3QHPA

Crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
159
structure length
159
Chain Sequence
TPFKIAMVGRYSNEKNQSVLIKAVALSKYKQDIVLLLKGKGPDEKKIKLLAQKLGVKAEFGFVNSNELLEILKTCTLYVHAANVESEAIACLEAISVGIVPVIANSPLSATRQFALDERSLFEPNNAKDLSAKIDWWLENKLERERMQNEYAKSALNYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Type 1 capsular polysaccharide biosynthesis protein J (CapJ)
publication title Crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 62
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3qhpA00
3CEMA 1C50A 2X6QA 5TVGA 5DLDA 4BQEA 2X0FA 1UQTA 1BX3A 5IKPA 1UZUA 2XGMA 3MRTA 2IEGA 3CUVA 2QRPA 4EL5A 5C1DA 3OT5A 3O3CA 2JLBA 1WW2A 1RZVA 3BD8A 4RIHA 3G2HA 2QN7A 2JZCA 5BNWA 2QN9A 2IYAA 1NLMA 5DXFA 3NP7A 1M5RA 1SXPA 1L5WA 2ECPA 4X7PA 3T7DA 2GEJA 3OKPA 4GZ6A 3MTDA 4M60A 3IA7A 2KS6A 4MHOA 4GZ5A 3OKCA 2QLNA 3MQFA 1Z6QA 2AMVA 2VG8A 3MBOA 1L5RA 6GPBA 3ZCVA 4Z5XA 3AMVA 1ABBA 1P2DA 1Z6PA 1WUTA 3PE4A 3S27A 4GPBA 2R4TA 2ATIA 3D0RA 2ZB2A 3QHPA 1GG8A 1GFZA 1GPBA 1FU7A 3OTHA 3CV3A 3CUYA 3NPAA 1LWOA 2H1HA 1EXVA 1YA6A 5ENZA 4F9FA 2C9ZA 4RIFA 4CTMA 5JTUA 1P2BA 3SYRA 5LQDA 1JG6A 1PN3A 2VCEA 1V4VA 2IV7A 3NB0A 4AMBA 5GPBA 1P4JA 2BGTA 3EBPA 3NAZA 3S0JA 3ZCTA 1XKXA 3D0QA 3MTAA 3GPBA 1JIXA 2BFWA 3SYMA 3CUTA 2F3PA 5IKOA 4RBNA 2IUYA 2QN2A 5D00A 1L5QA 1FU8A 2XCIA 2F3SA 4GZ3A 3BCRA 2R66A 2G9QA 4N39A 3IAAA 3L7AA 3DDSA 1GPAA 3OKAA 2QZSA 3DD1A 1NOKA 2BISA 4MRAA 3OY7A 3T3DA 1B4DA 4RIGA 4X7MA 2GM9A 1GGNA 4EJ2A 2Q6VA 3CX4A 3MS4A 8GPBA 4X7RA 2QLMA 2GJ4A 3GUHA 4CTNA 3G2IA 1JIUA 9GPBA 1EM6A 3MT8A 2FETA 2IV3A 2HY7A 3H4TA 1FU4A 5TMDA 1L5SA 1PSWA 2QN3A 4WHMA 1F0KA 2QLLA 1P4GA 3E3NA 3T3EA 2G9UA 3MT7A 3G2JA 4N9WA 1RZUA 1KTIA 1FS4A 2SKCA 4RIEA 3FROA 3HBNA 1AHPA 4AY6A 3MRXA 1VGVA 2QN8A 3RSCA 3WAGA 2WTXA 2QN1A 5D01A 3G2LA 2R68A 3BDAA 1IIRA 4FZRA 3HBJA 2SKEA 1GPYA 3BD7A 1NZDA 2IW1A 3MS7A 1FTWA 4CDRA 3Q3IA 2AV6A 5JTTA 2PQ6A 3H4IA 3TSAA 2XA9A 3PE3A 2F3QA 4HLNA 1P29A 2R4UA 2C1ZA 1Y6FA 1F6DA 2AW3A 4KQ2A 3EBOA 4EKEA 4GYWA 1JIVA 3VDMA 1FTYA 4FKZA 4RIIA 4AY5A 4BQIA 2JJMA 1WUYA 2YJNA 2FFRA 2O6LA 1C8KA 4AMGA 2ACWA 1AXRA 2PYIA 1L6IA 3ZCQA 1P2GA 4M83A 2XGSA 2GPBA 4W6QA 3L79A 2GT1A 2FF5A 2VSYA 3VUEA 1NZFA 4NEQA 2XMPA 4MHSA 4LEIA 1J39A 1E4OA 1C8LA 2PRJA 4LDPA 4NESA 1O6CA 4MICA 3CUWA 5TMEA 3ZCUA 3S28A 3S2UA 1PYGA 4M7PA 3OTGA 4XIFA 3MSCA 4KQ1A 2IEIA 3BCUA 1UQUA 1Z62A 1XL0A 2X0EA 4G2TA 2QRHA 3QKWA 2PYDA 1WV1A 1K08A 3NP9A 1XC7A 3BD6A 2ACVA 3COPA 4HWGA 1A8IA 1C3JA 4N3CA 1E1YA 3T5TA 2F3UA 3CEHA 4YUAA 2C4MA 1RRVA 3G2KA 3MT9A 1H5UA 4NC9A 1FA9A 3E3LA 3E3OA 2XA1A 3MRVA 4AN4A 2PRIA 2ASVA 3MTBA 3C4VA 3HBFA 2G9RA 1WV0A 1JG7A 1NOIA 2XCUA 3L7CA 2SKDA 5TMBA 1GZ5A 3WADA 3ZCSA 4MI9A 5I45A 4XI9A 1WW3A 2QRMA 3T3HA 1XV5A 4CTOA 1P4HA 4F96A 4RELA 1Z8DA 1HLFA 3G2NA 4F97A 5DU2A 2XGOA 1Y6GA 1FTQA 3TOVA 2GEKA 3HBMA 3OTIA 4BQFA 3Q3HA 1SXQA 2VSNA 4WADA 2QRGA 2X6RA 4EKYA 4YI3A 3UYKA 3CEJA 1YGPA 2XA2A 3DDWA 2P6PA 1L7XA 3RSZA 7GPBA 3BEOA 5HXAA 3BCSA 2G9VA 4MI6A 4WACA 3UYLA 1PNVA 3L7DA 3CUUA 1LWNA 3MS2A 3C4QA 4KQMA 2IYFA 3L01A 2X0DA 3D1JA 2AZDA 3ZCPA 1JEJA 3L7BA 1IXYA 1QM5A 1NOJA 2F9FA 1XOIA 4QLBA 3TAXA 2GPAA 3C48A 4L22A 4N3BA 3S29A 3NCHA 4BFCA 3Q3EA 4N3AA 3DZCA 1L5VA 2R60A 1NVKA 2BGUA 4RENA 3ZCRA 4MI3A 3NC4A 3RT1A 4X6LA 4GYYA 2OFFA 1XL1A 2VCHA 2QNBA 2GPNA 3T3GA 2QRQA 3WC4A 4REMA 3RHZA 1FC0A 3VUFA 4YI5A 1Y8ZA 3VDNB 4EL0A 4PQGA 3T3IA 2H1FA 3OY2A 1QKJA 2C1XA 1K06A
chains in the Genus database with same CATH superfamily
1PJ4A 3P0JA 5FLYA 1V0JA 4LRUA 4PZPA 3FNGA 1H0SA 1EBUA 4RH3A 3R0ZA 3IB6A 4N7MA 5T64A 2UU9B 4MB2A 4ITRC 4BJ5A 4OL0A 5KYKA 1YZ3A 3F8SA 1SA0A 3ERCA 1UBNA 5LOVB 1QXSA 1R9GA 1DCKA 4KQEA 2ARKA 4ECEA 4JX9A 4NZMA 4AKGA 3MWDB 4I1PA 1H2RS 1ZISA 3D6JA 1HE1C 2JGJA 1EINA 2QVCA 2XGMA 4EWLA 4DUZB 4HXFB 5CFMA 1XJCA 2GUWA 3EVEA 2QD3A 3EXIB 3V2HA 2BI4A 1CW2B 4H7KA 2UYCA 2GEVA 2AYXA 1BROA 1PJQA 1IN1A 5I8ZA 2I7DA 3RBAA 1VB5A 2HK6A 2JC3A 2XUGA 1FRZA 3P9CA 5TS3A 2Y1LA 5BSKA 1CFZA 2NPOA 4J2HA 4IZIA 4JD5A 4OG2A 2Z4TA 3VR3A 4JI4B 3K0FB 5C81A 1KPHA 3SWWA 3WWYA 2OHXA 1Z75A 5CR9A 3B1KA 1GKKA 4Z86A 3TR6A 4ASUD 2BJVA 3C6BA 1SZCA 4ER0A 3W9BA 1NI4B 1EUDA 1UBTS 1UZAA 2MR5A 3RK0A 3TOZA 1M8KA 2RAVA 2YIDA 1Y3DE 2HMUA 4EFLA 4GZ6A 3TTUA 2AXQA 2YHAA 3UN1A 1CKEA 5CVUA 4HEHA 3ZZUA 3H3FA 5FPKA 1CWUA 3OZVA 4KBGA 1TMYA 4K5QA 1Z0AA 4TMFA 4ANFA 2YMLA 4OMDA 1O5OA 1XXHA 4HX9A 1M2EA 3RKRA 1AHIA 3PNLA 3IO3A 2AFRA 3LPDA 3PC8C 3DULA 4REOA 5AJTA 3PQCA 1FFHA 3SXUB 2ZUTA 3SZ3A 1KARA 1ETUA 2M6LA 4FCVA 1N5IA 2VHJA 4R81A 3E9RA 3U4GA 1HRKA 2FVYA 3LBHA 1MOSA 2LP4Y 4H1UA 2R79A 4EUNA 5KQRA 1FF9A 2F1OA 2QZ4A 1ZK2A 3B1FA 4PWZA 1F48A 4U9UA 3RCBA 3SQWA 4LJRA 3JTEA 3WE7A 2Q5CA 3KETA 1T1GA 2PZKA 3GNSA 5AW1A 3VR2A 1OV6A 2AEFA 5DCWA 5JLAA 1WCV1 3NKLA 4TV9B 1JNXX 2N46A 4BAZA 3T34A 1DARA 3GELA 1VECA 2I4MA 1PNRA 2A5FA 1MX3A 1E5TA 2R6R1 2VYQA 3VU1A 1QG4A 2BFFA 1B74A 1MFPA 2RI0A 3LHFA 3PXCX 3RG8A 3CNOA 1JDTA 3EZ7A 3F4KA 2P4SA 2W83A 4L2IB 4A26A 3T1OA 1OAOA 1VLJA 1KOJA 3ORHA 4RKYA 4C6SA 3CV3A 2PU7A 1ND6A 2OCAA 2DHDA 3GR6A 2A0FA 4Q7MB 2B4KA 1AZSC 2I6FA 4OXRA 2XF2A 3ZWXA 1BRTA 4RJKA 1TFRA 