3QHPA

Crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
159
structure length
159
Chain Sequence
b'TPFKIAMVGRYSNEKNQSVLIKAVALSKYKQDIVLLLKGKGPDEKKIKLLAQKLGVKAEFGFVNSNELLEILKTCTLYVHAANVESEAIACLEAISVGIVPVIANSPLSATRQFALDERSLFEPNNAKDLSAKIDWWLENKLERERMQNEYAKSALNYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Type 1 capsular polysaccharide biosynthesis protein J (CapJ)
publication title Crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 62
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3qhpA00
3HBFA 2FETA 2O6LA 3MT8A 2F3PA 3IAAA 1C8KA 1EM6A 2BISA 3QHPA 4G2TA 3ZCTA 3SYRA 3RHZA 4YUAA 3BDAA 1FU4A 5TMEA 4L22A 4EKYA 2WTXA 4GZ3A 3MT7A 4BQIA 3MTBA 2QN7A 3BD8A 2ATIA 1GZ5A 2GEKA 3BCSA 3T3IA 4BQFA 2QN8A 3D0RA 3EBPA 7GPBA 4AY5A 4GZ6A 4KQ2A 3T3DA 3MTDA 2C1ZA 3NP9A 4RIFA 5D00A 3S27A 1JEJA 4RIIA 3T7DA 5ENZA 1GG8A 4KQ1A 2XA1A 2AMVA 2X0FA 2XGSA 6GPBA 3TOVA 3CUYA 1LWNA 2H1FA 3L01A 5LQDA 2IEIA 1HLFA 5DXFA 3VUEA 1BX3A 1VGVA 1XL0A 4HLNA 4XI9A 2C4MA 5BNWA 5TVGA 1FC0A 1F0KA 4M83A 3NAZA 4X7RA 1H5UA 1L5WA 3H4IA 2XCIA 4GZ5A 3G2IA 1P2GA 4PQGA 1NOKA 2VSNA 3MRTA 4MHSA 5JTUA 2R60A 2QZSA 2FFRA 1FTQA 1P4GA 3TAXA 3G2KA 4NC9A 1P29A 2SKEA 1C3JA 1IIRA 1YGPA 3CV3A 3UYLA 2IW1A 3FROA 4AN4A 5TMBA 2F9FA 3MSCA 4GPBA 2PQ6A 1UQUA 3DD1A 1PYGA 1YA6A 3Q3IA 1Z6QA 4N3CA 2QRGA 3ZCUA 3ZCVA 3OKPA 4LDPA 1JIUA 2F3QA 3T3HA 1XV5A 5IKPA 2GT1A 1UQTA 1SXPA 4F96A 4RENA 4BQEA 2AZDA 4N3AA 2IYAA 1Z8DA 1LWOA 4RELA 3GUHA 4Z5XA 3NPAA 3C4VA 2GPBA 1XC7A 5JTTA 2SKCA 3CUTA 1NZFA 2IYFA 3G2NA 3WAGA 5GPBA 1K08A 4CTOA 3VDMA 4YI3A 1Z6PA 2X0EA 1FU8A 1E1YA 1F6DA 4CTMA 3BCRA 4RIGA 3COPA 3L7CA 4MI9A 5C1DA 3D1JA 1AXRA 9GPBA 3HBNA 1XL1A 4N39A 4N3BA 4X6LA 2G9RA 3BD7A 3TSAA 2YJNA 4AMBA 2QN2A 3H4TA 1ABBA 3MS4A 1GPAA 1O6CA 3VUFA 1B4DA 4EL0A 3RSZA 1PNVA 4M60A 3HBJA 2C1XA 4FKZA 3MBOA 4FZRA 3OTHA 1WV1A 2GEJA 2IEGA 4XIFA 4CTNA 2R68A 2XA9A 4WHMA 2R4TA 5I45A 1IXYA 2GM9A 3PE3A 3CUVA 1P2BA 3G2HA 4GYWA 3DDSA 3OTGA 3DZCA 2QLLA 1XKXA 3S29A 2BFWA 1Y8ZA 2F3UA 2G9UA 2FF5A 1NVKA 1KTIA 2VG8A 1RRVA 2JJMA 3QKWA 2BGTA 2X0DA 2P6PA 1WW3A 3SYMA 3BCUA 5DU2A 2QRQA 1E4OA 3MQFA 3OT5A 3OKAA 3GPBA 3NP7A 3BD6A 4MICA 4KQMA 2QRMA 2JLBA 3S2UA 2ECPA 3CEHA 4W6QA 2XMPA 1SXQA 1WW2A 3Q3EA 3NB0A 4GYYA 1L6IA 1JG6A 3MRVA 3BEOA 2VCEA 3NC4A 3D0QA 4BFCA 2C9ZA 2GPAA 2R66A 4WADA 4WACA 1RZUA 2ACWA 2Q6VA 1NOJA 4NESA 4AY6A 3MS2A 2QRHA 4EL5A 4CDRA 3CUWA 2ACVA 4N9WA 4MRAA 2QN9A 1Y6GA 3OTIA 3RSCA 3WADA 1JG7A 3L7DA 1P4JA 1L5RA 5D01A 2QLNA 1K06A 3ZCQA 3PE4A 1WV0A 2HY7A 3MTAA 1UZUA 2GPNA 2QN1A 4REMA 1GPBA 1QM5A 1L5VA 3VDNB 1NOIA 4MI3A 3MS7A 1C50A 4HWGA 1WUTA 5TMDA 2PRIA 4YI5A 2X6RA 1GGNA 1Y6FA 1NLMA 2G9VA 3OY2A 3AMVA 3S0JA 1L7XA 3MT9A 3ZCSA 3CEJA 3CEMA 3Q3HA 4QLBA 1WUYA 3DDWA 3S28A 3OKCA 2QNBA 2QN3A 1GFZA 2XCUA 2XA2A 5HXAA 2OFFA 1FTWA 3WC4A 1C8LA 3UYKA 5DLDA 2IUYA 3HBMA 2SKDA 2G9QA 1GPYA 1L5QA 1QKJA 1V4VA 3EBOA 1JIXA 3OY7A 1J39A 3T3GA 4X7PA 2VSYA 3L7BA 4NEQA 4F97A 1EXVA 3G2LA 4EJ2A 2H1HA 1AHPA 2AV6A 4M7PA 2IV3A 2ZB2A 2X6QA 4RIEA 1L5SA 4EKEA 2JZCA 4MI6A 2IV7A 1A8IA 3E3NA 3T3EA 4X7MA 2PYDA 8GPBA 5IKOA 1NZDA 1FU7A 3G2JA 1RZVA 3IA7A 1P4HA 1JIVA 4RIHA 3C48A 2PRJA 2AW3A 3T5TA 4F9FA 3L7AA 1P2DA 3ZCRA 2BGUA 1FA9A 2F3SA 4AMGA 2XGOA 3O3CA 2VCHA 3CX4A 2GJ4A 1PN3A 3E3OA 2ASVA 2R4UA 1Z62A 2QLMA 3C4QA 2XGMA 4RBNA 2QRPA 3L79A 3CUUA 2KS6A 1PSWA 1XOIA 4MHOA 3MRXA 3NCHA 1M5RA 3RT1A 1FTYA 2PYIA 1FS4A 3ZCPA 3E3LA 4LEIA
chains in the Genus database with same CATH superfamily
4QM7A 5JU6A 1T4DA 4FD2A 2FETA 2XRMA 3PXCX 1SZJG 3GLGA 4KN6A 1K66A 3FN4A 1GNRA 4LJ7A 2GXAA 3H4VA 1A9QA 1R4MA 5I47A 4S1NA 2JLWA 2WSYB 2IIBA 2BFCB 4AP6A 5WRFA 1L5YA 1Q44A 4J0HA 4UNIA 4DT1B 1OV6A 3AY7A 1YBHA 2FVYA 2GVZC 3MPOA 3QHPA 2ZWPA 1DAMA 1IHXA 5DNWA 5B55A 2QX8A 3KELA 3HKDB 5KHLB 4HB2A 4ZANA 1X0XA 2BGWA 1Z28A 3OZFA 1KSJA 5CXUA 3KPWA 3OLVA 4OK5A 5BRNA 2WIAA 2A6PA 3SZOA 5JQGF 4EF5A 3HO1A 3N28A 4EPRA 5GINE 4MNTA 3UPUA 4A0QA 4J90A 4OHVA 1V5WA 4NNJA 4PZ0A 4HDSA 2WKQA 2QVCA 3PHBE 5DRYA 2XD9A 3Q40A 3ZYCA 3PX2A 1JTFA 4ZV9A 4ZOEA 5LBTA 3GT3A 4Q3OA 3SMVA 1FX1A 3L1JA 1Z2EA 4NJEB 1ILEA 1H8HD 1QGOA 4PLFA 4TKUA 3D0OA 4KG7A 3RJZA 3W5VA 1GZ5A 4BO7A 3PJDA 1U4NA 2AD5A 1C4WA 2H2FA 2I03A 3BXZA 3H6GA 3HVUA 4Z49A 3SR4A 5E6SA 4BAGA 4CKCB 2WW8A 4XSHA 4JI8B 3GEMA 1CUXA 2QDKA 2QJRA 4NJMA 3KAJA 2O3JA 5DASA 4YBZA 3WZLA 2ZI4A 4BZWA 3T3DA 2V54A 3ETCA 1CRPA 3HXKA 1PP4A 1M8GA 2XX3A 1YJXA 3M1IA 3D3WA 3EVGA 5I9TA 3UAOA 2GPJA 4JL5A 3LECA 4X1YB 4BVFA 3PC6A 4FDUA 3L0BA 1K97A 3WI7A 4CGZA 2B3TA 2J3DA 2D7DA 1JYSA 3MB5A 1X87A 3PNBA 1KEWA 4HS9A 4Y0VA 3TS1A 4WDQA 2X8BA 3CH4B 1NATA 1FQKA 4KMSA 4ZC8A 2GKSA 1A9TA 1EB9A 1T4CA 2ZS8A 2J0EA 3EFOA 3NDPA 3JYOA 4HNAA 3P0EA 2ID7A 1ZK4A 1V0JA 4PPQA 3KKQA 3LUCA 4N5NA 2FQYA 4FBGA 3HU2A 3TW8B 1JA0A 1EWRA 2EKDA 4RF3A 4WTOA 4BFWA 3GVCA 4EW1A 1VOTA 5ALNA 3L0SA 5KOHB 2J3EA 1Z6ZA 5A2QA 2QL9A 1OCEA 1XZQA 5JV5A 3BAFA 2ZQ5A 2M2IA 2OBYA 4M0EA 4CZ2A 4PHHA 2EDAA 1I0IA 4FHZA 3FI0A 1EE2A 4EG5A 2VF7A 3F8SA 2GPTA 2Q6LA 2WU0A 3A1DA 4Q7JB 2LCQA 3VNBA 1KEKA 1RBMA 1YB6A 3BG5A 4GZ5A 4NOJA 1T2NA 5JSZB 1S2IA 4RYDA 3SAJA 3UAWA 3PITA 