3QHQA

Structure of crispr-associated protein csn2
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
222
structure length
222
Chain Sequence
MVKINFPILDEPLVLSNATILTIEDVSVYSSLVKHFYQYDVDEHLKLFDDKQKSLKATELMLVTDILGYDVNSAPILKLIHGDLENQFNEKPEVKSMVEKLAATITELIAFECLENELDLEYDEITILELIKALGVKIETQSDTIFEKCFEIIQVYHYLTKKNLLVFVNSGAYLTKDEVIKLCEYINLMQKSVLFLEPRRLYDLPQYVIDKDYFLIGENMVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of CRISPR-associated protein Csn2
rcsb
source organism Streptococcus agalactiae
molecule tags Transferase
molecule keywords Sag0897 family CRISPR-associated protein
total genus 68
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09711 Cas_Csn2 CRISPR-associated protein (Cas_Csn2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11940 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qhqA01
3V7FA 3QHQA 3TOCA 3S5UA
chains in the Genus database with same CATH superfamily
2GXUA 4YAOA 1QGUB 4DIKA 4ZD6A 2EF0A 5I8ZA 4J4BA 4YRPA 1KSGA 3GLIE 2GA9A 3HY4A 2VK8A 4D4HA 1QPBA 1TJNA 3TLMA 1GZHB 1LFDB 5B30A 2V3WA 1LNZA 2XGMA 1UODA 2HCRA 2HY7A 3CXUA 4NOJA 4UM7A 3KJGA 2ZRAA 4HZUB 4LHEA 4A3SA 4QQRA 3TXXA 2OO5A 4H0NA 1P9WA 1U9ZA 3ZGNA 1XLTA 4I50B 2EZ4A 5EJAA 3R5JA 4WJKB 4X6XA 5L3SB 1EQUA 1ISGA 4MW0A 4M54A 4TQGA 1OLUB 1X38A 2CC2A 4YC7A 3U7FB 1HE3A 3ASUA 1NR7A 2X7XA 4MPTA 3J81k 2C29D 2PWYA 1GRQA 4TSFA 2IK8A 3VR2A 2J4CA 2XZOA 3R24A 3IDFA 3D54D 3PDUA 1WHTB 2BFNA 3VGJA 3BRSA 3JWPA 4CCYB 4H1HA 4K3VA 3HBMA 4IIYA 4RSRA 3AXSA 3U3MA 3EWNA 1OV4A 3VTKA 4EKDA 4A2WA 1B8NA 4ZEMA 2R6AA 2AQIA 3KSDO 1GNLA 1AQNA 4MCHA 2NUPA 3A1VA 3BEDA 1YBFA 1FEZA 3RSSA 2BFPA 3T7KA 4YRAA 2ZR9A 1JIQA 1BKDR 2ZPAA 5LBIA 4UTXA 3G5LA 3U3OA 1BC5A 3MA0A 5H4GA 4BCBA 4D82A 2UZ1B 1G8FA 4G6ZA 3WBJA 3FTDA 2AC4A 2FW8A 3ZWQA 2BHSA 4IWNA 1X1RA 1M7GA 2BI8A 2VJOA 5JSZB 3DLHA 1X14A 1CJMA 4RXMA 4P9NA 2B9EA 3TSYA 2Y9MB 3CJRA 5CM2Z 1PEDA 2VIIA 2BFEB 1TTQB 1IOZA 1UMDB 3H04A 3P4XA 1KZ9A 4N0QA 4XCXA 1DJLA 3AF0A 2ZUSA 3OD5A 3PNOA 4TS9A 1BX3A 4MR9B 4KTVE 3JWEA 4CI0B 1FTQA 1M2HA 1QTNA 2ZRBA 4OMUA 2GN6A 1MUUA 3GJ6A 3ICQB 1Z68A 2F90A 2H2GA 2E18A 4F4HA 1YZGA 1AE1A 1VDMA 4OQFA 1Z0KA 3NIDB 5KX5F 5BURA 1AIPA 2JJ2D 3WTBA 2WM9B 5JHHB 3EYWA 3CNOA 4DMLA 4XUDA 2VPTA 4KWEA 5FLXA 1SULA 1AV6A 4R1UA 5KX5B 1K6EA 3SXPA 3AM5A 2NP6A 5L3SA 1PIWA 4YB8A 4GGPA 4DR7B 1TYAE 1Q0SA 5JNRA 1I5EA 3RSOA 1IM2A 2ZKLA 4OQDA 3I9NA 2BCEA 4FQ8A 4HLNA 2B8EA 4FCCA 5THKA 1J0CA 3SFTA 1YZYA 3ZUGA 1CUVA 1NF9A 4D80A 4HOYA 2P91A 2QNIA 8ABPA 3JD4A 1AA6A 