2WWHA 3IKMB 1WBDA 1NFFA 2HB6A 3KYCB 2UVQA 4KZKA 4LZPA 1HKHA 3NHLA 4KACA 4RC9A 1JHPA 3SBEA 1FXUA 4ZMBA 5KTSA 4AECA 3M34A 4PC2A 4MS1A 4CI0B 4TZKA 4U2FA 4WNIA 4F56A 5JSQA 3VKUA 4PLFA 2Q62A 3CGGA 3LWZA 1KFKB 2P6MA 4OPMA 5EJMA 1PX0A 1TZBA 1OMOA 4W9NC 1BWRA 4U0JA 3HUUA 3HCCA 3AUAA 3JZDA 4MA0A 3T5BA 1NGSA 4ZI7B 4OX9B 4LTMA 1SCAA 1J24A 2OGUA 1JIXA 3RIHA 4YRBA 1N32B 2XYRA 1C8BA 3ESDA 2ZJ4A 2VK8A 1CB0A 1UWVA 2D5BA 2D8MA 1H4VB 2ONZA 5A5DA 4MKIA 3CUTA 1NZJA 3ECSA 1GADO 3NNSA 3QRWA 4GDMA 1NBIA 2EJBA 3JALA 1JA9A 4UBJA 1GTSA 1O94A 2QN2A 2JH3A 3IQGX 1SZJG 1L5QA 2QQGA 3SSMA 4NHEA 2UYHA 1EFPB 3TGWA 4K46A 1DIBA 5AKKA 2WG2A 5H16A 3FJ1A 4GZ3A 3T7RA 5CNJA 1HLDA 4J94A 3IP8A 3KR1A 4HJXA 1UXKA 6REQA 4AC9A 1MW8X 3TIGA 1SVNA 3AY6A 2GBPA 3BB3A 4P9NA 3LBYA 2V5AA 5D85A 4FWTA 4LF5B 4PSUA 3L41A 2KLBA 2WVAA 5JO9A 4OAPA 2J46A 5BNFA 4MRAA 1N3IA 3T9FA 1B4DA 3MHPA 1L8AA 4RIGA 5ECWA 2TYSB 3RVQA 1W7AA 3BMNA 2GM9A 3ZDYB 4N0MA 2WWTA 3FPSA 1Z3CA 3PV0A 4D43A 4UEKA 3OETA 1Q3HA 2VJCA 4Q3DA 5LZ5A 1OFTA 4AJ9A 3C4JA 1HDRA 2A92A 3HCFA 2PWAA 1EVLA 5FBRB 3EA5A 5C7LO 4CMEC 1D6MA 4KXVA 2RHLA 1MG0A 3PDHA 1X8LA 4LMRA 5AWFC 3RRYA 3UMCA 4DLKA 5KYNA 1G8FA 1E3EA 1KI2A 2YFYA 3QXHA 1RLOA 4WFKA 3ADDA 3WIEA 3DYIA 5TMDA 4HYYA 3HU2A 2IKSA 4DRYA 1ZJZA 1X80B 1K3FA 3L07A 5H70A 3RE1A 5A5FA 2DHQA 4O1MA 2H1SA 4RK0A 4QU8A 3B85A 3NWPA 5DRTA 2V1UA 1KMQA 3NC0C 4UHHA 4I6EA 3QVLA 4MP6A 3C1AA 3G2JA 3F3SA 3GVCA 1GPDG 4UHCA 3SFZA 3GLGB 2H1VA 2NACA 5CDTA 1WOMA 4IJ6A 3KB1A 4FN4A 2SKCA 4X54A 1RJGA 2AZTA 2IF0A 3D0KA 1FQKA 3EDMA 4FC7A 5CB0A 4URWR 4DUYB 1LQUA 4JYCA 4AY6A 3OECA 2BIFA 2VAVA 3OE1A 3RSCA 4A0QA 1DB3A 3ELUA 4NDZA 1QQTA 1UBKS 1U98A 4QOHA 2QJWA 1YQDA 1CHDA 5P8WA 2NV6A 3BXHA 3IT2A 2Y27A 3C8ZA 3O38A 4G5SA 3M70A 4KXNA 4NE2A 5D8DA 2XDAA 2A9RA 2BKEA 5J2UF 2BGKA 3KZKA 2OQVA 3RFCA 1ZMOA 1IZ0A 1UIMA 2JGMA 3MYYA 3PA8A 4YHBA 2RG1A 3PDJA 4UUOA 1JLRA 3M81A 1IBLB 1MG5A 5EMJA 1ZGCA 1I6LA 3MTQA 3OU2A 4QSHA 4BDSA 2IH5A 4JQZA 3PRYA 4O4IB 3S70A 2XXJA 5JY6A 3FHCB 3LRXA 3PGXA 3NDRA 2XA9A 2A9JA 4IWYA 3RYFA 4AG5A 1EE2A 4BO9A 1BEZA 3CKLA 4WGFA 4HVAA 4B33A 2D2XA 3DMRA 5LBTA 2GGSA 4Q6WA 1U1DA 4GIBA 4J6FA 5H82A 3N8NA 5DW0A 4LGMA 4D99A 5INTA 3KEGA 3K5IA 4F3YA 2D3WA 4YCLA 4HWRA 3K53A 2O8EA 3IUPA 3VDMA 3CG0A 2XOEA 3UMSA 4FKZA 2QMOA 3GDHA 3NZEA 2G6TA 3O4FA 3PDCA 4MA5A 1QHNA 5T6BA 2FFBA 3WGGA 3PRHA 4C3OB 4WBNA 4J29A 1KBQA 4BLVA 1TTTA 3DLCA 3P8ZA 1NYRA 4JELA 3RU9A 5ICSA 3RVLA 3GGGA 2Y0PA 1X38A 1ZM2A 1P2GA 1PGNA 3GDWA 3GMIA 2HQSA 2BW0A 3WRYA 3IDAA 5FFMA 3KLBA 4K6CA 1LB1B 4BNYA 5L51A 1TADA 3STWA 3OH8A 3OLQA 1GYPA 2CL5A 3QOXA 3CVOA 5B1EA 4XWAA 2WTBA 3FMGA 4N40A 5BR8B 5CD1A 4IXMA 2GAOA 2O3QA 4F5WA 1KFEB 5JARA 2C9BA 1CF9A 2E1RA 3AI1A 4ZWNA 4BFWA 1OAKA 1NR5A 4LEIA 5EXPA 3GH1A 2D7CA 4RVOA 1A4XA 4L5YA 5A62A 4M36A 1DLIA 3ZVMA 1E1KA 1JDBC 4DG9A 1TQ8A 2VSFA 2XRZA 1OH8A 1YQUA 4M0KA 3WK4A 2WJYA 1BGXT 3DMTC 1UJNA 2R7NA 4DJAA 5HIIA 3FAKA 4FYIA 3E8MA 4WV3A 2NUAA 4DV3B 3AI2A 4ETWA 3ZU5A 5A3JA 4GMFA 2ZI4A 2ZBDA 1UK6A 1NNEA 4IIJA 3FLAA 3BK2A 1NG9A 1DJLA 1UQUA 2NTNA 4KV9A 1W30A 4A5SA 3EPHA 3HO8A 1NX6A 3ENNA 2AMLA 2RJOA 1TZCA 1QGOA 2FSHA 2IY7A 4UXHA 1LPBB 2JFNA 5WRFA 3GN2A 5K0CA 4M8LA 1KQFA 5CNKA 3VMMA 2JJ2D 3HBAA 3NT4A 2EP7A 4OBEA 5EZYA 2QTTA 1GLNA 3A28A 1R6AA 1SNYA 2IYVA 2WIAA 3FOCA 4KWTA 3WHPA 2NMVA 2YYSA 3NEAA 2B30A 1VYVA 2CCGA 2NU6B 4LJLA 2QTWB 3EPLA 1TA0A 1O6GA 1T9CA 1QCDA 2BUCA 2HF9A 3CA8A 4GMXA 4MYCA 4XSHA 4ZHQF 1H1LB 4NAUA 4V1CA 1Y9DA 3HB5X 4HHEA 1SUSA 5K6AA 4C5BA 3THYA 1XCBA 4XD7A 3GLVA 2HWXA 5IAKA 5K5EA 3AKYA 2WUDA 2WWRA 4KO2S 5AO9A 3U3ZA 5DTQA 2O8FB 1YK0A 3I34X 4P38A 4CNQA 4J90A 2H4YA 4PAGA 4LWQA 3PB3A 5EHXA 1GUYA 4BFSA 5HKBA 2Y1DA 4YBZA 3WGUA 3IQHX 3KFXA 4BAUA 2WTEA 3ONFA 3MOSA 3WMEA 2EBHX 2JA2A 1EM8A 4XSVA 3CZ9A 1AA6A 1JG1A 1T4BA 3F73A 2OGTA 5FT9A 5LLTA 2Q4OA 4C0HA 1ZNYA 1DBIA 2G9RA 3DOCA 5DK6A 5ALFA 4KR2A 4JL6A 4CUKA 2O06A 2VHTA 2PMBA 1BN6A 1QCZA 4LSMA 3BA1A 1NBMD 5ARCA 5TMBA 1L4NA 3SXJA 3ABIA 5DBHX 4RXTA 1WW3A 1M0WA 1OY1A 2FPPA 2IYNA 2SICE 5IVDA 1JT2A 3TR5A 3KYJB 3EBLA 4NMMA 4YJFB 3UT0A 4Z8YA 4W5HA 1U7PA 1OVGA 3TIVA 4CKXA 5IUKC 3T06B 4GC5A 3H5RA 2DKFA 3OPMA 4N76A 5I9BA 1DZ3A 3UC5A 1Y1RA 2Y0BA 3GVHA 1AF7A 4LDRA 3LK6A 4BJ1A 5DCYA 4XX0B 4K0RA 4QNRA 1HEUA 4CN9A 1QPBA 1W0KD 4QT4A 2HV8A 4I9HA 3AT1A 1OYYA 3E1KA 2QA5A 3O94A 3KK0A 2E55A 4HNUA 4FN5A 3QTLA 3HB7A 5TPZA 3WL3A 5A4MS 3IEPA 5FPYA 2PSFA 2ZYSA 3U7QB 1ARZA 1BYIA 2AD5A 2PZEA 5KAMA 3ZKAA 2VF2A 2Y2VA 4RZUA 3GA7A 3UYKA 3S5JA 2VYVD 1P0FA 2BDUA 3CX3A 1HC7A 2RKOA 3IBSA 3EFOB 3V2GA 1GZDA 3MLBA 3KUCA 1RE0A 1ONBA 2WJPA 2OG2A 7GPBA 1XAHA 1GNLA 3BB1A 1YVRA 1RVV1 4JASB 4KN6A 1DI0A 1NW4A 1CUBA 3ITKA 1SD5A 1E3WB 2VHCA 3EG9A 5KHAA 3PKJA 1AUVA 3IL2A 4NEGA 1MO5A 4NBLA 4B8ZA 1AKTA 4BEVA 4N5HX 3A6ZA 2WUWE 4FJ1A 2IYYA 3USES 4B8WA 4YRDA 3ZQ4A 1EJ6A 3M4XA 3U44A 3G88A 4RKEA 2ZP1A 1RPJA 3ZJ4A 4DCPA 5CYOA 3A70A 3PL5A 1C7EA 3CLTD 4N6OA 1LC0A 1HTTA 3NIBA 4LJAA 4LHVA 4RD3A 4ZKDA 2WJHA 5KDOA 4KQMA 3UAOA 2VUSA 1CFJA 1X87A 3TTXA 5AUOB 4LMBA 1ZJWA 2ZIFA 3WYEA 1LBSA 2BM9A 1WDTA 4IIBA 4YJGB 4NZYA 4CIWA 3IR6A 3TWOA 5CTJA 1QIHA 5ECGC 