3QHPA

Crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
159
structure length
159
Chain Sequence
TPFKIAMVGRYSNEKNQSVLIKAVALSKYKQDIVLLLKGKGPDEKKIKLLAQKLGVKAEFGFVNSNELLEILKTCTLYVHAANVESEAIACLEAISVGIVPVIANSPLSATRQFALDERSLFEPNNAKDLSAKIDWWLENKLERERMQNEYAKSALNYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from Helicobacter pylori
pubmed doi rcsb
molecule keywords Type 1 capsular polysaccharide biosynthesis protein J (CapJ)
molecule tags Transferase
source organism Helicobacter pylori
total genus 62
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3qhpA00
4F96A 3NB0A 2H1FA 3HBFA 1GPAA 1Y8ZA 3MBOA 2QN9A 3OTGA 3C48A 3GUHA 3D0RA 1WV1A 2JZCA 2AMVA 2OFFA 1EXVA 3CUWA 1PNVA 3WC4A 1KTIA 1LWOA 4MICA 1C8LA 1JEJA 2IW1A 1ABBA 3NC4A 4WADA 4MI9A 2O6LA 4EKYA 4BFCA 4YI5A 1NOKA 3S28A 3WADA 2X0DA 3G2NA 4X7MA 4CTOA 5IKOA 4AY6A 1JG6A 5BNWA 3MTDA 3MS2A 2QLLA 3NP7A 2QN3A 1XC7A 3TSAA 3G2HA 1WW2A 2QN8A 3L7AA 1PYGA 2QRMA 2IV3A 4MHOA 3RT1A 1RZVA 2GPBA 4RIGA 2VG8A 2IV7A 1B4DA 1GPYA 1NVKA 4M83A 2G9RA 3EBOA 3Q3HA 1WUTA 2XGSA 4W6QA 3O3CA 1AHPA 2XA2A 4MHSA 3T3DA 2SKDA 1JIVA 3NCHA 9GPBA 1SXPA 4KQMA 2XCUA 3CEMA 3T7DA 1P4JA 3E3OA 3TAXA 3VDMA 3VUFA 4L22A 2HY7A 4WACA 5GPBA 4QLBA 1FU4A 2GEKA 4Z5XA 2XGOA 3CUVA 3WAGA 1L5WA 2H1HA 4X7RA 3G2LA 2F3UA 2C1XA 1NZFA 1P2GA 4M60A 4RBNA 1YA6A 4GZ3A 1P29A 2AW3A 2XGMA 2IYAA 3NAZA 3ZCSA 4HWGA 2Q6VA 3C4VA 1C8KA 2PRIA 1FTWA 1WW3A 2R68A 3MT8A 2X0EA 5HXAA 2ACVA 1C50A 4YUAA 1NLMA 3MRTA 2GPNA 1QKJA 1L5SA 4N3CA 1RZUA 3BD7A 2WTXA 4YI3A 1FC0A 5DXFA 4F9FA 1M5RA 3MT7A 3COPA 2ATIA 3H4TA 3OKAA 5ENZA 2VCEA 3AMVA 2ACWA 3G2KA 1XL0A 1E1YA 3QKWA 4MI3A 2AV6A 2GJ4A 2VSYA 3L79A 1JIUA 1P4HA 3MTAA 3MRXA 3MSCA 4GZ5A 3L7DA 4N3AA 4AY5A 2PYDA 3OKPA 3E3LA 2VSNA 2R60A 3SYRA 3MS4A 2YJNA 1JIXA 3MRVA 3BDAA 2QLNA 1Z6PA 2X6RA 4EJ2A 1XV5A 1F6DA 3CX4A 5C1DA 2QRHA 3E3NA 4KQ2A 3RHZA 2BGTA 5TMBA 3H4IA 1E4OA 3CUUA 4LEIA 3CV3A 1XL1A 4MI6A 3ZCVA 1L6IA 1SXQA 1WUYA 4M7PA 1H5UA 4EL5A 3T3HA 1IXYA 5DLDA 3D1JA 1P4GA 2QRQA 3DDSA 2G9VA 4FZRA 1GFZA 1PN3A 1YGPA 3MS7A 3BCRA 2QRGA 3L7CA 2QRPA 4X6LA 1NOIA 3DZCA 2G9QA 4CTNA 4N3BA 2G9UA 3CEJA 4N9WA 4GYYA 3CEHA 1WV0A 4LDPA 2QZSA 4AMGA 4XIFA 1P2DA 2IEGA 4CTMA 2ECPA 1F0KA 2QN7A 3RSCA 3NP9A 2BFWA 2R4TA 5TMDA 5JTTA 1K06A 1V4VA 3IAAA 4PQGA 2X0FA 3OY7A 3OT5A 5JTUA 1FTQA 3L01A 1XKXA 4NC9A 3EBPA 3SYMA 2QN1A 4N39A 3OY2A 1J39A 1PSWA 1Z8DA 2P6PA 1FS4A 2F3QA 2PYIA 4NESA 1GPBA 5D00A 4RENA 4RIEA 5LQDA 1GZ5A 4WHMA 1L7XA 4BQFA 3BEOA 4MRAA 3PE4A 4RELA 1Z6QA 4RIFA 2XCIA 3ZCPA 3DD1A 5DU2A 1Z62A 3Q3EA 2ASVA 3PE3A 3RSZA 3CUTA 2JLBA 3NPAA 2BISA 3IA7A 1GG8A 3G2JA 1L5QA 1RRVA 2KS6A 3OTHA 3S2UA 3HBJA 3DDWA 2ZB2A 2QN2A 1BX3A 3T5TA 4RIHA 2C9ZA 3VDNB 2GPAA 2F9FA 2SKEA 3T3IA 1UQTA 3ZCTA 1UZUA 3QHPA 4G2TA 3OTIA 1L5RA 3Q3IA 2FFRA 1NZDA 5TMEA 1EM6A 2GM9A 2GT1A 1O6CA 4BQIA 3MTBA 3OKCA 2XA9A 2FETA 3VUEA 3TOVA 1JG7A 4RIIA 1FU8A 5I45A 2JJMA 1FA9A 3G2IA 3ZCUA 2C1ZA 4EL0A 3MT9A 3L7BA 4EKEA 2IEIA 2X6QA 5IKPA 1A8IA 2R66A 4KQ1A 1QM5A 4GYWA 2XMPA 3FROA 3UYKA 2SKCA 4BQEA 2GEJA 5D01A 4REMA 3UYLA 1FU7A 3HBMA 4NEQA 1VGVA 3C4QA 1P2BA 2IYFA 3BCUA 1AXRA 2R4UA 1FTYA 1LWNA 1C3JA 2QNBA 3BD8A 3BCSA 1GGNA 3MQFA 3S0JA 2PQ6A 4AMBA 1K08A 1Y6FA 3CUYA 3T3EA 3HBNA 4X7PA 1XOIA 2AZDA 3S27A 1L5VA 3ZCQA 1IIRA 2IUYA 4AN4A 2QLMA 4FKZA 2FF5A 3T3GA 1HLFA 6GPBA 5TVGA 4F97A 2BGUA 2VCHA 1NOJA 1UQUA 4HLNA 2XA1A 2F3SA 2PRJA 4CDRA 4GZ6A 3D0QA 7GPBA 3S29A 8GPBA 4GPBA 2C4MA 1Y6GA 3BD6A 3ZCRA 3GPBA 2F3PA 4XI9A
chains in the Genus database with same CATH superfamily
4BGVA 3EEYA 4R1MA 3MUEA 4MCIA 2XHZA 3BD9A 3OPXA 3Q7IA 4PGGA 5EXEA 5B7GA 3I05A 3JWGA 2E3JA 3SLRA 1OAOC 1CNFA 3LZ6A 2CHEA 2XITA 4G0WA 3C7KA 3WZLA 5LIPA 4QRIA 3OZRA 4DJEC 3BSFA 4Q9KA 1O6FA 3NIFB 4HOYA 1ODTC 2F1JA 2HF7A 3DWIA 3N87A 1TA0A 2XF8A 1SH7A 1RQLA 1X8KA 3QEMB 4IR7A 1DBSA 4RE5A 4XSVA 4L9SA 3MVEA 4YJ3A 2C5FA 2P0AA 1E1QD 2PK3A 3FZGA 4ZQIA 1O57A 3T5CA 1USGA 4XX0A 2SCUB 2CLLB 16PKA 2ZIAA 5G4KB 2GNAA 1MA3A 4PYOA 3U26A 1SVNA 3ZV7A 2GJAA 3GC6A 4IIEA 2XODA 3FR7A 5B1IA 3UG7A 4ZCRA 1EXVA 3CUWA 3AINA 1G5FA 1N0IA 3LBAA 1PWXA 1PGPA 2FWBA 4UDNA 1LWOA 4FTWA 1VBNA 1OIVA 1IWOA 2YJGA 3LV8A 4DADA 1SURA 2UZ4A 3F5DA 2JDID 3L05A 1XNHA 3G23A 1AT1A 1GCGA 3MMNA 1NATA 4NG4A 1VKRA 1TUEA 4P4SB 3QVJA 2MMGA 3UF0A 4DFDA 1OWNA 3AFGA 3E22B 3FMOB 3QH4A 1ORWA 4UUBA 2W4IA 1G1MA 1Q0LA 1WQ1R 4FJ0A 4UUNA 4BO7A 4YJFA 3WK9A 4BVBA 5KOJA 2GYVA 1SXJA 1Z4JA 2GRJA 4N0PA 4E21A 4LOJA 2AFHA 1Z5WA 4MDHA 2ZJ7A 3EMKA 4YUYA 3G9UA 3NLLA 1YIDA 3T9CA 3V5NA 2IYNA 3BE4A 1W2WB 2PMWB 2Q3BA 1ZP6A 3A6KA 3ANNA 5EJ9A 5JADA 2QM7A 4G5OA 2GO1A 2CXNA 4OLAA 2P75A 2P68A 3CN7A 4Y0AA 3OX4A 1VJGA 3GOQA 4D9BA 3QLUA 2A3NA 3G2HA 4ZAGA 1QYIA 3BIOA 2PD4A 1P39A 3IMKA 4JT4A 3SM3A 3U9TA 3VNRA 2YVLA 1MQ8B 4R7TA 3HKBA 1QLHA 3R7NA 2X0JA 3ESDA 4FCCA 3RH0A 5FOSA 4CKBB 4D9NA 1RZVA 4RTLA 1I4LD 4ARSA 4ZZIA 4ZTZB 1DC3A 2CJFA 1S2IA 5JS6A 2IH5A 1EX1A 1XP8A 4FFPA 1EVZA 5K01A 2F67A 3O0TA 3HPRA 4YWJA 1SCKA 3PQCA 5FT9A 3LNCA 1NYRA 4YXWA 1QONA 1JQJC 2QVBA 1HE1C 4GI7A 4TM7A 1A5TA 1BE8A 3LCCA 1OH6A 4X44A 2XGSA 1EIWA 1GCOA 2H0AA 4Q7MB 5KKAA 4KITB 4DIOA 