3QHFL

Crystal structure of fab del2d1, a deletion variant of anti-influenza antibody 2d1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
215
structure length
215
Chain Sequence
EPVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVSWYQQVPGTAPKLLIYGNNERPSGVPDRFSGSKSATSASLAISGLQSEDEADYYCAAWDDSLNGFWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Human monoclonal antibody del2D1, Fab Heavy Chain
publication title An insertion mutation that distorts antibody binding site architecture enhances function of a human antibody.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2011-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qhfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qhfL01
1NFIA 3OAUH 3UBXA 1VEPA 3CSGA 2XNAB 5BVPL 3CZJA 2R1XB 2CK2A 1KELH 4RMVA 5T3XE 3PHQB 2BVQA 12E8L 4JFYB 3UPAA 1X5LA 1VFBB 4WEBL 1UKQA 3BXNB 1I9RH 3EW3B 1NDGA 2V5MA 1GPOH 2GUOA 2X4NA 4OLWH 3QWRA 1P53A 4MLSA 2YRZA 5D7IF 1BJ1J 5DRZA 4LCYA 1T66C 2JELL 1R24B 5J9PB 2DQDH 4YE4H 3BN9D 3O6FA 1SYVB 3F65A 4R96A 3IDUA 5HHPA 1HQ4A 3DUSA 1U95A 1JF1B 4X99B 5DMIL 3L3DA 3D25B 3MFFA 3MOAH 4HKXB 2JB5H 4PRHA 2FR4B 4LLUA 2Y07L 1AH1A 2JJUA 4R4FH 3ZKND 1CFSA 1GGBL 4RGOH 2VIRA 2VXVL 1BQUA 3VRLF 5D7JB 5DHVH 3OKKB 2P8LB 3QUYB 1ADQA 1N5AB 4EQ2A 1VFAB 1ITBB 5IMKB 2R23A 3PWVA 5IF0A 1AKJB 4X6FB 1SJEB 3BH8B 3AREA 4LSVL 2CLZB 3KG5A 3MLXH 2EYRB 2FEEL 1LP9B 4OLVL 2GT9A 4NN6C 1U8LA 1A6VL 4JPIA 2DLTA 2HYMA 2F9BT 2QR0A 3QXWA 4YFDB 1CE1H 4JFOB 1OTUD 5HXMA 5E7FA 4D9LL 5HVHC 2E3VA 5IBUG 4AM0B 1IVLA 4L8DB 1BQHA 3F62A 5T5NF 1MI5D 3QFJD 2NY4D 4LKXB 2DBLL 3BQUC 3O2DH 1EJ6A 4N8PA 5SWZA 4XVUD 3ZHKA 5E6ZA 4J2XA 4J3TA 3GHBH 1IM9D 5ACZA 4TSCL 5JORA 3D39D 2XI9A 3AVEA 3EDEA 3QPXL 5BS0A 5GZNC 1I7ZA 3PWNB 1ODAA 1IL1B 2R0LL 3VE0A 4O5LL 5C8JB 4UZGA 4W81A 4F58L 4NT6B 5JXAL 1I8MB 3C60C 1QLEL 1QSZA 3BPOB 5DRNA 4KK8D 5EIIB 3SQOH 3MRQA 4HWBL 5JPNB 3GFUA 4YDJB 2FH6A 4HUKB 4O2EB 1N5YH 2IBGA 1OT1A 3VGBA 4FS0A 4HZLA 4RAUB 1D9KB 3T4YB 1H9VA 1KB5B 1KTDA 1GGYA 3I3EA 2XZCL 4MCYA 5E2UL 1RJYB 4PGBA 3P0YL 1W0WB 5J4MA 1NUGA 2X9XA 3MUY1 3LH2H 5DJYB 3NTCH 3T2NL 2YK1L 3I2CH 4PV9B 3MV9E 1J05A 1UCBL 1FO0H 4JPKL 1QBLL 4JB9L 2VNCA 5C1MB 2Z8RA 1WZKA 2EDNA 2ARJB 3OXSB 2X05A 4DKDC 5FA4A 4HSQA 5H37H 4M7LH 1UM5H 4JZOB 3HUJB 5GGSY 3TNNB 4CU7A 2NY5L 5K9JH 4X5WA 2BNRA 4M43H 4Y8AA 2VLRB 1LEGB 4OZ4A 4YQXL 4MD4B 2HTLD 2QKIA 1YEEH 4J3UA 1UH2A 4PRAA 4MXQC 2BSED 4RFNC 1HINL 2GEEA 1R5VB 4WENB 3EJYD 2BY3A 3X14A 1DVFC 3FT4A 3UZQA 4R3SA 1QHOA 1BGXH 2NTFA 5GJTH 4Y16D 5BXFB 4M62H 1MFEL 3TBTB 4LGSB 5HDQL 4PJCF 1FNSH 2ADGB 1YEJH 4RISH 3R0MA 4Z7VF 1P1ZA 2QQNH 3ZDZE 1MHHA 4PJ5E 5CILH 3HC4L 5DK0B 3QBTB 5FK9A 2DOCA 4NPYA 3GMLA 3X13B 4WV1C 4E42A 1B6UA 4IDLA 3ARFD 3X3FH 4Z7OF 1RU9H 2X70A 4TUOB 4ZUUA 3DIFA 3SGJA 1J7VR 5FHAL 1EAPA 1L7IL 2W92A 2EEDA 4AIOA 3O9WB 2A74A 5DUPH 1OARH 2ZG1A 2OYPA 1NBYB 2DQHL 4LLYA 3OKLB 4MD5A 1KPUB 3QWRD 3W39B 3QDGA 1QBML 2B1HH 1L9MA 4P57B 3QHTC 3QIBB 2ZUQC 1AE6L 4OZHF 5MEOA 2VTFA 1DLFL 1ZLSH 4EI6B 5FA3B 1J0JA 3RI5F 2C3HA 1F4WL 3IXTA 1NGPL 5L6YH 4BJLA 8FABB 4Y4FA 1KYOK 1FBIL 4YFLI 1YEGH 3GSQA 1YECL 4YH6A 3BUYB 2F8VA 2HVJB 2XTJD 5ETUB 4Z95L 1TETH 4IRJC 4M02A 3IAGC 3ARED 2NYYC 3MROA 5JPMA 2AAVA 4K8RH 1NCWL 5TH2B 1DBMH 3WNNA 1M7IB 2DQJH 3ZYIA 1OAUL 5T1LD 4TUKH 3L7EA 3VFPB 3KGRA 3DWTA 1X5GA 4BA8A 1MELA 5GS0H 4R0LC 4K94C 3ZE2E 4HCRL 5JW5B 2EIZB 1FV1B 1TVHA 1RIUL 3P9MB 4UILL 3QXAA 4KXZH 3S35L 5SWZD 3HRPA 4WW2A 4RFEA 1TPXB 4N5UA 3RWCA 1OHQA 3CVHB 3RNQA 2DIBA 3GZKA 1OOAA 5IHLB 1ZHLB 2NQCA 1OL0A 5JQHC 4PJ9C 4J4PC 3QB7C 1N59B 4R7DA 2OJZL 3QZWA 1CTOA 1MCLA 5J1AA 4M3KB 1MVUA 3O11A 2HVKB 3GUTA 3AY4C 3SJVB 1CF8H 2XOTA 5CEZH 2R2BB 2ZSVA 4ZSOA 3FQTA 4L5FL 5CFHA 4NQTA 1MRCH 5DDHA 3ZHLA 2AABL 4AENA 4LBEA 4K2UH 2ZNWA 1RAMA 3KLSA 3MC0A 4P0DA 4P4KA 1EZVX 4ELMA 1I8KA 2X4RB 2VUOA 3KNBB 2DM4A 43CAA 2D03L 3GSRA 4MAYC 4JVWA 2JIXB 1FVCA 5LWYH 1PD6A 3CDGB 4JPVL 5D1ZC 1FFOA 4OGXL 3F7RA 5F9JA 4MSWB 4PRBA 2VXUH 3LRSA 1HOCB 1ONQA 5JXED 4KTEL 4WI4A 5DD0L 3BIKB 5FB8B 1KCSH 3ZT7A 2CKBA 3HMXL 3MREA 4JZJC 4XB7A 4CVZB 3AGVA 5DJDB 1GGUA 3FN3A 5JOPD 1IQDB 2JJTA 4G43A 4ZS6C 2NLJA 4HPYL 3RIFF 4FP8L 4Y16B 3NVQA 1OAKL 4XPTL 2XZQH 1MFCH 3MMEB 4ZUTB 4DK3A 3IFLL 4CVXA 3MV7A 4H0GA 5F1IB 1AI1L 2PCPB 4O9HH 4DAGL 4P5MB 3STLA 3MLUL 3CFBB 5ITBL 4G9FA 5CIPB 3C8KB 3EIFA 2DKMA 3C9NA 6FABL 2OL3B 5SX4I 5BQ7B 4APQA 3IT8D 4ZXBD 1NFIB 2VN4A 1DANU 3UBXB 5KS9A 3VWKA 4ONFH 3WN5A 2BVQB 4ZFFA 3LMJH 1BHGA 4GRLC 3HPLA 3RNKA 1FNLA 4BKLA 1F6FB 1NDGB 4U6VL 2GUOB 3DUUB 2NY0D 2CKNA 1J86A 5DO2C 1KENL 3L5HA 4Y8DC 5HGAB 2ZJSH 3QDGD 5DRZB 1FQ9C 4LCYB 2BZDA 2YXFA 5FM5M 2J5LB 1XGPB 4PJGE 5DC9B 3O6FB 4PJDF 4R96B 5HHPB 1FL5A 3DUSB 3TYGH 2E6QA 2C5DC 2CUMA 1D5IH 1X5KA 5GISH 2AQ3A 3L3DB 3KXFE 2BVYA 3MFFB 1RIHL 1KIRA 4HJ0C 4PRHB 4LLUB 2Z8SA 3BP5B 1CFSB 1C5DA 1G9MC 1ZT1A 2VIRB 5LGJA 5EZOH 4MNGE 4IHOA 4Y4FD 3KS0J 4NKOA 2JK5B 2ORBL 5BZDA 4F7PA 1CFBA 2XTJB 4U1NA 2R23B 1AR1C 3PWVB 5IF0B 1MPAH 4O58L 5IK3B 3RAJH 4ZG1A 5F6HJ 4LMQI 5C6WH 2GT9B 3M45A 3CFJA 4RMTA 1AGCA 2RAMA 1OCWL 1U8LB 4UTBH 1RZJL 2QR0B 4IRJA 3V6BR 5HD8C 5I73C 