2Y6VA 1CRZA 3QX9A 3TVTA 3H1FA 2P3QA 4JJZA 4DCNA 4BRUA 4BAZA 4FGLA 4EPXA 3DE5X 1CDDA 1RHKA 1UT6A 4CL0A 3RHFA 4A0QA 4DB2A 2H5LA 5IVDA 4KLCA 1USUA 2HWXA 3IOCA 3W5AA 2CVQA 4G41A 2BR5A 3EY4A 5FA5A 3VXKA 4A73A 1B8OA 1LA2A 2Y1LA 5EZ6B 3RYFA 4B2PA 4ENTA 4COKA 4MGZR 1H23A 3EFBA 4LRYA 4ZVUA 3HBJA 4PN7A 3SIWA 1YR6A 2HMWA 5JPCA 3QSYA 4URFA 1ZONA 3QHPA 4KC0A 4KGXA 1APBA 1MAVA 1NQAO 4NBLA 3RSLA 1CUHA 2VCHA 4GVLA 3NCTA 3SEQA 3UJBA 3UK2A 1PJTA 4ML3A 4N49A 2NO7A 2WD9A 4A8JB 3AH8A 5BRNA 1IPEA 1EWKA 1MHPA 4J03A 1AHNA 3G0IA 3VOAA 4CLHA 3BHNA 4NC9A 4WNAA 2VTBB 2X9NA 1RBQA 1XZPA 3HWSA 1J2RA 1EGHA 2Q99A 3Q8WA 1YVRA 4U1RA 1LDEA 4IVNA 3ONWA 2CL6X 3I4CA 3Q2OA 2VJYA 3ZWCA 2Z5GA 1E9FA 2NXWA 2QM3A 3OIWA 4ZJPA 2CFCA 5KYKA 1PZFA 4Q82A 4J16C 1VP3A 3UJDA 1D2GA 1TJYA 3N87A 4KXNA 1RPJA 1KTIA 4B3XA 5IJZA 1J0EA 3T1OA 1CJUC 1XJWA 2QUJA 2PYDA 3KS9A 2HQ1A 3H6KA 3L1KA 3M1LA 1P61B 1C1DA 2EQ5A 5E2BA 2CHFA 4ABTA 4J9VA 4UM9B 4U9HS 2PGDA 5JV5A 4W9NC 2FSHA 3NAQA 5C1IA 1S8FA 4CEHA 4GSYA 2D7CA 2DERA 3MUEA 4PHFA 1WDKA 4G9EA 3OTHA 2YJ4A 3CLRC 4NCHA 5EKTA 4JXZA 4J0DA 4AQYB 1J97A 3OT1A 1HZZC 3RNLA 3VZPA 4YRNA 1GRCA 3CNQS 4YUXA 5IF9A 1JG2A 4X7MA 2AOUB 2W2OA 3EXHB 4AB1A 3DXYA 1HDZA 4F9TA 3IVGA 1BOOA 2XCSB 1DWPA 5HIAA 2HSJA 4RIFA 3RLIA 2B5WA 1RWKA 4FYYA 1UP7A 4NE7A 5B3LA 4CUZA 1ZM9A 2W6NA 1BDHA 4XYLA 4FWIB 3FPEA 4PC1A 3SKXA 4TKVA 4HH4A 4JUAA 4RVCA 2XZPA 3ZJ4A 1HDYA 1DFGA 4IH9A 2CV0A 1E2IA 1DQYA 4GNRA 1XZGA 4W5WA 2OYCA 4DCGA 3WQQA 3E0QA 4OMCA 1W87A 4O4LA 4D98A 1MORA 3GPDG 1HL7A 4LV6A 2IHTA 4D8UA 2V7UA 3COZA 5FOXA 1V5GA 2I33A 1ZNQO 1IULA 2J87A 2MMCA 2KX7A 5FV7A 1NUHA 3WJ2A 1IY8A 4MMZB 5HBRA 1Z2DA 3HZZA 4NIMA 1NT2A 3PCTA 4BFWA 4G5OA 5IYZF 5KWIA 1QYRA 5JH7A 1A27A 4D41A 3WX0A 4D8YA 4YP7A 3RPEA 3TJZA 1ILEA 4IH4A 3QU2A 4DY6A 1UJ5A 2H4ZA 3BX1A 4PQYA 4WZZA 3TJMA 1DL5A 3TI9A 1K6XA 2V59A 3IQDB 4DA9A 1L4YA 2XZTA 4JJ4A 4FW8A 5KQLA 4CM7A 3D7MA 4BO4A 3WLQA 1NBOA 3A1WA 4CTKA 2WU8A 2FRXA 4LK2A 4J29A 4OO3A 1FMFA 2XNJA 3IPLA 3R7NA 4C78A 4H0FA 3AF6A 5JO9A 4FE3A 3JQ9C 3FNFA 1DX9A 2JFQA 1YZNA 2A9JA 4JHXA 4OP3A 4HR7A 1Z16A 4BRSA 1FYVA 4DAEA 1VYUA 3E2IA 3FYTA 1SZCA 2AJTA 1DG9A 2D2IA 4IQ4A 1YJXA 2BZ0A 1MABA 1D4AA 1DJQA 2XDQB 3QKWA 4CKWA 4DV1B 5F52A 3Q7PA 3INNA 1GQRA 1NQWA 2XGSA 2YWJA 3TTSA 1TYZA 2AL7A 2BSAA 4PHGA 4HRAA 1SUSA 2A8YA 1L5NA 3IOEA 3A1TA 4MUNA 1Z5PA 3OP1A 3ZGZA 4NATA 5C7YA 5SZHB 2QJFA 4IDBA 4UBOA 3RU7A 4YR7A 3R74A 3PZRA 3V1NA 2B1GA 3RHZA 2BM9A 1ZGCA 4YCMA 3MHPA 1ZM3A 1Z0ZA 4LE2A 4A10A 4RHTA 1N8KA 1F4VA 4DC9A 2AF3C 