5ECDA 5EE0A 2WQZA 3IH5A 5KOIA 2JIZA 1DAEA 4WK0B 4JY7A 5I7UA 2WC1A 3FSGA 3W3AA 3WJ2A 1FRVA 2JA1A 3KHSA 4UBMA 2JZOA 3NGLA 4PYJA 1US8B 3R5SA 1PDVA 3EEOA 5JSZB 4DZZA 3PVCA 3BEDA 4E5SA 2J7PA 2QY6A 3UJHA 4RF5A 1ZUWA 5EXDA 4IFTA 2D2EA 4DYVA 2R8XA 3VKWA 4QO7A 3ZJ5A 2IEDA 1UUFA 3M4NA 3D02A 1WUIS 2CHUA 1L5VA 1YBFA 2P1DA 4HLCA 5JEDA 1ODSA 2OMEA 5ITSA 1RADA 4EMTA 1JA0A 1MB3A 1RAIA 1PL7A 2DXIA 3OCYA 1CZKA 4CR6A 1OYVA 1WKCA 2Q8PA 4BECA 4EGFA 5ICMA 1KEUA 5KB3A 3EZGA 4WFIA 4GL4A 1OXSC 1IDOA 2C5FA 2OHFA 3N2IA 3BHJA 2WJJA 1Y5IA 1DUVG 1TCVA 5CVCA 3OCJA 3THWB 3MWGA 3DQZA 2ZRJA 1ISJA 1T10A 3K0KA 1R4NB 1IOVA 5H68A 3IXMA 4REMA 3RYIA 1SOWA 3SIPA 2B5OA 2IBSA 4Q4JA 4EZBA 1O4WA 1AQNA 1CUCA 1PYDA 4A0GA 2X4IA 1V1RB 3HJGA 4XQCA 4RF2A 4EOGA 4X20A 3C3KA 3D8RA 3ZH2A 1E2QA 4U7HA 3RVDA 4QXRA 1IAQA 3V97A 4EI7A 3E35A 3FVVA 4LHWA 3R5FA 3CLVA 3KAJA 3PC7A 1DC7A 4HN9A 2JGLA 3RTDA 1WUKS 4UHDA 3EEBA 1J2YA 2HK7A 4JJ4A 1EDOA 3ZHSA 3CEMA 1KGDA 2CL0X 2CN1A 1N2EA 2A5DA 4NFHA 4YJ2B 3QKSB 3BTSA 5TJ9A 3ZLVA 3PEYA 2WWGA 2V4MA 3CLRC 4K9DA 5K3FB 4I8IA 4LJSA 5JQGF 3WS7A 5DNUA 2D1QA 3OA0A 4GBGA 1XHEA 2HF2A 5G2OA 3MJFA 4MQFB 4UUBA 4E30A 3WV4A 2ZWAA 2V65A 4MVXA 4OHMA 4YC7A 2BFEB 3EZ9A 3LJKA 3SC3A 2YHSA 1JILA 3JQ9C 1UKVY 2XWSA 3PXAA 3KLPX 3GGSA 3ZXXA 4CM1A 4EB3A 1O9GA 1SBYA 3WAKA 4BGIA 1C80A 4QOGA 1Q44A 4Y2QA 2BFCB 5ED0A 3DQPA 4BV2A 2XGJA 1JAZA 4ZDKA 2IYAA 1UKEA 1UZLA 2YJZA 4CG3A 4QFDA 1WCYA 4UXJA 3VISA 1DT3A 1PVDA 1RAGA 1MVLA 1E1DA 3AILA 5CT4A 2UZAA 4PZ9A 6ABPA 3LHKA 4JT8A 1Z5NA 4IDNA 3WIOA 5GADl 2VTEA 4KAAA 3G1WA 4RESA 4I6JA 1HDIA 2FQYA 3CZ4A 3IURA 1UOEA 5GJWC 1E99A 2EG9A 2L17A 1HBJA 2YJTD 3SSNA 3VO8A 4G07A 2I7XA 3W9SA 3U4MA 1VPTA 1AGYA 1CF2O 1U7UA 1CQWA 2GEJA 2J4CA 2W6ID 3PQEA 3L49A 3OCUA 4N8DA 2DGDA 1IBKB 3HSSA 5CP8A 3GUVA 2XDWA 5KYXB 1XVLA 3R7WA 4LNAA 2NZXA 1Y1KE 3M6LA 5IAEA 2VQEB 1YQGA 3S7TA 3F5FA 3G79A 3SC6A 3LCUA 4JVLA 5A7FA 4ARIA 2C78A 3X1KA 3IOMA 4R1SA 2C7GA 1Z6QA 3B9PA 3QBDA 4DXHA 5ADWA 2HA3A 2AVNA 4RHFA 3RJMA 2EBWA 5JAQA 1AM4D 1J97A 1PS8A 2YWJA 1IEWA 4QJIA 5EXTA 2XE4A 4YP0A 4EI2A 2O8CA 1RJDA 4UJ5A 5I7AA 5J1SB 2Y67A 1G7TA 1N6IA 1C14A 1P7WA 2MIIA 4PSAA 4ZI2A 4TTSA 1RIFA 1A7KA 1A7JA 3KZ1E 5KVSA 2H9YA 1WXFA 2F4VB 3LO5A 4RLQA 1N2BA 2BP7A 3H1FA 5JALA 5KU7A 3WNBA 4A1OA 4KDEA 1OXVA 3H1AA 3JAMA 3I39X 1RRKA 1RHQA 4IDGA 2YVLA 1ES9A 1Q83A 1NY5A 1HUQA 3HSKA 4UNPA 3E53A 3K32A 5IVIA 1RI4A 1B6TA 2WU3A 2NYRA 5BT8A 5C5DA 1JI0A 1WDMA 1G7RA 2DBRA 3E5HA 3AXTA 4DCTA 3AEYA 3EXHA 4ZCIA 1A88A 5I7OA 1EI9A 2JRLA 4M1TA 5JSKA 1P62B 3T6KA 5BT9A 2ZZKA 3QJGA 3LLCA 1A71A 1PD0A 2P5TB 3VC2A 4F72A 1I4TD 5EWJA 1HA3A 4KO4S 3BL8A 1T5HX 5ENZA 1FYXA 3U56A 3DTTA 3EUWA 1JG6A 1G6Q1 4EB6A 2E18A 4KO3S 1KXJA 1GO2A 1TJYA 2Z2XA 1KYIA 4UBLA 5EQDA 3VPCA 4C6TA 6CHYA 5DM0A 4KGDA 3BMQA 1PBNA 5THKA 3QE2A 3RYTC 4MDHA 3A3YA 4TWAA 2EL7A 4BZXA 3W5DA 1II8A 4FYYA 1E6MA 3H97A 4MKZA 3HTXA 4DUGD 4JYPA 2YWHA 4G0VA 4NDNE 1P5HA 2QD4A 5JLJA 1CS0B 1YVDA 2VHXA 1Z7BA 2AQKA 5KC9A 3HNOA 3IT0A 4YCDA 5F98A 5T5QA 4KXFB 4YRMA 2DAPA 4RJJA 2X8AA 2GS9A 3U7IA 3DL0A 1JDUA 3LQRA 5ELXA 4AG6A 2D0PB 1KP2A 5FAKA 4CG2A 2DC1A 2REQB 1VP9A 1DO8A 3W2EA 1RC1A 2EP5A 3DWEX 3WBBA 3U9LA 5HE8A 1PWYE 4C4ZA 1JLLA 3OIGA 5GGYA 4BLTA 3TCXB 4OLFA 4CM3A 4OJQA 5G1OA 1VE7A 4OK5A 5DYWA 4GR9A 2EX1A 4R69A 4LF8B 1GWNA 3C3YA 4PLVA 3NANA 3OBIA 2IXGA 3UW3A 1NM5A 4QARA 3S4YA 3ZU3A 3VO2A 4MPRA 3R7FA 5TQJA 3U7HB 3EWNA 3B6KA 1QRAA 2PZ8A 5BQXA 2Z1DA 3WDKA 3O82A 5KNCH 5A9TA 3OPYB 1PSDA 3EQ8A 5ADUS 3CU5A 2IHTA 2IYEA 4RK7A 3TF5A 1KSHA 2WP0A 3Q7SA 4ASUA 3KBOA 5LOVA 4EAQA 4KFUA 4QPDA 2GJ4A 2Z4SA 1Q0LA 2GRAA 2DY1A 5B2FA 3T0GA 1GTL1 4DHEA 3Q7IA 3V6LA 5EIHA 3OZBA 2IV3A 2Q9BA 5JXIA 4Z4EA 1YTUA 1BMQA 3EFBA 3G6WA 4RQUA 4QICA 3SE7A 4EA6A 5C7OO 3GFVA 2G1KA 3JY6A 1U7DA 1BXZA 4Z7QB 3V8NA 2GPYA 3WL4A 2XBUA 4N6NA 3T5GA 2JASA 3H1GA 2DVMA 1FDWA 3K0FA 4UD6A 1ISRA 4B6SA 3I04A 2W70A 1HYEA 1G8PA 2XLCA 2ZI7A 2PGNA 1YFZA 2NX2A 3F9RA 2CK3D 1LK7A 2PQMA 3QMVA 4M3NA 4UE3S 5FX2A 3TG8A 2RBGA 4UTZA 1E9VA 4AK9A 3Q7PA 3O5AA 1EGQA 2X4GA 8MHTA 1EPUA 4R2IA 4XFJA 2AK2A 3ZVKA 2WTXA 4K3UA 4KEAA 4QVGA 1Z33A 3WTCA 4G4JA 2ZQYA 3FRHA 3PYMA 1OZGA 4P7GA 3TLCA 1SIOA 4IICA 4KHPB 1D04A 1Z0DA 2FEMA 2XB9A 4EQZA 4ZZ0A 3U1BA 1JEOA 3I42A 4HB0A 5ANRB 1NQUA 2YN0A 4PGHA 3SXUA 4ZEXA 3E70C 3BHNA 1H2WA 1VPDA 2CMFA 4DN6A 1TEZA 3UWDA 5CFPA 3S2ZA 3ONDA 2RONA 2H52A 3ZHXA 4TVBA 2YWXA 3JXEA 3F67A 1YC5A 1Y6RA 4GKKB 1OTHA 1BHO1 3KWJA 3CS3A 1A69A 3JQBC 2FPMA 1W47A 5E6UB 5JXGA 3A6LA 4CUZA 2R7KA 2RHRA 5AW5A 5JWRA 5BSTA 1F8GA 2PZGA 2AUMA 3EVAA 3IP1A 4DNFA 5HK9A 1QYCA 2YFHA 3B7WA 5BYAA 3TLYA 4KWIA 4OM8A 4HMPA 2OMKA 4BMNA 2VK4A 2JJYA 1VZ3A 4UMEA 4PQFA 2PZLA 3AHEA 1Y9JA 2OCBA 4N5MA 4NZPA 5AESA 5E1DA 3DWFA 2J9GA 3C39A 1TLFA 3OX4A 4L2IA 3K73O 2P6NA 3DBLA 4XGIA 3UC9A 1PFWA 2YRXA 2ZIUB 3TSCA 4E5YA 1OOEA 2IHZA 3E61A 4G56A 5B1HA 1UC4B 3FOAA 3TDKA 3VDRA 2KLHA 3KD2A 4RSRA 4U3JB 3Q6NA 5HE9A 3QE9Y 3QVGB 3KYCA 4EPTA 2NUBA 4A8JB 1G21B 3G68A 2X1MA 4UATA 2XUQA 1L1FA 1LBTA 3CE6A 1NVUQ 4NBKA 2JKZA 5JZ9A 1D2RA 3IKJA 2DPMA 1LJ8A 2C58A 1N36B 2Z9BA 3PR1A 3OD5A 5F23A 3DEAA 3HQ4O 3FFBA 4X0EA 3LBAA 