2IAMA 4Z0XB 1X3DA 4KY1L 3GJFK 3WFHA 2CKBL 4I48B 4PJHF 4GG8A 3QCVH 4CJ0A 1SJXA 1Z9OA 1X4YA 3TO4A 3FCTA 5IJKA 4PJBE 5F3BA 1IGFL 1B6DA 1C08A 4R0LA 5ACZB 2F53A 1OAYH 1BQSA 4XNZB 4I3SH 5JORB 2CGRL 5CEZE 1OQOA 1JE6A 3UTTA 4PLJD 3LRGA 2FB4H 4JFZH 5DJ6A 5BS0B 4PBXA 1HYSD 4FQJH 2V5TA 3VE0B 1Y18A 4LVOB 3ULUF 3QWQB 1EV2E 4D3CL 3ULVC 1MJ8L 5HYQA 1JRHH 1UACH 4PJIB 1T1WA 7FABL 3BJLA 3WNLA 2UUDH 5DGQA 5DRNB 5KBNC 1PZUB 4EN3D 5T1DL 2O5YH 1XGYH 3MRQB 5SX5K 1S7TA 2R69L 3D0LA 4JG0H 2WV3A 2FH8A 4U1JA 3MPCA 4WTXA 3VXPA 4MCYB 1ZLWK 3VXRB 2VLMD 1T20B 2IANA 4P4KD 3UAJD 3WHE0 1XF3B 1J05B 1V7NL 2V9QA 2EE6A 4X9GA 2NNAA 4LF3A 3ARWA 1A1NA 3UZEA 4XMKL 4R4ND 5FA4B 3EYVA 1PYWA 3T0VA 3WFEL 5DURD 3NFSL 3QEQE 4MAYA 1FC1A 3MBEA 4X5WB 2BNRB 1NGZA 4HLJA 4OZ4B 3B5GA 5B21A 2BNQE 3SKNA 4JFFA 2QKIB 3E8UL 5TQ2H 2QV2A 2Z0BA 4PRAB 4HDIA 3C5ZB 4WU7A 1XGRA 3FT4B 4KMLB 4WUUD 4LPCA 4GAFB 3TVMC 4JZJA 3UYRH 3WLBA 4P2OA 5DVKA 3QHZH 3SKJL 3LIZH 1BLNA 3MV7D 5DQ9A 5E4IA 4DTGL 1TZHA 1P1ZB 4JKPH 4LLDA 2GY7B 1MHHB 5EH1A 1GC1C 1V3MA 1XMWA 2X4SB 4MJ2A 4G9FD 2XQBL 1JPGB 4NC1E 5FK9B 3S4SA 5J57B 4NPYB 1UA6H 3GMLB 4E42B 4KKBC 1YN6B 4HUVA 2I9LA 3VWKD 4UV4L 3CVIL 3JUYA 1EAPB 2IH1A 2GJ6E 1P84K 2VDRH 4HH9A 3BGMA 4QRSA 5HPMA 2CDGA 2QHRH 3LKOB 4XNMA 1FE8L 2AJXH 4K9EC 3WO4B 4DVBB 4LLYB 3D69A 4QTIH 1WICA 5EU6E 4JO2L 3KPSA 4MD5B 3CUPA 4FABH 3MTRA 4AL8L 3GSNH 1JHTA 1IKFH 4RFOL 1CGVA 4NKQB 5CEYA 2EO9A 4HWEL 32C2A 4TSBL 2BFVL 3NPSC 1NCAL 1ZOXA 3DYMA 3V6ZA 1MFBH 3EGSA 1JZ6A 1A64A 1PDKA 1JGLH 5ESQA 3ZT6A 5I1LA 4FQPA 2OSLA 3IXTB 4JFQA 5CZXC 3IVKA 1SVZA 4YX2H 1P9MC 2LAGB 2J8UA 4Y4FB 3HE7A 1HH6B 3GSQB 4LHQB 4R7NA 2NCMA 3UTSE 1FAIH 4P9ML 4IM8A 5GS2D 3WKML 1INDH 2V9TA 1T2XA 2FEDD 3MROB 5LKNA 3HAEH 5JPMB 4WEMB 3MUHL 4LASH 1I3UA 5T5NG 2G75A 4KK6C 4UINH 2IAMD 5I1IL 5D2LF 1NEZB 4JY5H 4PRIB 4K23L 1YYML 4E41E 1VB9A 4PLOB 3NACL 1P6AB 3TO4D 2BOCA 4YXLL 5TE4H 5HVHB 4B5EA 4GSDL 2YPKB 5KZCB 4HS6B 4WW2B 1IZJA 4RFEB 1QYGL 2JJVA 4RGNE 3RWCB 2ZCHH 5CCKL 5K59E 1K3ZA 3UTTD 4YJZL 5SWSA 1T0NA 1YEFH 1MCQA 2VH5H 5KSAA 4OTXH 4R7DB 1AXSA 3QZWB 4EDWH 4FFWD 4XBEL 3MLWH 3MLYH 5J1AB 1G6RH 5J3HC 1BAFL 3U7AA 1MVUB 3O11B 1ZHBA 1CIUA 3GUTB 5C0BA 4ZTOL 1E4XH 3TIDA 3CLEH 4RWYL 3P40A 4QXUH 2ZSVB 3U48A 4ZSOB 1BVLA 3NH7L 3FQTB 4N9GA 3TPUA 3WD5H 3WS3A 5DDHB 3BO8A 1FG2A 4AENB 4LBEB 4EI5A 4WWKA 1F2XK 2IH3A 3C60B 3MJ7B 4GAJH 3RZCC 3BKJH 1JHLH 1DQDL 4K7PH 4IRZH 3T09A 1I8KB 3TA3C 1JMZA 5JW3H 43CAB 3GSRB 1ZWIA 3I6LE 5C07A 1FVCB 3RVUD 1PSKL 4RMQA 3MNVA 1FFOB 3C5SA 5HJ3A 4HIJA 5JIKA 1DQMH 3LRSB 4LSSH 4UOW1 2V5SA 3MBED 1ONQB 5JW4Q 5FGSA 3IDXH 4JFFD 4ODTL 1OTTD 3MREB 4J23A 4W6XB 3W2DL 1WTLA 3LEYH 4NNPL 4G8GE 4G43B 1FZMA 4U3HA 5EO1B 1CZ8L 4JGUA 3F6IA 1OB1B 1RZKC 4P2OD 2EKSA 3O0RH 4RIRA 3MV7B 5EU7C 1DVFB 4CVXB 5DXWA 5FFLA 3EOYG 3STLB 3JV6A 2CDEA 2PW1A 4G9FB 3OR7A 5ID0A 3C9NB 4K3HA 5JUEL 4APQB 2VLJE 2CK0L 2AGJL 5KS9B 3VWKB 3NIGF 4UU9A 4ZFFB 1T3FA 3HPLB 3RNKB 2QJDA 4QHNA 2GITA 4U05A 4HW6A 4BKLB 4NHCL 3H7BA 4QF1A 4YBHA 3KPSD 1H3PH 2BXYA 4TRPH 3WUWA 4XWOD 5B4MD 1HKLH 5EA0H 4DUWA 5ACMA 5FECA 4YXKH 2YC1B 4X7SL 3IDMA 4DOHE 1FL5B 3W0WE 5F88A 4NQEA 3FOMA 5J6HA 5EBWA 1KEMH 1QP1A 1KIRB 4Y1AE 3FJTA 1E28A 1P7QB 2YZ1A 1C5DB 1ZT1B 5LGJB 5GGVH 2OMBA 4MJIA 3L5IA 3HE7D 5BZDB 4F7PB 3U7YH 4U1NB 1I9JH 3QQ9C 3KPRA 4DGYH 3L3IA 1PG7X 5CGMA 3HCVB 1IGIL 3EO0A 5D71L 1I1RA 3CFJB 1AGCB 4HIXH 1BIIA 3VD4A 1F45A 4E9LA 4IRJB 2OR7A 3WFHB 2MPAL 3ZT5A 4GG8B 1GGCH 2UY7A 3S9DB 3WEXA 2ESVA 4OGZA 4MVBD 5HGHA 3FCTB 1YPZE 5EUOF 5A2FA 3FO0L 4LGPB 5F3BB 1AO7D 4MA1C 1C08B 4R0LB 2F53B 3LQAH 3HFMH 3UTTB 1OW0C 2V2XA 4R8WH 1Q0XH 3MUJA 4XC3H 1VSCA 2WWKT 1WBXA 1Y18B 2IF7A 3GO1H 4PUBH 5HYQB 4ODHL 4PTTA 1TJIL 4RNRA 1FFQA 1T1WB 4PJ9B 1GGTA 3P9WB 4NYLA 4PJCA 1BD2A 4LSRL 4U6YA 3DX9B 3FQWA 1RHHA 4Z7VA 4GJTB 5BJTA 1U8IA 4KXZI 5L7XL 3D0LB 5T3XL 3TWCH 4UDTA 4EI5D 4WWKD 2A1WH 2Y06H 4E0RA 3G04B 4U1JB 3BGFB 3VXPB 5DJ0A 2X6MA 5CSGA 4ONGH 3H9HB 2IANB 4OGYH 4LEOA 4OD2A 5C0CE 4M7ZC 4XVTH 4L29A 2NY5C 3CX2A 2UV3A 2NNAB 4OCXL 1A1NB 4N0UA 2BVPA 4JG1H 3EYVB 4GKNA 4JFXB 1PYWB 3KLDA 3LPWA 4GKSA 5IT2L 4MAYB 1CS6A 3MBEB 5DLMH 2ERJC 1NGZB 5FEBA 5D1ZB 1QSED 4NZDA 1YNKH 2BY1A 1LO5A 4JFFB 1BQLH 2DQTH 4XCEA 2I25N 5C0RL 1YNLH 4M6ML 3VGAC 2ZOLA 3MJ9A 4N90D 4HDIB 4WU7B 1R3HA 1MIEH 5F89B 1XGRB 3U9PL 3BP4A 1MY5A 1CGYA 1CBVL 1RV6X 4JZJB 1KTLA 5E8EA 4P2OB 1F3RB 5F7MC 2R0ZH 3R8BB 2OXHA 3BZ4A 3C8HA 2P45B 2LE9A 1BLNB 3MCLL 5DQ9B 2VXQL 1TZHB 5BV7B 5H37G 4LLDB 1J0IA 4QGTA 5F1OB 2SEBA 1QFWH 3IS0X 4M00A 2Q20A 3UJTH 2X1QA 4FXGA 4NJAL 1W0VA 2EE3A 1CU4L 4BYHA 3NZ8A 1JFQH 3HMWH 1U6AL 2IH1B 3BGMB 2BHUA 4QRSB 5HPMB 5FHBH 2YD2A 4XNMB 3PGCA 4S10A 4L9LA 2Z31A 3QUKB 3BPCA 3D69B 3TV3H 4EUPH 5KVDH 4JDTH 3KPPB 3KPSB 3CUPB 4GRLB 1G9NL 1JHTB 3EO9L 4TQEL 3I02A 32C2B 3AB0C 4KZEH 1JF5A 5GGQH 5C09E 3RY6A 4N0YH 4WY7H 3G08A 3EYQC 3V6ZB 4OZIF 4CMMA 1G0YR 3H8NA 2ZUSA 1U58A 2PO6D 3EGSB 3FO1A 5HGBB 5EZJA 4Z7QE 5IP4A 3TZVD 3QEUA 4G7VL 1CDUA 5ESQB 1F02I 4AH2B 5I1LB 1K4DA 2HMIC 2OSLB 4JFQB 1TZGL 4NQED 4BZ2L 5CZVL 3VXSE 1AQDA 3MXVH 3MCKA 1U42A 4Z9KB 3PP4L 1YA5A 4KI5C 2J8UB 3BKYH 2ZG2A 43C9A 4CAGA 