2YN2A 1F2VA 4FUTA 4FQ7A 4URUR 1LGYA 1DC7A 3PUKA 4MVYA 4YRIA 1VL5A 1J33A 2PL1A 3SR4A 4E46A 4ZYYA 4IQFA 1ZU4A 3BRQA 3C7AA 4UDXX 4C6TB 2Q3HA 1HE5A 1SQGA 2H2IA 3T94A 1UBMS 4XIJA 3BB4A 1Y5IA 5BQXA 2FUG6 3DF9A 4PO9A 4E2YA 2UVDA 4NCAA 5KKNB 4KQKA 3RBXA 1L3BA 3HB4X 3DONA 5T5QA 1PU2A 4M1EA 2GYYA 5REQA 3CX3A 3CMCO 4G0VA 3VI3B 2BBWA 1PFGA 3II6X 2J5XA 1R88A 2V6IA 3WLRA 3RODA 4CIBA 1R0CA 2WHYA 4NH4A 3LT4A 4QU9A 3ZGYA 1L8AA 2OXFA 4PV7A 1ZCBA 3LY9A 1OCEA 4Y1GA 3ZXYA 3TECE 5FYDA 4C5CA 3TQSA 2IU0A 5BSEA 2ZTVA 1WD5A 1YUBA 3ZDEA 2WDZA 4BP9A 2UVPA 4TKMA 1ESMA 4M21A 2JD0A 1YRBA 3EUFA 3P9SA 1FDSA 1MEJA 1DMRA 1KI7A 1Q1NA 1QDUA 2HMYB 1Y7TA 1AC5A 5GJVC 3V8PA 2PVSA 3H2KA 4OXXA 3V2UA 1L5VA 2FRDC 3G2JA 3I5MA 5LC1A 3HR7A 1NW4A 4EFKA 4YT2A 1KOGA 3KTAA 3QE9Y 1NRXA 4RQAA 4X64B 3SYLA 3ROFA 1G5RA 1C9EA 4F5YA 1GCIA 1KRHA 2GN9A 3EIHA 2QY9A 1RTKA 3N74A 4XW2A 5AIAA 3JQGB 3WFZA 3RYCA 3HN6A 4YVFA 3I6QA 1DRJA 1Z6GA 2IEZA 3ETNA 3PQ4A 1SQ6A 4U2EA 3E8XA 5KYNA 4WI1A 4WD3A 1U0NA 2H31A 4KQMA 1EGAA 1K06A 3Q98A 3QF4B 4FHDA 4ZXFA 2XA9A 2E2WA 3ICCA 4ID3A 1DQSA 1XLTC 3Q6IA 3MSCA 1PSDA 5LKRA 4BLWA 3PL1A 4RPGA 4G4JA 1XD2B 2OHVA 1P29A 3PITA 1OB2A 1LKZA 1Y1LA 5LMUB 4K7JA 1HWYA 1PAUA 3JQAD 2N0SA 4X1IB 4YRFA 4L4YA 3CCCA 4KV7A 2AI2A 1NXVA 2YVLA 3CEHA 2VJPA 2LV8A 2OESA 1F8FA 3I8SA 5E2IA 4JI6B 3AKDA 4TTQA 3AUUA 1RYYA 4MKXA 4WDQA 5CDHA 3HH8A 3BMCB 4NVRA 4QFCA 5C81A 2PLFA 1ZLXA 3AL2A 3NIWA 2O2HA 1ODLA 4RHUA 2BTEA 4DM4A 1E2HA 2XBUA 2QMUA 2ZQ5A 4YTEA 3U1TA 2Z1MA 4J6EA 1M83A 3DW1X 1SHUX 5JCXA 2LKDA 4N5LA 3GEEA 4JWKA 1JNYA 1XD8A 2BMWA 4I81A 5FPYA 1XZHA 2YN0A 4KUGA 4NICA 1A9PA 1LH0A 2GBIA 2BM0A 3IEIA 1YZQA 1FFSA 1DAGA 5KNCA 4YAGA 5GGXA 4B3HA 1PBTA 4E88A 3W7VA 2CLSA 1Z26A 3I2FA 3LA8A 2ZRKA 3ANTA 4G8DA 3LOPA 5A5GA 2IY8A 2BFAA 1I14A 4J0QA 1N0HA 4G4GA 3T7RA 2QBYB 3V2GA 1V1RB 3JWIA 2QT9A 3KTAB 1A4RA 4WAUA 4XFDA 1MO2A 1SEPA 2ZJBA 2Q21A 1FBTA 3TR0A 4YPVA 3T1TA 1M2GA 1N7GA 4OHYA 3PGVA 2ODWA 2WAXA 5H0IA 2TECE 3VAYA 2P9TA 4AJOA 3K2BA 1JEJA 3KU1A 3F3MA 2MR6A 2I87A 1DKLA 1U7TA 2F43B 4OSPA 1I6KA 2A4MA 1I51A 4DN6A 1EG2A 1ODFA 2CL0X 4KQ6A 1O95A 2ZBFA 3EOZA 2C7BA 3DBIA 4PAGA 1WB6A 4EA6A 1U6KA 3D3WA 5ARBA 1UKEA 3ILYA 3QEOA 1N2XA 4J2TA 4B6QA 4V03A 5BPHA 1ZAKA 1SWWA 2IRWA 2JC3A 4KIJA 1M66A 1T3SA 2RGNC 2NSYA 4MRVA 4RCVA 4UD2A 1BFKA 3K9LA 4FD2A 4UMEA 3TLEA 1CCWA 4RVSA 1T2EA 2ZUTA 4ZZIA 4E5KA 3WMRA 2FF7A 3ZS8A 5JAIA 3IP7A 3P19A 1IC6A 4C0WA 1RHUA 4W5QA 2EDAA 4HGQA 1L4NA 2EXXA 4L3WA 1HC7A 4YDRA 5EWMB 4EM6A 4FQ5A 4WN9A 4G09A 1AMUA 3C3YA 