1W93A 2A35A 2RGWA 4N76A 4Z9XA 3AUKA 4XX1A 3T3DA 4LHEA 1W1UA 2FQYA 1IAQA 3L7LA 4LJAA 1OUMA 2B35A 2DQSA 2P5TB 1UJNA 2D74A 1ND6A 1ULTA 3MAGA 3O8OB 1T15A 5K4HA 5KSWB 2HCJB 1CUYA 5SYMA 1KKLA 1KSFX 1ECLA 2QDKA 4XWTA 4RTOA 4LSMA 3Q7QA 3DNPA 4PF1A 4R31A 1U02A 1RJ9B 4OJYA 2GN9A 5GPBA 2BFMA 1JUDA 4Q4CA 1D4ZA 5HZMA 1C14A 4R01A 5A4MS 1TQDA 4ND1A 1Q22A 2VTKA 2P6UA 4KSYA 5ARDA 3RNLA 2J5QA 5ITZB 4ZMSA 5LU9A 1IDOA 1E5VA 2Q99A 4PAQA 2CCGA 3IQEA 1P2GA 3JWEA 2F1KA 4HTAA 3PUXA 5E3HA 4PC2A 3CLUD 1XLTC 2GZSA 2J7PD 4UDYX 3VYWA 5TR9A 4DMFA 4ZANA 2V6IA 1ZMBA 1YJ5A 4FK8A 4TTIA 2XB2A 4JC8A 1HTWA 2ZKLA 3HM9A 1HOXA 2OHHA 2WIAA 2EJWA 2VH1A 3ZCSA 3LDGA 3AVPA 1I7NA 2H7VA 4QBKA 5GONB 3WSVA 2ZJYA 4I3HA 1VLJA 2QN6A 2CB9A 5HIKA 2VJCA 3K2IA 4KWCA 2HSGA 4F6LA 4C4SA 1I5OA 2BUBA 5T3YA 3IVMA 4EPTA 1SN7A 3BMCA 1E79A 1YS4A 2NSLA 1HT1E 5LVAA 2I1WA 4B6GA 5DNAA 4P08A 7ABPA 4JB2A 2E5FA 1JE0A 4LTDA 3ND8A 4M0CA 5J9FA 5CD1A 1FLNA 2CYCA 5DNVA 4YI3A 5CBPA 4YRPA 5CIYA 3E27A 3ZH9B 3RSGA 5CFMA 3J81k 5EIWA 5THXA 2EW2A 2PKEA 3P94A 2YHBA 3AKYA 2OENG 4OKSA 4TYMA 4NBWA 1JPNA 4C3VA 3O1JC 1DHRA 5D5QA 1Z68A 1ZRNA 3AFMA 4M49A 3UGKA 1EK6A 3VR2A 1LTQA 1PKXA 2IF2A 5HQJA 4BE9A 3E58A 4MI3A 4M1WA 1N7JA 1JHOA 2VSYA 4TVKA 4OKNA 3G2MA 3T3OA 1O6GA 1RYZA 2HREA 1J0DA 3HG7A 2VK8A 4PGMA 1NGSA 1JHUA 3VZRA 1KMNA 3ZQKA 1XD9A 1LSSA 1EWRA 5IARA 1EK0A 1S9DA 4RVCA 2A1IA 3KQHA 5IANA 2ASEA 4YAOA 1V71A 5KINB 5IS2A 3UFXA 2ZI4A 5AW5A 5DT2A 1ZUWA 3D4IA 2BGLA 3BRWD 1XT6A 4PRYA 4NOKA 5EHZA 2Z6UA 3KC2A 3W4IA 9MHTA 4KTTE 2WAMA 4EJ2A 4EVRA 3DEZA 1AVTA 4XIIA 5E6UA 4EZEA 1JT9A 2C4KA 1BVUA 4CUZA 1RT9A 3KFXA 4XJTA 4MR7B 4DCVA 3CQ9A 3H4IA 5I8WA 4EQ6B 5THQA 1VDZA 3V34A 5EPUA 4FBGA 1YZYA 2FW8A 3VJLA 8LDHA 3V7YA 3JRWA 2NWQA 1FP7A 2A9OA 1H2RS 2XI4A 3CMMA 1RYYA 2FZVA 2H5JA 3AEXA 3IVXA 2G82A 1B26A 3DUFB 1VBKA 3FF1A 5AI8A 5AKYA 5FIUA 5K8LA 2PR7A 1M75A 2AN9A 2C31A 1E0KA 1WUYA 2AI3A 4LHWA 2G07A 3NEJA 4WQMA 3BJMA 2AR7A 1OIXA 2VNAA 3CZQA 3OF2A 3PQ8A 4H7HA 3GLFE 3GQBA 1HGXA 4B81A 4WK0B 2VH2A 3PNBA 1L2TA 3GPLA 2X8JB 5TEWA 3ZGXA 2CKDA 1UP6A 2AIRA 2V45A 3C3JA 3EAQA 4HF7A 4UULA 2AJDA 5FWDA 3TRDA 4EWLA 3O4RA 3PS9A 3NV7A 4XWKA 1BHJA 1W48A 3OMWA 4E5MA 2O3TA 4J1SA 3LP8A 4LV8B 2PN1A 3LG2A 2FZCA 3HGMA 4Q9LA 3AFIA 5B3AA 3Q3GE 4R8SA 2YNMC 1JJIA 3L0ZA 2ZB8A 1M9NA 3HEAA 2X1HA 4MKRA 4CM4A 1M54A 1O4VA 3MXTA 5JZMA 3PSHA 4KC0A 4QPZA 4TS9A 2DPXA 2IEDA 4MKGA 5DK4A 3SI7A 2NVWA 4J2TA 5LQAA 1JLLA 2YV1A 1GUBA 3H16A 3UJCA 1LBEA 4HNTA 1JIJA 3PXAA 4N3NA 3TPCA 5IXJA 1EFAA 3BDVA 5EINA 5DMHA 4TN1A 5C4IA 4YMWA 1LF5A 2WP0A 2Q0HA 4E5NA 4IJQA 3WJ1A 1YKFA 4CTMA 1ZMXA 4UBLA 1F0KA 2R2AA 2I3GA 3E8SA 3H11A 3JQ8A 4EO7A 1NKTA 1Z47A 2B4QA 4JLSA 3GNLA 1XELA 2GMWA 3QG5A 5E7IA 4M22A 5IH3A 2WYOA 1DJPA 2Y0EA 3U3KA 1BOOA 1RKXA 4AZ0A 4BUJA 3JZFA 2E4XA 1V5EA 3VZQA 3KSDO 4JH0A 2GJ9A 3KTDA 1DAIA 1GPDG 2D2FA 1U3CA 1SBCA 1V7QA 2IGTA 3MJFA 4CPDA 1JF8A 5D5PA 3BFKA 1UK8A 4P4UA 4C7OB 1TQ8A 3RRNA 1J5XA 2ZULA 1OLXB 4FZJA 1P2FA 2HJWA 5E2AA 1X19A 3JALB 3LKZA 3OY2A 3U40A 3VISA 1OZ0A 3VX3A 1YC2A 4RZ2A 3V2UA 4A23A 5BUSA 4ZI7F 3ADKA 1GQYA 2A30A 2J5BA 4PU0A 3IDOA 1OWMA 4I5DA 5T6MA 2AR9A 2Q62A 2PDAA 2XTMA 2RKOA 2RK3A 1EDZA 4WGGA 1BA3A 3LCMA 3ZWAA 4ENRA 3QFSA 1SULA 3JQ9C 4FDVA 4MO9A 4NRDA 521PA 3H2GA 2IBSA 4JNCA 3NBZC 1LNSA 2YCBA 5DNEA 5FBVB 3TRFA 2PX4A 1ZJ5A 2I4NA 5FDFA 2FN4A 5HRCA 2QAGA 3OVMA 5EE5B 4B2LA 1WEHA 1XVIA 1YR9A 2MSWA 3F8SA 1JEDA 3BC1A 1M34E 4IZOA 3DB2A 3AM5A 1T9BA 4YT5A 4BX8A 4EMUA 5KYNA 1H2EA 1EFTA 3A3OA 3OCUA 5TT1A 3R7AA 5EVJA 3ZWVA 2GWHA 4Y67A 3AFNA 4CV2A 1LC0A 4AWXA 2Y4OA 1SG9A 4N9QA 1JX6A 2LR0A 1N5JA 2BISA 3G2JA 4DA0A 1N2IA 1G6HA 2AOTA 2PKCA 2WJWA 2PS0A 3RJMA 4LUCA 2NU9A 3UENA 3S2UA 4G9GA 4NAUA 2VF7A 2O3SA 5LMNB 2CXPA 5DW0A 4Z4IA 2FWPA 1RE0A 5A5VA 2B2XA 1X74A 1HF3A 1H8ED 1CRQA 4DQKA 1FYDA 4ENSA 5K5EA 5K4GA 4IS3A 3D2AA 4I6JA 4L5AA 4RIHA 1YI8A 2WD9A 3GJ8A 1CU1A 1M6YA 4TL9A 3VDNB 4OHXA 3FB1A 1CQJB 5CHYA 2OHXA 1Z5UA 4GOKA 1KORA 4NAHA 3FKJA 3KQTA 1V8OA 1T24A 2MR6A 1AQUA 3HA7A 2ODEA 1N2EA 2ISCA 2WYUA 2FU5C 2XT6A 1CQWA 1JG2A 3PCXA 4QYIA 1BYUA 1QQ7A 3KEOA 2FRDA 4HJRA 5CX1A 4EGFA 3BXZA 1A9QA 3HNRA 5FO1A 1Z5VA 4UE3S 1DUIA 4K6HA 3CTPA 2GA8A 2A0XA 4PWZA 4TUYA 2EKQA 4MUHA 2FCRA 3G0HA 2ZI7A 4QG3A 1KQ3A 1JEOA 2E4AA 4D44A 2R7NA 1PZFA 4CGYA 1MVOA 5JNRA 1MH9A 4OXYA 5K0EA 1G3QA 3THWA 1OLSA 1SBQA 1WL8A 5KVCA 1ZYUA 5IVPA 1A88A 4OG2A 5LFAA 1JG3A 1BE0A 4QSMA 4G26A 5CVVA 2DPHA 1YSCA 4LDZA 4OEHA 3CHYA 3HN2A 3GPCA 3ANSA 2FMUA 2PUDA 3DO8A 4G0ZA 3ID6C 3LO5A 3ZVMA 1QQBA 2BHLA 3PT9A 1XPUA 3TJMA 1IL0A 3G9TA 3JZMA 3G89A 2IOYA 4JQOA 2IE0A 3L7BA 1UBEA 4KGDA 1KYYA 3NALA 5IKPA 2O2EA 1ZUD1 3TZ6A 3WYGA 2H51A 2OSBA 2VSFA 3KEGA 1YQXA 3R4VA 5CEJA 2BE9A 2J1LA 4JOQA 2O8BA 5L9AA 1L5YA 1WXIA 2YHSA 3KSZO 1H0SA 3QU7A 4O1IA 5HBRA 1Y37A 5LZ4A 1WCV1 1ECJA 1MO4A 1D0SA 5G0WA 3OM9A 2VQ3A 4R2XA 3TR0A 2PFKA 1VECA 2PUVA 1M8GA 2NZYA 4HC4A 4WDQA 4OO3A 3OZWA 2NVUB 2R4QA 2XQJA 2K7FA 4BCBA 3AHFA 3HBMA 1A5SB 3QEKA 1EUYA 4KREA 1L4GA 3FB4A 1YL7A 2VAMA 1H6AA 3F6PA 3FFTA 4M2LA 3HV2A 4W1QA 3AH8A 5DIZA 3I9NA 3O8DA 3PFIA 4KH0A 3L8GA 4W1SA 5C34B 3V48A 4EVQA 4NCIA 2ZXUA 1QRUA 