3QISA 3O8XA 5D5ME 3HE7B 3QULA 3HZVA 3BMVA 3FN0L 1UADC 2X4UA 1B2WH 2JKXA 3AFLA 1A1OA 1AC0A 3HB3C 5F8RC 3VMOA 1IGTA 1CIDA 2CRMA 1DSFH 1EFXA 4OFYA 1JZ7A 2VC2L 4D9QD 4QEGA 3WFBH 4L4TA 2G75B 3D48R 4LCCA 4J3SA 3C87A 4K3JH 5MEPA 2BNUB 4P46C 1BZQK 1Y6MR 4LRNL 2N1KA 3VJ6A 1P69B 3BI9X 5I73B 3ECBA 4G6KH 1A7RL 2BOCB 5CBEA 3K80A 3LS5L 1LVEA 3WLWD 4GQ9H 3RIFK 4X4YB 2PETA 5DMGC 1AXIB 1Y6NR 1ULVA 2H1PL 4R2GD 3LKQA 4N1EA 3KHOA 4ZXBC 2Q8BH 2DBJA 5DFTA 4V1DE 5HHXH 5SWSB 1T0NB 1FFRA 3T0XA 1YY9C 5BVJA 1R0AL 3WIHH 5KSAB 1KELL 1AXSB 2OBGA 3MV01 2XRAL 1A6PA 4GOSA 2DYPD 5C0BB 5HI4C 3SDCD 1BD2D 1J8HE 5HHMD 2HT2C 4N9GB 3DI3B 3WS3B 5E8PA 1F42A 1DTUA 1UKSA 4JVUA 2IBZX 2GSIA 4WWKB 4EI5B 2XY2A 1HHGA 2AEQH 3W5MA 1LWRA 5ADPH 4JANB 3MO1A 5E1AA 1ZWIB 1WISA 5C07B 3K3QA 4TNVK 3K46A 3MOAL 4QY8A 3MNVB 4BQ9A 4K3EL 1JRHI 3RDTD 4PRNA 3C5SB 2FGZA 5IQ9B 5HJ3B 2YPLE 4HLZH 3LSOB 1FCGA 1MWAL 2HRPH 4KROD 5JHDA 1KN2H 3RX8A 3HRZB 4IRSC 2N7AA 4X5LA 1TTGA 3MLXL 2HKHH 1ZE3C 1A7NH 5C0IB 2VO5A 2E7BA 1UWEL 4A6YA 4MYWB 3CLFL 3MJGX 5HY9A 1FZMB 2JCCE 4PY7A 2EXWD 5L88H 2FYYB 7CGTA 3MRCA 4LCUA 4GG6F 1K8DA 5C08E 1QRNE 2VUYA 3U36B 3S34H 2AS5M 4XNXL 1HZHL 4RIRB 4OB5H 4JDZB 3ZDYE 2FNBA 3VG0L 4Z8FH 4JO4H 1KV3A 4D0DB 3JV6B 2CDEB 2NW3B 2I9TB 1MFDL 3OR7B 4WGVB 3JBG7 2OZ4H 2ICES 5HDBE 4N0FA 1X4XA 2CH8A 5KN5A 3IAPA 3G6JE 4Y0GA 2B2XH 4UU9B 1RULH 1L9NA 1U8PA 2UZIH 2OK0H 2MCG1 1T3FB 3WMSA 4QHNB 2GITB 5GHWH 5KANG 1NGXA 4M6OH 3S98A 2Z31D 3H7BB 4OM0H 4QF1B 4J1UA 1U41A 4EN3C 2VZ3A 5MI0C 1M7DB 2LABA 2J8HA 1KT2B 3WUWB 3S5LG 4PLKC 2Z93A 1F13A 2IPKA 3GSXA 5FECB 2IFFH 4X4XA 2EDFA 3QQ4B 1AY1H 3UAJC 5F88B 4M8QA 3FOMB 4WI8A 5IVXF 5J6HB 4PGCA 1CFQA 4TTGA 3I2CL 1E28B 5H94A 3D18A 3F58H 4HG4K 4LAJH 3U83A 5DHYA 2JTDA 4MJIB 2WLZA 1P4BH 3O8XD 2R1WB 3CK0H 3OPZH 2IWGA 1RZJC 3C6LC 5JIIA 3KPRB 1I75A 3SBWA 3L3IB 4M43L 4ODSL 4JKWA 5JOEA 1RZIA 1FFPA 4OFYD 1KG0A 1EFXD 5CKGA 4TVPL 4XI5C 1A3RH 1BIIB 4WFED 1OGAA 5DF0A 1XGQA 4DN4L 3V4UL 1BGXL 1B0GA 2E9WA 3OHXA 4G6FD 1I1FA 3PV7A 4M62L 4XP6H 1GZPB 3WEXB 2ESVB 3VXMA 1FNSL 1GSMA 4A6YL 3C2AL 1L0YA 5I1GL 5TJWK 4P46A 4NWUH 2QQNL 1WV7T 5MEND 1T6VN 1H15A 1R3LA 4HQQH 4ZAKC 1QSFA 5KVGH 3N85H 2V2XB 1TCRA 5DS8B 6CGTA 5CP7A 4HWZA 3B8YA 4U0RC 2BRRH 1KPVA 1FZJA 4PTTB 1U2CA 1LO3H 4NQDE 5IVZA 2P5ED 4RNRB 4XB8A 4FQXD 4NYLB 4PJCB 3MLSH 3QA3A 4U6YB 5HHMB 2CUHA 2CXKA 4UB0H 4X6CB 1JNHA 3RUGE 1GCFA 4H1LA 5BJTB 1U8IB 4FQHA 4UDTB 4E0RB 2V9RA 4YHMH 1G6VK 3NIDF 5DJ0B 3TCLB 3K2MC 3DX7A 3QAZC 2FHFA 4OD2B 4D9RD 3MLTB 1ZLSL 2CR3A 3RZCB 2J88H 2IPUG 1J5OH 4N0UB 3V6OE 2BVPB 1N0LA 4LVHC 1I3GH 4H0IA 2NXYC 2KKQA 1OSPH 4GKSB 4Z6AT 2FHCA 3MJ8A 4KROB 4TVPD 1U92A 5GXBB 1S7SA 4OUUA 4MA3A 1LO5B 4H8WL 4XCEB 5FAAA 2RCSH 3ULUL 1TETL 1VDGA 2ZOLB 1ZVHA 1R3HB 5F93C 4X5XA 1IGJA 1Y0LA 2YA2A 3BP4B 3VXTA 4DW2H 3GRWL 1DP0A 2IADA 4TUKL 3ARBA 1KTLB 5E8EB 1UZ8A 3BZ4B 1B3JA 5GJSH 3S88H 1NC4D 4OI8A 1ED3A 3PUCA 4XHJD 4S1RH 4J6RH 4WCYL 2NW2B 2SEBB 4JKKA 4WNQA 5K9KA 4ODVL 4M5ZL 4FXGB 1PX3A 1W0VB 2V6HA 5J13C 3KS0H 1A6UH 3QCTH 3BD3A 1QFWM 1SM3L 1BOGA 5C0DA 5J1TC 4XGZA 2IG2H 3FFCA 2QQLH 3PGCB 4ZOEA 4L9LB 1DQQA 2Z31B 3BPCB 4XAKD 3V0WH 4LLWA 5I1JH 4X4MA 3L6FA 2W9EH 2WNGA 4HIIA 3VRIA 3I75A 3I02B 1CF8L 3MGTA 1RUMH 3PL6D 4O02H 3RPIB 5TF0A 1XR9B 2CXGA 3G08B 3UYOD 1H3GA 1KULA 1KCRH 4CMMB 1F3DJ 5DRXA 3FO1B 4M4RA 5EZJB 1XF4A 4G9DA 3QEUB 1RZGB 1WEJH 15C8H 3GBML 1ZA3A 3L95A 3MCKB 1KPRB 1HN1A 2HH0L 4Z7UE 3BRFA 4LPYA 2CMRH 4DEPC 43C9B 3ULUD 3O8XB 3QULB 3HZVB 4WEUD 1HDMA 2VDKH 1TJGH 1PZ5A 2X4UB 3QDME 4NRZA 4ZD3L 5GGUA 3HPJB 3H0TA 1FGNL 1A1OB 1VENA 4GW5B 1IGTB 3CU7A 1EZVY 4WTZA 5CJBA 1B4JL 2BJML 4K7FA 1IC1A 2UY6A 4L4TB 3T1FA 2FD6L 1OGAD 2IPUK 4Y5XA 4LCCB 4M1DH 4MCZA 5MEPB 1G7HA 1MREH 3KLHD 3VI4E 3HNTH 4YC2C 3W11C 3PQYA 2FIKA 3VJ6B 1KCVH 4IIQA 3ECBB 2X09A 5C0AA 3VXMD 1WZ1L 2UUDK 3EJZD 5CBEB 1H5BA 4KFZC 4O9HL 1IZKA 2BVTA 4PJXF 2ITDA 3CAFA 5DSCA 4DVRL 3LKQB 4JFHD 4FQLH 5GGTH 2XA3A 5D2NA 2DWEA 1QSFD 3OJMB 1X44A 2ED9A 2NY2D 4N0RA 5E70A 5GSVA 3S37X 2NZ9C 1UWGH 3AMLA 3HAEG 2DM2A 5BVJB 4ONFL 4MA1B 5AD0A 2D9CA 3IKKA 5FUZH 2B1AH 1V3JA 5B8CA 4KZDL 4OLXH 5J11C 3K2UL 3BP6B 1A6ZA 4RGMB 3AAZA 2WUBL 4AQOA 1YJDL 5DYOA 5E8PB 1QR1B 4KRPD 2ZJSL 2EDTA 4MQXC 3BKML 5CAYB 4JFDB 1G7MB 2X1OA 3B9KC 4NSKA 1KIQA 3TN0C 5LXGL 3MO1B 5E1AB 5EFIB 4JKMA 1D5IL 1HIML 3DX8A 4OKVA 3U0TA 3CIQA 4QY8B 3JWDC 1IBGL 4YDLB 4ALAH 2FWOB 4PV8A 5E9DA 3TESA 2GKIA 3QXVA 5DD6A 3TFKD 4M7ZB 4I0PD 4LQ1A 4MHHI 1Q9WB 5FUCE 5I8OH 1A3LH 4Y4KA 5JHDB 4KKCD 1NLDH 3PDOA 4IDJL 2XWBA 3RAJL 1MIMH 1QZ1A 4TOYL 4DGVH 3L3GA 2UVEA 2KPNA 4PB0H 2AJVL 2ERJB 4U1SA 4HAFA 3KWWB 4S2SA 4A6YB 2B39A 4PY7B 3MRCB 2PTUA 2PR4L 4LCUB 1K8DB 4UQ3A 3VGAB 1IEAA 3ARBD 3MV11 2AEPH 3O6KL 4HXBL 1QLRA 2DQFA 4MVBC 5ALBH 2Q87A 3EYUH 5IB2A 4ZQKA 3RVXC 4OV6F 3BKCH 3JWOL 1INQA 3QDJE 2W9LA 5D1QA 5SWQA 5CKAA 3VA2C 4OGAD 4ONHB 1AR2A 2R2HA 4J7RA 4N0FB 4G8EA 1CG9A 5KN5B 2P7TA 4QKXB 2A9NL 4YWGH 4HK0A 1U8PB 5FKPA 1QG3A 5I30L 2Z9TA 4JFZL 2O5XH 1U8OA 3G9AB 3NBNA 4AMKH 3FFCD 4OV5A 1NGXB 4LSQH 1JRHL 3VMNA 5DEGA 1U3JA 4I5BB 4J1UB 5EBMA 3N1PC 3DXAD 5KG9A 1ND0A 5L0QB 1P6FA 2YRPA 4HS3A 5IKCB 