4P08A 5LD2B 3C41J 2J4CA 2LE0A 1DBWA 3QVOA 1EEXB 1CUVA 4XYMA 3OZBA 1RHRA 1HEYA 4S04A 5EJ8A 2G82A 2XH8A 4PX2A 5JSKA 2DG2A 2Q9CA 3JQFC 4PYOA 1MA0A 1Z34A 1TRHA 5T6BA 4NZOA 4DJEC 5A9RA 3A36A 1LI7A 4RNDB 1IONA 4QTXA 1B15A 1I5EA 4M0KA 2XCRB 1YJAA 1V1RA 2Q3EA 2J5XA 4WGFA 4WKNA 4Y6PA 4GBED 2Z9DA 3RAGA 2Z3ZA 5FHQA 4Y6RA 3RVQA 1NF8A 2RGCA 5EKUA 1UM9A 3RS8A 3MSCA 3OIDA 4RF4A 3IQZA 2XUKA 1WVMA 3ASZA 1FMJA 1KYXA 3LSTA 3DW1X 5AI6A 2FN4A 5EWLA 5AVJA 4ZYZA 2ZI6A 5BUZA 2O8DA 1FFHA 3K5PA 2CKDA 4YIHA 2PMDA 1MNQA 2X2EA 3RYHB 2YDYA 4OYLA 1T6YA 4KPYA 4R2LA 1Y4ZA 2ZSBA 3QLEA 3SS9X 5A1JA 5HP4A 1KI1A 3PGXA 1X2BA 3W4IA 1QGZA 5B3JC 1CB7A 3NTOA 4JK3A 2D8MA 3Q0TA 1FSGA 2D1RA 1FP7A 1Q0PA 3ID6C 5FXMA 3K0FA 1U9IA 1NL3A 1E1RA 1VHDA 3DOUA 3IKJA 5C8XA 5IUJC 5JASA 4KIJA 4OHZA 1VYTA 3DJFA 2VTDA 1P8AA 2QE6A 4WJZA 3EWAA 2XECA 1MEOA 1EQUA 2CMFA 2W4QA 1EAYA 2H8GA 3ECCA 4WEQA 2QUAA 2B69A 3IKLA 1GIAA 3WLNA 1C4OA 1RCTE 1VIYA 2ZSFA 1JIQA 1LSUA 3B3AA 4NBWA 4QJ4A 4RZXA 3EMBA 5DM2A 5F33A 4I99A 1XZBA 1N6NA 4R7ZA 1M0EA 4YX9A 4G01B 4UD6A 3MC1A 4KFCA 4RK5A 1I4DD 3JVUA 4BE7B 2Z2XA 3AZOA 2G06A 2XKBA 4JEHA 2PH1A 3JYNA 2HAEA 1M2VA 1JILA 2NW6A 3JQQA 4M1TA 1T1JA 1A7KA 5GPBA 4ZI3A 2FXIA 1SVOA 2BM9A 3EGEA 3O21A 3MXTA 3PUZA 3UC5A 5JNWA 2X0EA 3L46A 5KYNA 1AMOA 3E9QA 4UUQA 1RNLA 3OBBA 1QFXA 2F1OA 3G0IA 3FDJA 3ZQKA 4LSWA 5KO2A 4JHLA 4MUKA 3AX6A 4YHBA 1C3XA 1D2HA 1TFUA 3HUFA 4YJGB 2Q2NA 4LNUA 3NM5A 4DCUA 2VWPA 3N7AA 2YXNA 3BD7A 5L8VA 1ZH6A 2DPMA 2VP0A 4WY8A 3QUSA 5CP8A 5AHWA 2R8BA 4YJHA 3TE6A 3TTUA 2CLMB 4LKOA 3ZKWA 3A6PC 4DL9A 1RADA 1PSZA 2R25B 2MMCA 2VBFA 2GAAA 1PR1A 2VIIA 3K15A 3KTFA 5B1YA 1GPAA 2YRFA 3FAZA 2A33A 3ZG6A 2DGDA 1M2KA 5AVKA 1BHQ1 2ISQA 4G4SP 2PUGA 3A9CA 1DEKA 3GJTA 5T8KC 5A9TA 5KNCD 1NC1A 2RHHA 2NSJA 1IQUA 1I1QB 2HCTA 4S2EA 3LXMA 2R2AA 2E18A 1XPOA 4RESA 4RX1A 4D45A 1Y6ZA 5JOQA 3EPHA 1TZBA 2AVDA 2FSFA 3R7NA 2YXPX 1FSFA 3ZUPA 4ZMSA 4C6TA 2NV2B 4ECAA 2GFHA 2LDBA 2Q0SA 4MVJD 4PN7A 4I66A 4ZQEA 4PAOA 1VHWA 2YFQA 1MB4A 3EVAA 1BGVA 2Z83A 1DJOA 1MHPA 2W6JA 4OQYA 1HLDA 2BPOA 3DC2A 5IN5A 3QA3E 1R4AA 1S9HA 1J33A 5BMVB 3QW2A 4OLHA 3LWZA 4M22A 2HHHB 4FSXA 4MW0A 4XD7A 3TQRA 3F5QA 2HFKA 2QJOA 5KNLA 4GRDA 5DI3B 3O7WA 4DA4A 1HDCA 1GT91 4M89A 1EP2B 4C2UA 2RC5A 3H7IA 2AUTA 3K9LA 2G9NA 5A4MS 1ESZA 1Q0SA 1DQZA 2JI9A 4UDNA 4WCDA 3IUNA 4WK2B 5EYPB 1W1WA 2FRVA 3E5MA 1FFXB 4U7HA 3U3KA 4ES6A 1YFLA 2Z9BA 4ZVLA 2YIDA 1Y8ZA 4DV2B 2HBQA 4ZXFA 1G8GA 2C2YA 4XWGA 5BSMA 2XDWA 4MQEA 1RPZA 1PL6A 3LXRA 5CEEA 2PX6A 2O3QA 1HYHA 3GO4A 4JVSB 4WDRA 5TQ0A 3AUYA 3BMQA 5CDSA 2IPAB 1XDSA 1KDRA 1XNGA 1PBNA 5ALWA 3ZH2A 1XQWA 3FF4A 2PJZA 1ADBA 3CMCO 3UJ8A 4DYDA 3MWJA 1NMXA 3E82A 3M9XA 2IEBA 1OXXK 4NBNA 3LT0A 3BIOA 3LU1A 1ZJYA 4TVKA 1TEHA 4XGRA 1E3WB 5BQFA 5CFQA 2RONA 4ZGGA 3QWFA 2VJCA 1E4OA 1LBSA 4M8NE 4FMCB 3HQ4O 5IXSA 3KSBC 1PLLA 5BT9A 3HKCB 3DL7A 1JPJA 4XFKA 4CMHA 1LI5A 3AL0C 1A5TA 4MVYA 4UHHA 5J5VA 4DM3A 1BFDA 2X9VA 2PKXA 4Z7JA 5ES4B 5KS2A 3HVRA 3HP1A 4IO1A 1UZLA 3K7EA 3AUAA 4AO6A 1WOMA 3GFBA 2WZQA 3K94A 1OZGA 1DBVO 3EK2A 5H70A 4UTRA 2UVDA 4ZI2A 1CS0A 3AF2A 3AC0A 2HQRA 4YCNA 1THTA 3PQDA 3EGVA 4OL9A 4BO5A 3PB3A 4I2NA 2C54A 5JHGB 4UTPA 2QTTA 1FNCA 2VWHA 1STOA 5IG2A 4N3NA 3L6OO 3DLCA 4FVTA 1YZHA 5EE1A 4BB6A 5JNRA 2EZUA 3U7GA 4YPOA 2VQ3A 4UW9A 1L2TA 4WFIA 2IZ7A 2WYOA 3LW8A 4EDFA 1P77A 1A69A 2BM0A 2I6QA 2PKQO 4RK6A 4MKFA 4XLZA 3VR4H 1SXJB 1BEZA 1QYIA 2WVGA 3DHNA 2K2QB 2YH2A 3ADOA 1TCAA 4GLFA 4QATA 4XD2A 3SPXA 1PJCA 1CB0A 2J4FA 2CK3D 3TTXA 5BV2P 1CNMA 4I9NA 4MWCA 5TB5A 3A6JA 3W7VA 5D3MA 5CT8A 4CL0A 2ACVA 3RSOA 2BEWB 2XUPA 5I48A 2QTNA 5FPTA 3S81A 2PGOA 3H9UA 1JW9B 1YE8A 1QF9A 1MV5A 5E4YA 3VH2A 5JJ5A 5DWDA 2C5LA 3U44A 4I5EA 5A1TA 4JR1A 2UVPA 3LUPA 4P7BA 3SM9A 2IA5A 4CQMD 3R8FA 3O82A 3PFGA 5BN4A 1ODKA 4Q39A 2JBAB 2GBPA 2C4UA 2IDZA 2OBLA 1PDOA 2ILTA 2YN4A 4BO4A 1DAOA 1WXWA 3I1JA 5IMBA 1JQLB 1QIFA 3A9RA 2OFPA 3IQIX 1O1YA 3M6VA 4Z0TA 4ZMRA 3VBEA 3FTCA 5I3CA 3AM1A 1V8PA 4AO8A 1H5NA 3RC7A 1CJCA 4IEIA 3UCXA 4QUIA 1DC3A 1W48A 1M6VB 2QORA 4LA4A 2YXDA 3FYSA 1IJFA 1I6WA 2RAUA 3QPAA 4JH0A 4TYPA 3JASA 4XQEA 4NS4A 2CDRA 4HGQA 4F86A 3TG2A 2EL7A 3SEQA 3UAZA 2FEXA 3DWEX 4CLRA 1U7HA 2FZGA 1U7WA 3QIAA 2J46A 5AKIA 2IW3A 3WGOA 4FE4A 4ZRNA 3ACDA 2P5UA 2H92A 1JWBB 3MOGA 3MSXA 1X1EA 4UC0A 5BV0A 1GNPA 1OUMA 3IEXA 4IDQA 4ITVA 1JALA 5C1BA 4OEHA 2PRIA 3I8XA 5KWEA 4NU0A 1NX9A 4OJMX 1OFUA 1PGJA 3KR2A 5A06A 1DC4A 1SKBA 5EPOA 1E9FA 1SIUA 5BVGA 2V7BA 3JQRA 5HQ3A 2QRZA 3LPDA 3GH3A 4IWNA 1SU4A 2Q5HA 3EBLA 1JP7A 1UKCA 3KT6A 4GQIA 1NW6A 3MD0A 4M1KA 5DBEX 1JA1A 1MKYA 3I5XA 1CYDA 5KYUB 1DXHA 1E4YA 1U8YA 2UYCA 4K2AA 3KYCB 5DYTA 5FLEX 1AQNA 4EABA 4AO7A 1U28A 1A9XA 1AUPA 1JQJC 1O87A 1PUJA 2AEFA 4Q7LA 5GJCA 2WG0A 3RUFA 1K7FB 1U9ZA 4L2IA 3TMKA 5K99A 2VYNA 1B76A 3QZUA 5CPFA 1O94A 3CE6A 3PF8A 3TCKA 4X20A 3S1LA 1W0KD 2XQJA 2PG3A 2QZ9A 3OOJA 2HDNB 1TNDA 4PNPA 1DQYA 1P62B 1BXZA 1PJ2A 1Q7RA 2CN1A 3IAHA 3QK7A 1JR3A 1ISPA 2DC1A 2Y4NA 2EF1A 3KOMA 4YAOA 4DMHA 1KC3A 5JQGA 1CP3A 3KL2A 3QJYA 2BGLA 1Z6AA 4JNCA 2WHEA 1NF2A 1GPYA 1MJGA 1KH1A 2PT7A 2HU8A 4ZFNA 5M5BA 3JQAD 2VT2A 3EBOA 4BB9A 4BN5A 3E8XA 