3OIUA 4IIJF 2ZI6A 3G5AA 3PIIA 2EHDA 1UOEA 4NFLA 1ORRA 1TMKA 1V6CA 2Q5JA 1YBAA 4F21A 5F1YA 3U48A 4DQUA 1KRWA 4XJXA 1L8AA 3ZDFA 2FEKA 3R3WA 3U4CA 3BCSA 4PNZA 5FPTA 4Q1EA 1O87A 4U2KA 3ZY4A 2XUZA 1U0JA 3S8MA 2H1OA 2R8ZA 3K3PA 4X7PA 1Y82A 3G88A 1QS0A 2RH9B 4YXWD 4WK4B 5LKRA 1FDIA 2DX7A 1L5VA 1R6AA 2QZ4A 3C7TA 3FPJA 4NYJR 1K7FB 2PV0A 3ELBA 4BV2A 1BC5A 1NR5A 1MV8A 1RKVA 1UEJA 2Q3JA 3PQDA 4OFXA 4Q4JB 2FP4A 2OZLA 3WFJA 1GRCA 1NUQA 3GLHA 4L1KA 4WZBB 4A5SA 5F9MA 3IJEB 1FFXB 1U7PA 2HMAA 5AHRA 1OXTA 4R7GA 5AVRA 5JXWA 5AM5A 2DEUA 1M1YE 3EVAA 2CXTA 1VL6A 2H5IA 5CNMA 4IF4A 1KQOA 3KOXA 4QTXA 1VCMA 1Q6ZA 4NY1A 3KO8A 5KYYA 1DIGA 2BGUA 3NHBA 3NHUA 4FXPA 4Z7QB 4CKCB 5CYGA 2IIQA 4AZVA 2XE7A 3NHYA 1U98A 1QZUA 1RWOA 4RY9A 3RIYA 3T1OA 2Z08A 4CV3A 3ZTYA 1U8FO 4IG4A 5KTKA 3C8MA 4GZ6A 4KQGA 1DKOA 1N2OA 3IAM1 3O4JA 4E1AA 3D0QA 1ZH6A 2NO9A 2P11A 5L3SB 4I6EA 3PSAA 1X1RA 3DGEC 1EUCB 1Q92A 2YYSA 3B36A 4OYLA 4CR8A 2J4DA 3N0TA 3B9QA 3M5CA 4PSAA 1N8TA 3N2KB 1VCNA 3ONFA 4BGDA 3AL0C 2BGKA 5FORA 4LF9B 3GD7A 4LTMA 1MC8A 2IYQA 1K5GA 1MOQA 1ZH2A 2K7ZA 4R9UC 1UP7A 1OWLA 3BGWA 5IVDA 3QUAA 3SQNA 3WZ2A 2PWAA 1PT6A 4WBSA 4AN1A 4DV1B 5JNVA 1I4DD 4JJKA 3WJAA 1CNEA 3MGAA 4GPTA 2AMVA 4XLTA 3RSFA 4C4PA 2H3EA 4C88A 3GEGA 3H2JA 4KIWA 4RNCA 1Z37A 4PSKA 1Y33E 2J41A 1BD4A 1EUDA 3QMMA 2TMGA 3M6UA 2B4AA 2NU7A 3ILYA 1XZAA 3EEFA 1P9RA 2H54A 2IXAA 4PZDA 1QQ5A 4KG7A 5EOVA 5BP7A 2DWQA 3WYDA 4WADA 1UAGA 3Q4GA 4EI8A 4Z3KA 4DEXA 2VAXA 4AJJA 5L7WA 4A26A 4OB6A 5J43A 4Q3BA 2BHNA 5EESA 2GN6A 1UPFA 3B1KA 1GZ7A 3CLSC 1URPA 2ZTSA 3U7RA 2ZYGA 3EXAA 1XJQA 5DRYA 5FI3A 2I2FA 2QTGA 3DCJA 3OOHA 1GZ6A 1IEXA 4ESHA 2B6HA 4AY6A 3UB2A 4NXMB 2QP9X 3ZX5A 2TRSB 2QMZA 1W29A 4ISCA 3L1HA 5IC6A 4F9EA 1ZD5A 2HCBA 3EGXA 3KKZA 1SIUA 1JBQA 4OHRA 1XPOA 3QYFA 5AWFC 2IYPA 5GGYA 2QIPA 2HU5A 1B2RA 3TI7A 5KJFA 2QGNA 5KC9A 3U60B 1ZNQO 4MW5A 5F51A 4XIGS 1X1EA 3OQJA 3PGKA 4BVLA 1QWSA 2A9QA 4RADA 2QUHA 4D5EA 1S02A 2GAAA 3MQ4A 1RU3A 2EX4A 3V4LA 1BMFA 3ZWCA 4D7AA 5FX2A 2R8YA 2NU6A 1GPYA 5AHXA 3KDAA 1ILEA 3ZDQA 1QCZA 2Q1YA 3AF1A 2CDAA 5ER6A 3STVA 3ZGYA 3JQCA 1PTKA 4LS3A 1QIEA 2QUJA 4R1PA 1GQQA 4B85A 4DVJA 1REQB 1EBBA 1L1FA 4FILA 4GGPA 5LDGA 1RWMA 3LRPA 5F4BA 5C8YB 1KEEB 3I30X 3H19A 3LIPA 4ABYA 5JNUA 3G5UA 3NETA 4B5KA 4EHJA 2QROA 3EZLA 3IP5A 4UNRA 1UOPA 1WUIS 2I78A 1H4VB 4PGAA 2JLQA 3T94A 5HKOA 1V2GA 2O7NA 2O8FB 4J16C 4M9XA 1YR2A 2RC5A 3VDXA 4TTTS 3TBHA 3VUFA 1SC6A 3SR0A 3QTBA 4CIBA 2Y0DA 1SXJC 5FTJA 3ZOZA 4AL4A 4NSNA 4Z7OB 3FVRA 1YI0A 2XGOA 4U2DA 1FB5A 1F2TA 1G64A 1Q7CA 4M88A 2YFKA 1B14A 1T1SA 2HADA 4BTVA 1FDVA 1C5KA 4HZIA 2PQ2A 2QM8A 3QEMA 5ULLA 2JCVA 2I2BA 1OTXA 2DTEA 1X87A 5JFOA 2O8CA 2IQIA 3INYA 3PNPA 1LA2A 1A27A 1ZGCA 3QTTA 5C4GB 2G28A 2SCUA 2ZE6A 3TDNA 1YZKA 1X2BA 4AJKA 5KSPA 4DWOA 4YDQA 5KQRA 1ZVJA 2ACKA 2BEKA 1JTFA 3KSRA 1M2KA 2QYHA 1F6BA 2AW3A 4NCXA 3TLAA 5K8VA 4UNQA 3CRZA 2WMYA 2W0MA 4FS8A 5UKDA 1FRFS 1EWVA 1T0JB 3I6ZA 1AU9A 1VG1A 4A36A 3EODA 1SHLA 3F5SA 3FSRA 4KGZA 2P9QA 3QE2A 4NBTA 4O8ZA 5EXPA 3HGQA 2GEDA 4KDFA 4UBKA 1NYTA 3STTA 1V6AA 1GTG1 1ZD4A 2NO0A 2QMEA 4BB5A 4YPVA 1KH3A 1MAHA 4OQFA 5GP1A 5C3MA 4P4SA 5I7VA 1U3UA 3MCUA 1C30B 1NDUA 2PRIA 4WOCA 4L7QA 3UT5A 3GA0A 4H77A 5E3IA 5JNTA 1G38A 4BO3A 1TIPA 3HDVA 4U7TB 4B6RA 3I9V6 4YCSA 5G0TA 1UK7A 1AK9A 1DKMA 2ZTLA 4ZT3A 2H4HA 2ZJ5A 1RYBA 1JS1X 1DTEA 4OFZA 3I2YX 3B1ZA 2BM1A 2RBKA 5EG5A 2WJPA 2P30A 4R4JA 1VG0B 5L6MB 4FR5A 2ATIA 3OD1A 4R2KA 2NUAB 3SHQA 4A0QA 4Z4EA 4FR2A 3CLTC 3FCOA 3AMVA 4KWIA 2NYUA 3BILA 1AE1A 3WJ2A 2H2AA 1W36B 5LBTA 2O2XA 2YJ4A 1YVEI 2AV6A 5DKFA 3RSLA 4KPYA 3R9WA 1Q19A 3TIGA 4LRXA 3C6YA 3B12A 2J5XA 3K8ZA 2RB5A 1DPFA 3SZMA 5EIXA 5AW2A 3I4LA 5EMHA 1QFYA 1VHWA 1JG4A 2PX3A 3DF7A 5AK4A 1E92A 3RBXA 2QQ0A 5LIRA 3AB3A 2Y71A 3HCDA 2PYDA 3U4AA 4JYZA 1RLIA 5BYKA 1AQJA 2XZOA 4JBHA 4BS9A 2XQKA 4HDKB 3GB9A 5THKA 4EGCB 3BAFA 1BH2A 1EWKA 1JHXA 1BD3A 2QTCA 3BHNA 2C2OA 3DE2X 1H3EA 1T4CA 4L4SA 1XV5A 1NL3A 2YINC 2Y05A 1XCJA 4EAAA 3AUFA 1NJ5A 3C3YA 4CFSA 5B1YA 2VQFB 1ZIXA 4EHLA 2H1RA 3O8OA 3ZGLA 4KSBA 2UVDA 2GB4A 1PFQA 3VZCA 5AK0A 2N0SA 4FT4A 4NABA 5DRTA 3S81A 1NMZA 3B6ZA 3GFQA 3O0DA 4HUQA 4PLHA 2JPDA 3R6TA 4Q3NA 3V8PA 4V0SA 5HNKA 1ZBQA 3IA2A 5JD3A 1Q0HA 4HO1X 2FN9A 3PWTA 1YHNA 4MI6A 3TW6A 2JKVA 4GT1A 2O5VA 4DCOA 3B60A 3O1IC 4I9NA 2XVMA 1ZJYA 3FI0A 3GLGE 1L6IA 1CZLA 1Y6JA 2EFYA 3NAGA 5LZ9A 3A1UA 3SJCA 4IUBS 2EXXA 3R7BA 5LDHA 3TNDA 4UM9B 1ULSA 4GC5A 4ZQGA 1QUEA 4R3NA 5JD6A 1IXYA 3VJRA 2RK6A 4JOCA 4Q66C 2FF7A 4M1KA 3IRVA 4FC7A 1O77A 4RK5A 4UVEA 1QU3A 3ELYA 1OX4A 3DMYA 2ZCUA 1F9EA 4FZRA 1H42A 4BLRA 1IXKA 6LDHA 3ANXA 4U63A 3JPWA 4XYBA 4JAVC 4CV1A 3PLNA 3L4JA 3K1YA 2AHRA 2R6AA 5ALVA 3TNYA 1ZM3A 4MUIA 4DARA 4QREA 2PJUA 3MB8A 5AM4A 3E3MA 3ZHRA 1A69A 4TT8A 4ZRDA 5FQNA 4IZ6A 5IWCA 4B2PA 1QQTA 2Q49A 2X2OA 3ICVA 3MTGA 1E3MA 3FSEA 3CIOA 4Q1AA 1NHWA 1RWNA 4N9WA 5NULA 2C7VA 2R7KA 3EDMA 1QX4A 1BE1A 4I5GA 3TI9A 2VJAA 3UJ3X 3GXOA 3S8YA 1JQEA 1ONNA 2EKZA 2AUMA 1BU5A 1KDPA 3AR3A 3DTYA 4IMRA 3CCBA 4NYIQ 3ZS8A 5IXYA 4M55A 4OQDA 5BQOA 3UUGA 4EMSA 1M8KA 1PL8A 3CSUA 2YH2A 4A8JC 5LPNA 1E1LA 4YJ2A 1LS6A 1TNDA 4JEUA 3OLYA 3ZIAA 