3FZUD 1XGYL 2Z93B 4LAQL 3GSXB 2IPKB 3M8OL 2LU4A 1Z0MA 3C09C 2Y1VA 2GTZA 4G7YH 3I9GL 4FFVC 3TT3H 2BK8A 4X80H 3MNZA 5KSUA 2NY3D 4M8QB 1W2KT 4PGCB 4MJ5A 1CFQB 5H94B 3D18B 4DZBA 1J9CT 4KQ4L 5DHYB 1F8TH 3D5OF 5CGYD 1JYXA 4LOUD 5TF1H 1L4IA 3DURA 1T1YA 3A6OA 3PHOA 3EOAA 4Z7WF 1HILA 1INEL 2V2TA 1Z3GL 4HBCH 3MUGA 5F96L 2ILLA 4NCC1 1JNNH 3HC3H 4PJEE 1HWGB 2AJUH 1RZIB 4RMWA 5GRJH 1FGVL 4OD1H 1CDIA 1FSKB 2OI9C 1OGAB 3SHSA 1A4JA 4X7EC 5T5FL 5T33L 1XGQB 2H8PA 4P5TA 1B0GB 1WFOA 3OHXB 2J2ZA 1U0QA 1I1FB 1ZGLM 1RMFL 4LDOB 3PQYD 4NQVB 3GIZL 2VDML 3NCJH 3FB6B 3OKNA 1RJLA 1LO0H 4XAWH 4MXVF 3ZO0A 1T7YA 4P46B 1U3HD 4LSUH 1QBAA 2VZVA 3IDYC 4X83A 5F9WC 1DL7H 3S3SA 1R3LB 4PG2A 3T4AA 1QSFB 5EOCH 1UA6L 4N8VG 4PJ8D 4Z76B 5E1HB 1TCRB 2IQAA 3EDDA 2Y25A 2DM7A 5B22A 4ZO6A 2WZPD 3QQ3A 2V2WA 5FYJH 5CP7B 4HWZB 3GKZA 1KPVB 1KJ3L 1NAKH 4S0TD 1RUQH 1U8MA 2QHRL 5IVZB 3LRHA 4G6ML 1MCEA 4BSVA 4FZ8H 4OQTL 4B7IA 1NANH 3F7YB 1NCCH 2A6DB 4FABL 3OR6A 4HPOH 3GSNL 1U8KA 3VFVB 4G6JL 5BVPH 1IKFL 5DEFA 3UMTA 1FNAA 3LVEA 12E8H 2MMXA 4OCYL 1MHCB 1JYWA 4ZDHA 4KJPC 1JZ8A 1FZOA 3CVHH 3DTXA 4LCIL 2HWZL 1CDYA 4U1IA 4X8XA 1NEUA 2JELH 5CWSA 5E9DD 1EVUA 3VH8A 1XF5A 5ANME 5JDJA 3MJ8B 1LP9F 3ZSTA 4MHHG 1S7SB 4OUUB 4GS7B 4QNPF 4Y4KD 4MA3B 1BZ9A 4WFFE 4U6HB 1QSVA 1U2HA 3R4DA 4KJQD 3PG2A 3ELAT 3D85B 2YKLL 1DN2A 2Y07H 4QRPE 4XVSL 2EH7L 4OZIA 1IGJB 1GGBH 1Y0LB 1J18A 2DQIL 3VXTB 3RGHA 4IRSB 2IADB 4FMFA 2AXGA 4GAYA 1G7IB 4QHKJ 1MJUL 1NBVL 1AP2A 4QRRB 1UZ8B 3PP3H 4JY5L 5ADOL 1FN4B 4LSVH 2N56A 3VFSA 1KB9J 3O3AA 1I9IH 3MLZH 5K9KB 3C2SA 4LPVA 4P5KB 3OV6A 2V7NA 3FMGL 3H9SB 3ARXA 5IMOA 3MRRB 1EFQA 1M6OA 2ZCHL 4XPFL 5HYJD 5LJYH 1BOGB 5C0DB 1A1MB 1YEFL 3FFCB 4OTXL 2DBLH 4GW4A 5K93A 3K7UA 1DQQB 4NO0A 3MLWL 3DROB 3SGEH 4LLWB 3KHQA 1G6RL 4Q6YA 3SDCC 3NCFB 1G7LA 3VW3H 4HIIB 1JNLH 3STZA 3VRIB 1DN0A 4TSCH 3CLEL 4QXUL 3MGTB 3WDIA 5I17A 2AJ3A 3QPXH 3WD5L 3X12A 3QUMA 1H3WM 2R0LH 5CSBA 4O5LH 2OL3H 5DRXB 2ZWLT 4F58H 1XF4B 1JHLL 4OUOA 4IRZL 5JXAH 4K71C 5JW3L 3HUJF 1ZTXL 1X9QA 2X10A 3L95B 3IKCA 1OY3B 4HWNA 3ARDA 4UT6L 2BC4B 4L1DA 4FTVB 3WDHA 1V05A 2MCPH 1GIGL 1PZ5B 4EUPG 5CSZB 1CLZH 2XZCH 5GGUB 4Z7NF 4TTDD 5A2KH 5E2UH 3H0TB 2YD3A 3P0YH 3RL2A 3T2NH 2YK1H 2DKUA 4K7FB 2D4DA 1QBLH 1NL0H 4G8IA 3C6LB 2BOBA 3T1FB 2EXWC 4Y5XB 2IMMA 4MCZB 1G7HB 1CD1A 3BH9A 1VFOA 3PGFL 4P5TD 3T8XA 3PQYB 3GI8H 2E7LC 3V0VA 2FIKB 4YQXH 2BVOA 3Q5OA 5C0AB 1OGTA 3O0RL 1H5BB 1MCBA 3NA4A 3ZTNH 3P4NB 1HINH 4U3CA 2ITDB 1MCPL 5EOQH 4BQ8A 3MRDA 5DSCB 3CFKA 3VFTA 4X6EA 1MI5E 1QACA 4MQTB 2W38A 3QFJE 5D2NB 5F9OL 2DWEB 1E4KA 1F4AA 2QADC 1MFEH 5HDQH 2VDLL 4QRTB 5GRWA 4ZFOA 3KYMA 1JMXA 5AD0B 1T03L 1UG9A 4DUXA 5B8CB 4ESKA 3D39E 1OP3H 4GG6A 4XCCL 1LK3H 3HC4H 2VLKD 1A6ZB 4HFUL 5KVFL 3BRDA 1YEDA 3AAZB 4B0MM 4U0RB 3RA7L 4EQ3A 5DYOB 2E8ZA 2BVEA 3CFDA 3MBXH 1MCDA 4N1HB 5CP3H 3GMMA 3GBNH 5IMLB 1HKLL 1JP5A 3KLAA 2XXCB 4W4NA 4JRYB 2H9GA 4QTHA 4NSKB 1KIQB 2DQHH 4BSWB 3DX8B 4OKVB 3LHPH 2C1OA 3VWJC 1KEGH 1HEZA 1I7TA 4NDMA 5I71B 5CS7A 4XXDA 4PV8B 5E9DB 3QAZB 5DD6B 3T0AA 3P2TA 3C5JA 5L2KB 1QBBA 5I1KL 4Y4KB 1KIUA 3PDOB 1DLFH 2NXYB 4POYA 1F4WH 3L3GB 5AAWA 2IC2A 3PXHA 3IETA 4U1SB 1CD9B 1NGPH 1UH3A 3GMPA 4S2SB 4HGWA 5D7KD 3LD8B 4HIXL 5I0DA 4QYOB 3UP1A 3ARGA 1FBIH 4HUUB 4PJFB 4UQ3B 1TQCB 1YECH 5IVXA 1IEAB 1CGSL 1FIGL 1D6VL 2VQTA 1QLRB 2DQFB 1FVDA 3LPGA 4MMZC 5IB2B 4ZQKB 4HLZG 2F15A 2EDOA 5E2TL 5D1QB 5SWQB 4D0CA 3JXAA 1OAUH 1IC5L 1MJ7L 3O41A 2R2HB 4BK5A 4G8EB 1CG9B 2CRYA 4QHUA 2H3NB 4HK0B 3UTQB 4U0QB 2DLFH 1S7WA 1U8OB 5D6CA 4KKAC 3BWAA 5BO1H 5J13B 1RIUH 4UILH 1PLGH 3KPOA 3T3PF 3S35H 5EBMB 1XZ0A 2G5BA 5KG9B 3MRMA 1ND0B 5CINL 4P4RA 1SY6A 4HS3B 3U7WH 1I1AA 1RURH 3KPTA 4RA3A 2VZTA 4X7FC 5EORH 2GTZB 1LDPH 3CSYB 4WI6A 1PJ9A 2AK4A 2P8MA 3MNZB 5KOVC 1XEDA 3G5XA 4MJ5B 4X9IA 4HGKC 4F9LC 3QEGL 3S3JA 3GSUA 5IROC 3LKRA 4DZBB 1UXWA 4L5FH 1JGVL 3ARDD 1U8NA 4JG1L 3T3MF 1OF2A 3DURB 1T1YB 4M6AA 4JM2D 2DI8A 1HILB 5DLML 1VHPA 4GRWH 4ENED 2V2TB 3A67H 4Y2DA 1YNKL 1UM4L 5BW7A 4R90L 5C70A 4KMTL 1TVDA 1YNLL 4KWUA 5CGTA 4JN2A 4OGXH 1A4JB 2XTJE 1MIEL 2H8PB 5ALCL 2HP4A 3O2VL 4XVJH 3F7QA 2X4QA 3CDCA 1KJVA 4KTEH 2MQCA 2R0ZL 3SDAC 3MODH 2NY1C 3OKNB 1RJLB 2RFXA 4AT6A 3I84A 3RKPA 3CSBA 3HMXH 4YC2B 2NR6D 3L5XL 2FBOJ 4J8RA 2Q3ZA 1OAXH 4WO4C 5CJXA 4NCC2 3T4AB 4HPYH 2P24B 4FP8H 2PXYC 4GT7A 2XQYG 4C83A 2IQAB 4KTYA 2E8YA 3QQ3B 1QLFA 4S1DD 2V2WB 3DGGA 1AI1H 5SWZE 3T0ED 4GMTL 4HKZA 4DAGH 4P99A 1IM3B 4AYFA 5FHBL 3MLUH 3L3KA 5ITBH 3VDBA 4BSVB 6FABH 2HN7A 5ABDE 3ARUA 1NBZA 4U2YA 3OR6B 3PL6C 1U8KB 3TJEL 3NFPA 5KTEL 2VERN 1EGJA 3SE9L 3R06A 4JQVC 3V7MA 3K8KA 3D2UA 1RUPL 4WY7L 1FZOB 3O4OB 4PRPA 2NX5B 1A9EA 3DTXB 4U6VH 3Q5YA 3H9YA 1RPQA 2VISB 1KENH 4U1IB 3MXVL 2R4RL 1SHMA 1AD0A 5I6XC 5CWSB 1LDSA 5IFJA 3LPFA 1XF5B 3VWJA 2X1XR 3DNKA 1BFTA 4K8RC 4NQXA 1SYSA 1J88A 1BZ9B 2YEZA 5INCB 5KVMC 5DJAA 3QFDA 1S78C 5B39G 5C0FA 2WIIA 1RIHH 4UMGA 35C8H 1KJ2A 2VL5A 1DE4A 4AY0A 1EH9A 3QUXA 5F1NA 3VXUD 1J1OL 5GS0C 3INUL 4ZUWA 1EEYA 2ORBH 3ARGD 4Q7DA 3KLHC 4GAYB 1MF2L 2YPVL 2FJHA 4HFWA 1AP2B 1NMCC 1FYHB 2YZ8A 3PWPA 5ID1A 4O58H 3NFNA 5EZIH 1CXIA 5JOPE 3LY6A 4MS8C 3QNYA 