3SJZA 4K9RA 5ER9A 1JXMA 2YHSA 4E13A 1ONOA 4WNIA 1TJPB 3SQDA 1SCAA 1G9SA 2YWRA 3KQYA 1GTVA 1PZGA 3E9YA 3T8YA 4LSZA 1LK5A 1XIVA 1OAOA 2O2EA 1Y4DE 4YCMA 2FZKA 3A3KA 2KLHA 3B1JA 4HDKB 3P45A 4ARSA 1A4RA 1QG0A 3E3AA 3FDXA 5ICFA 3I2GA 1JVBA 1V9LA 2OOSA 2XB4A 4FIDA 5TGDA 3FNGA 3P0RA 2OB2A 1NNI1 4MS1A 1YVPA 4MP8A 3S2SA 4Y2PA 5L7YA 2EAUA 3QV2A 3G2OA 1YQUA 4HDQB 1C2TA 5CVVA 3S5JA 1WP9A 2PYDA 3LZDA 2FFHA 3V4ZA 2HXSA 2D00A 1NZDA 3GFFA 4LDJA 3MA0A 5JFTA 2XIQA 1F14A 3WG9A 1NNLA 2OQIA 5EUQB 4IHJA 3F3MA 3W78A 2OM2A 3GZJA 3TLJA 3DAPA 3VKUA 5HUJA 5CLLA 3IT2A 2BMFA 3PIIA 2YIMA 1QFJA 1XVAA 4QG3A 2Z3WA 3ANTA 4D4LA 4F9FA 1A2QA 2HUNA 1HZZC 2UYGA 2IV2X 4BMVA 4YDQA 5JS6A 2CFOA 2DZDA 1YULA 4KYUA 2EFCB 2JGNA 1VE6A 3NETA 4U1RA 1ENOA 3STYA 4QGAA 4E14A 4YV2A 4LJSA 5A6SA 2EKLA 4K3UA 4TV9B 1MPTA 3ZV5A 2GAOA 3AILA 3CW2A 2PHZA 3BGDA 3GNQA 2YJ6A 3RRMA 3Q41A 4DNXA 1U7PA 3TBKA 1VPDA 4HSGA 4QFDA 1W36D 3TQFA 2QLMA 3Q9LA 1JDBB 4OB7A 3FOCA 2HV8A 2J9YB 4KLRA 2HF7A 1ECCA 1MEJA 1U1IA 1Z2DA 3HGQA 3L79A 5J2UF 1VJRA 1WUHS 4ETWA 3GLQA 2E6UX 2QRJA 2RHCA 4KAAA 4Q3CA 2J6IA 2ZJYA 3BMCA 2P1DA 4KXYA 1G8YA 1NVVR 4WLUA 3TEJA 4ZOLF 3JQDA 3NJ4A 2DAPA 2C8JA 1F2DA 2D1TA 2DBRA 2M1XA 3I92A 3MWEB 4K46A 5CFNA 3AV3A 2G63A 1WUIS 3BTVA 1K5HA 1L6RA 3K92A 4L74A 4PTLA 3Q3CA 3ZCPA 3U1TA 3M81A 2XOKD 2FR0A 5EPUA 1LPOA 1T36A 4YJ2B 4A91A 4MQFA 2O6LA 1X15A 2BKEA 4GKAA 3BXPA 1GQYA 4ND8B 3UMCA 1OIXA 1YVUA 4WECA 3O4FA 2EEZA 3BF7A 3V7FA 1JDUA 4JWTA 4B3GA 1LKZA 3KFLA 4J6EA 4LMRA 3MMZA 2BISA 1E61A 2WF6A 4QNRA 5L4NA 2FUNB 3ZY5A 5ICCA 2BFOA 1SKYB 1HA3A 1NKSA 2Q99A 4UEWA 2GSWA 3I8OA 4P4NA 5HFAA 4K6HA 2P9BA 2R1TA 5EE5B 1K7SN 1I36A 2PU7A 2WEKA 4DYVA 3PNLA 3EVDA 5FPHA 3STXA 2FH5B 5LVAA 1XPRA 2LWIA 3KOOA 4MI1A 3VNRA 3GPLA 1A95A 1JFLA 1RKBA 1TQ4A 4JMLA 1E2NA 3A06A 2BTOA 2ZSJA 4JT4A 4QOIA 1L5GB 3VO9A 5MF6A 1O4VA 1DI0A 2G77B 2NO0A 2BFFA 4GPTA 4BO6A 4YRMA 1KYZA 3K8OE 2GJ8A 2R6GA 2VL7A 4BJ6A 5GOTA 3HB5X 2O8BA 1CY8A 1JH8A 1J0BA 4JJFA 3WBFA 4CMEC 4JNKA 1UJMA 2YOFA 4LX8A 1H2YA 4Q9NA 4RFVA 4BGEA 1S2MA 2HRQA 4ZDKA 1J20A 5IARA 3PR1A 5KDLA 1FDOA 3T06B 3BH0A 2QWXA 3IQDB 3L6CA 2P79A 4BKRA 3H3XA 1VSVA 2YXLA 5B3AA 2DB3A 5DOVA 2I80A 2Q4RA 3NP9A 5ALIA 4WBNF 3EDOA 2CXNA 4PR3A 2C3PA 4CQNA 3AGPA 4H7KA 5DBIA 2IF0A 2H07A 2VT6A 3PQ6A 1OYYA 3EIQA 13PKA 1ZEJA 1HMPA 3FE2A 2AJDA 4RHFA 3SE7A 3O1JC 4C4RA 1WSAA 4UFNA 5CW2A 4ZI7F 1UWKA 2IZ1A 2OPBA 1Y1LA 3IX7A 4F7DA 5KI6A 1TLFA 3UJBA 4BWYA 4QWWA 5L6LB 1N1GA 1GKLA 2QTGA 3KZKA 4RADA 2HX1A 3A4VA 3CRNA 1CF4A 3AB7A 1VGVA 2NWQA 1XD2A 2VUIB 2WWGA 2WAXA 5KX5A 2H18A 3DONA 3E18A 1ULUA 1K3UB 2HLHA 3MCAA 1CUWA 3HMQA 4KV7A 3FHOA 2YR0A 4F6LA 3P27A 1AGNA 4MCAA 1KI8A 1Q2UA 2HDWA 4JU9A 1N5JA 3WHIA 1Q1GA 4GRIA 2HA4A 3FUCA 1J2EA 2H0QA 3QMMA 2XUQA 3S2EA 4NQRA 3UV7A 4BL5A 1Q7GA 2BGIA 4IDAA 4L5YA 4MRVA 1NOKA 4FX5A 1AKWA 1DXQA 1TW3A 3R7AA 5FWDA 3WL8A 1HG1A 3LZ6A 3P96A 1YHNA 5HF6A 5L53A 1HYBA 4QYXA 2QQFA 3GW8A 3PXBA 2BMWA 1VYUA 4CKEB 3AY3A 3KSUA 4BFXA 1FUYB 4ZO7A 3K5WA 1LBEA 2F64A 4JUAA 1L7EA 5TVKA 2G09A 4FX2A 4L07A 3G49A 1WQ3A 4RMIA 4BP9A 4D6XA 1CYEA 3K6SA 3EFHA 4A03A 4D5GA 2ATXA 2OSVA 5FTNA 4AZ3A 4GPBA 4WXPA 4RY0A 1G1AA 2OXFA 4N18A 2G71A 3QKSB 3TQQA 2P4HX 3ROEA 5E1MA 5AVWA 1TK2A 4ZVNA 3DPUA 2GWRA 1EM8B 1GADO 1T43A 1OYOA 2DLNA 2Q1UA 4FJ0A 4N3CA 1H2XA 2JD2A 4HNRA 3EULA 3KLMX 5FYQA 1PL0A 1WB5A 4O3MA 5TT1A 1EFDN 5F9MA 3BBPA 5IJ0B 1VLVA 1M7HA 1P5RA 2M9MA 2XVYA 4F1WA 4UTVA 3OZEA 2IYXA 5LZ7A 4XIJA 1O96A 3ORYA 1SXPA 5CBKA 2AG5A 1UBNA 2XTJA 2NU8B 4CRWB 4HQFA 1CUJA 4GR4A 2ZLBA 1QIIA 2CW5A 3A70A 3ONDA 2V8OA 4HGNA 1PTJC 4KW7A 4MIYA 3ROKA 3VDXA 4N6GA 1XP5A 1UDWA 3URKA 3MBIA 1LF5A 4R5HA 2P0YA 4QXQA 5IU6A 3GXOA 1M1YA 3OICA 2D8AA 3CF4G 3LYHA 3HEMA 4BV8A 2VNAA 3MJDA 4N01A 1VSBA 1DELA 3OJFA 5GY7A 1HDGO 2DP4E 2H57A 4IFBA 5H1YA 1IVSA 3L0OA 4IZOA 2PX3A 1H6CA 3D81A 4R40A 3M6UA 1PEDA 3IUJA 1GZ7A 2IYFA 3ZGOA 3ZQUA 4B8ZA 1KZ7B 4K9OA 5F7ZA 4M54A 3SLKA 1H4TA 5BQ3A 5K7SA 2R1VA 3FWKA 5HS6A 1F6DA 3R77A 5K03A 2OORA 1Z5UA 1C0PA 1W25A 5HJ2A 3D64A 4ABYA 1JFTA 4I1SA 4IQ8A 5JCJD 4RHXA 1SEVA 4OB6A 1X3LA 2HMVA 4U7PB 1JRLA 4YRTA 4X6LA 4ENUA 3NTXA 5CDGA 4OGLA 4XFDA 4FYHA 4DCNA 5CDFA 2V4MA 3OZVA 3EC7A 1NBME 1C8VB 2XD4A 4UMEA 5AVOA 5EXPA 2OV4A 2A0FA 5KPJA 4LV6A 1WY7A 1O2DA 2XYPA 3FBWA 3HU1A 1TMOA 3WS7A 1FVHA 2CF5A 4KAFA 5KB3A 3RSZA 4CLXA 1M33A 3WIVA 1THGA 2YBEA 4GRAA 4AYTA 2D1YA 1MAHA 1N5LA 2E85A 3HY6A 4BUJA 1H8ED 3ZWYA 5CDYA 1QH0A 2WD8A 1A4XA 2XUJA 1C9KA 3MRSA 5E1DA 4A0HA 1DDIA 2ZJ3A 4MS3B 1OZFA 3LUGA 3Q12A 3PJFA 2G0AA 1ELOA 1W5FA 5L3ZA 3TRIA 3FOWA 2GCOA 3CLTD 2WIJA 5HE8A 4X24A 4HNQA 4BLPA 3Q8KA 2EOAA 3H5LA 4R84A 2OK8A 1KMIY 5HTKA 1VE3A 8ATCA 1E2QA 1Z5GA 2KLBA 3ON5A 1LSSA 1Q1NA 1T4BA 3KYIB 3OPYI 2R00C 4KX3A 4W99A 3S99A 3ZWNA 1KO7A 3G2HA 2P9CA 5K0FA 1EVEA 1ZKMA 1T26A 5JD6A 5KSPA 4CU5A 4L4UA 2FWJA 2C58A 3QXSA 4DEXA 2PX5A 2QP4A 3AK4A 2AOWA 4OF4A 2HDOA 3V00A 3W5SA 3F2VA 4YJDA 3R7WB 1YBMA 4GX2A 4GOMD 4TROA 4KXMA 2JVIA 3EGXB 3VU9A 3H4MA 4AZTA 2CV2A 5BNIA 1KTIA 1SD5A 4V0SA 1I2DA 4QYSA 5IAJA 1QE3A 5H16A 4GWGA 4JYAB 1PJ4A 2ACEA 1AQUA 3A4LA 4HTFA 1NBAA 4IFTA 4RY9A 3KOYA 5GONF 1ZO8A 