3IQGX 4P35A 4FFWA 4ZMBA 4IVPA 3PUVA 3WGHA 2JIRA 1RI3A 5H70A 5IAOA 1J09A 2I3GA 2HJSA 1JJ7A 2CNWA 3A3NA 4G2TA 3SQMA 4EUFA 3C3EA 3HVKA 4N65A 1TC2A 3G5TA 4C3UA 2ZIUB 2QWXA 4K9OA 3N76A 3BOSA 1VG1A 1WV0A 2RB4A 1U3TA 2QZZA 2GEKA 3FAKA 1AG9A 2D1TA 1E2BA 4L9AA 1Z6XA 2CLEB 2ZBDA 1Y81A 3HP1A 2ZJ0A 1TA4A 2ZU0C 4C04A 5FI3A 2HA2A 4WWHA 4X1YA 1VKRA 3KAJA 5CB4A 2PWZA 1MAAA 4C87A 1V1RA 3I1FA 3WR5A 1IN8A 2G8NA 1YNOA 4QYXA 4BV2A 4HDKB 3GHYA 3BSYA 4L4ZA 4L8GA 1T1RA 3KQTA 5CK5A 2D5LA 3U9TA 3GBPA 2QF7A 4UULA 5AK4A 4LYDA 3FUUA 3TE6A 4DSNA 4CV2A 5CEEA 3SR3A 4TMZA 4IOMA 1WPGA 1QCCA 2VH2A 1Z5VA 2H4FA 2FCAA 2CNLA 5HCNA 4QD3A 1X7WB 2OV8A 4AQDA 4S05A 5LOVF 1FUKA 3RK0A 4JASB 2B8NA 1PT9A 1NBIA 1RJFA 2D3WA 2OQRA 3MGGA 2O1SA 1EUQA 3QBEA 2IXFA 2CWDA 2PPLA 2QTBA 2AYZA 4G37A 3A6KA 3DC2A 3OE1A 1M6NA 4PYLA 2DFVA 1F0NA 1T34A 2XTAA 3RRYA 2VXOA 1L4EA 3GEPA 1NYLA 3GR6A 2DFTA 1IDOA 4K9RA 1NOJA 1FW8A 3ESBA 4KE8A 3CH5A 2VSFA 4ZOLB 3OQJA 2FWPA 2BEVA 2WF6A 1U81A 4NZ9A 1DFHA 4ZDIA 2Z9BA 4R3NA 5F12A 4ENSA 1JVSA 3LCCA 4YAEA 3WNBA 5LQUA 5D2CA 1NFQA 1Y8AA 3O6VA 2WFLB 1YJBA 5FOVA 4Z1OA 2XXBA 1WNFA 4I9NA 4IEEA 1SBHA 4OH7A 4QARA 3THXB 1BX1A 2O4UX 3CF2A 3CLUD 1MP0A 2C4NA 4BVEA 5FAXA 4HNTA 1LLQA 2A59A 2GM5A 2XE6A 3ED5A 1CRWG 3DLIA 1FMLA 4R84A 2C0QA 3N2LA 2HA6A 2QQFA 4CCSA 1W35A 4FKMA 4P83A 3TR5A 4MB0A 2OXTA 3EPHA 1RABA 5TB5A 4RD2A 1NXPA 4GQIA 1UC4B 1F9AA 2BHLA 1U3DA 3NETA 4C05A 3MHTA 4N82A 5IVPA 4QBFA 1XU4A 3QPDA 4MHTA 1I32A 1LLDA 4QGGA 8AT1A 1UDXA 2ZJ6A 1P9OA 4O08A 4B45A 2CEKA 3JR7A 4MW2A 4F5WA 3O8BA 4JP2A 4Q37A 3JQ7B 1IATA 1EU1A 4C88A 1K9VF 4XB2A 3HPQA 5JSQA 1NN5A 5IUJC 3FHJA 3FNIA 3ZHOA 1EFTA 1EFVB 5K0NA 4CFSA 4M88A 4HMOA 3SHOA 1U1GA 3PIDA 5FLYA 3VPCA 1KBOA 2R8YA 1E89A 3CLHA 1LX7A 1QZZA 1PD1A 1QS0A 4YAUA 5HDQA 1FX1A 4HQ0A 4TT3D 2HF7A 2ZRHA 1T1SA 2Q1YA 2GNPA 3RRJA 2J32A 3RRZA 3VU8A 4M1OA 1LPMA 2WWFA 3TS1A 5KPJA 5IFLA 2AFVA 1RHQA 3QU9A 4CM1A 4F9FA 1X15A 9LDTA 4ER3A 3FFXA 2IZ0A 1HYBA 4J1TC 4Y6OA 3VR0A 3EC2A 4P93A 3CO5A 3VBCA 1JDNA 3DBRA 1IQPA 1M75A 3JD0A 3MJFA 2ZBEA 6NULA 3GJ8A 1Q0ZA 1W36D 3N6RA 3NYWA 1SBQA 3NHZA 2YQZA 2XCQA 2OTCA 3JQ9A 1ZH2A 2CFSA 3UV3A 1I0IA 3IHTA 3A7DA 1LBEA 4EYGA 4KFSA 5IJXA 2J3KA 2VHXA 3BMOB 4GZMA 4ACAA 1CS0A 2GH1A 3CT6A 1O6CA 4KB5A 2PGAA 1TM5E 6REQA 1PF7E 4V0KA 5JTUA 5FUQA 1W47A 1USGA 2QNBA 4PYKA 1XF1A 1S3SA 4UUNA 2K6GA 2QK4A 2EERA 2WVHA 3KYCB 3PSAA 3FYUB 4PZAA 5FL7A 4ALMA 4BFZA 5LZ9A 1JQAA 4FINA 1GVHA 5CXUA 1PWZA 3CJQA 4GP6A 4K9MA 1FZQA 2V58A 3ZIDA 1Y6RA 1B00A 1VRWA 4C6SA 3DQQA 1OHHA 