4NUGL 5C08D 2A83A 2R2CA 3O3AB 5CBAB 1OCWH 5FGCB 2M2DA 2K9UA 4GQ9L 1BF2A 1T5WA 1DQLL 2V7NB 4X6DE 1BWWA 4KY1H 2MKWA 5IMOB 2CKBH 5D96C 1DLHA 3IDNA 4PJIF 5HHXL 2QLVB 2F8XC 4R6UA 3HR6A 2PTTA 1MNUL 1RUAL 3TNMA 4BELD 5E56A 4XTRD 4NO0B 1SEBB 1Z5LA 1G7LB 3STZB 4I2XB 1DN0B 2CGRH 4L4VA 2R2EA 5I17B 1FYTB 2AJ3B 4CU8A 2R39A 1HWHB 4FMKA 4JQIL 3DX6B 2I5YL 1I1AD 4PJXA 3QUMB 1T21A 4CNIA 4Y4HC 3QO0A 5KSBF 2AEQL 2AV7A 1A2YA 1Q38A 3GM8A 4GRWE 3QUZC 2AK4D 3QDGE 3RIAK 3C09B 1BPVA 3NIFE 4YHIA 3RHWK 1NCBH 3IKCB 1F90L 3MV8A 5T1DH 1BM3H 2R69H 3SCMC 4I0PC 5HHOA 4XMLL 2H2PD 2ZUUA 4F9LA 3ZKMC 2IBZY 1DBBL 1KTKE 3O2WH 3RL2B 4UBDD 3FRUA 1C12B 4Y2DD 2Q7NA 3V6FA 3SDXF 1V7NH 4G8IB 3O3EA 1A7NL 2BOBB 2DDQL 2HT4C 3JZ7A 3UXFA 3NFSH 3GBLA 1W72A 1CD1B 3GKWL 3BH9B 4HHAA 1S7QA 3QXDA 2BVOB 4DKEL 2OI9B 4KKNA 3S34L 4LVEA 1BOYA 4JE4B 2PNDA 4EKXA 3Q6FA 2ZUXA 4Z8FL 4JO4L 2GQHA 2W0KA 1IAKA 2BCKA 5GS2H 3CFKB 3VFTB 2PYEB 1NFDF 4J12A 5E5MA 1JGDA 3L3JA 1M05A 4BFEA 1J0YA 1S5IL 3SKJH 4NJ9L 2B2XL 5F9WB 4NC1C 4ZFOB 2UZIL 2VR5A 5DK2A 2OK0L 1C16A 2A0LC 2H2SD 1FC2D 4KJWD 4DTGH 1PKQA 1ZT4A 1L0QA 4GG6B 3DJ9A 5GHWL 1CLCA 5D7LA 1XIWA 4W4OC 4OM0L 4N0CC 4XMPH 4F8TA 3CFDB 3GMMB 3PXJA 1QEWA 4UV4H 5I1CH 3KLAB 1B90A 3U4BL 3WO3B 4QTHB 2H9GB 1KC5H 1FE8H 4PRPD 3SO5A 3W82A 4ZSOE 1J10A 4JHWL 2C1OB 3ROLA 1HEZB 5GPRA 1J8KA 1I7TB 4AL8H 4NDMB 2E5EA 4RFOH 4TSBH 2BFVH 2VLME 1F4XL 5D1XC 4ELME 3UCRA 1LO4L 1G7QB 1PAMA 1EO5A 3C5JB 3OPZL 5F1KC 4M93C 2HFGL 1ZXQA 4BQCA 5E99L 2H32H 3MLVL 4GBXD 4NBZB 5I15L 4XP5H 3DUHA 5D72L 5JZ7D 3GMPB 4Y5VC 3RU8L 4HGWB 1DEEA 4FXKB 3H7LA 2M8XA 1JJUA 5FKAA 2EC8A 3QIUC 2YD8A 5IVXB 3C6SA 3KYAA 5DD1L 5E94A 1CICC 4P9MH 5LQBL 4B53A 3G5ZA 3PWPD 1FVDB 4KV5F 4WW2F 3V4PH 4ZNEE 3EYSL 4WHYH 3IDIB 1I9EA 4WUUE 3NCEB 3HNVL 4YUEL 4NWUL 4D0CB 1V3KA 4F15C 3O41B 4P23A 3E6HA 4KUCF 4ODXA 5C0EA 3VGGA 2R9HC 2VOTA 3MV7E 3UPRB 4QHUB 3HE6D 3N85L 4K23H 3H42L 4MNHA 1YYMH 1S7WB 2EYTA 5E08H 5D6CB 4RGNC 4G9FE 3BWAB 5CZKA 3O6LH 2W91A 4TULL 2ED8A 5KS9E 3KPOB 4GSDH 1LO3L 1TJHH 3VI3F 1QYGH 2G5BB 3QEHB 1PG7H 3SN6N 1T7ZA 3MRMB 5DFVD 4HXAL 5DRWA 2VR4A 4L4VD 4P4RB 5BV7H 1JHKL 1QOKA 1I1AB 2XNAA 3ET9F 4OFDA 4QOKA 4QXGH 4TNWK 1MJJA 1G1CA 4YHML 3PWUA 2AK4B 2P8MB 3BEWB 4P9HL 1BAFH 2H6PB 2NTSP 2YOCA 5T3ZL 4ZTOH 3G5XB 4GXVL 5B3NA 2HKFL 3GHEL 1UXWB 4IOFD 5DUML 1OWWA 4PIRF 3WNKA 1WQVT 3MV8D 4N8CL 4P49A 5D8JL 3V4VH 4OT1L 3QUZA 4KKLC 1J5OL 1U8NB 1OF2B 1I3GL 4K71B 3EYFA 5HHOD 2E9BA 5KJRL 1R24A 5J9PA 1DQDH 3OKMB 3DMMA 2HFFA 3RWIA 1OLLA 3B83A 1N0XH 3SCMA 1RZFH 5HHQA 2UWEE 4FHBD 3MRHA 2NY6D 2RCSL 5FYJU 1PSKH 1X5HA 4JN2B 3TJHD 4PFEA 3UBXI 4X98A 3V2AR 3JV4A 4CUCA 3QEQA 3RGVA 4DW2L 2X4QB 1X5YA 1KJVB 1N5AA 1CFNB 4JFED 1Y6KR 5IMKA 2RFXB 2A9MH 4O00A 4AT6B 3FB5A 1NLBL 4Q0XH 4I18A 2EYRA 1LP9A 3W2DH 4S1RL 1N64L 4J8RB 4J6RL 3S7GA 4H26A 4OBSA 1WIUA 1CZ8H 1H0DB 1KIPA 3V79C 3ZE1E 1MLCA 1A6UL 1QLFB 4AM0A 3MJ6A 3DGGB 2QADB 4PJ5B 2WBJA 3UTTE 5JUEH 2HN7B 1TLKA 4CU6A 5D7LD 2CK0H 1NBZB 2HT3C 1NPUA 4NZRL 4LL9A 5E2VH 2YS4A 2R15A 5T3ZD 4KGLA 4O02L 5L8KB 3R06B 3RP1A 4NO3A 3D2UB 4NQCD 3BOVA 2V7HB 4PRPB 4W6YB 4CL7A 4NHCH 3O3BA 1MAJA 5F72S 5ESAA 3G6AA 2E9IA 1AD0B 1HNGA 5IFJB 2B5IC 4Y5YA 3VWJB 4YDJA 4Q9RH 2AJZA 5BOPA 5DTFA 5HYSA 4X7SH 4NQXB 5CJ8A 1SYSB 3MX0A 2YEZB 3B2UD 3VXOA 4O4YH 1SBSL 3QFDB 4LEXL 5C0FB 2WIIB 2X42A 3LN9A 4OJFL 4ETYA 1BZ7B 1KJ2B 3E6FB 4MXWH 1DE4B 3QUXB 4S0SD 4ZUWB 3VD3A 4M1DL 3UTSA 5EU3B 4JFFE 4JZOA 2FJHB 1MREL 4HFWB 4LSDA 4Y5VA 3TNNA 2YD4A 3VMPA 5ID1B 3HNTL 2VZ1A 1VEOA 3M1BA 3NFNB 5IW3A 3I3DA 1MAKA 3OKOA 4XNQA 3SE4A 1IGIH 1MCWM 4CDHA 1A4KA 3QNYB 5D71H 5AG9A 2A83B 2FLBT 5JIHA 5GRXG 4UT9L 1T5WB 1D6EA 4ZPVA 4POUB 4F9PC 3X17A 4DK6A 3UPCA 2QQKH 2MPAH 1DLHB 1M1SA 3IDNB 3T65A 3VCLA 3D9AH 3RVTD 1D7FA 4L3EA 1AGBA 3TBTA 4PBVC 2ADGA 2PTTB 2EEBA 1F6LL 3TNMB 2B1AL 1KN4H 1O7SA 1FG9C 3OF6A 4L4VB 2ZPKH 1EO8H 3S97C 2R2EB 3X13A 3QRGL 5K9OA 5FM8A 4BFBD 5B38A 5DFWH 2VLLA 3MNWB 3SOBL 4JN1L 3CDYA 1P84J 4A2MA 4L3CB 1T21B 4QOKD 4CNIB 3QO0B 3GMRA 4PD4K 1A2YB 3KPSE 4ODHH 2AV1A 1TJIH 2APFA 2YUXA 4YHIB 4LSRH 3OQ3B 1FO0B 1KCUL 3MV8B 3QPQC 1NQBA 1KPUA 4P2CG 4ALAL 2VQ1B 3IF1A 5L7XH 1D5ZA 4G42A 3DSNA 2EXYC 4LRIC 3IDJA 4TYUA 4OSUH 2EC9T 5HDOA 1EJOH 2C3XA 3FRUB 1NLDL 3DMMD 1NCNA 2VKWA 1MIML 4TUJB 1LD9A 4PB0L 3O3EB 4KRNA 3ZYOA 4ELKA 4ERSL 1UC6A 4YZFE 4PY8J 5B3JF 3HHRB 1KB5L 1W72B 2D7TL 5IT2H 3UBXG 4HHAB 1T2QH 4FFYL 1FH5L 1S7QB 5D7JD 3RGVD 2Z8WC 3QXDB 4XPBL 3QUYD 2WINA 4G80A 5ETUA 5ALBL 1AKJD 1SEQL 3Q6FB 3ZYZA 3GI9L 1IAKB 1R3IH 3E1F1 2BCKB 3SDAB 3U9PH 4G8GA 5E5MB 1JGDB 3L3JB 1WCQA 1M05B 3VFPA 1Z9MA 1MLBA 3QH3A 1WT5C 3QCUL 4JQXC 1R3KA 5DK2B 1C16B 1AO7E 1DQTA 2E9JA 1A7BA 2O5XL 2VXQH 1PKQB 1ZT4B 3WXWH 1ZAGA 1EX0A 5JW5A 4AMKL 1MHPL 5ACLA 2WBJD 1FV1A 1XIWB 4KGJA 1ZANL 5SWSE 2FATL 2OX5A 4NJAH 1KCKA 4X6BA 5I66A 3I6GA 1SMAA 1UM6H 1QEWB 4CW1A 2ZP0T 1AC6A 2Y6SD 2YUVA 4XRCB 3NCCB 2J8UF 3P77A 3HI5L 1T83C 4LPWA 2BXZA 3RVVD 1G9NH 2R56L 3WS6C 3BT2L 3EO9H 4TQEH 3SJVA 4LHUA 5DZOA 1F8TL 4PJGB 2ZKHL 4JM2C 2DI7A 5TF1L 4WU5A 1BQHG 3VFOB 2MHAA 4NRYA 1FCCA 4G7VH 2C1PA 5CJ5A 4RBPH 5FYKL 3SKUD 4HBCL 2FIRT 3KNBA 1JNNL 3OZ9L 