2P0EA 3AKCA 4IINA 5IASA 2PBZA 3EHDA 5K0ZA 4A2CA 2XMPA 4RMGA 3JZIA 1L4FA 3O1LA 4KMSA 4ZI7A 1C81A 2PT9A 2Z09A 4P3XA 1E4OA 4RSMA 3K94A 7MHTA 1P45A 4BDTA 1VE1A 2A33A 1FFAA 3SJUA 3R74A 3H75A 4K0KB 1G291 1M5TA 1QB8A 1YJAA 2O0HA 1SXJC 2ORED 2W6QA 5F2EA 3ROTA 3A31A 4X7BA 3UMVA 1V9CA 4KW7A 2P68A 3WYDA 2ZVDA 4BLUA 1RC0A 5DNCA 1GZSA 3DOHA 3P96A 5HDQA 4CQJA 1WQ3A 4JB2A 3WSTA 3FPGA 3FUUA 3LYLA 1BFKA 3ZHVA 4A16A 1MB9A 4HO1X 4D1YA 5JWOA 3SEFA 3ZNPA 3ANTA 3GVXA 4YCJA 5A2QA 4WLOA 3WGVA 1CDOA 4FNMA 5FXMA 1R4MB 3AVPA 4GC9A 1H69A 1TQHA 1NR7A 4HJRA 1XQWA 4RL6A 3PXBA 4B4OA 4N3NA 5FBZA 1BDJA 1H2ZA 1K08A 1DAMA 2G25A 3QPBA 3RRZA 1OSNA 2GAJA 3M4YA 2E4AA 3MVEA 1Y7TA 3BD6A 5FTJA 1K4MA 4LN1A 1WULS 4QODA 2HHJA 4BWVA 1IM8A 1CS4C 4P0PB 4N3CA 1CUWA 3CEHA 2LIPA 4CPDA 3UJ3X 1S8FA 1PQPA 4CLRB 1RPAA 3WP1B 4FBMA 4G63A 4YDHB 4ZRMA 1XYVA 1H5UA 2GN1A 3K2QA 4OIFA 4Q12A 1XE3A 5DH9A 2C7OA 4Q34A 4H4CA 4R3UC 4EJSC 5AHRA 1GPJA 1X80A 4GE3A 5BSWA 1TC1A 2G70A 2B6HA 2XNHA 4MVJM 1QAMA 1XLWA 4DY4A 4B6FA 1Z13A 4WE3A 1EGVB 1SOMA 1B8NA 1BXRA 2UZ3A 1U8XX 3DLAA 7AT1A 4QUAA 1C7FA 1WZEA 4HGOA 2XCUA 3C6MA 1PLLA 3IBTA 4LG1A 4B4DA 1A8SA 2XVMA 2ZS7A 3L7CA 1DQZA 4I55B 4PPGA 5E95A 3AERB 3PQ2A 2HR1A 1MRNA 3BWDD 1I7QB 4H31A 2WY2D 4B8YA 4AN0A 1D1SA 1TI7A 1AMNA 2P9FA 1C0IA 4YRCA 1PFYA 5BPHA 3ZDAA 1XRQA 4QRHA 3EE6A 3UCEA 3RS7A 5CDUA 3W9YA 1PWHA 1VKJA 2AR9A 2QL6A 4LGYA 2A1TR 4MQMA 3RUCA 3JQ8B 3QM1A 2G1JA 3TOXA 1I6MA 1IJEA 1HM5A 5SY6A 3U13A 4AF8A 4PR0A 1J90A 1L6RA 1UPCA 3FTQA 3W8EA 4JP2A 5CNMA 2AR7A 3CEPB 5LZ8A 1V95A 1L5YA 1XI2A 3CSUA 1XXHE 3EF3A 3EVGA 3EDQA 3GG2A 3K2EA 4O4IA 4OUDB 4A23A 2JEYA 3EJWA 5TGTA 3RUPA 1C0PA 2HJRA 3AW8A 3NDJA 1OJLA 1XRNA 3HCAA 4OI4A 4P3NA 5BSEA 2D59A 2FOIA 1TQ4A 3Q10A 3VPDA 3OSZA 4BIMA 2X2FA 4G65A 1FRQA 1DIRA 2C82A 1Y48E 4ABTA 1ZRHA 5CURA 2FEOA 4GUDA 3CNNA 1XPRA 2BONA 5F7XA 1JB9A 3UHAA 1HR0B 3M3HA 1VTKA 4KV7A 2V7QD 2QV7A 4YWHA 5J4LA 3AR2A 3VVLA 4K9MA 4WXRA 3JRWA 4F0JA 3STYA 1C3XA 3L0OA 5AJUA 1YBAA 3UUEA 4ZO7A 1YDFA 2JFHA 2FEWB 4OQDA 1IHPA 3MS2A 4DHWA 4EP1A 1OWNA 3ANYB 1DQSA 3I01A 2WF9A 5G4KB 2F2TA 2VJQA 1TPZA 4YACA 1BA3A 3ONVA 2WZQA 4BB0A 5CAEA 4MV4A 1JN0A 2KWIA 2Y2UA 2X0DA 4Z4IA 1MIOB 4N03A 3CRQA 2AGVA 2O9JA 1EEHA 1T2VA 1E59A 4R1TA 3WWDA 1S2IA 3UY4A 2EGHA 4TRRA 3VKHA 1L7PA 1X2EA 1TLLA 1E2EA 3D4OA 4PANA 2JJ2A 1IC6A 3KKEA 4FHGA 3HO1A 1OVMA 3GRFA 2OXTA 3K0SA 1XMIA 2ZJZA 4HGNA 4CHGA 2F1RA 1X39A 1W4AA 3KJEA 1O95C 2Q3LA 3BL6A 4XXHA 3VAAA 3D3EA 2GZ2A 1M2JA 4TMWA 1JUDA 4DA7A 3QYPA 1M8PA 1ZZGA 4UM5A 3RJTA 3SC2B 1TK9A 1Y9EA 1GUDA 4GH5A 4D9KA 2W58A 3VPAA 1TZJA 1UPUA 2D1SA 3D3KA 3MD0A 4GE0A 1U8EA 4X85A 4TMYA 1EE1A 4B2IA 1DX6A 2WIDA 3F8TA 2O3JA 5JIBA 3H5AA 2XUZA 4K9RA 1PK8A 4RHEA 4KLRA 4PVCA 4CUJA 1DRWA 2I55A 1FSZA 1ZHHA 1ZCFA 4J1TA 3GDOA 5FA5A 4JH0A 1UPTA 1E6WA 3HVHA 4RGQA 1ZNXA 2PWBA 2Y1FA 3H9BA 3HJBA 2H5EA 5DK4A 5I3CA 1SOVA 2ACEA 4EVQA 2V3WA 3A6KA 1QH9A 3D2BA 4D3XA 3WC4A 2NU6A 1EE9A 4OVKA 2FPXA 1F3OA 3BSWA 3E05A 3C6KA 3F71A 4BVLA 5JS6A 2L69A 1B43A 1B41A 1QO7A 1U8ZA 1TEXA 3SAJA 1NBMA 5TQVA 3NORA 3SEAA 2QW0X 1UDXA 2CLEB 3QV1A 1SCUB 1WBJB 3L8YA 4IQ0A 3TLKA 3W5BA 3CLUC 3REQB 3VR6D 1E2UA 3K1AB 4RY8A 2HCRA 2O8FA 5AW7A 4IXWA 4O63O 2F64A 3RT7A 3HVKA 5DGIA 5DM60 1FTSA 1FDIA 1RLUA 3M6XA 5A0TA 2ZT5A 2VYCA 3A2KA 4EKNB 2DPGA 3P2OA 4PCLA 5BN3B 3HE3A 4R6WA 3OM8A 1LV8A 2X6QA 3ETGA 5FLXA 221PA 3P9QA 1W87A 2VJNA 1X3LA 4RETA 4F85A 2Z56A 2YY5A 2HI0A 4BO4A 5BNIA 3HYSA 2IA5A 3O2QB 1Y82A 1W0KA 4NECA 4KYTA 1KHHA 3DMNA 4MS3B 1P4RA 1VJ5A 1N6HA 3MIZA 2ZS9A 2CWWA 3NUGA 1XPOA 4NENB 3TUJC 4IIUA 4B74A 3DHEA 5FV7A 1JL3A 2OV3A 4MVWA 3AO0B 3E2MA 4JJZA 4JEIA 1UR5A 2VYVA 1LGYA 5DOZA 3RFFA 3U4AA 3I73A 3VJMA 4F5DA 5ICCA 3ILYA 4HC4A 1WSBA 5IHPA 5L7TA 4KX3A 5TQ0B 4DL9A 3NETA 1Z07A 2ZEJA 3N0VA 3DXXA 4YJFA 2BMWA 4YLYA 4EW2A 1LNZA 5CIQA 5HKKD 3WNCA 5TPWA 3OMWA 1OU0A 1Q6ZA 1UOOA 5DP1A 1N2CE 2DR0A 4NOMA 1OAOC 4KUGA 2ZJBA 1U0EA 5EVJA 4ZZIA 1EFCA 2YIJA 3ZE0B 4I8XA 3EJ6A 3DO8A 4RHYA 2WVHA 1G7CA 2OHGA 4GLOA 4B75A 1DCFA 2QOEA 4RVGA 4TKZA 4OP2A 4QGAA 1FL9A 4C30A 2P4QA 3OKPA 3UWPA 2ZSKA 3WB1A 1DS6A 1ZUHA 1P73A 5TT1A 2E0IA 3U7QA 4BMVA 3IA7A 4WK2B 2CV2A 4I1OA 4G9EA 3S8MA 1N3YA 2P7IA 1SVOA 2V5VA 1PGPA 2FEXA 4IGKA 5E9QA 2OV8A 4HP8A 1KH3A 2NZJA 5HVNA 3NM4A 3ZDDA 1CTQA 4I9FA 2WTNA 3CZPA 5JRZA 2PS1A 1KS9A 4R2MA 4YDSA 1XMOB 2WIBA 4AS1A 3CRVA 4GPZA 3RHTA 5HM8A 3KE9A 2QAJA 5I7HA 3OIUA 4ALJA 1G59A 2I6UA 4N65A 4RLSA 3R3XA 4KRYA 3OWXA 3QUCA 4MKRA 1VKOA 1UWCA 1BU8A 1L1EA 2VEOA 3LC0A 4F3RA 1O94C 1M66A 1ST2A 2ZYHA 1Q0TA 5DSZA 1SBQA 2QXUA 1SU4A 2IOHA 2IHYA 1R6UA 2RB4A 3BF8A 1CNMA 1JR2A 2AOTA 3CNEA 5HBRA 4XQEA 4BEBA 2B20A 3QHPA 4NV1A 2AJ8A 1L4MA 3TVYA 2QPAA 4YP9A 2F9MA 4JOSA 3A1UA 1WO8A 4QXPA 3ZKWA 3GDGA 3UHJA 1PW7A 4L0QA 5A2GA 4GOLD 4DV2B 2RKWA 4LRYA 3QQPA 3IP7A 1RHUA 4AJJA 2YY7A 1IHDA 1US8A 4KDFA 1J0BA 4L4RA 3VR1A 3NHAA 3PFWO 1DELA 2C9ZA 2AQIA 2FFJA 3QU4A 2GCIA 4KXLA 1A1VA 2IYLD 3ZW7A 4J9VA 2GLUA 3GEBA 3CB4A 5FYDA 3EQ9A 1E3TA 2WSYB 2O50A 3A3NA 2RH9B 1Z0SA 3OCXA 5ALGA 4G5FA 2FSFA 5DNVA 4I50B 3C24A 3D7KA 5D6OA 3HCOA 3OIVA 4M53A 5EL0A 5KYYB 4ZODA 1U5AA 2JIOA 