1G4AE 2EWMA 5J2UF 1Y9ZA 4JI7B 4AS1A 1RKBA 1N2GA 3H83A 3ZKWB 4I1PA 1L4MA 2PUHA 1FS4A 4ODIA 2IXBA 4EO7A 2XCTB 3ZH9B 1XXLA 3IS3A 1WDLA 2HHJA 1JPVA 1NJ1A 3LF1A 1T5SA 4TWAA 1KDTA 1P9RA 2BFOA 3V1UA 1XKLA 3TZHA 3G13A 4LKOA 1U7UA 5C5IA 1MR3F 1QS0B 2JFOA 4AYWA 2XDAA 1O1YA 1ZCJA 5AQ1A 3TSZA 1JPNA 1XYVA 3M6FA 1HO3A 1NSYA 1KJWA 3NHBA 2R48A 4IW3B 4YUVA 4TROA 4CLDA 2I65A 4Q4JB 1E2MA 4B3RB 3AM1A 2V7EA 3L8DA 1A98A 2AOTB 1M34E 2A84A 3LDAA 4RMIA 1C7RA 1JL3A 3DOOA 3SQLA 1FUUA 5J2UA 1YC2A 4FN5A 3I34X 4OXYA 4XD7D 4AULA 2AKEA 1XF9A 3ABQB 1R8JA 3I9V1 4G5YA 4NCKA 2P9QA 5DM60 1PUIA 3B3JA 4MA0A 4B9AA 1YZLA 1X3LA 4UBNA 3CNHA 5K09A 1DNPA 3C7KA 3ZLTA 4CQNA 1ZOPA 3EF1A 4WZAE 5CJPA 2WNSA 3OIDA 4AROA 1E7MA 4WACA 1CJTC 5L6LB 5FTKA 2FYTA 3JZMA 4FD3A 4EL0A 2BCGY 4A1FA 4BX3A 2ZJ4A 1TIKA 1QYCA 2XMDA 1CZNA 1FSGA 4CEIA 2XBMA 4I5EA 1T3HA 2HHHB 1OXSC 3KP1A 2FUNB 1MC5A 3GGPA 4ARZB 1VZ2A 2FMHA 3MCVA 2A94A 4IGEA 5HJ2A 1FDOA 2UYYA 4C3OB 4QICA 2P41A 3CUEF 3ILXA 4I1SA 1SA0A 2O06A 5HE9A 2PE5A 4JLVA 3QLJA 1JFLA 1ISPA 3GGOA 3P2YA 4AWBA 3T7DA 3TLYA 2PYZA 4B75A 1HT2E 3LWZA 4A91A 2Z95A 1X1BA 1Y0BA 5EERA 4DQUA 3U9SA 4MDHA 2YZNA 4G26A 4QLOA 2IYFA 4P58A 3PC4A 4DCVA 5JVDF 4EPTA 4IOKA 1N75A 3ZE1B 3EA0A 1EBBA 1I3CA 3JR3A 3L6CA 1CQJB 2YC4C 2CUTA 2JJ2A 1GKYA 4RBNA 5BRJA 4MW9A 2QLFA 3AHEA 5DBEX 4B8ZA 2EX1A 3JASB 4B0OA 1E3WA 5BN4B 2XMSA 4TLCA 3U7QB 3VKWA 5JNTA 2OXCA 2XMRA 2WQ7A 1C0PA 1XTJA 1L2TA 3VDMA 1XIVA 3KAKA 4TWRA 4AZ3B 2H4XA 4U5XA 2IXTA 3MN1A 4D43A 3TRKA 2JFBA 4DC0A 2ZYUX 4EUKA 3CUYA 3O8CA 2PTGA 1RYFA 3R3VA 1JEQB 2AD5A 2GKGA 3ZW8A 1NXTA 2FUKA 2OQ2A 1G6OA 3FDIA 3U3KA 4R3UC 1Y3AA 5B7PA 1C0EA 5I9BA 4CF3A 5JS1A 2XMGA 5FEMA 1LU9A 2C5GA 5G2OA 1GEGA 5H02A 1CVIA 3DQZA 4HTFB 2MYPA 3OPYB 3OUUA 1U8YA 4LFAB 1HRDA 5L3VA 4D4IA 5DM4A 4KXWA 1G0OA 2Q5LA 4HNGA 2J9YB 3B8EA 4HUTA 1DEXA 4LOHA 2AOUA 3EXHA 2BMJA 1MHTA 3B85A 3H17A 3ECSA 4KPFC 2DSNA 3EXHC 3QA3E 1BVYF 2DKNA 2Q5QA 2R6FA 4R8SA 2XT9A 1UWKA 2BDTA 4BKPA 1YNSA 3F9RA 2BUCA 3DCNA 4UVGA 2VBCA 4BJ3A 3HCBA 2HPZA 3GRUA 5ILQA 4WOJA 1TF2A 1UMDA 3INTA 4M53A 3SIXA 4EW3A 1AN9A 2X8AA 2ZE5A 4CVNA 3EZGA 2MTBA 3DBLA 3V1KA 3VH1A 1XRLA 2IYYA 2XB4A 5BMVA 1WE2A 5IWAB 5BR1A 1LB1B 3QKIA 1QHHA 5ED0A 4TYYA 5GMOA 1NX6A 5F7ZA 5HP4A 3AF3A 3DKPA 4WINA 1JG1A 5CT6A 2B34A 3H8JA 1T2CA 2P1ZA 2P77A 3FD8A 3M3HA 4QO7A 1CR0A 2A9PA 4EF4A 1R50A 4RSGA 4JC0A 1FJHA 1SQ5A 1Z83A 4U2CA 5JQGA 4QFBA 1PQUA 4PLGA 3UMCA 1NL3A 1O6ZA 1M7HA 1GAWA 3Q9LA 4RFSB 2AG5A 4PINA 1FDVA 1ZY2A 4K6OA 4L75A 1VLLA 3CLVA 2OHGA 2HAEA 