1DEEB 5GRJL 1D5MA 4MNGB 5FKAB 1A14L 1U8HB 3O6ML 3FN0H 1NGQL 1IE5A 4KK5D 1N2RA 3C6SB 2AJSL 5E94B 5D7IE 5TE6L 1D5BA 4N90E 5LGHL 2VXSL 4U1KA 5IMMB 2KH2B 2VLRD 4TSAH 3BIKA 3VFUB 3LQAC 3Q6GH 2HLFC 4G6AD 2VC2H 4AEHH 1NMCB 5IEHA 4NNYA 3H3KA 3JTSA 4P23B 2VQUA 4ODXB 5C0EB 3DV4A 4PP1D 5F7WC 2R29H 4YHYB 3VRLE 2E7MA 4LRNH 3DVGA 4MNHB 2EYTB 5GZOC 1CT8A 2COQA 5F6IC 4L3ED 3U2SA 5DVMA 5A3ID 5FYJL 5MERB 1G7JA 3VG9C 3ULVF 3LS5H 1ZKAA 1NAKL 5HHVL 2DMCA 4XPHL 1Z9LA 3G5YB 4POZD 4ZO9A 5T1KA 3C8KA 4U1GB 5DRWB 1N8ZB 2DIJA 2QL1A 3OF6D 1NCCL 2Q3AA 4HPOL 4S1SH 4PJAF 1FHGA 1R0AH 4QOKB 1EPFA 1KXVC 3IDGA 4MLIA 1MJJB 4LMQE 2XRAH 3PWUB 1CI5A 3O9WD 1NCDL 4LSTL 3CVHL 2OCFD 4MDJA 3QI9C 1U3ZA 3DUUA 2DJ4A 2ZUYA 3QUZB 5HGAA 4U49A 5FYKD 3QDAA 3EYFB 3QIBD 2WANA 4NQEE 1XGPA 4IOSD 3GM0A 4YHPA 3DMMB 2HFFB 3RWIB 3SCMB 3LZFL 5HHQB 3WJLC 2ZCKL 3MRHB 1MUJA 5F7YC 4MJIE 2A77L 2XN9A 4K3EH 1HXYB 4MB3A 1TTUA 3T0DA 4X98B 3BP5A 3JV4B 3KPRE 3QEQB 3RGVB 1WIOA 2JK5A 3WFDH 2WUCL 1MWAH 1U91A 1OP3K 4D9QE 2ZUVA 5IK3A 3JVGA 3FB5B 3D3VA 4HK3J 4LIQL 1HHJA 4HUMB 4I18B 1UWEH 2A6KA 1T5XA 3CLFH 4H26B 1I9IL 1CFTA 3MLZL 5DVOA 5LCVL 5FYJD 3RJDA 4GKZA 2D4FA 1KIPB 2EEAA 4Z0XA 1IC4H 1MLCB 2BX5A 3AM8A 4I48A 4XNXH 1CD0A 1HZHH 4KK9C 3BRGC 3VG0H 2F5AL 1FRGL 2WBJB 4CRPA 1MFDH 2EZ0D 4ORGA 1I85C 1CLOH 3MRNB 3HLAB 2AK1H 3VW3L 4UOW0 1JNLL 1ZK9A 3MRLB 4ZNCD 4CN6A 2GJ6B 4NO3B 4XP1L 5DJ8A 4I77L 4PJCE 1BD2E 5IHBA 1J1XL 2OL3L 3ILQD 5HHME 3O3BB 4PJIA 4Z7VE 5ESAB 2GI7A 4K3GA 3VXQA 3G6AB 3LEXA 3SJVD 4DQOL 5C09A 2H2PC 4Y5YB 4LHUD 2AJZB 4ZUVB 1NAMA 3DSFL 5DTFB 2MCPL 3WS6A 4Z7OE 5HYSB 4YEEA 3FQXA 3QYCA 3TPKA 1DDHA 4C58B 2JB6A 4DUVA 1CLZL 2DB8A 3VXOB 3CC5A 4YO0B 4JGMA 1X7QB 3VXRA 4N0UE 5GRUL 1T20A 1NMAL 4GMSL 1XF3A 4FFZL 1NL0L 1LHZA 2JIXD 3RTQA 4LPUA 5KSBA 3EZ8A 5IWLA 3UTSB 4XXCA 4Y5VB 5DVLA 4L8SA 4CDGC 3LKSA 1BEYH 3GI8L 3M1BB 4ODSH 3QSKB 4OM1L 1X5AA 5I1EH 3OKOB 1KLFA 4OZHE 4XNQB 3QZWG 4OIAA 1A4KB 3QIUB 3LB6C 2C4XA 2F54A 3IJYB 4TVPH 4OZGF 3ZTNL 1ADQL 3C5ZA 3NABL 1D6EB 2GHWB 4ZPVB 5EOQL 3AXLB 4DN4H 3V4UH 3UEZA 1Q72H 3SDXA 2W1NA 4I9WE 3T65B 3VCLB 1K5NA 4L3EB 1AGBB 3N1QC 1R5IA 1BVKB 4A6YH 1G0XA 3C2AH 1X5XA 5I1GH 4KAQL 2NXZC 4X6CF 2XV6B 1LK3L 3QG7L 3TYFA 2X4SA 1CGUA 1JPGA 5JR1L 3B8SA 4V1DA 1YN6A 5K9OB 3MBXL 5B38B 4Y2OA 1UJ3C 2VLLB 1A6AA 2ADFL 3GBNL 3VGEA 3DLQR 1R5WA 3GMRB 4YIQB 1NFDA 1I3VA 2AV1B 1HHHA 4HJJL 3LKOA 4Z5RB 5C6TL 5FDWA 4LNRA 5FF6A 4D94A 4DVBA 4HKBA 1J8HA 3O3UN 3LHPL 1KEGL 5J12C 3IRPX 1MCFA 3IF1B 5C9JA 3NAAL 1D5ZB 4G42B 4PB9L 2C3VA 3QI9A 3OB0H 3IDJB 1KBGH 2PF6A 2CO6B 3V6OC 3E3QE 3O6FD 3WNMA 1YUHA 5IW6B 2XICA 5JZ7C 2A6JA 2KZWA 1LD9B 1MHEA 4ELKB 2ICWA 1NAML 1VGKA 1BIHA 2XN9D 4PRHD 3CMOL 3ARRA 1G0DA 1HH6A 2FBJL 1EUTA 2ZSWA 5F8QC 2WINB 4G80B 2PW2A 4UIKL 4N5EC 4WFEE 4H8WH 4L4TE 3ULUH 1HSBA 4R97C 2XKNB 3D3VD 3CPLA 1CDBA 5MP6L 4G3YL 4G8GB 1T7VA 3FL7A 2JCCA 4YLQT 4F57L 3GRWH 1RHFA 1QRNA 3RVWC 3U79A 1MLBB 4PGZA 3QH3B 1NEZA 4PRIA 3BE1L 4YPGA 4M9OA 1R3KB 3FOLA 5MENE 2DLFL 4PJ7F 1PW3A 1UZ6F 4FQCL 3EAKA 4K7PX 2X4OA 5BO1L 4WCYH 3B9DA 3CNKA 3VGHA 4EUPA 4ZTPL 4ODVH 3MXWL 4NM8L 1PLGL 2YPKA 4M5ZH 5A2LH 4HS6A 4X6BB 2OQJA 5I66B 3QG6A 3I6GB 5E95B 3BQUA 1TXKA 4CW1B 3U7WL 1SM3H 3VFMA 3P4MB 2ID5A 2P5EE 1HNFA 1RURL 5IIEA 1I1CA 5BS0D 1ZHNA 3GNMH 5EORL 1LDPL 2HJFA 3P77B 1C5BH 5DWUL 2IBBA 3MRJB 1Q0YL 1F00I 1F4YL 3BEVB 5E5UB 1N6QH 5C92A 3FN9A 4OF8A 4LHUB 3I6KA 4D9RE 2B7DT 2O5ZL 5IV2B 3C60A 4WU5B 3MJ7A 4DOHB 2MHAB 4NRYB 3QJHA 4AQ1B 2C1PB 4M1CC 2A2QT 3FHAA 2B5IB 1HI6B 3A67L 4W6WB 2WWMD 3VXRD 4H1LH 4KRLB 3HAEB 4JAMA 4K3DH 3GBMH 1FDLL 5EO9B 3TJHC 2HH0H 1D5MB 4MJ6A 4TVPE 4KUZL 3RTQD 3MR9A 2Y72A 4P3WA 5TGBA 4QWWD 1N2RB 3B9VA 2BRQA 4ZD3H 1D5BB 4NN5C 4XVJL 4U1KB 5D4QA 5I1AA 1FGNH 1LNUA 2BNRD 2OTWA 1TTFA 4R9HA 4PJDE 3WJJC 3MODL 1B4JH 2BJMH 2YBRA 1AXTL 5IEHB 4JJ5A 2X2YA 2MFNA 4NNYB 2F54D 4ISVA 3CMGA 3JTSB 3C5ZD 2FD6H 4RCAA 1E27B 3A6CH 3DV4B 1OAXL 3N1MC 4JO1L 3AUVA 4LDLB 1VESA 5EO1A 3QIWC 1JZ2A 1LQSR 5FGBC 3DVGB 4RSVA 4XBPA 3UTPD 1OB1A 1CT8B 3WIHA 3U2SB 5MEQA 4ZO7A 1G7JB 1WZ1H 1DVFA 3JUZA 3MGAA 1T4KA 4H20L 5ISZA 3V0AC 4Q58C 3T04D 2AQ1A 3ROOA 2RGSA 4KVNL 5T1KB 4DVRH 5I76A 3I3BA 5CEXA 3S36L 4WHYG 1P7HL 3SE3C 4XAKE 4JY4A 1CXHA 3IDGB 1OTSC 4PJHE 4WV1A 4NQDA 4KZDH 3BHBA 3K2UH 1IARB 5IB5A 1S9XA 2RHEA 4GLRI 3U30C 4MDJB 1BX2A 2WUBH 4U3XA 2QTEA 4M5YL 1YJDH 4MB5A 5DC4B 2AEIT 3BSZL 5HYEA 3QQNA 5EOTA 1KLUA 2HJLA 25C8L 3BKMH 4NUJB 2L4OA 1PY4A 4YBQC 2VDOL 4YHPB 5E6IC 1OPGH 1Q94A 4JHAH 3ZTJH 2YC1A 1MCKA 5LXGH 1HIMH 5FUCC 3ULUE 2Q86B 1MUJB 1T66D 4IS6A 1IBGH 2XN9B 35C8L 3S4SG 4KRMB 1P7QA 4EXPX 3TC9A 5C0GA 1WF5A 1E6OH 2B4CH 4P48A 5KAQG 4OBRA 3IGAA 1U91B 5IHUL 4IDJH 4NKIH 2WQ8A 4TOYH 5HDLA 1OGAE 5EZIL 3D3VB 3HCVA 5FO9A 1Z6JT 2AJVH 2VRAA 1HHJB 1T89C 2Y5TA 2A6KB 1ZT7A 1T5XB 3N9GH 5J8OA 1CFTB 4JPWH 3CZFB 4GKZB 4R4BA 2UVFA 3G6DL 2PR4H 1VEMA 3VXME 1G84A 5E8OA 1KFAL 4XBGA 3O6KH 4HXBH 3B43A 4PREA 4PRID 2I26N 4JFHE 2D0GA 3ESVF 3JWOH 1QSFE 3WSQH 4ORGB 5J0BA 4BH8A 1A7OH 3REVA 1RIVH 1UCTA 2PYFB 2HTKC 5HI3C 2G5RA 5KZCD 4JEGB 5TPWH 1NCTA 2A9NH 2KQNA 1SMOA 5I30H 3BQUD 1EMTL 5DJ8B 5C7XL 4AZ8A 4KUCD 3MA9L 