1TVEA 3C3PA 4K26A 1HQDA 5JANA 2DLCX 4HWSA 3P4UA 4ILKA 3QYFA 3ORRA 2DWUA 1WHTB 4I5IA 1WW3A 2J59A 2O48X 3JCZA 4QXOA 1OLSA 1LZLA 4P81A 3EXHB 3QX9A 3X2EA 4KK3A 2X40A 3I23A 4TUYA 1IQPA 2CCKA 1U63A 4OOFA 3ICVA 3SM3A 2BP7B 3ABOB 5CJPA 5LQUA 1BCSA 5EPEA 1XEWY 2IXBA 3N0XA 1VA5A 2IHNA 2C9YA 3OKAA 3UT5B 1ZXXA 2GO1A 4O2RA 3AUKA 3RQIA 1EBUA 1L7BA 2FSGA 4HEA1 4Q7EA 4AFNA 2GN8A 1AA9A 4D92A 1SMKA 3Q7RA 3I1IA 4TXMA 4LHWA 5JNUA 3U3MA 1EQAA 4WD3A 2Z0MA 4J2HA 3FG9A 4DG8A 5BORA 3GRYA 4M0UA 2MOKA 1PGQA 3KPYA 1CUIA 1G5FA 1RLJA 3D6HA 4NTZA 4PXAA 5J5AA 4N76A 3NIGB 2HCJB 1TUGA 3ZVMA 3NPMA 1LBQA 1Z29A 3MAAC 5HA5A 1K9SA 1UJBA 3WRYC 2GJ9A 2QMOA 1DAGA 4BE9A 3NALA 3AVXA 4GE3A 1D4FA 2IIQA 1V11B 1JXAA 1NM5A 5M2QA 4F3RA 5CG1A 2UZ0A 1NY5A 4FI3C 3LHKA 4JJKA 1WLSA 3A8TA 4I46A 5K0TA 3V8BA 5CB8A 4TYQA 3EZ9A 3TUJC 3W1EA 2YNMC 1VG9B 3U0VA 1TT5B 1VRVA 2F4NA 4PNZA 5HIKA 4WVFA 2XMDA 3IRUA 3OSZA 2DY0A 4RACA 1GUFA 2REQB 1DOZA 1T3LA 4I1OA 5JSQA 3AJ8A 5AW1A 4KQIA 3BGWA 3LD9A 4QXPA 4JI3B 2WVAA 4GF5A 4A16A 2P62A 1E1KA 2ONJA 2PL3A 4IL5A 3KJZA 3KU1A 3HP7A 3PC8C 3RANA 1F3LA 3STHA 1JMKC 2BTQA 2H1SA 4B3RB 2AZMA 1Z4MA 4CL8A 4R0VA 3K0AB 2QMQA 5CLIA 4JKOA 2HWYA 2OQ2A 4UCFA 1CZOA 2OG1A 3KV1A 1WV0A 2L2QA 4TN5A 3THXB 3M9WA 5BQPA 2PX2A 4EZBA 4KQ9A 4ZDJA 4LF4B 2YZKA 3PQEA 2IOQA 1C3EA 4YT5A 1BYIA 1N3YA 1VSTA 1N2CA 3B12A 4D2IA 5BN3B 2IWRA 3BMNA 1AVTA 3KU4A 3IT0A 5K6RA 9ATCA 1JAHA 2A5GA 2GM3A 2Z4SA 3PT5A 5E7MA 4ZU6X 3D6MA 1FDTA 2ZBVA 2FG6C 1OYWA 3MYRA 5D1HA 4C0JA 4HF7A 1Z47A 2NACA 4YI5A 1W1UA 4OQMA 2VZLA 4YMGA 4B3XA 4OY3A 5KMGB 1NVFA 1NLMA 3QKTA 4KPGA 4TT8A 2J6BA 4ZOLA 5IASA 2AZ4A 2GFQA 2O2SA 2VAPA 1A8SA 1H9BA 3KYDA 3X1KA 1N32B 5E4TA 3S8MA 1N9GA 2VQSA 2X4IA 4J16A 4LCEA 4N12A 4R8RA 5A7GA 1IY9A 3N2ZB 3CEJA 1HGXA 2G72A 3N6RA 1ZH0A 3OA2A 4NNPA 4BVKA 4Q7QA 2GPSA 2WU8A 2WV9A 3L0DA 1NQAO 1Q5PA 1GUZA 2G4VA 5ITVA 1JKJB 3C3EA 2GLUA 3MVEA 1G3UA 4LJ8A 3VXKA 3A26A 3MFQA 1ZMBA 3N74A 3ZTYA 2J9FA 2IZ5A 2GZRA 4CR6A 4LSMA 4MX8A 3TOZA 3KWJA 3KQPA 1UBUS 3ED1A 2WTUA 1KJ9A 1J0DA 1U3FA 3EY9A 1Q6ZA 1MJNA 4ONEA 4OJTA 3AI7A 1ZIYA 1E8MA 4M0MA 4O0MA 2RDMA 4RH0A 4DLUA 3R7BA 2Y92A 1IPEA 2FJ0A 2MSNA 1Z83A 1ICIA 4HUQA 4I36A 3IALA 5COBA 2RGAA 5L3SA 4RCVA 2HRCA 1F38A 2N3ZA 2ABWA 3TXXA 4IIDA 1SK8A 1XE3A 2FK7A 4OM7A 2PLNA 3DPSA 4RKRA 2VF4X 1KKMA 4QX6A 1YZGA 2NVOA 1T15A 4U6NA 2A3NA 1M73E 3IPCA 3UAYA 1YCFA 4EGFA 2QE7A 4U7DA 1BVYF 1KARA 3QRWA 2BM8A 4PLYA 2HGSA 2I3ZA 4KXWA 2VK8A 4HB4A 1QMGA 3GJZA 1WF6A 3TN7A 4K87A 1D2RA 1FXSA 4Q4CA 1DGQA 3FSEA 1XF9A 2JJYA 4MR8A 1N1DA 3KAPA 5FA6A 3HL4A 2GWHA 5K6TA 4YONB 2Y76A 4KQ6A 4TTJA 1IB0A 1SK9A 5FEMA 3OZIA 3TLEA 1XNRB 3DE6X 1X7YA 2H06A 3WGQA 3ZI0A 1APBA 2QMEA 1JNXX 1T9ZA 3W6ZA 4JT9A 4DLXA 4MINA 3LQ4A 4EMSA 3RK1A 5J1SB 3PUYA 3RIHA 2CF6A 1FDRA 3BK1A 1RZVA 4ZI7A 2Y0CA 2R9VA 2ZBRA 4DV1B 2Q7OE 2Z6QA 2W2TA 2G28A 5C5EA 4OHPA 3SX0A 1WZNA 4RIHA 1Y6QA 5D7BA 2W00A 2CLEB 1I7QB 3FMVA 4W5OA 4UTXA 4IILA 4PRZA 1NSYA 1RHQA 3O8BA 4QLAA 4M9SA 2ZRDA 1EINA 4R9UC 3OT4A 4P5DA 4XIYA 4Z9XA 3D6UA 4W63A 3L7AA 1IN7A 2YWBA 4Q3BA 4K9MA 3JPWA 4ZXPA 1XTIA 1DWUA 1B8NA 6Q21A 5J4VA 1TCBA 5LQJA 5FLKA 1G17A 2HO4A 3AKZA 3Q11A 1IY0A 5LBUA 4BO9A 5HZHA 3NHSA 4AMGA 2ETXA 5KVSA 4XPZA 3N53A 4WGGA 1TTQB 3VZCA 4UUAA 1SHKA 4GKBA 3VZPA 4DUGA 3TL2A 1U81A 3V2GA 3EAFA 2ASVA 2J3MA 3ZHXA 4XB2A 2V7TA 2XNDA 3B7WA 2LRHA 2WUEA 1ZUWA 3C4QA 4J0IA 1KZ4A 4QIHA 1J00A 2Q9UA 3WKEA 1CVRA 1DT5A 3M82A 4U3JA 5DCLA 4J94A 2VXOA 2GKOA 2Y1DA 3SS7X 1ISFA 2WJVA 3SX4A 2GCIA 5DTRA 2EZTA 4BQQA 4P54A 4YRKA 3B3FA 3CZCA 3PNSA 1ND6A 3NCHA 4CM9A 5KCZA 3PRKE 4CLOA 4QKQA 1HUQA 1VCHA 4EKYA 1ZJ5A 1W2GA 3P9KA 4MGYR 3SJ7A 1T1SA 5LXTB 4G81A 5C52B 1CJTC 2IL1A 3HWWA 1O95C 3NOVA 521PA 2IEAA 3SP1A 1E3EA 1E3MA 1L7DA 1P1FA 2I6SA 5IW8A 3RO7A 4PSCA 4FONA 2JGDA 1XJ0A 3WXBA 2J32A 2AX4A 1L7NA 1VHJA 1C7RA 4U39A 1I2BA 4QTYA 1KSFX 3EG9A 3I37X 2UZ4A 1S7GA 4OGKA 1KQNA 2VH5R 3FR7A 4RJLA 1XTSA 3FLBA 1IXRC 2GYVA 2IP1A 1CQPA 5CBPB 2Z04A 2OUIA 4XYLA 1PT5A 2B99A 4GL4A 5EN4A 2W93A 2V58A 4CCSA 3VRHA 1PJRA 1QHFA 2VF2A 3FTFA 1A9XB 1KI9A 2HADA 1JDSA 4GOXA 4QU5A 3IEMA 2O7NA 2OAEA 3GLHB 3FYUB 1I3CA 2I62A 4ME6A 3RVLA 3KR1A 4BXOA 3IXLA 1SM4A 2ID4A 4EI2A 5LMUB 1QAQA 4K1LA 5CYFA 4QXRA 1T0JB 2JGRA 3H05A 3EISA 3DP7A 3CIOA 3O3NB 4NAUA 4X00A 4P6VF 4KQ2A 3FVVA 3GYBA 1T1IA 1XTRA 3GFTA 4PICA 2G07A 5SZKB 5E9WA 1B2LA 2Y8EA 1NJGA 3DXFA 4FZVA 4JCCA 4Q21A 3RC9A 4G0WA 1UZAA 4WH0A 1CE8B 5FD8A 5BNTA 2A2ZA 1NW4A 3GJ0A 5TJHA 1EH5A 2XIJA 4MUYA 3A9SA 3S1SA 5AKGA 3UMMA 2I2CA 2R6ZA 5ENZA 1L4BA 2HLNA 4LDAA 4KQ1A 4J4BA 2QX4A 3NONA 1NI4B 4INJA 3LY9A 4BFUA 4MSUA 2CFTA 3PJEA 3UOGA 1RE0A 2ZRJA 5BXQC 3ZJVA 1NBEA 3TWOA 4C7BA 1AN9A 3K2BA 3H19A 3MTGA 3HRHA 4FYJA 4OP3A 1G21B 5KINB 1SCUA 2C8LA 4B74A 1WCWA 4QZVA 4PC2A 5IC5A 4EZEA 1OX5A 2HUPA 2QYSA 4HD8A 5DI9A 1IPFA 2C84A 4H35A 1P4AA 3BN3A 2OYCA 5K0SA 1XL0A 1RZ3A 4I4IA 3WDMA 1XJWA 4F21A 1T3GA 3SZ3A 2PE5A 2V9CA 4IDNA 4BQSA 2C4MA 2Z08A 3G88A 4MVJM 1MU0A 4B6SA 2BGMA 2GAIA 3DLTA 3G23A 4W7IA 5FBVB 3UGJA 3H86A 3AF3A 4ICIA 1NDHA 1RKQA 3JWIA 1K8YB 3KTDA 2O5CA 5IPFA 1NFRA 4KKXB 1Z4KA 1ESDA 4PQGA 4LVOA 2FPPB 1Z4JA 