4WH0A 4DQDA 3AEUA 2WJGA 1E3WB 3QG5A 4R2KA 4UVIA 2P3LA 5TJ9A 5BN4A 1R0LA 2HSEA 4CQJA 1NNEA 5AIBA 4ZZ2A 1UEXC 1ULBA 2XYQA 4BP8A 3TM4A 3FWYA 4BNMA 2K87A 4YYZA 4OIFA 3DE3X 3QGMA 1WD7A 4HO1X 1A3CA 4BX8A 2Q0SA 2A58A 3QMVA 5ENVA 5KU7A 3K4PA 2JGKA 2OO7A 3H16A 4IDOA 4F6LA 3NORA 3KQNA 1ZHOA 2IUFA 3OT5A 3ZZUA 3PXXA 3NAGA 4DMUB 1ND6A 2IYZA 5EJ7A 1DOHA 3UOGA 2Q6IA 5JR3A 4O4IB 4G1EB 3BE5A 1L7BA 2GAJA 2G4CA 2Z8YM 4RK7A 3RYFB 4B33A 1SG6A 4IM7A 1U2RA 1EXMA 3L6OO 4NENB 4L07A 3TL3A 1JKJA 3L84A 4EEZA 3K71B 2YJZA 3D6VA 4IPTA 3ZCXA 3ENQA 2Q4RA 3J7TA 4NOMA 1KI6A 5DBFA 2Q41A 1VE1A 1KZ1A 2D54A 2AOWA 1AKVA 5DXFA 5T67A 5EAIA 2H1VA 1OLSA 1DBPA 1Y98A 2CNBA 3N5KA 4Y2PA 3K0EA 4XYMA 1PE0A 1UT5A 2XUGA 4CL8A 1U31A 1UK9A 3R7LA 4R1MA 2BBSA 4S24A 1K4YA 3N2KB 1C30A 1WSDA 3NM6B 4GNKA 1BMFD 5H83A 2RI0A 4CQMB 3IE0A 5KNBH 2HQBA 3PA8A 1R6UA 3NTRA 4AP6A 4FSHA 5KYWB 2MR5A 3LSYA 1XXHB 1G3UA 3WK8A 3QPCA 5IT9A 2GFQA 3L8CA 1CY4A 2G9ZA 2H5IA 1PFQA 2XGOA 2ZRQA 2WI8A 4AM8A 3ZK8A 2B1QA 3AB8A 1F20A 3B5EA 2XRYA 4IAOA 3B9QA 5JC1A 1DKPA 2YOGA 2XNDA 5FQNA 2I1VB 2FSPA 2QXUA 1YJQA 2GUWA 3AEUB 4BKUA 2QRZA 4MMYB 5DEIA 3PUYA 4WZAB 1KY4A 1J23A 2WQZA 1VE9A 3Q85A 2GA8A 4QQNA 1L5QA 1S96A 4WY2A 3NATA 4DB4A 3U3DA 3D6UA 1W7AA 1MTOA 5IT4A 1UJMA 3QVGA 4MUJA 3HUUA 1RKQA 3PR1A 4JLJA 2X5NA 2QL9A 4DTCA 1NPDA 4NPAA 4D9MA 2BRUC 4AMVA 1BGVA 1F0PA 1U0SY 3JQAA 4IJUA 2PNJA 4UJ5A 5EHXA 4CYMA 2BF7A 5LBTA 5ALSA 2P4UA 3NAZA 4LGVA 4L6AA 4ALNA 1KK2A 4CMKA 4DYDA 2RFLA 3PD7A 4Q1VA 4BNJA 1X1EA 1M1NA 1GA1A 4RC9A 5EE3A 3G2PA 4JDUA 1KY2A 1DCKA 2IYVA 4RZHA 3TYXA 1QYDA 4TZTA 3K70B 3DFIA 4MUKA 5E4TA 2XYHA 2C5EA 4AYTA 2ID8A 3GAAA 2P62A 4M8SA 3ZDFA 2VUHB 3QNMA 5D7BA 3JD1A 5HF6A 3SIPA 3F5DA 4HXYA 4HT3B 4EGAA 3DEHA 3WMXA 2Z2ZA 4JVOA 4X7RA 1S2DA 1JSLA 3HGQA 1CU1A 3WGMA 3KHUA 4YUYA 4YMGA 1E5QA 4Q4HB 4KXQA 5IM5A 1M2EA 2HU2A 3P2JA 1L4HA 4RL6A 4ETWA 4MCAA 1EXVA 1YOBA 5CJ2A 1Z4NA 1R6TA 4TLAA 5DO9A 1P80A 1U3CA 2YMLA 2YWGA 2X7JA 3SHWA 1S9HA 1EWVA 1W44A 1TCCA 3IQZA 5JXJA 1G66A 3HU1A 3MVEA 5HFJA 2GF0A 3LGAA 1E4EB 3PE6A 4ER5A 2LDXA 5JD4A 5M3BA 4JYBA 4LTMA 3PC6A 1O5TA 3I1JA 5AM4A 3FNHA 5LB4A 1Q91A 3A3PA 3UIEA 1YBVA 2ILVA 4JLKA 3L1IA 4KQGA 3CVXA 3RUIA 5LJLA 5CUQA 5HTKA 3V8QA 4I6JA 4RA6A 1HMPA 4E30A 2B25A 1SU8A 3PNMA 4UASA 2X6RA 2ANBA 4GS5A 4HDSA 1ENPA 3SEZA 1B93A 4OJQA 1K5GA 1X70A 1F2UB 2N1MA 3RV3A 4YYEA 4BIMA 3SDZA 4EGCB 5LL6P 1DAOA 3KQYA 4KDRA 3WXMA 5DV9A 2NSDA 3EVNA 2XKAA 3OCYA 4GZ6A 4BMVA 1P5RA 2ES4A 4ZU1X 1ZIDA 5CDUA 4E6PA 4LOAA 4BECA 2PRIA 3W4KA 2C8VA 