5K6TA 3TGWA 3ESZA 4INZA 1IBSA 1S1CA 1LXCA 4ZT7A 4JB0A 3OEWA 1B41A 1YZHA 1MDFA 1ML4A 1YFZA 2UVQA 3KR1A 3OCZA 4LYDA 2RJ3A 4NBVA 5HKBA 1GAXA 2PRYA 4E5DA 4P7GA 2A0WA 4ZVQA 5ALJA 2R751 1W4ZA 3CKYA 2CLSA 3SX0A 1SVWA 3UC9A 1E5DA 4GD3Q 4B4KA 5F64A 1AO3A 2NZUG 3OPMA 3RR2A 4E5SA 1ZKMA 4X1YB 2YS7A 4MSUA 3H9CA 1UJMA 1LI5A 3SJUA 3P2EA 1KY4A 2C4NA 3D81A 2HRCA 4HQLA 4JLJA 1EWYA 3L4BA 4BN4A 2QMQA 3L1KA 1CTQA 3Q8XB 5LQDA 1ZLYA 4WCFA 2NGRA 3CBQA 2HO4A 1F17A 3L6DA 3BEOA 1EDBA 1ZVQA 5EGSA 4DG8A 1S6YA 1M3SA 3CW2A 1QJCA 3K32A 5AUQA 2AQ8A 4JIGA 4CMBA 3OIDA 4K6FA 2XCIA 1X77A 3DLTA 5K3AA 2HDOA 1H05A 2ZPTX 4ER6A 3VH2A 1M7BA 4Q3CA 5DGHA 3ZXYA 4BVAA 3EQZA 4MUGA 2OC4A 4JJZA 4RTPA 4I5IA 3F3MA 4M1QA 4D3XA 4EO4A 4JP2A 3QUCA 1RXWA 3WWEA 4H27A 3L5KA 2JLBA 3M70A 3BSYA 3NPAA 4URYR 1XHLA 1YZQA 2CLCX 3T4PA 3FNEA 4II7A 1DQYA 1P9WA 2XRYA 1ISMA 3H5OA 4J0GA 3NEPX 1V16A 1FUIA 3C70A 4YV1A 4HYQA 4JWTA 4UEKA 3N59A 2BFEA 4C4TA 4O4IF 4LHYA 4Y0VA 4AQDA 4M38A 2EBHX 2VTEA 3RG8A 2PAFA 3DDWA 2EFHB 3R6DA 4KLRA 2VEOA 1BX3A 2WIGA 2A78A 3QE4A 5JSQA 3V8NA 3QF7A 2PH7A 4WSOA 5KCMA 3JQQA 1FTGA 2OM2A 3TF5A 2WHEA 3BREA 2ANBA 4LQDA 3PQ7A 2HO5A 1NVFA 3HO6A 4FYYA 1PZMA 5AJWA 3RGWS 3CG4A 3ULKA 3OZIA 3OO0A 4DXDA 3PG5A 2ZJ1A 4XUCA 4MWOA 5CM9C 4HXYA 3L02A 3RKUA 4D79A 4YFVA 4HWOA 4HDQB 1KAQA 2QU8A 2G25A 5KJEA 4C7VA 4N5MA 1RTTA 1UEXC 5BWLA 4HQFA 2FEXA 4H3SA 4RD4A 1KOJA 3E1SA 1A76A 1YRYE 4JP3A 2ZUEA 4NYMQ 1LD3A 4L6CA 1KP3A 4JQSA 4UFOA 4CN8A 1HEUA 4FFLA 3C5EA 5BUCA 4GI2A 4BFZA 4FGUA 1SZDA 1VFPA 2F64A 2FEWB 1TLLA 2H1IA 1Z18A 2X0RA 4FLEA 2HF8A 2PD3A 4KACA 2QYTA 3X2EA 1Z0FA 3QXHA 3UKJA 1ADJA 2BGJA 5GJBA 1B74A 5LP6B 4E70A 1KJ9A 1ONPA 3V8VA 1O96A 1Z5GA 5KNDH 1E4EA 2FZKA 2Z56A 3W8DA 3PHGA 3EQ7A 4RFSB 4WXMA 1DEAA 2WIBA 2ZXFA 3NNNA 6REQA 1QPZA 2XVZA 5CTAA 2BFDA 3AVXA 3OCYA 2H4JA 3DZFA 1BWQA 2XUHA 3A3YA 3ICWA 4H4DA 1OH8A 1I0ZA 5F2NA 1NMYA 4GRIA 3LL7A 3MJHA 1AIPA 1LPBB 1OLXA 4FMCB 5FL7A 1UMBB 5J2UB 1HT3A 4UEQA 3SR4A 8OHMA 4WESB 3C1UA 4NARA 3OFSA 2GK7A 2QL9A 3UJHA 4XJVA 1V7ZA 2VUUA 4FSDA 5LA6B 1L7AA 2BDUA 2PU5A 2RAUA 2WOJA 4OXKA 3WLOA 3ZLBA 4AS2A 1JEYA 3QA9A 2Q07A 4E2FA 4H15A 5JDIA 2UYCA 1FS6A 1M5TA 4LGCA 1OXSC 4REMA 1QGUA 1NN0A 2CL6X 4JYAB 3P26A 1NAIA 5AM3A 3OWHA 2LWIA 4CN9A 2RI6A 1U2EA 1IY2A 1KAHA 1U0SY 2GF0A 1J0BA 3SFVA 3TSYA 1S5PA 3EX7C 3HZHA 1HX7A 4LQLA 2C20A 2NU8B 1KOGA 3ZQJA 2BW0A 2Z5LA 1AZWA 4UQPA 4K0RA 3GYGA 1KTVA 4WA7A 3HKEA 4KWEA 3EIEA 4IDEA 4N5DA 4U2BA 4H1TA 4YDRA 2YC4C 3T1YB 4ZYTA 1GSAA 1BMFD 3CUSA 1Z4IA 2ZKIA 3R0XA 2XZTA 5JXIA 1XZHA 2NAPA 1YS6A 1FNSA 1FFGA 3R7DA 5KDLA 5I4BA 3L6CA 1M2VB 2VI5A 3E5RA 1MJGM 3PJGA 4FIDA 4NJEA 4PO1A 4RL6A 5I01A 3F5MA 5IM4A 4DOMA 1UPTA 1N8SA 2PLNA 3EBLA 4P5EA 5ICFA 3RNOA 5CCXA 1H1DA 4AN4A 5D3ZA 5BWNA 5IULC 4C76A 1ADFA 2GLTA 1MU0A 3K0AA 4G6ZA 4MEAA 5JR3A 3B1VA 4H1VA 2HDHA 1KZ9A 2ZRPA 4DSUA 1QO9A 2VDWB 2XVXA 5DEIA 1OR8A 4LC0A 3JR3A 3M1YA 4KMSA 1NOJA 1UQUA 4JLAA 3PPXA 4AXXA 3NTOA 4J9UE 2H2FA 3PX2A 3R2JA 3L3BA 3KYCB 4PZYA 2RI0A 4PRZA 1AKMA 1XYYA 4O4JB 5JCOA 5A4DA 2QLJA 4PY2A 1XCOA 1TMGE 2P9JA 2GCNA 1G5PA 1JDNA 1OV4A 3K0EA 3ORSA 5TPZA 3AB8A 3S29A 4AP6A 3WGUA 3IPLA 1Y7PA 1L4FA 2CKMA 2W83A 2GPTA 2GM4A 3DBIA 3G68A 1G3MA 3TQFA 1G98A 3BMNB 1R5JA 3JD4A 2J32A 4TS1A 2ZIFA 3GPBA 3PEFA 5FHRA 3ZR4B 2MMCA 5A3QA 4AIIA 1DUVG 1IATA 3VC1A 2I6SA 3WNBA 1SVLA 4S2EA 2QDXA 1AF4A 3SBDA 5CVEA 1SUFA 1T1EA 3LP5A 3H17A 1RS0A 4ND2A 5JC1A 4MMZB 3LAWA 2HEIA 1MENA 3R9KA 3RC1A 3B3FA 3A05A 3T7SA 5CW2A 4OK3A 5K3SA 3GT4A 1Q11A 4OLJA 2I4RA 2H6EA 4JYCA 3VPAA 1TKBA 4KGVA 4N49A 5JALA 4HPWA 3N3BC 2BGRA 4G89A 4B3DA 3ZY5A 3ZXUB 1Z7YA 3GCGA 4I50F 2QKYA 4RZUA 1FE8A 3VKWA 7REQB 2PE5A 1U7WA 1QP7A 3N8HA 3CRNA 1E6CA 1XRJA 2I2DA 1UBNA 1NVGA 3B52X 2QQEA 1A2QA 1U6JA 1W25A 3EIQA 2WF6A 1CULC 1DS6A 1YVDA 2WFLB 3WL8A 4EEXA 3H9EO 3KBBA 5JRJA 4M0KA 4KVZA 1M8PA 4QAQA 2H57A 2OORC 1ZM9A 2FFQA 5K0LA 4LRTB 4ZRMA 3RSQA 4JJ8A 3CRRA 2UXDB 4ALJA 1P4RA 2R1VB 2FPIA 2CC2A 2M6SA 3QHAA 1K1EA 4NEHB 5AK6A 1PHRA 3O8RA 4ZXPA 4GOMD 4H59A 3RUHA 5F5NA 4GRAA 4O3FA 3TKAA 5BNFA 3IP8A 2PUGA 4N5HX 1Z22A 2W48A 3CU5A 3W0LB 4Q4JA 2CZCA 2R25B 4YCAA 2IXGA 4MHOA 3T41A 3KU4A 3O03A 5H1YA 1DRWA 3EF1A 3UB3A 3W5SA 1FFXA 2Q9AA 1OD6A 5H4HA 2EP7A 3RFCA 1TU0A 4FYHA 2WQZA 2IYRA 4KPUA 2OC9A 4JR2A 4CG0A 4CNQA 1B4DA 3ROTA 4LWPA 4EYEA 3SZOA 3F90A 1CY7A 1C1XA 3LW8A 1J7KA 4JR1A 4CL0A 4TL6A 2XMGA 4KSCA 4CKCA 3TCNA 3VNQA 3O3CA 2I4MA 3GOHA 3ABSB 4JQCA 4G67A 4C04A 2VBIA 1PL6A 1CEEA 3B7GA 4MB2A 3D8HA 1KYVA 5L3SA 1X1DA 4FIZA 1VLZA 2IEAA 5EZ6B 4A10A 2FFHA 1PE0A 5AW3A 2JGKA 3QKTA 1GG2A 3L0BA 4C3UA 4UNPA 5JBIA 4LK2A 2EGGA 1YMVA 4UXIA 3ZXIA 4QFCA 2FPOA 2BV3A 3FCXA 2XJ9A 4RVHA 1HURA 4AS3A 4CV0A 1GSOA 4KYUA 1NNI1 4JI1B 4CG3A 3RKSA 4EK9A 4C0XA 3D6AA 2B0CA 2Y2VA 3RAGA 1T1IA 3FCEA 4RCVA 4YAIA 4QOGA 2WLTA 5DHQA 1WDTA 1DBRA 2OCLA 1FDOA 4ZDKA 3DC2A 1EG2A 4GM1A 4ND8A 2ISSD 2H1VA 5DTJA 4K2AA 4M60A 5IEJA 1A72A 4R1LA 1AA6A 1RBMA 2C98A 2OXFA 3I04A 4TVBA 2WSYB 3ROFA 3TZCA 1GLNA 1QFSA 5ESXA 1IMJA 3GRZA 4EB3A 1E7SA 1FZQA 1Q50A 3MGBA 1BCSA 2VDRB 4HDNA 3C4VA 4ARAA 4Y1RB 4Y2GA 4ZYXA 2WM3A 3ESBA 3USZA 2ZW9A 4LVCA 4W8OA 2FFBA 