2HIAA 3C6KA 3DAOA 3VAZA 4D02A 2ZTVA 3OCJA 4RKQA 4XDZA 1RZRA 3UHFA 3ZE9A 5CX1A 1A2KC 2VSQA 2ZT5A 4RTJA 2GOYA 1H4VB 1QO0A 2C2BA 4V0ME 3K32A 3ZNNA 2X1MA 2E48A 3IOYA 1YZUA 3ZOKA 1SCIA 1YVRA 3OSUA 1T8UA 1V7PC 5FOTA 1CCWA 4UU0A 3TLKA 1J2TA 1UEIA 2DFKB 3SQOA 2KM1A 4FEAA 2VHEA 3DMRA 5B6IA 4F8JA 1UODA 3RTCA 1OBVA 5JZMA 3OX2A 2I8AA 5KIAA 2WLTA 1S2DA 4HY3A 3DOOA 2PQ6A 2YIJA 1Y81A 3L77A 1AG9A 3Q0IA 2BFEB 2N0SA 2CHEA 5JD3A 2B8TA 3VVMA 2XSZD 1YA6A 4BNFA 3O8QA 2D0DA 3FLMA 1XEXA 5JUWA 4YA6A 2V7QD 2XB9A 1SC9A 1RVV1 5K3FA 4W1RA 1F2UA 4WCFC 2QZPA 4DTIA 5GONA 4CQMB 1HNXB 2HYIC 2WJAA 1D3AA 1U5BA 1YQDA 3RODA 1JIUA 3VO2A 4AWBA 1U3UA 5FAKA 3SVTA 4K88A 4E2ZA 4FC7A 2FWPA 3JATA 1YXMA 1P33A 1QCCA 1X80B 1ECGA 2EW1A 1H1LB 1ZJ4A 1P7CA 4FYXA 3F7NA 3U7HB 5DNUA 1E1MA 3WGHA 3VR5H 1P0CA 2AZDA 2AEMA 5T67A 3WL6A 1JHOA 1BC5A 2PV7A 3UAXA 3FNBA 4Q4HB 1BXRA 5IZCC 4FGWA 3L4JA 4U5XA 4OBWA 4EJ0A 3IOCA 1PWXA 4N0PA 3ZW7A 1G6HA 2AE1A 3ESZA 4GGPA 5I9MA 4K8RB 4QHTA 4EQ6B 3GLFE 3WGNA 5LYJA 2CLOB 2EERA 4GPD1 1N8SA 2VYVA 2HSDA 5HKKA 5EUCA 1Z0DA 3PL1A 3G13A 3UT0A 2X1HA 1ZIDA 4A4DA 1F1JA 4Q16A 5JEDA 5LIRA 4D42A 1BMFD 4V1CI 2ZYUX 1QQ5A 2JCGA 2VHYA 7MDHA 5JD5A 4TSFD 3DMDA 1K08A 4DSUA 1CIJA 5I8ZA 4CTOA 1KYWA 1FU8A 3U9LA 3OOYA 5FV7A 4BBAA 1U0NA 2JC3A 2VH2A 2YZ2A 3CMMA 4G0MA 4NCXA 4G8BA 4JUFA 2CD9A 1RXIA 3G0GA 5C1DA 4OMFG 3MW8A 1ZU5A 1QIGA 3AP2A 1AXRA 1F60A 1SA0B 1WMDA 3MM4A 3LRXA 3MLEA 4OAOA 1KJIA 3A58B 4TXNA 4YO8A 3GLIA 4JJ7A 4X8LA 4M0LA 1RWMA 1T5OA 1B0PA 2G9RA 5DOZA 1PUIA 3PG5A 4WW0A 4D80A 4POOA 2N9UA 3PWTA 1BGWA 3CPJB 4JXJA 3A1UA 5FNZA 4C7JA 4HK4A 2WTAA 2HRZA 1ZGHA 2BEVB 3Q4GA 1KRWA 3CRMA 5IABA 3AR4A 5CD1A 1Q1EA 5F4ZA 4NE2A 5FPSA 3VR4A 4FKZA 4FZRA 2I5PO 5LNK1 2H9IA 1RJ9B 3M4XA 5DE3A 3KQOA 3SQXA 1DV2A 2GUWA 4TMZA 1RQXA 1FJ2A 3HFGA 4PVCA 5A9SA 1RQGA 3TGPA 1JZSA 4OHCA 1OKKA 2IXAA 5EL0A 3JQAB 1T9GR 3MXOA 4EI9A 1WD7A 4DUZB 1GNTA 3SSOA 1IXYA 2JI8A 3REQA 1JLKA 1VC2A 3H11A 1VXOA 4HMQA 3W9UA 3GV0A 4B45A 2UDPA 1X9IA 1EBFA 3OQIB 3P7MA 1N3BA 3TZBA 4G36A 1UIMA 2IS1A 5E95A 5D5QA 4ZDIA 2AD1A 1NP3A 1WQ4A 2W71A 4XPIB 5JAHA 5KTNA 3WWYA 4AF8A 1UEJA 1X8JA 5K0LA 4WZBA 4RULA 4JP3A 2DBYA 1CZRA 1UF9A 2Z98A 4B6PA 3E03A 1FVFA 1I1OA 2OCGA 5AXDA 2X1LA 1PL7A 3A25A 5C3UA 5TQ2B 3PNPA 3WL5A 3WLHA 4HZUB 1VL6A 3H1GA 4ZCIA 1Y7PA 5C2JB 4BPRA 2C99A 1HO3A 5JVDB 2ZT8A 3A10A 4OP2A 3D1VA 4OREX 1YR9A 4RA6A 2X3UA 4FFBB 3F78A 2L42A 5DCWA 4KRYA 4MKRA 5KOJB 4CEHB 1HOXA 2OLJA 3CG4A 4IGEA 4CM8A 1JYFA 1M6YA 3CGWA 1KS2A 3EF1A 2GPYA 4MAAA 5K4HA 4IDCA 1W4AA 4XB1A 5CMLA 2Z8ZA 2CLHB 4FHDA 1T9BA 4Y2GA 3NKVA 1EUZA 1B8UA 5H3CA 2HTFA 3GU3A 5JNVA 4RJJA 1UANA 4CEJA 4WUVA 3PE6A 2CBGA 2EV9A 4PR0A 4M37A 4FZ5A 2CXPA 2FMUA 4Y7DA 1FLNA 3T7SA 3W05A 2HSEA 5K9ZA 4BP8A 3JYLA 4N65A 4XWAA 2VSXA 3ISJA 4CT4B 5G0UA 2NUAA 2P0EA 3I9NA 4R1SA 4Y2RA 3L8FA 3IAEA 1CRLA 2HC9A 1P6XA 1X14A 1WW2A 1YR2A 2ZBFA 3BIFA 3ES9A 1N5OX 4MWZA 4WFJA 1S01A 5BMVF 4NCNA 1BE8A 1KPHA 1G8AA 1K8XB 1XLUA 2Z56A 3T5DA 4HX5A 1VPWA 1FE8A 2C00A 2W2KB 4MR7B 5FUMA 1JFSA 1W36B 2AXEA 2QQGA 1LS6A 4FBLA 2CXTA 3NHRA 3LKDA 4YV7A 4D3ZA 7YASA 2CCJA 3G59A 3ZV7A 3OC6A 4UE6A 1L1QA 2AOVA 2ZREA 3KZXA 1KH2A 1ZJ6A 3L1HA 3T0IA 3PQCA 2W6JD 3PKIA 4LF7B 1ZL2A 1RHUA 1B23P 1XEAA 2ZQZA 4X9XA 4RQAA 3HK2A 4XD7D 4TWJA 2I34A 3OJWA 4HN4B 4ZT6A 2K7FA 4IOLA 3T5CA 4OQNA 5GV7A 4F1JA 5CDHA 4FQ8A 1HSZA 4N9WA 1WNTA 4IGIA 4BKPA 4EEXA 5JNTA 3A6GA 4OJNA 2O7SA 1FSSA 1GU0A 3M7IA 1HL3A 3OQOA 2DR2A 2G6BA 1Z07A 2ZPTX 4AN1A 2H52A 3C3CA 3I4LA 4NZPA 2B98A 3JAKB 3DO8A 3JYHA 3CM0A 3FRIA 4XH9B 5LUAA 4FMCF 4HPJB 4YJFB 5T3YA 2XZTA 2AFRA 1QONA 4PINA 2FPLA 1NYQA 3HYTA 4R1LA 2BMAA 4EHLA 2CVQA 4DDKA 4NPCA 2GD0A 4GOJA 1XF1A 4QHYA 421PA 1A71A 5BVHA 1RLTA 3PSAA 2QTWB 1Y48E 4YT8A 1L4HA 2JKZA 5HF5A 4KE6A 2QN1A 3F0TA 4FE7A 3TD9A 3DO6A 4ZMBA 5JSFA 3STWA 7ABPA 1JSCA 3F3YA 3KE8A 4HFMA 1XRRA 2X9QA 2V3WA 4OGWA 1YWGO 1ID1A 1XN1A 2H4ZA 4FFNA 2JJ1D 2A92A 4ID3A 2PWBA 2YHUA 1M1ZA 4PPNA 4BNNA 1WZ2A 3NHMA 2NAFA 2R8XA 4NLLA 4J7AA 4RLFA 2EFYA 1XDBA 2I4NA 2QDXA 3FI9A 3L8YA 1RD4A 4G4GA 4NBKA 5T4BA 2OV1A 4B44A 2HTEA 1VMEA 1UBHS 3Q1LA 3WNQA 5BWOA 2Z4TA 2JLYA 4RK4A 3IVCA 4RJTA 2UZAA 3UJPA 4V0QA 4PLWA 4WNYA 4PCUA 3S8YA 2FOIA 1QGUB 2ZR9A 4RMHA 2WT8A 1RRPA 2A84A 4Z9YA 5FPKA 2B83A 1YVDA 1HNZB 1IXKA 5LN1A 2W4MA 3H1AA 1JBQA 5IDQA 4RMGA 5BQOA 4TTVA 3C8DA 4RVOA 4QGBA 5HJEA 1FPQA 3NNSA 3K72B 2QT9A 4M46A 2YIVX 3T4UA 4EW2A 1PFYA 3AIIA 3FDFA 4G5HA 1UPUA 2IVZA 4Y6QA 3WWZA 4CKBB 1M2HA 3HMKA 4OOEA 5FHRA 3ZXSA 2O2XA 5JNLA 4HUJA 4EUKA 1K88A 3LLMA 3DPIA 4B76A 3NDRA 4CR7A 4FW9A 4FSHA 2F9MA 3EZNA 2DH6A 1GP2A 2D1FA 3G2QA 2V9PA 4S2UA 3ZE0B 1C7EA 1FJHA 3DAFA 4I55A 4KXQA 4QQNA 4QUAA 1HT2E 1V71A 5T8KA 4JX9A 3OO1A 3FOFC 1NQTA 3DMYA 3ZQ6A 3PKZA 2VPQA 4UVIA 5K45A 2IH5A 3U4AA 5BPFA 4RW0A 2P7IA 4RGBA 2FR1A 3VH4A 1W6UA 4W8HA 4UUBA 4AVYA 1YL7A 2HN9A 3K9GA 1LPBB 3G2LA 1NR1A 2GCPA 3ONWA 4OA8A 3CTPA 4LRTB 1WDKA 4LMBA 1KO4A 3SKVA 5KKCA 2IHZA 3OCXA 3U5TA 3CVUA 4UZSA 3SC2B 2G88A 3BTOA 3P9QA 1IM5A 1HFEL 1S7CA 3GLRA 4P3OA 3QWHA 1UBEA 2G5GX 5EIBC 4ZCRA 3EYAA 1VL5A 5HKLA 4POAA 3GDFA 1HZJA 2A9PA 2AHOA 3NBKA 4WXHA 3HXPA 3T52A 