4C4RA 3IL2A 2SBTA 2KJQA 3FFAA 1YVDA 4UD6A 4UE2A 2WOOA 4LC9A 1PUXA 3MTDA 3OT4A 1NMQA 4MB6A 4PBSA 3C3CA 1ZZGA 4U4AA 4HNUA 2PL9A 4DUPA 3P7MA 2PRJA 4UNRA 4NP6A 4KYUA 2W6PA 3C5EA 3D3WB 2QMYA 4I50F 5DHUA 3C6QA 3D6FA 3G68A 3A28A 2HCBA 2QRMA 5KOJB 2V6GA 2WKWA 4AUMA 3QVLA 5ITZB 4RJLA 3KQUA 1HI9A 1YKGA 4I1RA 3I6IA 4UHCA 5GONA 1QHYA 1W5AA 1Z4JA 3ABOB 3JQCA 4M1SA 5F1PA 3VBEA 4BLQA 4PY2A 3OIYA 1GPDG 4U7PB 1RW4A 3RJZA 3A1NA 2H2AA 5TXGA 3O7MA 1IU9A 1WQ3A 2PZLA 3STVA 5A5EA 4R81A 4CUJA 1GADO 1ZMXA 1QR2A 1RTTA 4LMRA 5REQB 4ASUA 3TSOA 1LQTA 5F98A 8ATCA 3EIQA 2JGDB 3FY4A 1TZKA 1B1CA 2GXQA 5D7NA 3FFBA 1EK5A 1P17A 4N3CA 2C2XA 5LP6F 3FROA 3Q88A 5C8DA 2JLYA 1XCLA 2FPOA 4DIMA 1CDZA 4JI0B 4ZCMA 1IZ7A 2XRZA 4C7JA 3O8NA 3L0ZA 1VQ1A 4RNCA 1KYTA 4Z4IA 3BGOS 1EVEA 4ARIA 4RWEA 1HT1E 3HWRA 4KVGA 2R79A 3F6PA 4FYJA 1FFGA 3SC2A 4RA6B 4BGUA 4MA5A 4BRZA 1MV5A 3GC6A 3Q11A 2PRZA 1ZHHA 4KVZA 4ZQBA 5D5QA 3GI1A 3RVJA 3I39X 5F4ZA 3TIIA 4YV2A 3T9FA 3UHPA 1ID8A 4A6PA 2EIXA 3DDOA 5A3VA 2C5AA 1G9SA 1B1AA 4BLTA 3F5QA 3MRVA 1GWNA 3H65A 1JJBA 2C7OA 1F7UA 1I3OA 3AQIA 3SQOA 4R1TA 2DBVO 2E4AA 1MOSA 3T8YA 2DLNA 2IY9A 2Q1WA 4F4FA 3E2PA 3EW9A 1KR2A 3VOSA 1BHJA 2H57A 3RASA 2PWAA 1U7DA 1B74A 3M34A 4O33A 3FPJA 4RYDA 3W3ZB 4IV8A 4B40A 1IZZA 1E60A 5IDWA 3D7KA 3U4QA 5AKKA 3I1IA 1N33B 4B71A 5EE1A 4CF5A 3HL0A 1BS9A 1H65A 3SF8A 5AMXA 3GLFA 1P45A 2FDXA 1W0JD 3QVUA 5B6PA 1W46A 1WBBA 3T41A 5K3AA 3OZTA 3WYEA 3WQHA 1N2CA 1PR0A 2JGEA 3LG2A 2QL7A 3H7AA 4K8OA 4PC7A 1L3CA 1VMIA 1SUCA 3ORHA 1EFPB 1RXCA 1UEJA 2OD9A 4C03A 1NUUA 3T5MA 5BUQA 4EFDA 3PEWA 4TGLA 4LDRA 1XAIA 4CF7A 2ZRIA 3GFTA 4ERNA 1RXIA 1UP6A 2IPMA 3CKLA 2JRLA 1HL3A 1BXKA 2ZI3A 2ZR0A 4I6GA 3QYJA 4LZPA 3ZHYA 1KK0A 2DPLA 3S2YA 4INJA 3H11B 5CDFE 5JXHA 1V7QA 3V4PB 3RARA 4AY6A 2Z30A 5D51S 4BAGA 1W2WB 2F59A 4JR1A 2CUNA 1PR5A 5F3DA 2YRFA 5J1SB 4LC1A 3OZIA 1WS6A 1DT5A 2EP7A 1XTUA 5DBIA 1AQIA 2Q6KA 2P4EA 2BR4A 5TDHA 1L4BA 2GWRA 3EOBI 2ZAGA 1GUDA 3E1GA 3ND7A 4MJXA 4Q01A 1BU8A 1KU6A 4ZO8A 4GXNA 3RB8A 4EIWA 2ZXUA 3A6JA 3FYUC 3OJEA 3E18A 1UC9A 4UQPA 1JSRA 2ZKIA 4MQLA 3JQQA 4Y2UA 1E2QA 5EKUA 3VR4D 3GPCA 3WHLA 3JQFA 2PGOA 3RU9A 1CC1S 4MITA 2X3YA 2WWYA 5TEWA 4CKEA 4TWJA 1KSFX 1ESNA 1UBCA 4XWWA 1SOVA 3AI7A 1U65A 5JANA 3EUWA 3P9KA 1A9TA 1J99A 1CUFA 1WOMA 5NULA 2WIFA 4ZOBA 1DTWB 1DWQA 4PG7A 4C1BA 1HNWB 2X19A 2Q3EA 2R5NA 2YXDA 4FEYA 1SCNE 3QLUC 1SUWA 2H5EA 1RI1A 2D4AA 3E9DA 4GE0A 3KJQA 4D81A 5B6JA 1E3LA 2IITA 3WV4A 2JGLA 2WB2A 3P97A 1P1IA 2AUMA 5CLGA 2C8LA 4YJFA 3SF0A 3K16A 1A5SB 