1NC1A 4CT5A 4ZGGA 3KRTA 4RPIA 3GPBA 3Q11A 3QG5A 1YV9A 3D6MA 3EXFA 1RT9A 1PG2A 1L7EA 1IPFA 3LQ4A 3RS0A 4GI3A 4TT8A 1O97D 2BH9A 2C92A 1L7NA 2BFWA 2VPWA 3EGEA 3THWA 3L93A 1M1ZA 4UNNA 2HSZA 2GYYA 4PG6A 4WZAB 3I4LA 3PF8A 4BNMA 1BWPA 1DIOB 1R4NA 1QZZA 1V11B 1NN0A 2AUNA 2G0AA 3AU8A 1BKSB 4MUYA 4ZAVA 3W5SA 1MABB 2XOKD 3RROA 2JIPA 1WSDA 4OGGA 2FR8A 1KFBB 1NP3A 4R9SA 1VIYA 3H0EA 5D84A 2DWQA 2WFAA 3HUTA 4RY2A 1J0DA 2ZI3A 4R8LA 1YQTA 4B34A 3D43A 1G4HA 4EPXA 4B4UA 4ZDIA 1L7AA 3L6CA 4GX1A 1XFAA 2O0JA 2OBLA 3HEBA 1D1QA 4XJTA 1RQ7A 4YO8A 1Z5GA 1KZ7B 3HRKA 1SUEA 4BCCA 4RTQA 1FS6A 3G9UA 1T9ZA 2I3ZA 1E8NA 3H9EO 4E1AA 5HF6A 3A9TA 1QS0B 4GWLA 1EBBA 2UV8A 3LGSA 2DERA 2AJTA 1E2BA 2PLRA 1NF8A 2CUKA 3DOEA 4MQFA 4ZCQA 4O1IA 5TB5A 1DTSA 2OWDA 3VR4D 1EUQA 1ULHA 3BG5A 1B3RA 5DT9A 4PXSA 4YRAA 2W6IA 2BFEA 4L6IA 4X3CA 5EAIA 5GJCA 2FUCA 2FETA 5BV0A 1XR3A 1KPGA 1XZEA 3N28A 3U5TA 3RADC 1VHLA 3OC6A 4O02B 1Y8CA 5ILGA 2BFCA 3GZTB 2OQ2A 3K09C 2QN3A 3LP5A 4YROA 3WLQA 1SELA 4L07A 3C7CB 1L7DA 2J9RA 2IH4A 3W5UA 3WYGA 3FTNA 2TMKA 4INZA 4Y1EA 5G3YA 1YHYA 4DQLA 1CDZA 2RHJA 1K8QA 1U0LA 1JVBA 3DPUA 4M8IA 1KTIA 2ZJ8A 5AVYA 1DX9A 4B85A 1T5IA 1R27A 4K88A 3CKMA 1U0GA 3OOHA 3QWIA 1KYZA 1GGFA 1Z15A 4M6WA 3WAGA 3FHJA 5EQTA 3VMFA 3GMDA 4GQIA 5KYXA 4UHBA 1P4SA 5EKTA 3BSYA 2ORIA 1A9SA 4F6LA 3TIFA 4Y6PA 1IIRA 3UJ9A 5KWJA 3OHPA 5F9FA 3RQIA 3NRBA 3JSAA 3UV6A 3ZV6A 4EHAA 3SCZA 4YT8A 4DCNA 1P0QA 5L9AA 2RE8A 5JNLA 4E5NA 1WZCA 1QF6A 2H5LA 1PT9A 3M7IA 1NSYA 3OTQA 5HGJA 3A1DA 3KDSE 3NIFB 2XQFA 3B6JA 4OK6A 1EGAA 1PZFA 2EBFX 3HCPA 3UG6A 1X15A 2X7XA 3O74A 3DVSX 4M0UA 3PE3A 3I9OA 1EX7A 4X9XA 1S2NA 2GK4A 3L3BA 2FWRA 3BKWA 4CKBA 2VLBA 2ZXUA 2W2NA 2Z08A 4Q03A 1SCDA 4RV4A 4AG3A 5P21A 5LNK6 3VX3A 5I7WA 2ZSUA 3SLRA 2PG3A 1RIIA 2FEPA 4N49A 4DLVA 4ZXFA 3CUSA 4BU0A 1YZQA 2FPUA 4LHEA 4RH0A 6LDHA 2IS6A 3JQAB 1MQSA 2GMWA 4RIIA 5GJVC 2Z5LA 2OORC 2HL6A 3GLHE 3QX9A 4DUGA 1CP3A 5IDQA 4E2FA 2F3TA 3FDFA 4AI6A 4HDNB 1M0SA 3B51X 4I6GA 3NTUA 4IUBS 2CYBA 3W8DA 4EECA 4PN3A 4BNIA 3WWEA 3NBXX 4MW1A 1Y34E 1GGMA 1E6CA 1R0WA 1SUWA 3AKDA 3PFNA 5DF1A 4ARAA 4LDNA 3GFOA 4BO1A 3VC3A 2E87A 4UXIA 2PYIA 3E9ZA 1L6IA 4XM0A 3M0EA 3VOAA 2QNIA 5JYCA 5K6AC 2V55B 4FZ3A 1H2FA 2X7JA 4FLMA 4ZVNA 4FGUA 3UK7A 1AQJA 1NJGA 4KYUA 1FFXB 3C5EA 2PX0A 4HVCA 5C18A 3AR3A 1P1JA 1G5HA 2FF5A 5D5PA 4TYYA 3IUSA 4NEQA 2G09A 2O1SA 2ZOSA 2M32A 1M2HA 3JQAD 4MCHA 1WNFA 1DCMA 3VPFA 2C5EA 5AR1A 4MHSA 4U4AA 5EMLA 3RBXA 2Q07A 4MJ7A 4MW2A 3TNYA 1CS0A 1TU3A 3CH7A 2NYAA 3AEQB 1I33A 1PJ2A 4OQQA 4WZBB 4PTYA 2PNFA 1X7XB 2IWRA 3SZMA 2W2VA 4M37A 4B0PA 5IULC 2VK1A 5D7BA 4GQBA 4EB8A 3U09A 2R6AA 1MORA 1U2EA 1XROA 1Q12A 2PGJA 3IPRA 3SOZA 3VGJA 1G8KA 3IAS6 2QRUA 1KVSA 2AWOA 1ND5A 2REQA 5CX1B 4ZYXA 1H6BA 1E2HA 1YU9A 2QMUA 2QVLA 2FCAA 1DEAA 2JAOA 1N1GA 1AOXA 1N7JA 1LY1A 4C4PA 2Z98A 2FKNA 2HSJA 1XL0A 2V7UA 3WISA 4EUKA 1XZLA 4G2TA 1ONNA 1TO6A 2NVUA 1TM1E 4X60A 4MR7B 1WUHS 1FX1A 4QIHA 5LC1A 4QOEA 3D7SA 3ROXA 2PRZA 1DBSA 3F5DA 5CFLA 1U3UA 4TRMA 1D5CA 3EX7C 3AUXA 3LD9A 2DT8A 4RTKA 1S7GA 1ZIDA 1XC7A 5LD2B 4EVRA 1R66A 5CW2A 1TUBB 2CK3A 3MMSA 3FYCA 4LBYA 3U0VA 2VJPA 1TQDA 5HIMA 1T9KA 1E1YA 3AIIA 3DVQX 3KKPA 2FZWA 2ZR7A 3IDZA 1YSCA 1YKFA 1Z2NX 2CLHB 4RVUA 1RRPA 3SSAA 2PKQO 5HTKA 1E4VA 1MV5A 3RK1A 4DSUA 1DJPA 3O4IA 5LMCA 1IXKA 2VZLA 4FR0A 1W6RA 1DC4A 3LSTA 4IQFA 3G13A 2HMAA 3KU4A 2ZJOA 3E2IA 3OU6A 3SK0A 4Q1DA 1G18A 2DUUA 1ECGA 2XA1A 1XTIA 1S8NA 2C00A 3O4VA 4IIFA 4D3ZA 2F55A 2JAPA 3WGLA 1SKUA 2VNSA 3PT9A 3VPGA 3MUFA 2JLCA 4K6GA 3TQSA 3U48A 3AB7A 4ZYLA 1HL3A 5FFFA 1OC2A 2QROA 4OATA 4AY4A 3CH4B 4JBWA 4NR0A 1QGDA 1BG6A 1XD9A 4MITA 5LQMA 1TAUA 5A4FS 3HLKA 1XA4A 4JVMA 4DJJA 3W5AA 3RIXA 2EQ5A 1JNYA 3SBDA 3TRKA 4ZZ1A 4G5GA 4RPCA 2Z6VA 2HM7A 5CJJA 3GGCA 3KSAC 3JV7A 1Q92A 4Q93A 2CLKB 4G3XA 4CTOA 2HA0A 2PZBA 2X9NA 4D45A 2MINB 2QRKA 3CR3C 4F86A 4CEIB 4ZEVA 3S44A 1EXNA 3EGOA 3ELBA 2BZSA 1H6DA 3TBKA 2PA3A 5HS6A 4M87A 3T1NA 5EJ6A 2PVPA 3F7TA 4WXHA 1T1SA 3FUXA 3MYRA 1Q74A 2QAIA 3Q3GE 3WLKX 4AF7A 2Z3VA 3V5NA 1T9GR 3EISA 1NUQA 4R1LA 3ZTTA 3LUPA 1EX9A 1QBKC 3OQBA 4DDUA 5JD5A 5EHIA 2XZOA 2P41A 3N07A 4ZQGA 1T1EA 5F4ZA 4KFRA 5E1MA 2PDAA 1H2YA 1N5KA 3DFZA 5K01A 3WTBA 1KJWA 4BMZA 1RWNA 3IVXA 2VDVE 4DEXA 1JX6A 1C41A 3QKTA 2OCXA 3ZWQA 3ZW8A 4ZTZB 4HWSA 2CCJA 3ZZMA 2QTRA 3EARA 3NV9A 4JHXA 5BR1A 3QLVC 3GPCA 2HPHA 3BK7A 4N6GA 3IV6A 1E3IA 4BO2A 1F9AA 3VU9B 4W8HA 3C15C 1PNVA 4F91B 3HDYA 1EFTA 3QEBZ 3PENA 2EV9A 3AC0A 1P31A 3VBEA 5JCXA 3AVTA 4Z2YA 1B26A 2WT4A 4CGYA 2X5JO 2XTNA 4HG2A 1KNQA 1VHQA 3LQKA 4IIXA 4BNXA 2WWWA 1NXTA 1XNJA 2FP4B 4YRKA 1XCLA 3O9ZA 3THRA 3ZDQA 2B61A 2JZNA 3AUFA 4FLFA 4FTWA 4U3JA 2AEEA 3ZNNA 5IJWA 4IIJF 4A8JA 3LUHA 2QG9A 2Z1NA 1G21A 1QPGA 4F7WA 4H7DA 2CXQA 5HRCA 4D9EA 1ZMBA 2ZIZA 1C29B 5FJIA 2I6XA 2AZDA 3BTOA 5TDHA 3ZCPA 2YXNA 3GJ7A 3FPFA 5SZIA 3QFTA 1Z7WA 3EZLA 4ZEMA 1DMSA 5EZYF 1ZC4A 1GUAA 2YYAA 3M6FA 3MWFA 3FUVA 3OQIB 4BLWA 3MCAA 2H11A 1JPNA 1SOUA 1QJCA 2FLKA 4JUFA 4QBIA 4WVFA 1TB4A 2UVDA 4NVRA 3QFRA 1W4CA 5L4NA 3WLHA 1SFRA 4N7BA 4MJXA 3ZLJA 2C9DA 4W7SA 4TXJA 2Q7OE 1D0SA 4FM9A 1F7VA 4W6ZA 2X7HA 4EHLA 3HKBB 2VH5R 