4GH7B 4PJ9A 2XXMB 4J4PA 3VXQB 1UWXK 3LEXB 1Z0NA 4KI5F 1K2DA 1NCBL 4FG6D 5C09B 3JWNC 3DX9A 4LAQH 5L2JA 1BM3L 3M8OH 3AY4A 3GGWA 1NAMB 3FQXB 3I9GH 1DDHB 2JB6B 3C60D 3G04A 3CC5B 3SDDC 4QHKI 3O2WL 3H9HA 4LKCA 1ACZA 2QSVA 4Z7UA 2JJWA 4KQ4H 5DD3L 3RTQB 3S8WA 1ZGLA 5KSBB 5D5MB 5BZWA 3KVQA 3LKNA 3H3BC 4JFXA 5JW4R 3CXHJ 3ZE0F 5BMFL 1P4LA 1A0QH 3MACH 2ZUWA 4L8SB 4M6NL 1CE6A 2RB8A 3LKSB 4YHZH 1INEH 4OZFA 1Z3GH 1EHLL 5D1ZA 5F96H 5ELIA 1RZ8A 3LS4L 3S36X 2F54B 1FGVH 3PJSB 5T5FH 5F89A 5T33H 4QCIA 1WWAX 2CQVA 5KVEH 2I24N 1R3JB 2VXTH 4XCYA 3SDXB 4WI2A 1RMFH 1K5NB 3CFCL 2X1WL 5JO5A 4F2MA 1R5IB 3GIZH 2VDMH 4MXQD 3OGCB 1S9WA 1JYVA 2VAAB 5DMJB 5KW9L 1DVFD 2FSEA 1WVZA 3OTTA 5ISZD 2EDWA 4I8DA 2J7LA 5FGBA 3PNWA 5JMOC 1UT9A 1J0ZA 5F6IB 3TYFB 1B88A 3WIIL 3CD4A 5FCUH 3QWOA 3VG9B 4IMKC 4V1DB 4LNVA 4TN9A 4XMPL 3G5VB 3STBA 4APQD 3FFCE 4U1MB 3IXAA 1A6AB 2HA1A 2EDEA 2FL5A 1IGCL 1T7XA 4JVPA 1R5WB 5D2LE 5I1CL 1KJ3H 3DETC 1NFDB 3DXAE 1VPOL 1HHHB 3ZL4L 1KC5L 5FDWB 2BSTA 4K94L 4G6MH 4LNRB 1JVKA 5FF6B 3SE3A 3PWLA 3QUKA 3D0VA 4HKBB 4M1GH 4HC1A 4OQTH 1NKRA 1J8HB 1UYWL 5GS3A 4YDKL 2DQGH 3KPPA 5BRZA 4GRLA 4G6JH 4QT5B 5C9JB 3IJSA 4NFBA 2YRLA 5ENWA 2C3VB 4OCYH 3QI9B 5IB3A 3TBSB 2RBLA 3AC0A 1D9KC 3EHBC 5HGBA 4LCIH 1YUHB 1ZV5A 1IFHL 4AH2A 3QHFL 2A6JB 2XA8H 2HWZH 1MHEB 1TNNA 4MNQA 2ICWB 2QBWA 4XP5L 4GXUN 1VGKB 2WAHA 3BD4A 5E6IA 5IW1B 2X9YA 1P7QD 1N4XH 4RA0C 2R1YB 2R4SL 3SGKC 2ZSWB 4ETQA 2PW2B 1JTOA 5DC0A 3SY0A 1HSBB 5JNYA 3V4PL 3OAYH 2YKLH 4XVSH 3CPLB 2EH7H 4C57C 3V9FA 2DQIH 4EXKA 2JCCB 3Q1SH 3F7VA 3PQYE 1GOHA 4M7KL 4IRJD 1QRNB 5CD3A 3WUWG 5C0AE 3EDKA 1MJUH 1NBVH 1T89A 2BNUA 2NYYD 1BFVL 5ADOH 1A6WL 4NN6B 4YPGB 1DBAL 3FOLB 4RZCA 5E08L 5ILTH 1ZS8A 2ZCLL 2X4OB 5C0NC 3QDJA 3O6LL 5D2NE 3GK8L 4NOFA 4EUPB 4X4YA 1E6JL 1TJHL 4NHUA 3FMGH 2OQJB 1PG7L 3G6JB 3QG6B 3BQUB 2F53D 4XPFH 3FB8A 3VFMB 3ZDXF 1LK2B 5BV7L 5IIEB 2WIMA 4WDIA 4PP2B 4QXGL 1P2CB 3IU4L 1ZHNB 2OMNA 2HJFB 3O9WC 4LLMB 3UJIH 1T7WA 2I07A 3DGCR 4PJ9D 2V5YA 3PGDA 1A02N 3LV3A 4J4PD 5HYIA 1WC7A 3FAXA 3I6KB 3V4VL 4Z77B 1KXQE 4OLYL 5I74C 3NIGE 3BN9C 4ZFZA 4HC1L 3VXNA 3QJHB 4JANA 1N0XL 5E9DE 1RZFL 1ZTXH 2IAND 4PJAA 4JAMB 2PUQT 2DLIA 4MJ6B 1QTYT 3ZKNC 3MR9B 1EHNA 4UT6H 3SDDA 5TGBB 5GS1C 5IQ9A 4LFHG 1GIGH 1SJHB 3V52L 1AD9B 1QFPA 3LSOA 4MAYD 3VGDA 5I1AB 1LNUB 2DLHA 1QR4A 2OTWB 2BY2A 5D1ZD 1TVBA 4PJEA 2YBRB 2A9ML 3HRZA 3TM6A 4JJ5B 4MQSB 4Q0XL 3BMWA 5C0IA 4ISVB 1N7ML 3L5WA 3U1SL 1FIEA 1WWWX 3P3YA 1IAII 1G9ML 3OJDA 3ZMRA 5F71A 2FYYA 3UTZA 3PGFH 1OTUC 4RX4A 4XBPB 4IBLT 1X6NA 4RFNB 3U36A 4GW1A 5MEQB 1EBPA 4I3RH 4FA8A 2NY4C 5ISZB 2D7OA 1T4KB 4JDZA 4ZS6D 4D0DA 3TVMA 1DR9A 2P43B 2NW3A 3THML 5HYJE 1MCPH 3ROOB 2I9TA 4XVUC 1CK0H 2AKRB 5I76B 5F9OH 1AGDA 3DHMA 1EHXA 3FRPA 5CEXB 1TPXC 4KU1A 5E2VL 2VDLH 1FNFA 4JY4B 5CMAA 1A5FL 1JGUL 4HKJA 2P49B 1T03H 1XT5A 4WV1B 2EDLA 2APWA 2P8PB 3ILQC 3BHBB 4NQDB 4XCCH 5IB5B 5KVFH 1M4KA 1S9XB 2XFXA 4HFUH 2F58L 5EUOE 4HS8L 1BX2B 3RA7H 5F7EL 4RAHA 4KK8C 5BRZD 4GRLD 1M7DA 4HGMA 1KT2A 3OJVC 1X5JA 3F5WA 3BYYA 3GMNB 1KLUB 2HJLB 4M7JL 5EOTB 4BUHA 5IHZB 4XNYH 4Q9RL 1JGEA 3ARTA 1Q94B 4KTDL 2FCBA 3QQ4A 5J12B 2AXFA 4M9PA 5DO2D 3F12A 4IMLA 2C4FT 2DD8L 4PGEB 4PJFF 5AG8A 3ULVL 4O4YL 3T2OA 4UAOC 1OAZL 2FDBP 2ZUQB 4IS6B 2NMSA 3P11H 1CXEA 4MNQD 2F5BL 3K74B 4MXWL 5ANMA 5C71A 5C0GB 4DZ8A 2R1WA 3IGAB 5I1KH 2DTSA 5EC1A 4HJ0D 2Y36H 3VD7A 3ZZ1A 3KYNB 1RK0A 3DO3A 1GL4B 1OSZA 4LP5A 1P9MA 4EOWL 1PBYA 2C3GA 4R26H 2HTLC 3GMOA 5FO9B 4QRPA 3BAEL 5DR5H 2Y5TB 4XPGL 1UENA 1ZT7B 1GAFH 4WUKL 3EJYC 1A9BA 3RL1B 1RUKH 1AR1D 4R4BB 1MQKL 4J3OC 3FTGA 1CGSH 1FIGH 4Y16C 5E8OB 2QQKL 1D6VH 2GTWA 4XBGB 2CIKA 4MB4A 2WQRA 4U1HA 4PREB 3B4NA 3D9AL 1GZPA 5DJXA 1WAAF 4LARH 3KPQA 5E2TH 2IEPA 1KN4L 4BH8B 1MCNA 3REVB 1IC5H 1MJ7H 1DUZA 3WFCL 1T1XA 2ZPKL 1EO8L 3ARFC 4XNUL 1IRAY 3QJFA 4RBPK 5DS8A 4Q9BA 2VLKE 4OZGA 5SWSD 3KDMA 5KSAD 4NOBA 2AI0H 2EDXA 1ACYL 5ICYA 1WJ3A 3DPBA 2VN7A 4UNUA 5C0BD 1URLA 1GC1L 3BISA 1K2DB 5CINH 1A8JH 3I50L 3GMQA 4X6CA 3ULVD 5L2JB 5ERWA 2IGFH 3GGWB 1T6WA 5TQ0H 3BGAA 1CLYL 5IESH 4CADA 1ORSA 2CLVA 3O6FC 4OSUL 2B20A 1UVQA 3TCLA 2WK2A 1EJOL 4NQUA 5FUOH 4ZPTA 3IB4A 3MLTA 4LKCB 3QEGH 3RZCA 4Z7UB 5C07D 1ZGLB 2VYRE 1JGVH 5FYLL 4C56A 5BZWB 3I85A 3TA3A 3LKNB 1JPST 4F33A 1P4LB 1CXLA 2CR6A 1T2QL 1CE6B 3RI5K 2LAAA 4OZFB 2XTJC 2R8SL 5D7KE 4KI1A 4OZIE 1RZ8B 5GS1A 3T2QA 3HG1A 1UM4H 3AREC 4R90H 4KMTH 1BFOB 2BDNH 1R3IL 3UO1H 4QCIB 4ZOBA 4NRXA 5ALCH 5FM5O 3O2VH 3J7HA 4XCYB 4YEFA 1BJ1H 1VACA 3W81A 2DQEL 5JO5B 1S8DA 4F2MB 4RX4D 4X7DC 1S9WB 2E6PA 1MRDL 1ZVSA 5FGCE 2FSEB 3QIWB 5GSRA 3WXWL 3PNWB 4QO1A 1FJ1A 5C9KA 3L5XH 4HD9A 4YDVA 2NW2A 4Q6IC 1MI5A 3QWOB 4UOJA 4P2RA 1MRFL 2BHZA 3HI6H 3IXAB 4YXHL 1UM6L 2FL5B 3T08A 3P4OA 2QEJA 3B3IB 4GMTH 3BVNA 1IM9A 1S9YA 3D39A 1T0MA 4LVOC 5FV1L 4KKBD 1FPTL 2BSTB 2GCYA 4M8VA 5TDPA 3PWLB 1FVEA 3D0VB 4UQ2A 2KQMA 5BRZB 4PJ7A 3KAAA 2R0WL 3TJEH 5E24E 3IJSB 5KTEH 5ENWB 3RPIA 3SE9H 5JOFA 1XR9A 5IB3B 1RUPH 1MSPA 5FYLD 1CGTA 1RZGA 1B0WA 3SE8L 4GRMB 3S6CA 3DV6A 4MNQB 1N6VA 5E6IB 3BWUC 2X4TA 2R4RH 2XPGA 1KPRA 4PYGA 1CQKA 1G7PA 3CX5J 4MJID 5F3HB 2YUZA 3DOSA 4ETQB 5JXEC 