3AJAA 4R8VA 5G40A 2NZUG 3L07A 4IZ6A 3SSMA 2ZE8A 1PWYE 4DAOA 1EI9A 2Q3LA 5J3JA 1E2PA 3IMCA 5D6NA 4W6ZA 1IN5A 1E1NA 3O8NA 2IXEA 4IV0A 4BNWA 1DB3A 4DNOA 4EKIA 1OBHA 4J1TC 4EP1A 5HNKA 2Z5VA 4YV1A 4JIGA 3K8YA 4KU4A 2BFCA 5E8JA 1UJ4A 2AFHA 4IJQA 5JS7A 4TLBA 4QRHA 1AGRA 1X94A 1SCNE 2P5TB 4DRZA 1ZVJA 2RHBA 1WCYA 1KVSA 1WKBA 2P9QA 3A6ZA 3EEIA 4HZIA 4KNVA 4L16A 4I8DA 4YLGA 4HDOB 1Z22A 1LPPA 2NSLA 3LVBA 4KUGA 4YMTA 5G4KA 4PG6A 1DHTA 2NP6A 3TM5A 2CCGA 4IDOA 1YZVA 3LHFA 3RI3A 1P1BA 1IMOA 1PZFA 2JI6A 2ZDGA 1DZ3A 4UKDA 3T5MA 3OJLA 4XDYA 1R9NA 1RW4A 5SV2A 1Z12A 3TLGB 3PK0A 5K8UA 3VC1A 3PDJA 4NJEA 4PFSA 1KVQA 4M3NA 2HBRA 1XAJA 1H23A 3L0CA 1NRXA 1C4XA 1JR3D 1OBFO 2PL1A 4H0NA 2AMJA 1XD8A 3TZ6A 2WI8A 3M4ZA 3BSSA 4MJXA 3QLJA 4CKCA 1SCDA 4RSHA 2H5EA 2XRFA 2VJNA 2OFXA 3FGOA 3L05A 4J0GA 4HBZA 5CFPA 1RXWA 4G0PA 4MYRA 1M5UA 2YUIA 4FM9A 2E9SA 5ERYA 2X0RA 1TQDA 2V3CC 1XDZA 4G0UA 3PL5A 1Z4NA 2WWWA 4M7RA 3OUTA 2WSLA 3TTWA 2YN2A 3PEYA 1NRWA 1X92A 4W9NA 1LNZA 1P7ZA 5AM1A 3R9IA 1A9RA 3DT8A 1N6OA 1NRIA 3PD1A 2VHUA 3PQ5A 2VKTA 1SCJA 3NUGA 4YTEA 3JQPA 2XCOA 3GQVA 1XRLA 1X3SA 4B6FA 3SNHA 1YS9A 1C8KA 2V8BA 1SUCA 4HP8A 1DUIA 1JHVA 4OX9B 5I7UA 3ILVA 3FKSD 1P81A 3WWPA 3FCUB 1PVOA 2VAMA 1IK4A 1XU7A 4FDVA 3AG5A 4H7JA 2E4XA 4B6OA 2BKXA 5AJHA 2FHPA 3FNRA 4FFOA 3TW8A 3V2UA 2FJPA 1POWA 3M6WA 3JZFA 2GD6A 4CCWA 5AUNB 5IANA 2M6RA 3PDCA 5KTYA 4RK7A 4FYYA 1B0UA 1GCGA 1JR2A 4IIVA 3JX9A 4U2GA 3SBDA 3HJAA 2WHQA 4UVDA 2P4QA 1HT0A 3EA5A 4OYHA 3F6EX 4ITRC 4ZQGA 3ETDA 3VJLA 1CUBA 4PAWA 4QL3A 4TV9F 5E7JA 4L08A 3EMDA 4P8RA 1WCXA 4JI4B 2CXUA 4AJPA 1VJCA 4Q9HA 3EGOA 5F73A 3RLIA 1XQ6A 1N4DA 3EEQA 1BVRA 1ZD3A 1XCBA 3QWAA 4P4SB 1X7WB 3UJCA 4YUWA 2ZRLA 1SBTA 3K9QO 3ZBQA 2JAOA 3PLAE 3HCCA 3PNQA 4PY2A 3TR6A 5E4JA 3ZZ1A 1DC7A 4E5KA 4KITB 3MTDA 5BSEA 1NPTO 3UFBA 4BRWA 2P77A 4MGHA 5EIOA 2EVWX 4GGMX 4CIYA 5HIAA 2WD7A 1NN3A 1JF8A 1MX1A 1H0RA 2QEQA 2F3TA 4I1IA 3A9UA 4Q1DA 1SHLA 3ORHA 2JCBA 4KJXA 4EJ6A 2PYZA 3M33A 4M38A 4BWFB 3DT9A 3WYAA 2CGEA 4AJEA 3P0HA 5KNCH 1UDRA 1CIVA 4Y2XA 1E6UA 3K31A 1Z0FA 1XA0A 2DT8A 1J8YF 4PPGA 1KE1A 4YJ2F 1LTQA 1GRVA 2H65A 5C1IA 2H59A 3RWBA 4DV0B 1U80A 1EESA 5DXFA 2OCYC 4MVJH 4AG6A 3ESDA 5HHTA 5DNYB 1G0OA 4M0FA 1ZNZA 3QVKA 2I3DA 3W5IA 1VKJA 3M6AA 4AJ1A 4XOUA 1Y5LA 4KH0A 3AHEA 1SVNA 2VHWA 4NATA 3E9EA 1ZINA 5KJCA 1BX1A 1M72A 1XZFA 1FS6A 2RH5A 4IGKA 4AQYB 3DTVD 4RVCA 1IBRA 3D5TA 1L5NA 4II3A 3D1LA 3OTOB 3KFXA 2EX4A 2O54A 1VI2A 1Z35A 5IHXA 3I0MA 5AW4A 3ZU3A 5IAAA 1B8VA 5G0TA 2EKZA 5C18A 1DEHA 1I80A 4D97A 2ISCA 4D81A 5K8LA 4AKSA 2DUWA 2EGUA 1S3SA 5TMPA 1W0JA 4L4XA 3UANA 1R0KA 4HLDA 5CITA 2RCNA 2MJLA 2WV7A 4HH1A 4TLMB 4KBYA 1S2GA 1V4BA 2L0XA 2PRKA 4B48A 1J7JA 1NSTA 3GC6A 5BYBA 3UYLA 2WE8A 3CV3A 1YUNA 2IUSA 4BYGA 1E79D 2O2YA 4AKEA 3BT7A 3LK6A 1F9EA 1U3VA 3QLUA 2VJAA 5EOVA 5K2OA 4QUJA 3JWHA 3RIYA 4JBWA 5G0VA 3WK4A 4DSOA 2WSMA 3G0BA 5DNAA 2AMFA 3ECAA 3R3ZA 3W5AA 3ITKA 5HCIA 1GRRA 2I33A 3FPSA 4IX9A 1NXTA 4GKVA 4P83A 3QBEA 3JW8A 1WA5A 2FPRA 3HA2A 2YFHA 1MO6A 2GCEA 1EFCA 3IV9A 4INOA 4NOMA 1EFPB 4EB6A 4YJGA 1MB2A 2V98A 3ZWBA 4CV1A 2DHDA 5FJJA 3D54D 1XQYA 2J67A 5DBGA 1IY8A 1MAWA 3W8NA 1FJGB 1TJ4A 5SY9A 4GQAA 4E03A 4IF6A 3A1WA 2VCYA 2OBNA 4AY3A 1EXWA 4JLSA 4NIMA 2W4IA 2ZXFA 4OVKA 4YAKA 1CHDA 3HZZA 4WFKA 2KSQA 3BWDD 3NJ8A 4EOGA 2GB4A 1U2SA 1DKRA 3L0YA 4H4DA 1Y3DE 1U0BB 4ZAFA 4G5GA 5JY1A 4QOHA 1XWFA 1PJZA 4Z53A 2DWPA 2ERXA 1Z5VA 2WWXA 5ARDA 3OM8A 3NHBA 1Y1KE 3BE6A 1A76A 1NXVA 3PCRB 4G0XA 3B3JA 4X90A 2ICAA 1X7XB 3LKZA 2E89A 2ANCA 4TXHA 1Q0HA 3PWKA 5EWJB 1AV6A 1HT1E 1S8FA 3CUTA 4JU8A 1J56A 5DI3A 5ABPA 4EBBA 1DDGA 2H16A 3AHDA 3CB4A 2F59A 4BEJA 4EG8A 1E7QA 4B6QA 2FW7A 1DARA 4XARA 1FFAA 1UBLS 1U3DA 4Q66C 4B3TB 4YRJA 3WYEA 4JFRA 4RIGA 1MRZA 4FHFA 4EGQA 2GGSA 3ISTA 9GPBA 1V26A 1T10A 3R3WA 1ORTA 1Q15A 4MWGA 2DHQA 5LQRA 4NBLA 1YKFA 3KZMA 4HC4A 2PBZA 1SU7A 3C7TA 4YRCA 3H4TA 3FDZB 3N2GB 3FLAA 3R75A 3TOSA 4ZJYA 5COAA 3TMYA 4GAEA 3OEYA 4ZQFA 2YXEA 3GA5A 3D9QX 1JDVA 1F4LA 4BV9A 1XO1A 4TZKA 5KDDA 3NC1C 4RFSB 3OUUA 3UK2A 3G3EA 5C8DA 4M1ZA 5LYYA 1JHAA 3VSAA 4UREA 3HGTA 1TU4A 2NUPB 2PO7A 3KQTA 3ZHOA 1W5AA 4DIEA 1Q0ZA 4PZYA 3ETJA 3IELA 4UM9D 3WYCA 2IEGA 1JHXA 3RYCB 3ZGXA 1NBMD 4IIUA 3B5IA 5ALLA 3QA9A 4PAQA 4C7XA 3CYFA 4LN1A 3IVAA 3NOOA 1TKBA 4Z4QA 3LC7O 4S24A 1QXSA 3DAHA 4UCWA 4WHMA 4EKDA 2BR4A 3VGJA 1V3VA 3IBCA 4Q1FA 1G55A 2C42A 2R5FA 2VEDA 3O95A 4Z2AA 1PW5A 5EUMA 1MENA 3V7UA 1KVRA 2FGJA 1DWQA 1PS0A 3M70A 3NS7A 1JLMA 4FNOA 1U2PA 5JAUA 1H6AA 5B5SA 1L5KA 4FS8A 2J8ZA 1NULA 2HIGA 4BMSA 3TO5A 4AURA 1XKXA 3IQHX 3OLYA 2EKQA 2INGX 3QLVA 1TAHA 1ZSNA 4CKYA 4F60A 1X6VA 1F2TB 2WUVA 4EECA 3K3PA 2FK8A 4WAUA 1RRVA 2C61A 2W37A 2IYWA 1SXJA 4YUZA 1RMQA 5FUYA 1R6XA 2H29A 2B8JA 1TJ3A 4FGSA 4RY2A 3U6KA 4UOEA 5K6AA 3ZDBA 4C29A 2PZEA 3UMGA 3ZK9A 4IUBS 4B81A 5MN6A 1QYXA 2BEWA 4LFBB 3KP1A 3DMPA 3QE3A 4JLAA 4K9QA 3E5HA 1LW6E 5DU2A 1JLRA 1CERA 3QEAZ 4UJ3A 3QQ5A 4R51A 1Z06A 1N7HA 3BDVA 4WZ6A 1GTJ1 3K9CA 5AK3A 4N5DA 1HQYE 1W59A 5AXCA 4JQCA 2JD0A 1OAAA 3T0GA 3GPBA 4AQ7A 2IZ6A 1NVGA 4O6VA 4ZJPA 5CCXA 4R7GA 4R2XA 1D9ZA 1ZCFA 3HR7A 3ABRB 5F1KA 3S2UA 1U7XA 