5CB6A 3PRJA 1D6SA 4YCBA 4PHHA 4ZMRA 2JBWA 3LC2O 5B7GA 2XWPA 1PTJA 1L8XA 3DPIA 3K0AB 1I5EA 1TVMA 1J6UA 2P2NA 1HF3A 2I4NA 3AF3A 3V46A 1VFNA 3IEUA 2W8ZA 1PKEA 1TM5E 4A6PA 1ZNZA 2ID4A 2Q4TA 3GOHA 3LX8A 4MQUA 3Q7QA 1U7OA 1KU0A 4G0QA 1A8QA 4MVJP 2JK1A 2QNBA 1QRRA 5JRDS 3AETB 2AN1A 3PUKA 3RTEA 2QX8A 5IANA 1QTQA 1UMDB 2HLHA 3L8MA 4IJUA 2Q3FA 2J4FA 4IV8A 1OT3A 3IRVA 4M7OA 3TVTA 4UVEA 4PG8A 5K6RA 2V59A 2VNAA 5TGZA 4M21A 1NW8A 3F1KA 4O4JB 1QZTA 4Q3EA 1KC3A 3Q41A 4O5OA 4UHFA 3QIAA 3WGMA 1LS6A 3BM5A 3WLTA 4C07A 2H8KA 4BX0A 4UCWA 3VNAA 1YE3A 4Q00A 1QF7A 2H65A 3HXPA 3DOOA 4B31A 5IAGA 1RLIA 2B2CA 5C51B 3O1HB 4CLRA 3WNVA 3CMMA 2X23A 2OV2A 2C1XA 2RCYA 1E20A 5EESA 4Z49A 1I9CA 3KSUA 4LF7B 1PJZA 3LX6A 1FFCA 2ABWA 2WIFA 1Q0QA 4ETNA 3I9KA 2RGUA 3QBVA 5ARBA 2XYHA 1NMSA 5KTYA 3QLEA 3O0DA 1NW5A 4GNRA 1A9OA 2PY6A 5JMTA 1F8XA 2IUEA 1GCAA 2VDNB 2ZPAA 1J42A 3G8AA 3LNCA 4FIDA 5FCDA 4FFVA 4KJZA 4BZZA 5M5BA 2V4ZA 5CNIA 3IAM1 1MV8A 1VBNA 1AKWA 2A9QA 1DOZA 5FTWA 5IBCA 5HQTA 2QRPA 1JDSA 1KKLA 3CO5A 1XQVA 3N74A 1LC3A 4I55A 5CDSA 2CB9A 1B1CA 1M2VB 3AERA 3SS7X 2X0KA 2QTVB 4I1RA 3U7JA 3FPAA 1QBGA 3BD8A 3IP5A 4WFJA 1DQNA 4FCCA 1UBGA 2WDZA 4R16A 1XSEA 3ICQB 1U0RA 1XTPA 1SK9A 1CDDA 1WMAA 5HQ3A 2GAFA 3RSFA 5AVZA 1NXQA 2C8LA 4MAMA 4TM7A 1H4TA 3OZXA 3GLRA 4C03A 1YIDA 4UVIA 5EVCA 5SV2A 1R0XA 3RYCB 2V7QA 4MW6A 5L3SA 4ZCLA 3V7UA 3MERA 3EXHC 2QW1A 4LS3A 4MUIA 2ZE5A 4MR8A 4KAXA 1U99A 2HH9A 1COZA 3UCXA 4EG5A 1J9ZA 1EGMB 1GM5A 5GVSA 2PPVA 2XCRB 1WWKA 3FSRA 1L9KA 3FCYA 1XTBA 3RPEA 4Q7EA 2P9BA 5JFTA 5EA2A 1YJ8A 4FHFA 2HQOA 1ZGJA 2CFIA 3PGJA 3PNPA 2KS6A 2W2MA 4BOYA 2QVYX 5ESWA 1DINA 4PNPA 5CM8B 3S1SA 1SUIA 2VPZA 4RVFA 3B8EA 5F4BA 1NHWA 2RSLA 2V6BA 3PX2A 5B4VA 5BY2A 3W7AA 5JXJA 1RWOA 4EAAA 2DP4E 4IIHA 3WLIA 3VZBA 4EJMA 3F6EX 1M2GA 3RW9A 4EW6A 4RVDA 4WKOA 4YRQA 4C0KA 4TKVA 3Q8MA 3AUYA 2HIMA 4KIJA 4DE5A 1QF9A 3FRJA 1ZO8A 4PAOA 3QY0A 4DFDA 1RYZA 2O1XA 1GSHA 3SJBA 3G0OA 1ZOSA 2H4XA 4ILKA 3SZOA 4OJKA 2AB0A 4NCAA 3OJLA 2HDNB 2ZRBA 1AN0A 2R7LA 2RFLA 1E62A 1GQOA 5G4KA 3UFXB 2VI5A 4TWBA 1PU2A 2C7QA 5ALIA 4HAWA 1MIOA 4CQNA 4C6HA 2PA0A 2HYDA 3TEFA 3MIIA 4GZLA 3LCCA 2WBLC 1X9HA 1JXOA 4QOIA 1J8YF 1NM5C 4QQKA 5C31A 1EIZA 2F4NA 3GZJA 5CFZA 5NLLA 1ZINA 1SXIA 2PKEA 3MXOA 5HIAA 3LLUA 3FTEA 3PI6A 2PGIA 2GAAA 3L4SO 4ER3A 3DXYA 1TIBA 1PDWA 1MGPA 3Q3CA 2CMKA 1RAHA 2GEDA 3MD9A 1P2BA 3R24A 4ITVA 3SYRA 2FH5B 2QY9A 3R6WA 5CLGA 2BJHA 5LKRA 1KQOA 3MGCA 4K7JA 3JCZA 3UJPA 4R1UA 2OWEA 2X8LA 2I6TA 3DNFA 3HYTA 2WKQA 3VR6A 4XASA 5C8XA 3H1PA 1E96A 3G1UA 4NMWA 3BHIA 1W2GA 2P11A 3JQCA 3OUZA 4KO8A 2BBSA 3DE1X 3PQDA 3SHVA 5ALNA 2EZUA 5CDHA 3X1DA 1F2VA 3R7AA 1QC5B 2WYIA 3O8DA 4MYSA 3DHVA 3RV3A 3QBEA 3ZI4A 5HJ7A 2FOLA 3AHJA 3QE0A 2JI6A 1U2GA 4FFRA 3EDCA 1U7XA 4RBNA 2FAXA 3ZUPA 1JDJA 4O0LA 1F4PA 1I2DA 1NVEA 1VBFA 2AFHB 4XWOA 4BO7A 3T3NA 3AM1A 4L27A 4UCQA 1IEVA 3I0ZA 1GNPA 4TS3A 1MAWA 3KLMX 1YT5A 1QH0A 3N2KB 1CUVA 4D7AA 2XNDD 3VZPA 3K1YA 4LXXA 3UMJA 3K1AA 4N39A 1FQJA 4L08A 3AEKB 3L7AA 4C7XA 3TTTA 4CRWB 4KMRA 5HKKA 3NDIA 4NCKA 4WXEA 1GPAA 2ZUEA 2ZDHA 1HYHA 2OLJA 2I71A 5F9HA 1J5XA 5SY4A 4EYGA 3NEJA 3C14C 1F2UB 2Z8ZA 4MGEA 4DC9A 4DYHA 5KJ1A 1U2RA 3F4LA 4BO5A 3Q5DA 3IESA 1FLNA 3V1KA 4AAYA 4V02A 5UKDA 2C1EA 2EU8A 1TM3E 4MROA 5BW4A 1GD1O 2IPOA 3FIJA 2IZ5A 2QLMA 4NU5A 1VA4A 4FS8A 5HUHA 5FDFA 4MS3A 3ZJTA 1A2BA 3Q0EA 4CTNA 3FBGA 4EGJA 3O8RA 2H4FA 3BQNB 9GPBA 3QUAA 4NENA 4NXNB 2VJMB 2HY7A 4ZVMA 1KMNA 4MDFA 4C7VA 1I94B 1ZD4A 1C1XB 1PEKE 1JEEA 1YRHA 1Z0ZA 5IWAB 3A4IA 1JJAA 2VDQB 4EHJA 3GLIB 3H5LA 1SCQA 1ONSA 4K40A 4K8RB 5TQ0A 4HUTA 3SQMA 3Q2IA 1M9NA 1QAOA 4LYFA 3UUGA 4LDZA 4X1IA 3TRHA 5HKOA 1EGHA 4FI3F 2EIHA 5LQCA 3DFKA 4MUMA 3IJ5A 2PD4A 1PL8A 4GI5A 4WBXC 3IVMA 1N8NA 2IYRA 1FJGB 2P3LA 1KJ9A 1J5PA 2PFKA 5CPFA 5KNDH 4EHFA 2QB5A 2JL1A 3MRXA 2CHQA 2HRBA 1VMEA 4NONA 4LJ6A 4WFQA 5FA6A 2BD0A 1P1FA 1TUIA 1GZ3A 2ERXA 5FUXA 3KSZO 4HYTA 4NK4A 3K9FC 1O96B 2WQ6A 1LW6E 4Y2GA 4JYAB 4K9KA 3O8LA 2J07A 3WGQA 5I47A 2PN1A 4H3HB 5K4AA 1QP0A 3I5XA 4HRVA 1OI2A 5FO1A 3O8OB 3SZRA 1YWGO 1DEXA 3P5BA 4K9SA 5DLQC 4ER5A 4S04A 1X9IA 3GT7A 3LK7A 3HEMA 3MS7A 4QTUB 5IDYA 2CV1A 1UJ5A 3CMCO 1EFDN 4JMLA 3ER8A 3UJCA 4DSZA 3T7TA 3GAZA 2BM8A 3UQZA 4DCVA 3O26A 3OP1A 2IXFA 1KK2A 4BNFA 2VTBB 1CY0A 3EEIA 2HJHA 3CNLA 5CLHA 1M83A 3H2HA 1MZVA 1RHJA 4LXQA 2C1ZA 1ODJA 4MS4B 5TX7A 2EFYA 1F6DA 1IK6A 2WYVA 4S24A 1UBEA 2CFTA 1Q0ZA 1XCOA 4KITB 2YBEA 4JJ6A 5L3SB 4L5AA 1I8TA 3JRNA 3LQYA 4EKEA 1CR6A 2WM3A 4R9UC 4TUYA 2C8JA 3WZLA 2DUNA 2CKMA 1U1FA 2YVKA 4E6EA 2ZSJA 2VF8A 4D74A 3ZV5A 4LZLA 1XBTA 2V96A 3IQIX 1KDZA 2YJNA 1QQ6A 2C3PA 3JD2A 1T8PA 5H9VA 1HZZA 1MC5A 3UMFA 2O6LA 2IYTA 5EPUA 1C30A 3LDHA 1P9WA 4J0JA 1UKCA 4B7AA 3A9CA 1DWOA 4MUKA 4R5MA 3IUQA 4B40A 2WHXA 4NBUA 1QLJA 3ZIAD 4HS4A 3JWGA 1EXWA 4Q6BA 2HFKA 5T6MA 1OI3A 4HXGA 4JI2B 1MJFA 4ENTA 5EWLA 4W6QA 1QGED 2WSMA 3KU1A 2QLBA 4OKNA 2CFSA 2JAXA 4I4NA 3FVTA 4I50A 1BX1A 2X76A 2A84A 5J2UB 3LHDA 4P5EA 4TLCA 1NNUA 5KYYA 2D0IA 1ADBA 1SY7A 3PA6A 2P1ZA 3QK7A 2X9LA 4FINA 2HSDA 4M76B 4MCAA 4QUBA 3GJQA 2MJLA 1QTNA 2XKAA 4GLLA 2GN8A 1KFCB 4J6EA 2VJOA 1ULTA 3CUWA 1WSWA 