2BEWA 1JXQA 1SOUA 4K1LA 3AIMA 4F5EA 1DGQA 3TD6A 1F1JA 5FTWA 2A86A 1YL5A 3LS2A 5AKXA 5TQ2B 4XTCS 5H3LA 4G4SO 3TZQA 2NUBA 3F3SA 3W5HA 1TW3A 3JVVA 1Y81A 1YOBA 3VPHA 3TGLA 4KPGA 4MLDA 3UTDA 4ZN6A 3I0ZA 3ZIAD 1JHZA 1XA3A 3ROXA 3FVWA 2IGBA 3Q8KA 1VMIA 5B7PA 1P4AA 4L4UA 3RROA 3IXLA 1STOA 2DWCA 3PHHA 4TXHA 3JQAB 4ETIA 3OKAA 3QG1A 5ENZA 5B37A 3DQZA 5EIOA 1IZ7A 4H17A 3U7GA 3O1HB 4GM4A 3MUFA 4E3WA 1RWKA 3F78A 4Y9TA 1RYFA 4Q12A 3BIJA 3TIIA 5K3DA 5K09A 4KAXA 4PSDA 4U3JB 2XOKA 1PZHA 1M6NA 2VBCA 3RVLA 3D3KA 3A9VA 4KLNA 1AV7A 4WKGA 3RVRA 4EVSA 5CG2A 1BJKA 3GJ6A 1A5ZA 4LZPA 3PJRA 4NX2A 4IWXA 1Z4MA 5B55A 3HRHA 5TQJA 1U7TA 1R4NB 3CPEA 1JHVA 3AJDA 4URWR 4H7EA 3OLQA 3CO5A 1E1NA 4F2HA 3U7HB 3QNMA 1TLFA 1KU0A 4V1CB 1ZWLA 2XD9A 3PFHA 2CHFA 2WQ7A 1R4ZA 2VHEA 3BDAA 1DEHA 3PICA 4F9TA 2CJWA 4D3SA 1Z0DA 1N6HA 2HCTA 4J3JA 3PFGA 1CUFA 1U8EA 3WHIA 5I6DA 1T5HX 1X9IA 1YACA 4EY4A 4OHVA 1QSGA 3JYNA 2XTNA 1QC5A 4XOIA 3ZEAA 3AEZA 1P7WA 1EP9A 1GYRA 1W44A 4RQBA 2OQIA 1ZHOA 1D2NA 2RGEA 2BEJA 3H1TA 1E4OA 4DWJA 3TZKA 3CV3A 5GV8A 1EWQA 1GG5A 1YQDA 3B2NA 1XA4A 2FMXA 4KV9A 1UBJS 5AI9A 1S2MA 4NLLA 3UNXA 3WLRA 5AKLA 2O2DA 4IWYA 4RK1A 1XEFA 2QX6A 4IRXA 1JJAA 4ITVA 4LCEA 1KERA 3WYFA 3QFFA 1P0FA 2VT2A 3BXHA 4ZHQB 4CETA 4LBVA 1P4GA 4WN3A 5DN9A 4BE4A 1WD7A 4NWIA 3UG6A 4MUAA 3KLMX 3DLCA 2AW5A 3PGJA 5JJCA 1X1TA 2VQSA 1WAMA 3K1TA 4I55F 3VU9B 4KAJA 1KQGA 1E94E 4IVRA 1ACLA 2DQZA 2YYYA 4QU0A 2OHFA 5BMVF 4CNBA 1U7XA 1FP1D 2RIRA 3T5GA 2YFQA 1QPGA 2O8EA 4CTKA 3J7AC 4P2BA 8ABPA 2QRPA 2X4IA 4PHCA 4WLEA 1KJWA 1TA9A 3DP9A 2I5PO 2VNJA 3GLFB 4GPIB 4PHFA 2Q7OE 3HSYA 1C30A 3U3RA 4NKRA 1E2UA 5NLLA 3H5RA 3T5DA 3JQEA 4YNBA 2VK1A 2AF3C 1K75A 1ORHA 3LHSA 3HV0A 1K4KA 1G20E 1VI2A 2LZ0A 2O23A 5CFLA 3EPRA 4ZDWA 1VE3A 1EWTA 2FPPA 3PEUA 3DV0B 4GXTA 7AT1A 5JS8A 2P3SA 4IW3B 4J2HA 4JWKA 4JBLA 4ZVLA 2J0UB 4G1FA 3ELUA 4CKZA 1BTOA 3NDIA 2ZSFA 1CQPA 4QWMA 4DUGD 2ZSHA 1XVUA 2KHZA 2ZIZA 1BFKA 3L6UA 4A6EA 3QYAA 5FL7D 2BFBB 3AKEA 3EXHB 3IL2A 3PFCA 2ORVA 1R4AA 5HIIA 1D1PA 2QVZX 2VKQA 4NCJA 4C6TB 1FMJA 3CH4B 1UUFA 2I4LA 3T4EA 5FWYA 5EP4A 3OT5A 2DUWA 5JD5A 2FB9A 3V55A 3D64A 1NTOA 2OE2A 3O7MA 3AIIA 3SWWA 3ZNOA 1UOOA 2VS1A 4C7JA 1UDCA 2XDYA 3EBPA 1BG6A 3OHSX 2HJVA 4QELA 2Z6QA 4MVJF 3KV1A 2VHQA 1YHYA 3IPAA 1KZ6A 1HL7A 4WLNA 2VSQA 5HRAA 1OHHA 4JELA 3ROPA 2CUZA 4WEOA 4IXMA 4YRIA 1H6DA 1FUUA 1ZK0A 2UVPB 3O91A 1FS4A 3ELDA 3VR4H 1JWAB 4NESA 3SR3A 4NCHA 5BQPA 3U80A 4YP9A 1MXFA 4MR9B 4KQHA 5I7EA 3HU1A 3V6MA 4YRFA 2MSNA 2LPMA 3VPXA 1PEDA 3OQNA 5B2ZA 1ODSA 2PNJA 3VMMA 2OLKA 4PCUA 1OASA 4X1IB 3NNSA 3AOGA 5HHTA 3K70D 2J3QA 4OU4A 1QAOA 4E2ZA 5TGTA 4NH0A 3U3XA 4JI2B 5CJPA 5LQNA 3T34A 1G4HA 1TTTA 2D7JA 5TSDA 3U44A 1E0AA 4MUMA 1G7SA 5EJFA 2QHXA 1Q6YA 2NSYA 1NXXA 1SELA 1DZ3A 2Y0CA 3EF3A 3JQFA 4YRTA 3X1XA 2Z8ZA 1PQPA 4OGWA 1DG9A 1SCIA 4M9QA 1YQTA 1SHKA 2O3QA 3H4MA 4EMBA 1GVHA 3I76A 4CF6A 2KI5A 3BIFA 1M34B 5H59A 3RYCA 2R85A 1EDEA 1MJFA 2W43A 4HL6A 3OZTA 3WNVA 2ZB2A 1OVGA 1ZM4A 2QN2A 5I5GA 1F1BA 3H84A 5AM1A 2XDWA 3FFXA 1EX6A 1KZ4A 5CM8B 1C7EA 1K86A 3T9BA 5LXTB 3W2TA 4JNKA 1UK6A 3K0FA 5TPZD 3OLWA 2VF8A 4CCWA 1VGQA 3PEVA 2HMUA 2JLSA 2VH5R 5I48A 3ZS9A 4IYRA 3Q72A 4REOA 1TGYA 5EP1A 1KSJA 3AR9A 3DKKA 3D3QA 3PEYA 1PUXA 3TLKA 2YN2A 4OBWA 1P4SA 4NBRA 4BFLA 5GAJA 1V47A 2H29A 3ONVA 4JJIA 2ZYVX 1BX0A 3FRIA 3SHOA 3U9LA 4ZK6A 3V32A 4CDGA 4XOUA 3WSTA 5CB4B 5ALTA 3BF7A 2PS1A 2G6BA 1GNRA 2ZITA 2IHZA 4BV8A 3AIKA 3ONEA 5TY0A 4I4TF 5EIBD 5HG0A 2QD5A 1KFKB 4INAA 5EMNA 1G21A 1BDJA 3KQWA 3EUEA 5JY6A 4ZALA 1GZ3A 4U9IS 1G6OA 4CJXA 2Z83A 1A9YA 1GWNA 4RHXA 2FDXA 3WLIA 3PKZA 2D1QA 4MRVA 4HNGA 2C8KA 3FRHA 3O3OB 4LDNA 2V1XA 2IDKA 1CNMA 2YQ4A 4R5MA 4YC7A 5FR1A 5T7BA 5T57A 2NTJA 2ZS7A 1NMQA 3I01A 1L5OA 1RM4A 4GOOD 3CF2A 4PAMA 5AI0A 2CL5A 1MUUA 3HEMA 1TVCA 2ZRCA 3OQOA 6PFKA 3WQRA 3G79A 4WUTA 2ZWIA 5JG7A 1PFUA 3MOSA 2CE7A 3B2EA 5JYDA 2RONA 4Y2QA 1BS9A 2OGUA 2O19A 4V1CI 5U1PA 4UDOA 3W78A 3HE3A 4DILA 2VDVE 4BEWA 3G5LA 1FUEA 3WWPA 3KPYA 2XMPA 2FPGB 1U9YA 3BRSA 3CR3C 1IJFA 3E9MA 1U28A 4ICIA 5A3JA 2HAEA 3L8ZA 1AS3A 1CIVA 2R65A 1ZCFA 3ETGA 3PUWA 2BKEA 1F3LA 1I2BA 3RIHA 2YRXA 3GMDA 2IIVA 3DHNA 1ETHA 3IH5A 4RFVA 3NWPA 4CLHA 5CXQA 2XPCA 2Z4TA 1HE4A 5ENVA 2ODTX 3EGDB 3DDHA 1QZ3A 3Q8WA 1XLVA 2AUNA 2R1UA 3E1KA 1XTPA 1PQWA 3SBOA 4M9UA 4TRRA 3BD8A 3VOBA 3QIVA 2I33A 3LQKA 4O2BB 1V7PC 4Q02A 4NE9A 4FC6A 1QHHA 3LYHA 1M2WA 1TYCA 2BI7A 3BE8A 3HNOA 4V0OA 4P6VF 3LBYA 1DAEA 5ALMA 1G8GA 1KZYC 2GBGA 1LV7A 2Y9MB 3N8GA 1T29A 4N65A 4UTXA 4WX2B 1RTKA 3GLIE 1BEEA 1EG7A 2IYXA 1ODCA 4GC9A 5FNVB 5BW5A 2Y1WA 2VC2B 3N0WA 3GPIA 4FQ7A 2OQRA 4HNHA 4KW7A 2BGGA 1J2TA 2V0NA 3DS8A 1JQ5A 2WHQA 3CNQS 4DV0B 1CFJA 3DR5A 2VP9A 4HBZA 3D3NA 3FVVA 3TQIA 2DPLA 1V37A 1X39A 1OT3A 1GZVA 1SQGA 3F9RA 2EU8A 4DR3B 2HFKA 1I01A 3A2LA 1G8PA 1OYOA 5TVGA 2VSOA 1FSPA 1KRXA 1TVEA 1U0GA 2XA1A 2XW6A 3RFFA 4H7KA 3WGKA 3RYFB 4DABA 1L4MA 2G09A 4C0WA 1NW7A 2G9ZA 1Q1ZA 4YRSA 5ITSA 1OVMA 1KGDA 2O4CA 3DYBA 1QIMA 3B6MA 2DPYA 3P32A 2P67A 3BL6A 3K09A 1M1YB 4HNAB 1W4LA 3BTSA 1CJVC 2E4UA 4W82A 3RJTA 1C9DB 5FUQA 1T36B 2IPNA 1DCKA 1C7RA 3GLKA 2YMQA 1L8XA 2Y1DA 5COBA 