3TRDA 2FMTA 4PRYA 1BU8A 2OKCA 5FI0B 2VUSA 3JYPA 2OT3B 1M6VA 3EZ2A 4OMDA 1ISRA 5DN6A 1L6IA 3ZU2A 4CCYA 4DQVA 2CJXA 1QIDA 3TIIA 4MPRA 2IKSA 2ZWIA 2YVQA 2WABA 4J0FA 3LK7A 3JQCA 2O59A 1Q0RA 3IDAA 2DUNA 5SICE 5KJ1A 4P31A 2WFLB 1Y8QB 2IIVA 1Q3HA 1XRSB 3RGGA 1VTKA 3W77A 4A27A 1BWRA 3OIGA 2B4KA 2QX7A 1V8DA 1N7IA 3WTBA 4H08A 4E94A 3K9FC 2IGTA 3N8DA 3X3HA 4JV5B 3EGCA 2R7MA 4IQGA 2NGRA 1FUEA 1NQOA 1GITA 2PL9A 3FNIA 3KKNA 4TMKA 5AI0A 1HQKA 5KJEA 5FNVA 3JAWB 2WDZA 5JMOA 5KYUA 2ZT7A 3LXUX 4C4AA 2GK4A 2KHZA 4IOKA 3T9EA 3KYCA 3TZLA 5TLSA 1WS6A 2XWSA 3VX4A 1L5FA 4N41A 5F2EA 1UKEA 4S1PA 5EY5B 4BVJA 5JWOA 1Z5WA 1ZHFA 3GAFA 4IHQA 5D01A 4HDMB 4C3VA 4L76A 2GZSA 1L4UA 3F8WA 3G0CA 1PIWA 4NH0A 3VSDA 2CUTA 3CLRC 3WK5A 3PE4A 4CM3A 2ZVPX 1D4ZA 3TFOA 1YMQA 2GN4A 2IF2A 1EE1A 2ODWA 3K0CC 4AICA 4W5JA 4R7TA 3DDHA 3O4JA 2VAWA 2ODPA 2RG7A 4REMA 3FNFA 1ILWA 1C9JA 2HSGA 2VDWB 1F6BA 3FPLA 1FNBA 3OJ0A 4HWKA 4LOLA 4YPFA 2ORYA 3B1KA 4CF7A 1OWPA 1NYRA 3NKLA 3HS3A 4X71A 1J0EA 2JVJA 2C83A 5EMLA 3LX5A 4OQLA 2VDQB 3Q9SA 3NBMA 1Z26A 1U0GA 4KK4A 4NFSA 5AW5A 1EFRA 3W8DA 1DBSA 3ANYB 3ABQB 2GBIA 4OJYA 5C4IA 5DGHA 1QKIA 1KL7A 5EJ6A 3O47A 1X9HA 1VDMA 1J1ZA 5T57A 1Y6FA 1JDTA 2GR9A 3NT4A 4NU5A 3F7MA 4HDKA 2G9VA 3RV4A 1E1CB 3I0NA 3CXUA 5EIHA 1EZ4A 4DR2B 1BWQA 5DHQA 3EEFA 3LKBA 3PC2A 3QE4A 5DW0A 4MRPA 3TRFA 1ZHOA 2E55A 4PQEA 4DYHA 1ZNWA 4KQKA 2WJYA 1J06A 3CEMA 1N2XA 3U9TA 2BGGA 1DX6A 5LIPA 4AJ2A 1A7JA 1RAIA 1JHZA 2JAPA 3HCOA 1WEHA 1S5PA 1ZH8A 2EXXA 2JH8A 5G1OA 3T3OA 1PTKA 2CL0X 5TEVA 1FRNA 2XCUA 4J0CA 3UJDA 2XA2A 1XLVA 4EKGA 1MIOA 3IJPA 5GMOA 4OJKA 4A15A 2DUJA 2ZETA 3VGPA 1QYWA 1V8OA 3UYKA 2JAHA 4BQRA 3WBJA 2B30A 1RMYA 1JZTA 1QYCA 4HDNB 4MW5A 4MCJA 4X41A 2FQ1A 3BWMA 1R4MB 2FZLA 5A03A 3GVHA 3TNYA 2VHZA 2Y67A 4KDCA 2I7XA 4IG4A 4BY9E 3NHKA 2W6IA 2B1RA 1CSEE 3LUFA 3OFSA 3SDZA 4CUKA 4TVOA 3EOZA 4PPYA 3ZZMA 3UBMA 1Z7WA 3E22A 4JFAA 5DNEA 3WQHA 4IUDS 3QJGA 4KR0A 5B58T 2WOJA 3WLOA 2XCQA 4R68A 1MAAA 4F97A 2ILVA 1GFIA 3MK31 3FCCA 1P7WA 1BKSB 4IH1A 4OH7A 5LCXA 3OG9A 1XXHE 4MRNA 1FFGA 3L4SO 3I39X 3W9SA 4BUCA 4Q47A 3K9BA 3QFTA 2I1VB 3ER6A 4KQEA 2G36A 5B1HA 1T4GA 3FWYA 1J9ZA 4F4FA 2R00A 3KXDA 4O1HA 3ORSA 4JS0A 1BXKA 3CY6A 4OQQA 5DK6A 3HM9A 1WDWB 4NJMB 1GL7A 2DPLA 3MWEA 2VDLB 3ENVA 2X7XA 2Z57A 4V2UA 1BKYA 3CW9A 3DBLB 3H3FA 3DHWC 2PRZA 4O25A 1GZVA 3WDKA 4A2WA 3PYLA 1AKMA 4E7OA 4UU7A 1FSPA 4YJ2A 3EEYA 2OR3A 1JIVA 2J30A 4X1KA 1NNUA 3LCMA 4C6RA 1QOPB 2JLZA 4Z0PA 4UEOA 5H4GA 3OE5A 1NUPA 2XYRA 1SOWA 1XGKA 2HO5A 5AI4A 3Q5DA 3AF4A 2XWBF 5ER6A 5LWHA 1CIPA 3GELA 5ESDA 1RJWA 3EWNA 5E9QA 4HNAB 2V45A 2VC2B 4U02A 4WASA 2ZAIA 1IOWA 1I0LA 3CXRA 2YJ5A 5A3VA 1VJ5A 2K7ZA 4ZQIA 4UATA 4WMLA 4DC0A 2QLJA 4YMSA 2PIAA 3OIUA 4DIMA 2E82A 4L4ZA 3DG9A 3ZDQA 4LJ9A 3UGKA 4CNQA 2WB2A 3HV2A 2UKDA 1D6MA 3SQLA 4Y2HA 3V1NA 1S8NA 4YCDA 2BCEA 5AJTA 5E2BA 3SZUA 1KIMA 2Y0EA 4CMBA 5ITWA 1WVIA 4C1NA 4DMKA 1Q92A 1GRNA 1ZMOA 2V4UA 3HJTA 1IPHA 1KY5A 2RGYA 2Y99A 3BAZA 3FY4A 3BFVA 3OEHA 4P4LA 3ZHZA 1M5RA 3THOA 2NZWA 1PSDA 2HEIA 4YNBA 2I0FA 3BGIA 5CAEA 2NO7A 3NCTA 4JR2A 4C4ZA 2DHCA 4PLVA 2X0KA 4LXIA 5AM3A 5KTKA 1E1DA 1HFWA 4AI6A 4QG7A 5DM70 4ZKDA 3IQWA 3WQBA 4HNVA 5IVIA 3TUZC 4XVUA 1V1RB 2IFTA 5KTSA 4RKWA 1XCMA 1A9PA 4YP0A 3FMGA 3NMUF 1W581 2VJBA 5K8IA 3CNBA 1KKLA 5I7RA 2B1GA 3B1YA 4JYPA 1O9GA 4G8JA 1UM9B 3GFPA 5I9IA 4F1KA 3ONFA 3A6KA 1DP4A 2Y1GA 3OU2A 1UWCA 1QRRA 4Y0AA 1I32A 1CR1A 3ETHA 5EWLB 2D7CA 4M98A 2O8DB 2WM3A 3V48A 1H69A 2BFDB 3IBFA 1H2ZA 3EEOA 1IN1A 2QZZA 1QPBA 4FGZA 1XRQA 1XLTC 4BGVA 1TXGA 1YDGA 2ODAA 3H2IA 1N2ZA 5L4SA 3KCQA 4GX1A 4NBTA 1PR6A 2NNLD 3L6DA 3MIZA 3RFXA 1W47A 3WP1B 4YRBA 4DDVA 1P9OA 5TF0A 1MVLA 2AJBA 2H1WA 3BE8A 3D0RA 2D3TA 3EQ6A 3HR4A 4XGIA 1UADA 2ZUSA 1M7GA 4XXHA 2P9GA 5CEJA 1WVGA 3KKOA 4ESHA 4X94A 4N7JA 5EFZA 1YS7A 3L7JA 2HQOA 3FWHA 4BLRA 2ZUUA 5HJ5A 1ZNQO 2ZRMA 3D6FA 1E66A 4ND2A 4WOJA 3NC0C 4E4YA 5JXWA 1ISGA 1LEHA 3SC4A 2O3RA 4TRRA 5D5HA 1YFZA 4CKEA 4DDUA 1QVAA 5BURA 1WE2A 5GVRA 2PZMA 4ISCA 1FLDA 4GI7A 5CLQA 4JYBA 2UXDB 1T25A 3OP4A 4F5ZA 1EUYA 1QHGA 2XNDD 3GGGA 1N6RA 3JWPA 5LXTF 4BBPA 3H9CA 4XRGA 3UXMA 1Z45A 3QE0A 4L0MA 1JEAA 3U7IA 2JGAA 2O57A 1SJ9A 4AKGA 3O2JA 3FA2A 1FXWF 2CL6X 2FU5C 3KB2A 3OJXA 4QOGA 5CDFE 1EM8A 2BI7A 1FLAA 3DF7A 2FGKA 4YV0A 5E7IA 1LC0A 1Z2NX 3OLQA 1Z18A 2HSJA 4HAXA 4R5MA 2Q46A 3KM0A 4J3FA 4O63O 3QXXA 1D4AA 2QSUA 3ELUA 3TL6A 3R5JA 4LNUB 5IJ0A 2BH2A 1JDJA 3I05A 4DCTA 4J2OA 1VE9A 3IFSA 4UM7A 5HMMA 4JLWA 4MVJF 1UJ6A 1ULBA 2BWJA 3IVMA 3OQNA 2NU8A 1HRDA 1INLA 3U7JA 2R96A 5TY0A 1FFEA 4KHZA 2JL1A 1MJHA 2P65A 1PR5A 3BTUA 3T35A 3ELDA 3V80A 3CSUA 4E2FA 2FA9A 4J29A 4IXDA 4I8XA 1Z4QA 4ZVRA 4LZOA 4MV9A 4LS3A 4DM7A 3G5MA 2W22A 3RASA 3GZTB 1E96A 1NMYA 1WZIA 5IF9A 3R9XB 5BR4A 1YRQA 2E4VA 3GDOA 1IIRA 4K05A 4CU2A 4ZOAA 3NOQA 1TLLA 1E99A 4M1MA 4LMAA 4XQGA 4KIFA 4B34A 1FDVA 2OLKA 4UJ5A 4KR6A 3F1KA 2C5AA 2I1WA 4DDTA 3IQEA 1C3OB 5JIBA 2A0XA 2CXHA 2AWOA 2V7EA 2JFXA 3ILSA 4BASA 2A57A 1LSJA 4X64B 1E3IA 1U31A 2PL5A 3L7IA 1O3YA 1QYRA 1GSOA 3H17A 4FR0A 1XMPA 4OBEA 2YVUA 3SDBA 2NO6A 1OGYA 4ZT3A 1QORA 3ETGA 1H93A 5B12A 5LU8A 2WUGA 5T64A 