGN A;  2BFZ A;  1ZKP A;  5AHO A;  1A8T A;  2OHI A;  1P9E A;  5LSC A;  3KNR A;  2AIO A;  4TZF A;  5HH5 A;  4Z67 A;  4UAM A;  3ZNB A;  4J5F A;  4TYF A;  4RAW A;  1HLK A;  2M5D A;  5LMC A;  5LM6 A;  2BG8 B;  2QED A;  3DHA A;  5AEB A;  1QH3 A;  2YCB A;  3BV6 A;  4BP0 A;  3G1P A;  5EHT A;  1K07 A;  2Q9U A;  4D1W A;  1YCF A;  4JO0 A;  4YSL A;  2BGA A;  4UWO B;  3A4Y A;  4XWW A;  2M5C A;  1Y44 A;  4Z5Z A;  5EVB A;  4F6Z A;  2FU6 A;  4ZNB A;  5HIQ A;  1DDK A;  2I7X A;  1X8G A;  3I13 A;  3DHC A;  4HL1 A;  2XF4 A;  3WXC A;  4PVO A;  3BC2 A;  2WYM C;  4EYF A;  5LCH A;  2DOO A;  4NQ5 A;  4TZE A;  2AZ4 A;  1SML A;  4XUK A;  4EXY A;  4BZ3 A;  5HIS A;  2YNT B;  4EY2 A;  4ZEJ A;  3AF6 A;  4D1U A;  2ZWR A;  2QDT A;  2BG2 A;  2QJS A;  5A0T A;  2BFL A;  5LCA A;  3T3N A;  2QDS A;  4KEP A;  4LE6 A;  4Z7R A;  2GMN A;  1WUO A;  2BIB A;  5ACW A;  4TZ9 A;  2I7T A;  2Q0I A;  4RM5 A;  3TP9 A;  4Z6X A;  5HIP A;  4AD9 A;  3I14 A;  3L6N A;  2H6A A;  2OHH A;  5EV8 A;  5B3R A;  4PVT A;  4GYQ A;  1JT1 A;  5LS3 A;  2YNT A;  4UWS B;  4EFZ A;  2WYL A;  5AYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...