4BLTA 4F72A 4B6PA 2RJOA 2W70A 5DYWA 1DXHA 4I3FA 4E15A 1TQ4A 4M0MA 4RFSA 1Q17A 3AI3A 2TS1A 3R40A 1UT5A 4AKHA 2PGOA 3U56A 1E6UA 3TE7A 4FI3C 3RU7A 1K9VF 4V0MA 4HD8A 1QF9A 3VR5H 5JAZA 3M1IA 1L4UA 3PD7A 4WESA 3GEIA 1G2IA 3CMCO 3K4HA 1V3UA 1Q14A 3LT5A 3KQPA 1T9ZA 4MZDA 2CL7X 4U7GA 4B3FX 1GYQA 1II8A 2C5EA 3DVRX 3QPAA 5H5JA 3L0YA 3NVAA 3VFDA 4NCBA 5C7LO 3WKCA 1LPAB 3EVGA 2QRVB 1JECA 3WZMA 2FUG6 1Z4LA 3TNLA 4F8JA 5JRDS 1ATIA 3H6HA 3KJHA 3KVYA 1AZLA 2XNCA 2ZUBA 4A6PA 1CYEA 2W6ZA 5JBQA 4I14A 4MVJM 3IP6A 5CR9A 3E6AA 2FOIA 3IE1A 1Z6ZA 1MW8X 5BR7A 3RV4A 5HKAA 3AB7A 3HB0A 4JITA 2VJPA 4IGKA 5YASA 5CYFA 4LF8B 1RI1A 4N82A 4M3NA 1HNXB 3OP1A 4UC0A 1K0UA 1P5ZB 5EZSA 4EB8A 1E1KA 3NHPA 4WRRA 1JDZA 2VHJA 2XOKD 3JQRA 4EJSB 4BE7B 5KMGA 1C8VB 2HK9A 1O9BA 4MW7A 3AVOA 5HCNA 1AM4D 2H3HA 2I1LA 2CFSA 1PDOA 2PFSA 5LUAA 1V48A 3AKDA 3NIGB 4OQMA 3WRYA 5BN4A 5LOVB 1M2HA 1MOSA 3PGVA 3U6KA 4I5EA 4L27A 2H5LA 2PV7A 1ZW6A 1KXZA 1KU6A 4XB2A 5T4HA 3DB1A 4IFTA 4WZZA 4AZTA 2GJ8A 5HIJA 1M6VB 3I42A 4DBLC 5L53A 1E8MA 1MR3F 1RXCA 1XKQA 3DOJA 4JX9A 3LPDA 1M2JA 2COKA 2VUHB 3IKJA 4C0QC 2B2NA 1H85A 3SK0A 1A77A 1QOZA 3GV0A 3IEPA 1KPHA 3FG9A 4L5IA 2G8LA 3NHJA 3PC6A 3UMFA 4PX9A 3PVCA 3GNTA 4DB2A 2ZRGA 2RHHA 1QFXA 5BR1A 1J8VA 2PTHA 2C2KA 3BXGA 3DEKA 4X3OA 5LZ7A 2RAFA 4OXIA 4LRUA 2OUKA 2WAOA 2PJRA 1N32B 3FDZB 4TWIA 5IWAB 3K0HA 5DWVA 1KYQA 1GA4A 1GLGA 3PC8A 4R2JA 9ABPA 1KVQA 4D81A 5ALLA 1ISJA 1CB7A 4NBSA 2DBRA 1SG6A 2ZDHA 4U7JA 5BV2P 3O9MA 3JATB 1E61A 3TOXA 5TIIA 4J03A 3WTBA 4XDYA 1P7YA 2FSVA 4ZDIA 3NCHA 2QD4A 3A37A 4Q3DA 3PLRA 5HS6A 3UWKA 4R8KA 3TIVA 4ZZ3A 2QLTA 1A7UA 3LUGA 1FS5A 1MB3A 3UT0A 1WDMA 2P27A 3CRVA 3TMYA 3LFTA 4HN2A 1MOZA 3VDMA 1QRDA 3WIOA 1QCCA 5FXMA 3UKDA 1IK4A 3PWZA 4LF7B 3T0FA 1LDNA 2AVNA 4JLKA 4UAGA 1VSUA 3CUVA 4X1OA 4UHFA 3C14C 3ETLA 5INTA 3W2HA 2IU3A 1B6TA 2W8BA 3V1YA 4UZEA 4AX4A 4ERNA 3JYQA 2YHAA 4NR0A 1VCIA 2RBEA 4TV8F 5CITA 1L5FA 4NPAA 5FTLA 1WXDA 1GG9A 3QNUA 1W8IA 5FLXA 3X43A 3W05A 4CKEB 5CFPA 3C3CA 4XQCA 3FNBA 2X5JO 4YMIA 1OBOA 3ENWA 4NK5A 2N1MA 3KKOA 3F4BA 3PDCA 3UMBA 1QV6A 4ETNA 1KEZA 3RTBA 1XZIA 2GXQA 2JATA 3HR8A 4H35A 4L5BA 2HFJA 3EVCA 4N18A 1X7YB 3VO8A 3U4QB 4MPJA 7REQA 2RGRA 2RH8A 4X20A 3CH5A 4BMDA 3ZBPA 4CKWB 2D7DA 4RXTA 2OECA 3ND9A 3QX7A 2VJLA 4FEAA 3KPWA 4GMKA 4JHLA 4KDCA 1GA6A 1H6BA 3I9LA 1OLUA 4H6VA 2GEUA 3W77A 2Q0XA 1W36D 3FZYA 1TUGA 4YUAA 2QR5A 3LNTA 2IBTA 2AEEA 5B2EA 3BE6A 1YS7A 5FHQA 4N3CA 2HW8A 2WTXA 1XDWA 3V97A 3DCNA 1THGA 3KEMA 1Z63A 1O89A 1DIHA 1YZTA 1DAOA 3ODPA 4W9MC 1D2RA 5JC8A 1WF3A 5K4AA 2ZTMA 4P7JA 1ATZA 1EDDA 1NMSA 2A67A 2HLDA 2Z9CA 1CERA 3G02A 3KQNA 3ADDA 3RUDA 1CY1A 1XGKA 4E5YA 3WKEA 4E5KA 2IYOA 4KHZA 4WINA 3QKWA 5FFNA 4BHTA 1P5HA 1ECBA 2VXOA 1P4HA 1VYUA 1Z88A 2PNFA 1MN6A 1TCVA 2OV3A 2CBGA 4U6SA 3MSCA 4H08A 4WKCA 4JI3B 1ADGA 3AF0A 3D4BA 2IITA 4Y1GA 1X80B 3ROGA 1NT4A 2NO6A 4RKQA 5J1TB 2CVPA 4KTVE 4G5FA 4RZHA 4MJ3A 2X58A 1U2RA 4U0JA 5LWQA 5J2TF 4W5OA 1GM5A 2POQX 2UZ0A 4KO4S 4FYPA 3W8FA 1Z0ZA 4N7BA 2GBPA 4AJIA 4WBNF 4J1TA 4JCOA 1DLJA 1C1YA 1WY5A 5A71A 3LMKA 1T9GR 3NM6B 3NWOA 1U0EA 4QQFA 3L8DA 5JMPA 2ISQA 1MQAA 2VJKA 3QVWA 1CZUA 5JXGA 4UPEA 1HEIA 1KR2A 3V3TA 1JAYA 4TLCA 3RRZA 1J20A 4BLVA 5JMTA 4UMFA 4D9JA 2EWMA 1JIQA 4BV9A 3LTNC 3PT5A 4UCQA 3QVSA 1RI5A 3JQBC 1D9XA 1WOMA 3U3OA 3CUUA 2ZRNA 4MUNA 2P4SA 4UEOA 4RPCA 1P3DA 2QVLA 3DFFA 4RHFA 3I2FA 3JAKB 2VPWA 2W2XA 1FCJA 3N2IA 3SDSA 5I7HA 1UPUA 2EZUA 5A6SA 3ND7A 1QVVA 4I4NA 4C4XA 4JC5A 2VJQA 4NV0A 4URUR 2GKGA 1HSZA 4PX3A 5HJ2A 1OI7A 3A4NA 3W9SA 3G0GA 4AY4A 4EL5A 1TU4A 2WTUA 4IO0A 4DEYA 4FFMA 1RWXA 3QHQA 5ENDA 1GSIA 2JARA 2V6JA 1YQGA 3DO6A 3PYMA 5DX8A 1ZO8A 3C87A 3RVQA 1DARA 5EIFA 4ARUA 2VK4A 3VC3A 4QXAA 3VYUB 3FMGA 3A1TA 1L4NA 3ZDYB 1NVAA 1QTIA 2GZMA 3DPSA 4DRYA 2AE2A 3GLGB 2Z9BA 3NHFA 1PDWA 3HUFA 3MS7A 3RTDA 3D8BA 5B1EA 4YR9A 3GP3A 2V5VA 1ZOOA 3BH6A 3KR9A 3W1VA 2W2VA 4AG3A 1C8BA 2DR3A 3OURA 4GPD1 1EGQA 3DMRA 2LGJA 1LH0A 3W8NA 1YDEA 2XUKA 2ZRBA 2P5SA 5T64A 3S2EA 3N2LA 1FFWA 1RXSA 3GFVA 5JCZA 1NC1A 5TQ2A 5ILGA 4IDCA 1KE2A 3HWWA 2PSFA 4C1NA 3CX7A 4IHJA 3VZSA 2WUVA 4LSWA 2ZRKA 4RHCA 4DAEA 4LDPA 4F5DA 2QZSA 4NEGA 3AF3A 4ZVRA 3T7IA 4NU0A 3ZJ4A 3P52A 3TSOA 1WXHA 1GGJA 3IJ5A 1C7ZA 1UOQA 2IEGA 1RM3A 2HNAA 3ISTA 4FE4A 3TRKA 2HQRA 2QN7A 1NM5C 3DPUA 3GXBA 4K7JA 3SHVA 4H31A 4ZEVA 2HIMA 1I1HA 1J33A 2WINI 4Y9UA 4PO9A 3TMAA 3DAFA 1BMTA 4LYHA 4AF8A 3HDQA 2JAPA 5G3YA 1Q5PA 2C0PA 3W34A 4AUEA 2J9ZB 3LQ4A 3C3BA 4HDCA 5HUHA 4RJJA 5GZ3A 1NY5A 3FPLA 1L7VC 2PZFA 5KX5F 2RHJA 3JSAA 1EZZA 2QRUA 2NTNA 4JT8A 3UJBA 3I8SA 2OK8A 4COKA 4E22A 3T06B 4HRXA 4FBLA 1DFIA 3I2KA 1G0OA 4EARA 4LOIA 1M8JA 1OBFO 3QKRB 2IHBA 3BSWA 4K9QA 5BV8A 1GKYA 2PZ8A 4J9VA 5IU6A 5KWIA 1USIA 1E7QA 1F2UA 2GN2A 3IVGA 1J9EA 1I30A 1PUIA 2ZDQA 2PCJA 4RD2A 3FPHA 2NMVA 2WVAA 1IEWA 1KK2A 2V97A 4NMLA 3ZQ4A 5C5CA 1V8FA 1PGQA 3AW9A 2R6DA 3UGQA 2FRVA 5FBLB 2F3RA 3PYXA 5BSWA 4EDHA 3ZTTA 2OAGA 1CZRA 1DX4A 3S2ZA 1CLEA 1MF7A 1H1LB 4RIFA 3GP8A 1TTPB 2EQBA 2BKAA 2W7TA 3I9KA 3OU2A 2KW5A 1GTL1 5TPWB 1VXRA 2P5UA 3GRCA 2ZWMA 5FPQA 3V2HA 3WB9A 4CE6A 2J09A 1A1VA 1WXEA 1ABFA 3DA8A 4IOJA 1EESA 3IJRA 