3QF7A 1Z6QA 4C4OA 4YAJA 1B8PA 2Y1KA 4G0QA 2QHXA 2Q1YA 2Z95A 3THYA 3FWZA 5B7NA 3JQ8B 5BSFA 1NW8A 2FW0A 1FUIA 2V1XA 1JJAA 1RYHA 2XITA 3MEQA 2C0CA 4LDQA 2W8BB 4LDPA 1E3LA 1YQXA 4X8OA 2G25A 5BSGA 5UKDA 3T3HA 3T15A 4MQEB 2RHJA 2HZBA 3GMSA 5E6UB 1U3TA 1UK7A 4QASA 4O33A 4E21A 4QBTA 2GNAA 2ZYDA 3PQ2A 4ZAWA 4B3DA 1VKNA 5BN5A 1RPJA 2EARA 3IC5A 5TQ0B 5GIOE 1B3RA 1DADA 3ZIAA 1D8AA 3PFNA 3FTDA 3SKYA 4ALIA 3PFCA 3I2YX 3EX7C 4Q01A 2VBIA 1JSLA 1XK7A 1ZD9A 1N2BA 2XJ9A 2X7JA 2ZE7A 3DTNA 1U0TA 4MS3A 4AUEA 4K28A 2DSNA 3H75A 4NXNB 1JKMA 2EJTA 2ZATA 3C6ZA 3EQ7A 3E5NA 1N5MA 2XQIA 2UUOA 4FLFA 1XTUA 4LHEA 3V1YA 1QP4A 4MDFA 2EWMA 1E69A 1MFZA 3MGCA 4LRXA 4PV7A 5AVRA 2D74A 1LU9A 4KL8S 2ZTSA 4D3DA 5JLAA 1XYVA 1BAPA 3FVWA 4YRRA 4Z8XA 4AY2A 2I91A 3WKCA 3UAVA 4F3TA 3QHQA 1NUSA 4BLQA 1XVIA 2ACKA 2J09A 2Q3DA 5CT6A 1G4AE 2AI1A 3L7MA 3L7CA 2YWXA 1CS0B 2PNFA 2JCXA 4L8WB 3TSZA 2XKKA 1RZRD 3ELBA 3R5SA 1ZM2A 4N39A 5DSXA 5K3CA 3R7WA 3AFMA 5DNCA 5KTTA 4IDBA 3TFQA 1A5BB 3EGXA 4B8YA 1ENYA 2IXGA 5K4AA 6PFKA 1ISSA 3LPNA 2ORIA 5HZGA 1LVUA 3H0KA 2DERA 4EJSC 4L1KA 3UWDA 1G98A 1ABBA 2JPDA 2O3TA 2R6HA 4UEQA 2G80A 1RYNA 4LZNA 4MITA 1L4EA 3VUFA 1B4DA 3OQBA 4URFA 4FCWA 4EZIA 2A9QA 1SGWA 1MB3A 1WHTA 2HNAA 3H1BA 4GOOD 1SC6A 3KJNA 4JJGA 4LIPD 4M8IA 4R98A 3JV7A 5AICA 1AK9A 5LDGA 2B37A 3ZE1B 5IHPA 3K30A 1QAOA 3WZMA 3OZRA 4Z4GA 3OAAA 2PUFA 5E1BA 1UBOS 4TS4A 2NXWA 9ABPA 1G63A 3CR3C 4QAJA 2BP7A 4R8MA 4P86A 5CXSA 3WA6A 2F55A 4II2A 3WGIA 2J45A 2UVPB 2J33A 5EE9A 3E81A 5EJFA 4KO1S 2CHFA 1LDBA 3CF4A 1I24A 3IT3A 4JP1A 4LYAA 1IRXA 4OL0A 5BN4B 1V8ZA 5I45A 1AM4D 1CZHA 2YZMA 4F56A 2VQEB 4PCVA 2P9EA 4PNHA 1VMIA 2X5KO 1UJ2A 2RG1A 4JI1B 3K0HA 3KWLA 3RJ9A 1OD6A 3MMNA 1UXIA 3QVVA 4JR0A 2Q5CA 4KXVA 4FCVA 4P3KA 3CNEA 1JHYA 1TECE 2FW6A 3H87A 4RUKA 1CUDA 5JAIA 1XT6A 4NOLA 2CBZA 3RG8A 1Z7BA 2OL4A 3D5EA 3WNDA 1OTXA 3WYBA 4TTPA 1LH0A 2B35A 3SIXA 2C57A 4OXYA 1A50B 2NG1A 5IWCA 4JYZA 3MLBA 3QI7A 4IJWA 3SFTA 4CLRB 5EIEA 5L6MB 2NTEA 1ISMA 4HGPA 4OFXA 2WZCA 1V11A 4DGSA 2OHIA 4RWEA 1BDJA 2P1ZA 2PXCA 4OK3A 5C5CA 1QQBA 4UHEA 3QFFA 2HIMA 2Q6OA 5IS2A 4L4RA 1N78A 3AR7A 3VYRB 1Z16A 3VNUA 5DIFA 3QH4A 1M67A 5JY6A 1FOEB 3ZV6A 3BRQA 4UQLA 1TT5A 1O97D 4INPA 2GERA 2HLDA 4XKJA 3VMFA 3HCDA 4AECA 2XUHA 1GNVA 5EMNA 2IBSA 5JAZA 2VR1A 3M4YA 2VK1A 3B60A 3GUUA 3OTQA 2FQXA 3C3KA 5EFOA 5BVGB 2GNOA 3B48A 2FSHA 5H02A 1HV8A 1B73A 1SG0A 4C03A 4ZHQB 4DLKA 3C87A 4CDNA 5DV9A 2ZM6B 4MICA 4L85A 3TNLA 4JBNA 3DB2A 2CZQA 3V9AA 1B6TA 1QIMA 2GJSA 3K0AA 4RPHA 1RBQA 1ZOIA 1I6LA 1M0SA 1RRMA 2R5WA 2VNSA 4MGKR 2HGZA 3EFEA 4BLOA 3I9LA 1DOAA 1GQRA 1Z4LA 3OPVA 1E5QA 2JGJA 3JQGB 1GSAA 1P6QA 4L6AA 3U3XA 3W6PA 4C7KA 5KSWB 1RM4A 1SC3A 2ZJAA 2Q2VA 2WUDA 1NI3A 2ZULA 3IP7A 2DQYA 1KSGA 4ENQA 2EW2A 2GFIA 5JQGB 1B93A 1VP3A 5BN3A 3NEYA 5KYWA 1WTCA 5E9AA 4E5VA 5BR8B 3GCGA 4FU0A 3L0IB 3JRXA 1C7FA 2R66A 1OKKD 2UYOA 2V5VA 2VZ8A 1JQ5A 3KT0A 3DMNA 3FPBA 4I6JA 3TPFA 4AQDA 4D6PA 5CNMA 4JXZA 4WKPA 4U2BA 2QV7A 3ZGYA 3ZZ0A 3A32A 1DC5A 1KR2A 1U4SA 1Y9AA 1NMQA 4O29A 1BRMA 1C9YA 3WHLA 2PZGA 4I1VA 1H2EA 3AV0B 3K1JA 3PUIA 1XX6A 5JVDF 1TTPB 1AKNA 1M54A 4TRMA 1E98A 4YUVA 5IM4A 5E2AA 1N36B 5H82A 3TZKA 3M9LA 5J47A 2ZIEA 5JS8A 4AYXA 3UH1A 2EIXA 1QO7A 2RKOA 2XNCA 3EIOA 4DJDC 3WADA 1B42A 1BQ3A 1QQTA 2YC2C 3IULA 4MS1B 4QAQA 3IUEA 1BVHA 1JKJA 2FWMX 1GEGA 4CL2A 1GKKA 2AQHA 4X54A 3HFRA 5AQEA 4LQ4A 2ZUWA 4AF7A 3W3AD 1RXCA 1ORRA 3B7GA 1KAMA 1PW7A 3IO3A 1E94E 3MIIA 4XIGS 5FDFA 2I55A 4IHJB 2HY7A 2N42A 4IAOA 4RZSA 1GEEA 4ZCSA 4MQ4A 4MWTA 1GZHB 4JDPA 4DLZA 5BW6B 4F91B 2GPNA 5ETJA 5FBHA 3ZIDA 4EARA 3VZQA 1ZBQA 1COWD 5LA6A 4J1NA 2WMNB 1K2WA 1SHZA 4LG1A 3DDNA 2ZBEA 4TTTS 3ADKA 1SOUA 5ESRA 3TKLA 4DWOA 4EY4A 5CVTA 4HAUA 2IYQA 2NADA 2YV5A 3WNBA 4Z9FA 5A5FA 4JROA 1SG9A 2XQFA 2VDMB 4AXXA 4WOPA 4E5PA 5EKTA 2CY0A 4PYNA 4HWPA 3KJFA 5A6SB 2EL9A 5HUQA 3ESCA 4V0NA 4XEUA 4L73A 4RXTA 1IM8A 4TMTA 2GTIA 3M6XA 2ZVDA 3J80A 4RCYA 4C20A 3JZAA 3KT3A 1IDN1 5GZ6A 1XDWA 4QELA 1YZLA 4M6WB 4ETIA 4I7EA 3QNWA 3ZD6A 1OLXB 3ZHBA 2B20A 1BOOA 1TT7A 2IHTA 2OE2A 4G5XA 5I5GA 3OJCA 3LIIA 4EVIA 1WMEA 1R18A 2BONA 3CRVA 1P7PA 2XB2A 4ZYWA 1CZKA 1Y89A 4RHUA 2C9OA 2QBYB 1VL0A 2F8LA 3BMCB 1BO6A 3QU9A 4JHXA 3L84A 3KIPA 4K5QA 2LCIA 4ITUA 4GX0A 5IUKC 4QPPA 2Q8NA 4CG3A 3BJMA 2YQ4A 2ZWAA 4HXGA 1MB9A 4PTZA 1TA9A 4X6YA 3UIEA 2IEZA 4MUFA 2O8CB 4H7DA 5DCUA 1QFSA 2PUTA 1T36B 3AW8A 4Y1FA 2IUYA 4LYFA 2B34A 3DTVB 4MQFB 4HFJA 2FN3A 3H3JA 4NWIA 6ABPA 3S1AA 3UCEA 1IJEA 3C98A 1TEZA 3FW1A 1NE7A 4HDCA 3WLJA 2J5BA 3QNUA 2Z2JA 3E2MA 4GU5A 1KNXA 1Z68A 4TS3A 2C5EA 5DLYA 1DO0A 1Z08A 1YB1A 4DM4A 3TZCA 3H5RA 1SRRA 3PEUA 4KYIB 4OHYA 3HE3A 1OFGA 2JJ2A 3IPAA 2OUKA 2V65A 1NVXQ 4PSDA 1N5RA 1H5QA 3EQ9A 5A05A 4JXXA 4NEQA 4WN9B 1ZC3A 3MJVA 5D87A 2AXPA 3FX2A 5KAMA 5LP6C 2PT5A 3GOHA 3ZTTA 5FI1B 5BO5A 2D0OB 1I9GA 2P30A 3CF2A 3F6SA 2PTGA 1SCBA 4PBTA 4TQAA 2BL4A 3BJRA 1V9SA 4M7PA 1L3CA 5EP1A 4MQ5A 3T9DA 4BO2A 4B8WA 1QC5A 4TL7A 3DVQX 4CMIB 5IFLA 4OKNA 3Q15C 4YJ3F 1A9ZA 2BFFB 2WZDA 1WUJS 4WZAB 1ZKDA 2XUIA 3GY0A 3ITNA 3NRBA 3GP8A 1YU6A 2JHPA 1Z4PX 4XGNA 4CETA 1NBIA 1Z17A 2YWEA 1I10A 5BR1A 2O8BB 4NR0A