1Y5NA 3QUSA 1H2AS 3GWZA 2GN9A 3OFJA 5FPTA 2K6GA 4HAYA 2XD4A 2ZB7A 5GVRA 3UOAB 3VR4A 5JAUA 4I1UA 2YXLA 2GVZC 3SJZA 1MABA 2AI3A 3QYFA 1YRBA 2R7MA 4ZVRA 2OR3A 4GBED 3IOEA 2IE8A 1H22A 2Q3DA 2J87A 2VJLA 4LKOA 2ENWA 1IOZA 2IHKA 2VWHA 1BEUB 1NURA 4QWMA 1V43A 4BMOB 1S2OA 3BZUA 3E9EA 2UXCB 2LXNA 2C4KA 3ZBUA 5BXQC 3IUJA 4YMIA 1R0RE 1KSJA 1VKRA 5I9MA 4G97A 3IXQA 3EIOA 2HYIC 3H0KA 4HDKA 5J43A 1NBME 4KYVA 1RAFA 1PUXA 4UTVA 4DLLA 3E3MA 3NH6A 2A9OA 3MC1A 1G66A 1NMZA 3GU3A 4YN3A 2YW2A 2I6GA 2VQSA 3CC8A 2RKBA 4ZFNA 4JJ7A 5C8VA 4ER7A 4ETIA 5LA6F 3H3JA 5BPFA 4KQCA 2CXSA 1HNXB 4P7FA 1T8WA 4DLYA 1Q7TA 4QJBA 1ZK4A 1VP3A 3ITEA 1EWQA 5FBHA 3QVJA 2ZETA 2ZR0A 4B3CA 2PT5A 3F8WA 1CU1A 3U3MA 5L8VA 4K1LA 1ESEA 2NPFA 3ZHTA 5JXWA 2VBFA 2WUEA 2ATXA 5FULA 3HB1A 4A4DA 1UDWA 1YXMA 3C7KA 3UWKA 1X7HA 2HAEA 4KWEA 2XZLA 3IP6A 1YB2A 3WLAA 6YASA 3WWPA 3HYCA 4YHHB 4RZSA 2YKGA 3PPVA 3PGA1 3N6VA 1ICIA 2V7WA 1WHSB 1SM4A 2WA2A 3BXZA 4OHPA 1P6QA 1QFXA 5JSYA 3ZHRA 3TQHA 3MMXA 4MEJA 4MLCA 2KJQA 4Q9LA 5E9WA 3LP6A 2JFVA 2CBXA 1KOLA 4M54A 2C95A 3N75A 2QT9A 3KT3A 4GLBA 4QFBA 3O95A 3PQ8A 1KDTA 2O7SA 2J8ZA 2R8PA 5GAJA 5EJIA 3VH2A 4ESEA 1B16A 3BFVA 4UM8B 3SKVA 3TW4A 1MPXA 3VNVA 2ZBEA 5IHXA 3ABSB 3VRHA 5LSAA 4JXXA 2IXDA 1LSSA 2MOKA 4BGVA 4CZ2A 5KYGA 1PGOA 4E70A 1EB8A 4BVJA 5FNZA 3UMGA 2BI7A 2P8JA 4JSYA 3W79A 2I4OA 1IRIA 1G64A 2GESA 4BVHA 5JAHA 1BOOA 2XWQA 3EIUA 1TNDA 4NFSA 4DMUB 1WCXA 2NUPB 4U2EA 1QO0D 3ZE9A 4CG0A 4CMBA 3WICA 3HBMA 1GPMA 4YRIA 3K0HA 4FGKA 3TVDA 4JC5A 3M5PA 4NRDA 1NVGA 4BQFA 1DEHA 2P6OA 3OZSA 1SXQA 4PLYA 2VSNA 3FGNA 4ZYYA 2Y0EA 4ZIRB 2ZSBA 4MTLA 4CKWA 1E9CA 2H4HA 2HBQA 2FFAA 2JF0A 3A6PC 2XMCA 3OEED 2M2IA 1T5TA 4D8YA 2PX6A 2P6PA 4LZJA 5ICFA 2VPQA 2H85A 2IPMA 2O2HA 3NGXA 3M1LA 1U0SY 4RCYA 5B5SA 1YA8A 1NF2A 3WR5A 3BEOA 1S02A 3BVPA 4IZOA 3U49A 2ZJAA 4J4BA 1DQPA 3JQAA 3OEHD 3PHGA 1IJBA 1I0ZA 1GHTA 2ZUSA 4N5IX 5JCOA 3O4RA 4OQYA 4HDNA 4IX9A 2YHUA 3AI7A 3R9KA 1B0UA 3CZ5A 3FH0A 5T4EA 4EHKA 3MBKA 3K3PA 4QXMA 1QRUA 2HSEA 1NDHA 2JLSA 2FW0A 4XJXA 3EYWA 3I04M 1VMDA 1QCYA 5DASA 1N0IA 4BLRA 3K9HA 2DJIA 3FSEA 4FYKA 2J3HA 2IEYA 4N5NA 2PL9A 4QNNA 4CLHA 2ALJA 1S1CA 4B5LA 3DH0A 5JVDF 4IHQA 1RYMA 3RU3A 1LRLA 1XYYA 3OOJA 5IW8A 2NU8A 3HA2A 4C1BA 5CEFA 1KY5A 1VIMA 3KB6A 4IILA 3T54A 2X2PA 4R3NA 3PGVA 1O4VA 1Q16A 3RM3A 3JQFA 3I6IA 3R8FA 3HI4A 3ISVA 1G3IA 5BMVF 1XOIA 1NFQA 1HZJA 2Z0MA 1QWOA 3DFUA 2F59A 3NAMA 5EHQA 5L6LB 2ZATA 3AEQA 3DV0B 1T6ZA 1QIEA 1X7WB 4HX5A 3O84A 4MEBA 1EVEA 3DBRB 5BYBA 2HIGA 3RH0A 3WZ2A 4PN7A 2FGJA 2XVYA 3KEOA 5AFSA 5EJ9A 4BMYA 3I12A 1UFRA 5CX1A 1UMCB 2OAP1 5AW3A 1NP6A 2GAIA 1BSVA 1ZOLA 4M0CA 2AJCA 2O3RA 1B0AA 2IHVA 3CN9A 4QGGA 4X90A 1YUMA 4KVAA 1YZNA 3WYAA 3AR9A 2WR8A 4I4CA 4P58A 4LE0A 4UULA 4LV5B 2QL5A 4YK7A 4IKOA 4XJSA 1E2MA 4HRXA 1KI4A 2V6FA 1H42A 3U37A 4B4KA 5F1OA 1FSGA 2O0KA 3GBPA 4X94A 5EMKA 2AXEA 2EZ9A 1I51A 3L7LA 4Q0MA 1I1OA 3O8QB 1N92A 1W2HA 3O31A 5AJZA 3M1YA 3C0KA 2YJGA 1EP1B 1Z0UA 3IAHA 2ADMA 4WMLA 4IJ5A 3V00A 1HDGO 4DR4B 2XCSB 3OY2A 4PAQA 1QKJA 5BWCA 3IJEB 4XGNA 1DIHA 1DFIA 3AF5A 1Z2DA 4J2TA 3CSDA 1P1BA 2OGWA 3HWSA 1BIFA 5CLJA 3FGOA 1ZBQA 2AOVA 1LI5A 4DY6A 2WFMA 1H05A 2W0SA 5TVGA 3TRJA 1DGQA 1GPLA 4EHBA 2Y8EA 5CT9A 1SXHA 4QUDA 3SP1A 1UK7A 3L82B 3FE2A 1EQ2A 1E63A 1GZVA 3T0IA 2X0FA 2DTDA 3KYBA 1RWBA 1ULAA 2C31A 1JLKA 4YIHA 3ILVA 5DX1A 3WXMA 3EGVA 3WOVA 2ZIAA 3JQ6A 5FF9A 4CJXA 1GAQA 1Y8QB 1XEXB 2H2WA 1YNSA 1NVXQ 5ITZB 1RBYA 1R9JA 3GYGA 1IUKA 4HBZA 4LK2A 1KZ1A 4OMUA 4V3BA 1PFUA 1OB2A 4EL5A 1PLKA 1DLJA 1IQUA 1ONOA 4WX2B 2J0VA 1BS1A 2HJ9A 5LCXA 1NXXA 1QE3A 1WW2A 2FQWA 2QTCA 3A32A 4MRNA 4QHTA 3LO8A 1E3SA 4WJLA 3SR4A 4MP8A 1GNSA 4C1NA 3RNOA 3EC2A 1YB4A 2JZCA 5BNWA 2XB4A 5CG2A 3ASZA 2MINA 4GI2A 3VYVA 4PG5A 4R7TA 4DR3B 2V8BA 3KR0A 1MEOA 4CLOB 4WLVA 1Z06A 3KTAB 2ERCA 2EKBA 1TRHA 1Y5LA 4I9UA 4AM8A 4LF6B 4OHUA 2H31A 2FMFA 4CLEA 3DEHA 2DG2A 3BZWA 3DE4X 5C7IO 1E8MA 2PUTA 1E1NA 1MT3A 4P3YA 3AR4A 3GRUA 2WIJA 2X2EA 2OVBA 1PJBA 2FPKA 4LRQA 2AJLI 1Y7LA 1OBOA 4ZT7A 4P36A 2BEKA 3NTQA 3KAKA 3KKMA 4PFSA 4DUPA 2ADOA 4LYDA 2ZBRA 1KI7A 4NBNA 5CM2Z 5TF0A 3IHTA 721PA 3WLSA 4Z7NB 4J0GA 2YWEA 3NEYA 4TSKA 1T9AA 3M8KA 4M98A 1A2KC 2QIPA 3WOHA 4QPNA 2QT0A 3OLYA 5JQGB 3VU9A 1ZPDA 1K97A 3U17A 1KY3A 1XU7A 1U2QA 2PVCA 2X6TA 4HNSA 1MJGA 2PKXA 4OH1A 4S2UA 1YO6A 2YZMA 2FP4A 3FYDA 4TN1A 1ZVJA 3UHOA 5I7FA 5JSUA 2ZYDA 4JLWA 2Y05A 2Y68A 1OH5A 3EIXA 1Y5MA 1WUTA 3PE4A 1FDUA 2RGEA 3RSGA 4CWAA 1W8DA 4P93A 2ZTSA 8OHMA 2R4TA 4NU6A 1E58A 1K88A 4PW0A 2I8CA 3C1TA 5B7NA 3BGIA 4DQUA 1DSSG 1IQ0A 1GPBA 3NTRA 2PR2A 1N7IA 1XK7A 4ZO8A 3VNQA 1ONPA 3GRPA 4XJVA 2HBRA 3OQIA 4KXXA 3C8MA 3V4LA 2P5SA 4UTOA 1JHRA 4DJTA 1ZN9A 2ODQA 5A1TA 4JB3A 5EIWA 3ZHQA 1JLSA 4HKTA 2H1HA 2ZM5A 2YV5A 5BN5B 1YA6A 3G7UA 4GT1A 4BUZA 4MPPA 1JIQA 2NZVG 1X7GA 5EUBA 3N58A 1D2AA 3EWIA 4A7PA 2O23A 4HGQA 4HTFB 4MR9B 4QEZA 4RHUA 4OXNA 1RP1A 3NVKI 5GPBA 1GA6A 5EKSA 4C21A 5AH0A 2H92A 4EA8A 3RJ5A 3EBPA 4JLUA 1C1YA 5EJGA 1TF5A 3CNQS 3HZZA 3KT8A 4HDMA 4BKUA 1P33A 3ILXA 4E2WA 4EG7A 5JU6A 1V8OA 2FSVA 4JJFA 2N1MA 4OJTA 1E0JA 4I3GA 5LNK1 2YN4A 3EDYA 4BB9A 2W8BB 5DGCA 1VM6A 