4PYLA 5BRAA 1E3DA 4FNGA 4G4SP 1L5LA 1A3CA 3KTOA 1Y9ZA 2VN8A 3NTVA 4L08A 5F3DA 2WQ6A 3BGOS 1NXOA 2H5EA 2V3WA 4RGYA 1BVYF 2NSHA 3V8MA 4ZYLA 3I52A 2WSIA 1I7PA 1RPJA 3H18A 3MWYW 4I19A 4JSYA 3Q3VA 2D0OB 1W36C 4RPGA 4O4LF 4DCJA 4CG1A 3W4JA 2HA5A 4I81A 3KSUA 3VU9A 4BBPA 4FD2A 1MEOA 3Q2IA 1TIKA 1OLOA 1V0JA 3K53A 5IJXA 3TTYA 4AKEA 4GWLA 3HJGA 5K2MA 2IP4A 2VPPA 4K26A 5BVGB 2PHZA 3NUZA 5CAEB 3PJEA 4V3CA 1H4QA 3HO1A 1ZG3A 1DOAA 5TJHA 1U5BA 2KWIA 5ALFA 3TZHA 5JZBA 4IICA 1YMUA 3I4FA 3KZMA 2XMZA 5AKEA 1FYWA 3EDQA 3OTIA 3WBJA 3Q3IA 2G6TA 1W96A 2PKXA 4BZPA 3SDZA 5K99A 3L5OA 3HBLA 1HXHA 5P8WA 5I9IA 2B1QA 3GJRA 1QQAA 3C8UA 1T43A 4D46A 2GSDA 5JW6A 2J0UA 2ZYIA 1SUEA 4JGBA 1EK2A 4O2RA 4M1YA 5DTMA 1TZMA 4DW8A 1W2GA 3G5TA 4LBWA 2XRZA 3M4NA 3EGCA 5JXHA 1D2GA 3H2BA 5AXDA 3RTAA 3FPSA 2LUOA 1RDFA 3QE0A 4GXNA 3F6YA 3FHTA 1IOLA 3IX7A 3MGKA 3ABQB 1V26A 4HFJA 3SY8A 3E9NA 3JQFC 1IXZA 3IEVA 3BZUA 3E7XA 2GZDA 1E6LA 1KI9A 5C8DA 5CDHA 4FGJA 5KNDA 3THYB 2W90A 3PXBA 2ZJZA 2HWXA 2NG1A 1U0TA 2ZS9A 3IEIA 4E6EA 2Q0QA 4MRMB 4Q4AB 4R8VA 4GPZA 2WLSA 4EL0A 2C29D 3DBVO 4K3UA 2D5LA 3FYHA 3LXRA 3CNEA 3PI6A 4MTLA 5DW3A 4NCNA 1MABB 5ESWA 4ZI5A 2I54A 1P5JA 2WAAA 5IM5A 1U6KA 4NYMR 3EHEA 2GGSA 3FGPA 3HXPA 4B0PA 4CF3A 2A58A 3FVQA 3PFKA 2Q28A 1TM7E 3EYAA 3L7KA 4HH4A 4LPKA 2CLDX 4U2EA 1NQTA 4L74A 3T7AA 3TLCA 5HYVA 4TLLB 5DGIA 3ZNNA 2AJTA 1XD2A 1TLTA 3LYLA 3Q11A 3UJ7A 2C2MA 2H92A 4EHIA 1ZW1A 2I34A 3GN2A 4QPJC 1MC4A 3N6VA 3PU6A 3K2QA 2Q1UA 3KLBA 3C41J 1Y9JA 3ETHA 2JLYA 3H7IA 2E48A 3P9XA 4K86A 4QVGA 4CQMA 1VPLA 1EK1A 1LCIA 1MRZA 3GWGA 5KTYA 1OT5A 4C01A 3SVLA 4DDWA 2ZWPA 1JG1A 3LUKA 1M1ZA 3IPCA 3KZNA 2WM8A 4QYSA 1LV8A 4OU5A 1G5TA 2ZBQA 1G7TA 1YBVA 4ENUA 2E4WA 3Q15C 1MO2A 3PCRB 3G2PA 1RD4A 1EE1A 4G0QA 2G83A 5JCXA 4LBZA 1R37A 2AZDA 1YV9A 4DIDA 2YX1A 1XHFA 3DVLA 4Y7CA 2G3YA 4REQA 3CZ4A 5JVDB 1G55A 3RS2A 2JFOA 5HMMA 3BFPA 4H3HB 2QLMA 1UANA 2O4UX 3E7DA 2WNHA 2FW7A 1IY0A 1C3OA 3PJFA 4LXYA 4NXNB 3W5JA 4MUBA 6GPBA 2OHVA 4Q9JA 5SY4A 2D4HA 2J87A 3K2EA 4EB6A 1RHQA 1OQAA 4U2CA 3SE7A 1ZK4A 2V0GA 5BSEA 2P69A 1ZJ4A 3L18A 3P20A 1SBIA 1W75A 3UXMA 2ZBUA 1QHGA 2PMFA 1KO5A 5BSFA 1DXOA 3W9UA 1PJTA 1ST3A 1ITZA 1U28C 3UVEA 4KO2S 1UXKA 3EH2A 4HCJA 1R3UA 2GASA 1CS4C 3M81A 5FADA 4CMIA 1A8QA 4XRGA 4XEHA 2R6JA 1FMFA 2KPOA 2XQIA 2ZVPX 1RAAA 2D0PB 3BERA 3FJYA 4RLHA 3GK3A 1E5LA 4DT1B 1OJ7A 4WT7A 3TUIC 3NIDB 3ZV5A 1HI9A 3OCJA 1QVWA 5TVKA 4N01A 2BFAA 5AMXA 2ZYAA 4JMLA 4AJ4A 4ALIA 4J75A 5E4JA 2F7SA 5J63A 2HU7A 4O0MA 4P1ZA 1LY1A 4PZ0A 5K8JB 2I7VA 4NZNA 3A0RB 1UMCB 2RAPA 3MAJA 3QJGA 2A4MA 1X7HA 3OCWA 2GERA 3OTGA 4TWAA 1I1NA 4HV4A 4I2VA 3C48A 2QVXX 1A9XA 1NHGA 1K7SN 1ZD9A 5HVNA 1DTWB 1HPLA 3CJRA 2NZJA 3SG0A 1ZKDA 3UAWA 4POAA 4KUHA 3DE6X 2OFFA 4DS3A 5EP3A 4HS4A 4MV1A 2R79A 3CF4A 3CO0S 4L8YA 1G8JA 4D98A 4XQ9A 5IJ9A 3GEMA 3N2EA 2B3TA 3A27A 4CLDA 4BVKA 3FIUA 3WGQA 3HCAA 3FE2A 3V6LA 1Z6XA 4Q4DA 2QVYX 3KJZA 3T5AA 3NOQA 4QC2A 4B9EA 5IBPA 2IZ5A 1FZTA 1Z9BA 1P0PA 3FWYA 1R0KA 4ZOLF 3OQHA 3IUEA 4RXUA 5EHNA 3NVKI 2AXPA 4PTZA 2HLDD 4QRDA 4JDUA 1QBKC 3HH8A 1WETA 3TIXB 2EX1A 3PX3A 5E9AA 3TZBA 1RLJA 2BL4A 4WFKA 4BGEA 2EKDA 5A4JA 4XVRA 5KQMA 4JY7A 1J8DA 1JR4A 1TM5E 3LHIA 4EUEA 4JS0A 3O4HA 2C2YA 3QM1A 5IPFA 3R8FA 5H83A 1QHSA 3HZRA 4JYMA 4KIUA 1JV2B 2VJDA 4DSOA 3PHBE 2IS1A 3RYIB 4MEJA 1YCDA 1Y1PA 1JFSA 4JLMA 5B3LA 5L40A 1ZIYA 2FPRA 2JH8A 3WO1A 1JKJB 3VHXA 3ZZ0A 1UWCA 1JYFA 1R9GA 1RE1A 3C15C 2VOJA 5HM8A 1ISSA 4INJA 5LP6C 5A6VA 1N2CA 1QDEA 4Q7LA 3NBKA 1XC7A 5HKLA 1QIDA 3FKQA 3D1VA 4CTJA 2PZKA 1JAIA 4D3ZA 3HADA 4KAFA 4OQEA 4GBMA 3ZPXA 1PJZA 2QN8A 4US1R 1QOQB 3L7AA 5GM2A 3FZNA 4KL8S 2IV3A 2ZSAA 2PH5A 4HGOA 1O3YA 1L9XA 1EI9A 5JYBA 3FCYA 4ARIA 4W1RA 4HRVA 2VG8A 2D06A 2G1UA 3BJRA 3LUPA 2ZYUX 4M86A 4CT5A 3FKSA 5FWAA 3QK7A 4DIUA 2RHRA 3ED5A 3DKIA 3DBHB 4QODA 3GNSA 3U7FB 1PJQA 2BKLA 2CXOA 4MV4A 1ZN9A 2PX8A 1WUTA 3RT7A 3JQGB 1ONBA 4PSCA 2ATCA 4Y6RA 5KO2A 3HNPA 4BCDA 5ES4B 4A2CA 3TFQA 4GOLD 4CR6A 1KR5A 2WJAA 2F90A 3KJGA 1BU8A 3OTQA 4MQBA 3LKVA 4XR9A 1WLSA 2XA2A 2I4TA 2ID8A 2QTVA 4HNAA 5JCJA 1BGWA 2VKTA 3GUZA 1R9MA 3GT0A 3NTXA 4ILKA 5B3JC 1JEQA 4AQ7A 2LTAA 2BDEA 1PNTA 1YZ3A 1IN6A 3B6JA 2IDMA 3QVXA 2P79A 4LHSA 1ECGA 4Q6WA 4DM4A 4L07A 4RZXA 2JB9A 1D1TA 1DQSA 2PLRA 1PUJA 3N6RA 2OLJA 5DPMA 1J2UA 1G1AA 1Q3TA 3NT4A 1EP1B 2O0HA 1ZUIA 3D8TA 3KL2A 2IHKA 1L1RA 1N2BA 2VEDA 3BQ9A 2GEKA 3M4XA 3ZIDA 2D6FA 5A62A 1I14A 3OIVA 1GAEO 1DAPA 2Z8YM 3VR3A 3REQA 5IRCD 3QPWA 4X7RA 5KNCH 3AF6A 2DTDA 1JR2A 3JQ7B 3FWPA 3HCRA 3BWCA 3NWJA 3RLFA 1OY1A 4FKMA 1MT0A 4XUDA 3IQWA 2UDPA 3SQXA 1U3VA 2E82A 3IAUA 8ATCA 2GPJA 1IWPB 1YQEA 4G1MB 3NYRA 4PLGA 4YUXA 2QRVA 1Y4UA 1QG4A 2GNPA 3AUXA 3T1NA 3WQQA 1SC1A 2JIRA 4FX5A 3CF6R 4NE7A 5AK5A 5EMLA 5FA8A 5TDHA 1GZ4A 1I24A 4BFYA 1NWHA 1V1MB 2WZQA 3D6JA 3DOOA 3IUYA 4FMBB 4NNPA 1CD5A 5G0UA 2UXCB 2OV4A 4TV9B 2PUCA 2J8ZA 3RAPR 3EXIB 1II9A 4HATA 3GP5A 4LMPA 2FG5A 2VWQA 1JHRA 1R9JA 2X7HA 3C5WP 1GIAA 5LQKA 1G5RA 3FNHA 4R84A 2C04A 4UHKA 1J8QA 3RUCA 2PX0A 3OSUA 1QKJA 3F98A 2J45A 5A1TA 2GCEA 2JRLA 4AKTA 3SC3A 1CUVA 1I36A 2XF2A 4IIXA 5LYJA 4CMHA 5KU1A 1BWRA 3GCWA 4DIKA 5JJBA 2C8JA 