4Y88A 3HPJA 3SY0B 3KPRD 4F3FB 5JNYB 1S7RA 4GW5A 4TSAL 3WYRA 1I8LC 3B2VL 5J89A 1N3NA 3Q6GL 4AEHL 3MOBL 3F7VB 3MLPA 1J1OH 3INUH 5FGRA 3BPLC 2ZG3A 5CD3B 1MF2H 4BFIA 2YPVH 1TCMA 2R29L 2W60A 3MJ9L 4RZCB 4XZUA 4YHLL 4YAQA 1ZS8B 2ESVD 2DS4A 4KK6D 4NUGH 3IRZA 3QDJB 2R0KL 1DQLH 5DJCA 4DKFL 4NHUB 1A3QA 3CCHA 1R6VA 3T0EE 4AG4L 3FB8B 3FB7A 4LFHD 4P59H 4JCMA 4S1SL 4GG6E 4WDIB 5C3LD 3SGJC 1A7QL 1RZKL 1MNUH 1RUAH 3L5JA 4WHDA 3A0OA 3ARFA 1JL8A 1OW0A 1Q9LA 2I07B 3BP6A 3WO4C 2NY0C 3PGDB 3LV3B 2PTVA 4NM4L 1WC7B 2CJUL 4HWBA 3V7AE 4JQIH 3VDCA 2I5YH 5D6DC 1QR1A 5C0JA 5J3HD 4GAGL 1YEIL 2W59A 4ZFZB 2Y4SA 2YD9A 2ICWJ 3VXNB 3O81A 4JFDA 1G7MA 3WE6B 5AZEL 5EFIA 1WLHA 4PJAB 1EGJH 1F90H 3RZCD 3SDDB 2FWOA 1CDJA 4XMLH 4C56D 4Y4FC 1XF2B 3TA3D 1Q9WA 1ZVYA 3WFDL 1DBBH 2WLYA 4XCFL 1YQ2A 2OR9L 4V2BA 1TVBB 4PJEB 1VGEL 3VXUE 3MYJA 3HG1D 4M3JA 5IVXE 2DDQH 3KWWA 3L5WB 1TQBC 3OJDB 4I0CC 3GKWH 2MKLC 3UTZB 1I7RB 4H1LG 1Q1JL 1IC4L 3IYLW 4DKEH 1KJ2H 4GW1B 1U3YA 5T1LA 2EIDA 2D3VA 3TVMB 4I9WD 1QQDB 2W0LA 4GKOA 5A2IH 4ONHA 1AGDB 4OLUL 1CLOL 3OB0K 4WW2C 4AEFA 2NY7L 5I16A 4JM4L 2AK1L 1J87A 3MOQA 4PLJC 1S5IH 4P2RD 4NJ9H 5CP3A 1AFVL 4QHMA 4NP4H 5CMAB 4Q6IA 1HYSC 4HKJB 3RJQB 5EUKA 1IEHA 2ZOKA 1FAKT 2BSRA 2XFXB 1XFPA 1JZ4A 3OSKA 2XWJA 4I5BA 3TBWA 1IGML 1FLRH 4HUNB 4FG6C 1PVHA 3X3GL 3F5WB 1JZ3A 5IKCA 1OWRM 2AK4E 2BVUA 3U4BH 5IJVA 1JGEB 1NC2B 2AXFB 5LBSL 3F12B 4IMLB 4JHWH 4P4KC 5L9DH 5DQDL 1CXFA 1IAIL 3NPSB 4UV7L 1SVCP 4LU5H 1CVRA 1V5JA 2C3WA 4OLEA 3DRTB 4R4NC 2OR8A 1F4XH 5ANMB 1LO4H 1MOEA 4DZ8B 5EC1B 5D70H 2HFGH 3K1DA 1F11A 1RK0B 3EUUA 5E99H 1OSZB 4F7MB 1BEYL 3MLVH 3NZHL 4X9FA 5I15H 3NIDE 5E2WL 3GMOB 5I1EL 4MAUL 5D72H 1K4CA 3IFNL 4QRPB 1S3KH 1KTRL 3RU8H 2VKXA 4ZMAT 4WI3A 5JXEA 4MGXA 1A9BB 3ZTJG 1P5UA 1OD9A 2A73B 2EC9U 2OJEB 3QQ9D 4L4TD 3UX9B 2JJTC 2Z91A 5I8CA 1I8LA 3FTGB 5DD1H 1AJ7H 2GTWB 1Q72L 2CIKB 3BDYL 4YDIL 2VWEE 5LQBH 4U1HB 1V7ML 3TIEA 5C2UB 4NQVA 5DJXB 3EYSH 1M7XA 3FB6A 3KPQB 3F7PC 4HCRA 3K4AA 1W72H 3HNVH 1YDPA 5J6GA 1TDQA 4YUEH 3K0WA 3RWFB 1DUZB 4X6DA 2LTQC 3LN4A 1T1XB 3MRGA 4APQC 3V5KA 1BFSA 4Z76A 3QJFB 4GUPB 3H42H 3VWKC 4OZGB 3WN5C 3KDMB 1DBJH 3QNZB 5F70A 1ZMYA 4ZXBA 3ALWA 1L7TH 1S9KC 5AAMA 4TULH 5ICYB 1MQ8A 4WTZG 1OQXA 1WBZA 1QVOA 5HI5D 4HXAH 3A6BL 1E4WH 4AIZA 3F7YA 2A6DA 1JHKH 3GMQB 4KVCL 3VFVA 5LGKA 4PRPE 5ERWB 1TNMA 5M94B 2ZNXA 4OQ1A 4I0KA 1NUNB 2EIEA 4CADB 1MHCA 1ORSB 4GFTB 3L1OL 2CLVB 3CFEB 2YD5A 3QXTA 1KBGL 4P9HH 1MCOL 3RWDA 1UVQB 2VDPL 4JFDD 4CKVX 1UB6A 5IG7A 5T3ZH 3S37L 4ODWA 5D6DA 3HN3A 4ZPTB 1YN7A 4OI7A 5I74B 4GXVH 2HKFH 2Q7YA 3GHEH 2IMNA 2G60L 3GDBA 5DUMH 3NN8A 5D8JH 4N8CH 4XPAH 3QT2A 4OT1H 4C4KO 4C56B 3RWEA 3TA3B 5KJRH 1CFVH 4G8FA 4F33B 4NO2A 5DMYA 2ZZUT 1Q9KA 3FT2A 5HTSA 5JHDD 5GS1B 1JWUA 2C9AA 2G9HA 3HG1B 4U6HA 1OP9A 3HMXA 2FEDC 5IFHL 2KDGA 2AQ2A 3D85A 1KXTB 2ITCA 4MZ3A 2IPTH 3PWPE 4NRXB 3ZDZF 1HCVA 2MSPA 2IAMC 4IRSA 1VACB 5IFAH 3L7FA 5TDOA 1G7IA 1S8DB 4QRRA 1ZVSB 1FN4A 1JWSA 3JTTA 1ZGLP 1NLBH 3TO4C 5DD5L 2YD1A 5GSRB 1FJ1B 4NZUH 1N64H 4ZODA 5IJKC 3N06B 4YDVB 1MI5B 3QFJB 4CVWA 4P5KA 2NY4B 1DQJA 1K8IB 3NOIA 4P2RB 3H9SA 4HBQA 3CH1A 3MRRA 1DFBL 5EU5A 3P4OB 3BVNB 1IM9B 1S9YB 1A1MA 4FFWC 3D39B 1T0MB 3D6GA 3GNML 4L4VE 2GCYB 5TDPB 1FVEB 1C5BL 4K7PY 3DROA 4UQ2B 4PJ7B 4NZRH 4PJXE 1N6QL 2D31A 4D0BA 3KYKH 1X5IA 3GJEA 3OWEA 5CLWA 4PY8I 5JOFB 1A7PH 4EN3A 2KL6A 3BGFC 3MV8E 2FX8L 4X9HA 3DHJA 4OCRH 5CJQL 5F7FA 3DV6B 5HHOE 1QFUH 2DQUL 3RVUC 3R1GL 1MEXL 2X4TB 4K3DL 3EYQD 1OM3L 2XPGB 4HAGA 4WVRA 4MA7L 1LEIA 1G7PB 1FNHA 2LQRA 4UAOB 2BC4A 2FJFA 4FTVA 2HMID 1CL7L 5MHSD 1EUUA 3EBAA 3MBEC 5CSZA 3GIVA 5IQ7L 2VE6A 1SBSH 4LEXH 1HSAA 4KI5D 1S7RB 1K6QH 4OJFH 1OTTC 1N3NB 4ZS7H 3BN3B 4FNLL 4X8JA 1S7VA 3C6LA 4GXUM 4JFEE 4ODUA 3SDYL 2GYSA 3H2WA 3ZE2F 3WXVL 3A6CL 4BFIB 3HB3D 3ZKSD 2W60B 4P2OC 3ZKXC 3OKEA 1GJIA 4XZUB 4JHBA 3NA9L 4YAQB 4ZNEA 1BJMA 3WFZA 4WUUA 4PPTA 4OCWL 1KNOA 3HNSL 5BV7C 4UT9H 2K3TA 4P46D 2QSCL 3P4NA 5DJCB 1AIFA 3SEPA 4F7TA 3CCHB 1WK0A 5DI8A 3FB7B 1PKQE 4FOMA 3E0GA 5DMGD 4QRTA 3BDBA 5I0ZA 5D7LE 2AVGA 4ZAKA 3ARFB 1ROWA 4QRQA 1UFUA 1Q9LB 2ARWA 5T3ZE 4YPJA 5I8KL 5IBTH 5EG6C 1YY9D 2EDBA 4PS4L 5KOMC 4XHQA 4NQCE 3QRGH 4HULB 5JMRA 2B0SL 4XWOC 3SOBH 5B4MC 1EEZA 3CH8A 4JN1H 1RK1A 5C0JB 1QFHA 4RMUA 2GFBA 5IMLA 5GGVY 3U4EA 1RFDL 3V8OA 3PHSA 5HI4D 2GJZA 2X4NB 4HZAA 5BCAA 4JRYA 3S96A 1OPGL 4JHAL 2HT2D 3WCYA 4BQBA 4TNVF 4F7CA 4BSWA 1KCUH 1Q9OA 4AEEA 4LSPL 2VAJA 1C7SA 4OFVA 2EDDA 1HQ4B 1MFAH 1U95B 1J0KA 3OBAA 3HE7C 2UYLA 5E8DL 1E6OL 1PKOA 1BWMA 2B4CL 5BOZG 5JA8B 5L2KA 3BZEA 4UDUA 4Q2ZA 3T0BA 2Q76A 2UWEA 1AGEA 4P3CL 1CVSC 2ENSA 4NKIL 3MYJB 1KACB 4P2YA 4ERSH 1YY8A 3D85D 4LCWA 2Y23A 2EECA 2CLRA 1KB5H 2WSKA 3N9GL 3S35X 4JPWL 2D7TH 4QYOA 4OFKA 1GGIL 2Y5EA 4PJFA 3AREB 4HUUA 4FFYH 1FH5H 1WUNT 4IRSD 4PBWD 1J1PL 1QNZL 4XPBH 3KJ4C 8CGTA 2CPCA 4JPIB 4QRRD 5T1LB 2P5WA 1I4FA 4JY6A 4Z7WE 1SEQH 2VZUA 3GI9H 4N1CA 1BQHB 3WSQL 1A7OL 1RIVL 4Y19A 5I16B 4FZEL 2EH8L 3T2PA 5TPWL 3H9SD 3BYTA 5E0QA 3VH8G 4QHMB 2H3NA 3QCUH 4Q6IB 3UTQA 2W07A 5SWZB 1JPTL 5EUKB 2ZOKB 1Z2KA 5KSAC 3GJFA 3UC0H 1MHPH 2BSRB 4YHKL 3FFDA 4PJGF 4MXVE 2XWJB 1ZAN