2QN6A 4I5EA 5DI3A 3K15A 2ZUFA 1KH2A 2IUFA 5FORA 4H4DA 1C0EA 5LYYA 2ZRGA 1KEWA 1NYLA 2YJ4A 1HO3A 3L1KA 1UMDA 4G89A 5D5HA 2PL1A 4FQ8A 3UWOA 1W85A 1T3LA 3VYRB 2PJUA 4QJ5A 5F2KA 2CV0A 3I30X 3SHTA 3HJCA 3L6UA 1SIWA 4O4JA 2XCIA 4AYTA 4TZ6A 4WN9A 2JVJA 2F3SA 5MF6A 1HURA 3HJRA 4QE3A 1W4ZA 5EERA 1K2WA 3OJOA 1M2KA 1QQ5A 1OX6A 3GZNB 1V6AA 4UCFA 3MAJA 3A9WA 4MI1A 4I5FA 4DPMA 2X9QA 2YDYA 4RY9A 3I01M 3BILA 2CVQA 3FKJA 1UDCA 5ITWA 3DDSA 1F2TA 4W5WA 4Y0VA 1ZP6A 2BBTA 4JT2A 8AT1A 3LC1O 4MP3A 4ZQEA 2JCYA 1RPNA 1Y4DE 3GYBA 3MJSA 5L53A 3CISA 3HGMA 3A9SA 2Q0XA 1LZLA 3B1JA 1KZYC 3A9UA 3VFDA 1XLVA 2X8JA 4IS3A 2ONYA 3NIWA 3LOQA 4PZYA 4BQNA 4X7RA 1ISPA 8GPBA 2H4WA 3CF4G 2O8DA 1LBHA 1NAHA 3MB5A 4KQJA 1VLLA 1G8SA 4EZIA 2VAWA 3KTFA 4KDCA 4OFBA 5E38A 3D81A 3QVXA 4MA4A 4F8JA 2YNMC 3CW9A 3NRCA 2BY4A 3GEIA 4DCMA 3H4TA 1M2VA 4QFCA 1FU4A 5GZ3A 4F4IA 5JROA 3W34A 1CRLA 2L18A 3IAS1 1N6LA 1WZ2A 1MZPA 3IT3A 1STOA 3GCXA 4PS0A 1D03A 4K9QA 5CK5A 3TJZA 1C3VA 2QLLA 5AUQA 1AKQA 3RAFC 1D8TA 5CT6A 3C85A 4G0PA 2QJFA 1PWEA 4B17A 1RXVA 4F4CA 2XVZA 1F5NA 3DAFA 3DW3X 5FHQA 3EHEA 3RYCA 4IVPA 5EZ5A 1J20A 2IYXA 4UDXX 1QSGA 2X1HA 5D1NA 1N2OA 3TDNA 3HJNA 3NOXA 3N59A 2QN8A 3L43A 4FE3A 4KAJA 4LJ7A 4YO7A 1JU3A 2ZIVB 1G2OA 2H5JA 5FBQB 3I83A 2OZEA 3IUMA 2ZTUA 3M9WA 4V0RA 5F2NA 1Z4QA 1T6NA 5FWXB 4TLBA 4RFVA 3SYNA 4L9AA 3MA0A 2R68A 4ZVUA 1QHYA 4B6PA 1T0BA 1NQWA 1UOQA 4RORA 1GA4A 1FW6A 4WESA 2R7AA 3OZAA 1OWOA 2B7BA 3D6HA 5ALEA 3HJUA 3RTGA 1CXZA 1KZGB 4Y1FA 1Z38A 2VOEA 5H1YA 3C98A 1T0JB 1C1DA 2WA1A 4DIUA 5A04A 1JHZA 1QGZA 2GNAA 1QPZA 4JXJA 2B1JA 2ERYA 3BMCB 2OT3B 2ZAMA 3AB3A 3K4QA 2YIVX 5DHRA 2BMEA 4Q4AB 4DS3A 2VJAA 9LDTA 3Q87B 1DHRA 3E9YA 3LGXA 1MENA 3NOOA 4IL5A 2R4UA 3ULKA 2Y1WA 3K1TA 2Q41A 2X22A 4WZ6A 2WJVA 4L4XA 2P0YA 4N8EA 4RM3A 1HFWA 2LCIA 5LQKA 2R751 3AF4A 5DHFA 1PIWA 1NPTO 3DBIA 3GPLA 1X8KA 2B3DA 2OSVA 4H16A 2CLCX 3IUBA 4LYGA 1G3QA 4J1SA 4JP8A 2GD6A 1T8SA 3FDZB 3RYHB 3S2SA 4C3ZA 3LS2A 1DNPA 1V8DA 4X8OA 7REQB 2BYTA 1N75A 4ZYTA 1ZQ9A 4DA9A 1N1DA 2QQEA 3ZXIA 2G0NA 2C2KA 4OTZA 3ZK7A 4MPJA 2QD2A 1TECE 4P7JA 3WGIA 4FEYA 1QTIA 4CLDA 1K6XA 1DXOA 4PHTA 2ZT8A 1ISHA 1VYTA 2IGTA 4ZVKA 2CD7A 2X4DA 4KNVA 1JB1A 2X5NA 1C7ZA 2I9PA 5AJYA 5CH8A 1BMTA 2W43A 3DE2X 1TX4B 2VDPB 3TKYA 5BSGA 4A0RA 3P9XA 1U1EA 3ZJUA 2NU7A 3C6YA 2P6RA 1CVLA 1FP2A 2F90A 2XNDA 4MCJA 5JECA 3AOEC 3NW9A 3HGQA 1RFGE 3WBKA 5KNLA 2GHRA 5AK6A 3KOUA 1ZOOA 3B5IA 4PXYA 4BLOA 3UB3A 2G06A 1I9GA 4FFMA 3EY4A 3T5CA 1L4KA 2GI4A 3FPCA 2PL5A 4EMSA 1SK8A 1T8UA 1ESNA 1LDEA 1QC5A 4JCOA 5TMEA 4GWKA 3TQFA 4YRTA 3VV3A 2ZTMA 1WXIA 4G67A 1YS6A 1P2SA 3UT6A 4BO0A 2GBLA 2E9SA 5ABPA 3LZ6A 1GKYA 1II0A 1FMCA 1M34A 2C5AA 4G01B 4M7PA 4P3OA 1P8AA 1YBHA 2WVGA 3H4MA 2AFHA 2HDHA 4JOQA 1VMIA 4OHOA 2IDJA 2P67A 3H2ZA 1KYXA 4U2BA 1TVKA 3WDLA 4B0OA 1KI6A 4OB6A 1LBEA 1S4MA 1A5SB 4BVBA 2R11A 4D0GA 3GOQA 5CGQB 2YJ3A 4MUXA 1DO0A 3WVNA 4GRAA 2FZKA 1DBRA 2QJTA 1QYRA 4PWYA 4D9CA 1A9XB 1E3LA 2NO7A 3AEKA 3D6AA 3KQMA 4U2GA 4C14A 1OB5A 1EEXB 5YASA 5DX8A 2I8LA 3BIOA 2QTFA 5EMNA 1JHQA 2CXXA 4FHDA 4L75A 4ND1A 2GOYA 3QVMA 3Q9UA 4B43A 2YHIA 1T8YA 3MNFA 4YDQA 4RTRA 3CCCA 3I09A 4IBOA 2ZG6A 1CE8A 3CY6A 4CI9A 4EX7A 4YAJA 5FI1B 1PSZA 1L5LA 5H3HA 4KGVA 2FW8A 1AVTA 1K6JA 4YRPA 1TGYA 1U2DA 3CW2A 4I2VA 1EAYA 4GD3Q 5GV7A 1CULC 4FW8A 2X0IA 3FPLA 3PS9A 1P5RA 1RHKA 4HWOA 3NYIA 2VJMA 1ZXBA 3FMPB 3QUQA 4B3TB 4L74A 4R9RA 2PQ0A 1C1XA 2QMYA 2GEFA 3O73A 4IEEA 3IQZA 4YFVA 1M2OB 1NN3A 1J0EA 5HYVA 1NMQA 2XYPA 4R1MA 3GLIA 1WUJS 2IZ6A 4MPTA 3S2EA 2UYGA 2XMGA 3C4VA 3K9WA 3KM0A 1EFHA 5K3DA 1U5CA 2FX3A 2LKDA 3D6NB 3KSBC 4L0CA 3EMKA 4B3GA 4FS3A 4ZCSA 5CDGA 5HJ2A 5JD3A 3IELA 3QG1A 1PK9A 2OXCA 5TR9A 3PHBE 2DHRA 2FMUA 4C7KA 1MVNA 4BWGA 2FLVA 5I45A 1XTVA 4YPOA 4FUQA 2EXXA 2BGLA 4FYJA 4A8JC 1L3IA 5AVRA 1RQLA 2EKDA 1SBTA 1BN7A 1I30A 1WEKA 2WTAA 1F0YA 1O96A 1V25A 3FXAA 5JQWA 3NBAA 1NAIA 5EEGA 4PIVA 3LTEA 4UZFA 2XDYA 4TRJA 4D9HA 5G1PA 2X4LA 2IDMA 1EG2A 2CJWA 3MCUA 5CVEA 1FMTA 1D4FA 3PFKA 3ZYZA 1QHEA 3FD8A 1RWPA 3LPNA 5H4HA 1NNI1 5KOHA 1RPTA 1AQYA 5CJPA 5KTMA 3KQYA 4OQNA 1V6CA 2WQ7A 2ZANA 3MUOA 5DLYA 3UAGA 4X41A 4BB5A 5K05A 2FJ0A 3CTMA 4DMGA 3CM0A 1ULZA 3BWCA 1CJTC 3RB8A 2ZJ6A 4EF4A 1ORTA 4C43A 2QENA 4P5DA 3CEJA 4LPKA 4DQKA 1KVRA 3U3JA 4DRXB 5I51A 3ZIAA 3B78A 3LSYA 4WY8A 5I48A 2WOOA 3AU9A 4YAEA 2IZOA 6Q21A 3C3MA 1PTJC 1S0UA 2JGKA 3BH0A 1XELA 1XYGA 1R9NA 1WLYA 1PLJA 5F3DA 2XB2A 1MKYA 3S2IA 4YRZA 2WJIA 4CFSA 2G9VA 4MI6A 2LGJA 3WIVA 5KCMA 1KDPA 2IU0A 3INTA 4E4RA 5KC8A 4CL8A 2XCOA 2WYWA 2Z2KA 4QTYA 4UHEA 4OA8A 2AG8A 4UU1A 4RLFA 3AR8A 2X8WA 1JFTA 4A10A 2XJ4A 3VPXA 5KYTA 3VH4A 5ER6A 5LQUA 3ND9A 3HY4A 5EC8A 3ELWA 4BRZA 4V0SA 2HDWA 2P8SA 3DHNA 4KRGA 3TZ6A 4TOIA 2B1IA 2I3GA 4HEA6 1RP7A 4X92A 1EP3B 2LNDA 5DGTA 3TQRA 2IYFA 3TLXA 3LCMA 4RWEA 3K92A 1WZIA 3OG9A 4OLAA 1JEJA 1BH6A 5ALUA 1PKXA 3NBYC 2O2IA 4RVHA 5J2UA 3WRXA 4TZ0A 2F9FA 2B2XA 2QSJA 3LG2A 1KSGA 4BUCA 5MHTA 2CFCA 2X19A 2D4HA 5I7RA 1JFFA 5LM3A 4MINA 3U4HA 4W1RA 4ZT3A 3BSSA 3HZHA 1C3OA 5DYIA 1JW9B 3C48A 3KYDB 4GKJB 3NCHA 4KWHA 4AJEA 1PL0A 4D4HA 1U4NA 2NO4A 5B3JC 2JI7A 2DUJA 3ID6C 5KTNA 5IAOA