3FYTA 3NBUA 5K2OA 2Q0SA 3CRQA 3EXEA 1VJ5A 1XL0A 1GU1A 3DDZX 5B64A 1NN5A 1HLPA 1S7CA 2VQEB 2I4IA 2IYUA 4HHEA 3RVBA 3AKZA 4FHFA 821PA 2XCTB 2OBBA 1LJUA 3BKWA 3P0EA 1JIUA 4MYCA 1ZONA 4ZCPA 2F1IA 2OP0A 3F67A 3WB1A 2OA0A 1OFTA 4ZQFA 4PINA 1U2TA 1TO2E 1MG0A 2PG3A 3WLHA 1SA0B 1K4YA 2B1RA 1USKA 1CIPA 2XUJA 4CL3A 4ZJZA 3OM8A 5H81A 2QE7A 3EDOA 2WDZA 4HBGA 1PSDA 1TOAA 2VDQB 5G1PA 4B4WA 3H42B 1WSAA 2GHIA 5J4LA 5M2QA 2YJNA 4J49A 4RMNA 3D4PA 2NZVG 1U99A 3LBIA 3PL1A 4F3NA 4B3IA 3PNOA 3KVNA 3QFTA 3WA7A 2FSUA 5K05A 1Z5PA 3Q87B 1ZJZA 2XIJA 3CXUA 2F4NA 4BXOA 2C00A 4JGIA 3KHTA 3TQTA 1GQSA 3P96A 4G1EB 1TIBA 1PCXA 3ORRA 4M21A 1GPMA 2YOFA 2MSCB 2Z2XA 4MPPA 1J56A 2KM1A 4LHZA 4EG4A 2BGWA 1Z0AA 2A94A 4HAVA 4C08A 5IKXA 2C88A 3G7SA 1AGPA 1ZQ1A 1S2LA 1KYWA 4X6UA 3R74A 4DIEA 5DNUA 3PF8A 3RVMA 1O97D 3PRKE 2BTEA 2FQ1A 4X3CA 3PTAA 1SKQA 1VTKA 1ESMA 1Q77A 3R5FA 3UPUA 1CUAA 1NIPA 3WMFA 3FI9A 2FVXA 3DOHA 4H60A 2AR0A 1H5UA 1K7XB 4XM0A 4P84A 3GUCA 4EPRA 4I3GA 2V0CA 5FJIA 1SD1A 3FUCA 1CEXA 1XTRA 3DMGA 5G0SA 1N36B 2X9NA 5EYPA 4IDPA 2W0SA 3WLPA 2GRUA 1VIYA 1EH5A 3R0JA 4FB5A 2WV9A 5IT0A 2D2IA 4P93A 5IG2A 3WRXA 1SC9A 1W5SA 4YRBA 3KT6A 1YGYA 4G0NA 3SMVA 1LX6A 5DP1A 1G8SA 1T2DA 3KZ1E 1KF0A 4DR2B 1AN0A 1WUKS 1O58A 4LHXA 4EHNA 4POOA 2HN9A 4GSYA 2WE7A 4ZTBA 4BWFB 2DGDA 2ZUVA 4ZPXA 3DM9B 3DL2A 3QU4A 1NLYA 3JVIA 4J1TC 5F78A 1I9GA 1K6IA 2HRBA 2QUIA 3OZBA 4OV6B 4PE5B 4CLOB 4PNEA 4US2R 2YV4A 1VP3A 2J6BA 3FY4A 1T5OA 4OA8A 2VTBA 3IR5A 1NFRA 3PPWA 4ZEOA 3ROMA 5KNDD 3ED1A 3O7WA 2LIPA 2ONYA 2GTIA 2CL0X 4NATA 4UUPA 4XVCA 4WGFA 3DEHA 3W90A 4YHBA 1QPBA 1K0FA 2JIBA 4F3RA 3EZNA 2OL4A 1JXAA 2BTQB 1HMYA 3RSCA 3D4NA 3E9YA 1QE3A 5JEDA 1G2QA 4Y18A 1G20B 1OZAA 5ALIA 4IFBA 2AXNA 3QUSA 1FSZA 4JP5A 2G36A 1VL0A 5TLSA 4I46A 2ZGVA 4UUMA 2FY8A 1B15A 1KJ8A 2EYUA 3B89A 1OXBB 4C89A 1ZNXA 5JNLA 3SZRA 2JGJA 1Y1SA 2D7CA 3I73A 2WAXA 2WSMA 4KKXB 2PZLA 1YFJA 4TMZA 1J39A 5CA0F 1W88A 1QNLA 2OB1A 5IDXA 4KN8A 2QJRA 3IUNA 5IHPA 2ZJ3A 4CQMD 1GPBA 3PXXA 4IV0A 5D00A 4ZMRA 1TQ2A 2E18A 1E9RA 2FN3A 2HSEA 1M7GA 5FA5A 5EMJA 4BQFA 1QP4A 2V03A 1C7QA 4K9OA 4MRAA 1RHUA 2PRKA 3S5JA 3D0KA 1T0UA 4WPGA 4CQNA 2IX9A 4D8TA 2CHQA 3QVGA 1EFVA 1L4LA 3CF0A 2H7YA 4R3WA 5GOTA 4AX8A 3BMOB 1GZSA 3SZLA 1N6IA 3LBNA 4F1WA 1Y1LA 4IS2A 1ESEA 4UCWA 2E6UX 2HA3A 1YI1A 2IHJA 3V8BA 4EOGA 9LDBA 1W94A 1OXVA 3KD2A 1R0SA 1NNSA 2NTEA 4L5JA 4QASA 1ELOA 1T8SA 4Q21A 3GAAA 1MB4A 3TZEA 2G71A 2VZ9A 4KLCA 1JYSA 1YNOA 2W2MA 2YIJA 3NDJA 3RJ9A 4ZOEA 3B3GA 5DCLA 1V11B 4OGFA 5I7OA 2XKAA 3WGTA 4JCCA 3ZZTA 2CNBA 3V3KA 4DV6B 1KMMA 1P6QA 2HLPA 4OTZA 3T5TA 4L3WA 3L93A 1YZFA 2IVFA 4WUVA 3TXXA 1PR4A 2WNSA 1IG3A 1Y6QA 4QXOA 3IE0A 4R6XA 4B1FA 1ZVVA 5ALHA 3WL4A 3PIDA 4II3A 3T3IA 3A2NA 1NN3A 1KAEA 2VWHA 2YJ5A 4PPYA 4C2BA 2ID4A 2ZANA 4DUGA 1A71A 1ZI8A 5AVZA 3KQYA 1LSUA 2QUZA 2X13A 3C6ZA 1U1CA 4BX0A 5IBCA 5I51A 2CDNA 3TTTA 3GJZA 5CIQA 3PGXA 4G2TA 4Y2PA 4BP9A 3PC2A 4B3SB 5BR8B 4TM8A 4WN9A 1IQUA 3F74A 5CDTA 1EA5A 3W5CA 3GAZA 1IQPA 5ABPA 4MULA 4MUFA 1CJSA 4CM8A 2Q5EA 1NQ5A 3HLYA 4EZBA 5AJVB 2IWRA 2D8MA 4DUPA 2XIQA 2GN1A 4FFBA 4L73A 3GZNA 5BOVA 3Q6MA 3ZKAA 2VBGA 4G0XA 1ODLA 4RV9A 1Z13A 3LHDA 1IUOA 3WKBA 1JN0A 4R0VA 3N70A 2KB0A 3D1LA 5BN5A 3BXXA 2IV2X 1VYTA 1JLSA 2FW0A 3L04A 3Q0EA 2AC7A 1B8VA 1PYDA 2BFFA 1LK7A 2E21A 5SICE 1NVXQ 1SIOA 3U7JA 3PXDA 2XWSA 5CVTA 3G0BA 4JASB 1EFCA 3WIBA 2EG5A 2ZT7A 5EHXA 3VZBA 4L76A 5EQJB 3QXJA 3WL7A 2X8LA 3ZDBA 4P92A 2J9YB 5CT5A 5DJ5A 2GM3A 4BNGA 5KYWB 3EVEA 1WSBA 3DLPX 3TXAA 1Y42X 1ST2A 3HU5A 4B7AA 1QM5A 1VMDA 1Z29A 4D80A 5LB2A 4F3KA 4YJGA 2P9GA 3R9IA 7ADHA 1OPXA 3HU3A 3UYKA 2CHVA 4FUTA 1J8MF 3ZNQA 1LPSA 1WF6A 4ZQBA 3CLHA 4MQLA 3MWFA 4U8HA 4PO3X 3MW8A 3L7YA 3RQIA 3C6BA 1HH4A 2VJMB 3DT9A 4ALMA 2DWUA 3D8NA 3L6OO 1P2SA 2XE8A 1VLMA 3TLGA 2PUBA 5EAIA 2ZIGA 2YL2A 2ET6A 1GN8A 1E3IA 4EY5A 1Q21A 1C0PA 1DKQA 1KFEB 1VZ2A 4KCGA 3HY6A 4X6YA 1RADA 1YL6A 3HVKA 2X22A 3CKMA 3M9XA 2C5BA 3JWHA 1CZNA 4AICA 1UFKA 4QUDA 3LCRA 3TQQA 1E2PA 3UJ8A 3CE9A 3FAKA 4IJMA 5DGXA 1CQIB 4HLUC 1WQ3A 3SXUA 4BNKA 5I3CA 3LZDA 1ISIA 1TT5A 3FKSD 3IBTA 4IMIB 4R6WA 4XYEA 1A7AA 1OFGA 3EXHC 4F6RB 4NCKA 4DMKA 4INOA 4RA9B 1GT91 1V5FA 4ZT4A 3RT9A 4UAJA 4KXQA 3QE9Y 1NQAO 3HVIA 5JEEA 2ECOA 4E4RA 3AEUA 3F71A 3K8OE 2WB4A 2AN5A 3LWDA 3REFA 3SYLA 1TW2A 2ODPA 3INNA 1GXSB 3RUEA 5D86A 3TLXA 4BTEA 4ZJPA 3W3AA 3RS7A 2E1RA 4CT4B 4Z3DA 5JCJD 1HLGA 4NIMA 2J3JA 2FSFA 1QYRA 4DC1A 3UEOA 5JI2E 3TB4A 1WSWA 4ENPA 5BV1A 3GRAA 2GZAA 1E69A 2C2XA 2AOUA 3L0SA 1EXDA 1CSEE 3KAKA 3ZD6A 3GLIB 3KQSA 5HSGA 3RE1A 1FXUA 1L5ZA 2BVNA 1Q57A 4BO2A 3ILVA 3G0CA 3LT4A 2FQXA 4RC9A 2CD7A 2ZSKA 2M6RA 1OX5A 2VPTA 1NJ2A 3AR4A 5H0IA 5FWXB 5DM70 3VPFA 3VR3D 1ZXXA 1YDGA 1VPVA 2X2PA 4J1QA 4BFXA 3CZCA 5LD2B 3EPKA 3CJTA 4BQOA 4C2UA 3I28A 1EA7A 4MQFA 2J08A 4Y2HA 3UA3A 5IHXA 1VL1A 3MCVA 5IYZF 2ZAGA 4KIFA 3JYPA 4R1OA 5IDQA 1NNUA 3G7NA 3IMFA 1U6IA 4ZCQA 2OO7A 1QRRA 2Q5HA 1B0ZA 4HDRB 4XAQA 4R0MA 1VHTA 4JT2A 1IM5A 2WJGA 2GYYA 3IDSA 2QUBA 4MKZA 5DYGA 2HYDA 3L1VA 3ZE7A 1HZZC 5CP8A 2VPQA 5D8DA 3EVZA 5HK9A 1KI2A 3LIIA 1W8DA 4G07A 4KK4A 4XVUA 3Q8LA 4YMVA 2TECE 3LC7O 4E4YA 2F43B 3CW9A