3ZHTA 1QQBA 3ENNA 1A1SA 1AUVA 4TT8A 1WPXA 1L7RA 3C41J 5JVDB 4OB7A 4B73A 3AUJB 1K88A 3W8EA 2W6ID 3I9V6 3BF8A 1EWQA 5SYMA 3QJ5A 1TZBA 4ZEXA 2CZQA 4JUDX 2QROA 1YB4A 2OYSA 5HA5A 3ZWOA 4R0VA 4RA9A 1ZYUA 4C07A 4C29A 3UY4A 1OWPA 2DWCA 1GYRA 3RVMA 1QHSA 1HH4A 3H97A 4L9RA 4ZO9A 4MLZA 3U4HA 2BD0A 2H08A 2O5VA 2QLBA 2PS3A 2WOJA 2PSSA 4QU0A 1JTVA 1T2UA 4X44A 4M3NA 3M0EA 1S5PA 3ZR4B 2IX3A 3MJDA 1O5IA 1JNXX 4DNOA 3HXMA 1R4AA 4BMOB 5JCPA 1EHIA 4X1YB 1YDWA 4GBMA 4NHEA 3CVVA 1Z0JA 3GX1A 1J00A 1QLJA 1DT3A 2W83A 2BFWA 1YKFA 4KJXA 1GGEA 3JQEA 3V1MA 1EINA 5BV8A 3EC1A 2I4IA 4KQXA 4C08A 3EGEA 4UDYX 4EK9A 1IG0A 2OLEA 2YWRA 5AVZA 4YUAA 2C1EA 4GRDA 3EX7C 3BDVA 2G1KA 2WHRA 4FI3C 3NV9A 4X6LA 2XHZA 4GX5A 4PFKA 4W8HA 3CC8A 3KYCA 2D1QA 4LMAA 5KCMA 3LQQA 4CKEB 2DMRA 4Q24A 3B38A 4TSFD 3HJUA 5CD9A 4EY7A 1EFLA 3R6LA 2G3YA 4MRSA 4W5HA 3LZDA 2W2LA 5K0ZA 1XPJA 1KHHA 2GZDA 3D0OA 4K05A 2X5JO 3H1GA 4WLFA 3KSAC 5JJBA 3F5FA 2WWTA 4KCGA 4M9UA 3V4LA 2UXDB 5CMLA 2C4TA 3LPDA 4PS0A 1G64A 1PDWA 4PYOA 5KNBA 1JQLB 5L40A 1PBNA 4TQ9A 2OOSA 2Z6QA 4BO1A 3TCXB 2BEUB 4EATA 3TFOA 2IZ5A 3A3OA 3R9XA 1F8UA 1OKKD 3RHTA 2WMNB 3FPFA 4OPMA 5D84A 1E99A 2DFPA 3HJBA 1B8PA 3IQFA 4NYIQ 4WKBA 1UJ2A 2D5IA 5AVUA 2RGRA 1KEZA 4B4WA 3UWSA 1WEHA 4ZHSA 3EXFB 2GESA 3N0TA 4N7RA 3RTBA 3BJRA 3MMXA 3ZI0A 2GCEA 3GAMA 3JQDA 3OQNA 5EWLA 4D5GA 3O4HA 1SQ0A 1OLOA 2QJWA 3K96A 5CYGA 4KU4A 2O8CB 1O94A 1X8LA 2WIJA 2B8WA 5AO9A 1GL7A 1UK7A 2R6DA 3HEBA 3TO5A 3FCXA 3IO5A 3VH3A 2CFOA 1ZGAA 3E5HA 1B2RA 3ESXA 3F8SA 1JQ5A 1QUEA 3GFRA 3OFVA 2PZMA 1J8FA 3DNPA 4YT8A 5A1TA 1AXEA 1K0UA 2RJNA 2PT9A 4OMDA 5H1YA 2FPIA 1QJCA 3DZFA 4NG4A 4ZZ1A 4HLQB 3L9WA 3CIOA 4ARZA 5HPYB 5KSYA 5K05A 3FLEA 3ICEA 1EVYA 5CT9A 1LSOA 3UJ6A 3V7UA 1PWXA 2IOFA 1PJRA 2HPVA 2YC2C 3QLUA 5HCUA 4JA0A 5K3DA 4R71A 1U8EA 4U2KA 1N9GB 3UJ7A 3ZDDA 3PS9A 4DLBA 1M73E 5DGCA 4BVKA 1TQ4A 1A9QA 5DE3A 2O20A 3EIFA 2POQX 5DEOA 4D99A 1O4VA 3AUTA 4FMDF 5AHRA 1T29A 3N70A 4RTMA 1IHXA 1Z39A 2P5SA 1K89A 1LVUA 1LBIA 2BY4A 1TDJA 1KH1A 2EJVA 4FMPA 4O3FA 3WYFA 3ISVA 4XWAA 2YXLA 5CB6A 2QD2A 1GY8A 5E9WA 4QVKA 2P6UA 2VCYA 3GGJA 1ICEA 3TLGA 2DKOA 1UWLA 1ZSVA 3GJSA 5KC8A 5KNCH 2WQ6A 9GPBA 1CUBA 5TC4A 4UUBA 3THRA 3TRHA 3U4GA 4OXNA 1TYEB 2IODA 5CEJA 4B2YA 1YZHA 1KEUA 2H7VA 4CIXA 4B31A 3L2OB 3FNEA 1Z2CA 4MYUA 5G02A 2ASVA 3BMOA 4DPMA 2PGJA 1T2VA 4J0FA 5DYIA 2VP9A 5FWXB 3UTCA 1QIFA 3P4YA 1U2TA 1NV8A 1SJ9A 4M1TA 4X71A 4D2IA 1P0FA 3H5IA 2IPLA 3PX7A 3QUAA 3ZWMA 2A35A 4LHZA 3AVPA 1H0HA 1C3JA 3F2IA 4U7WA 3ZHBA 4EKGA 4YJ3F 3R7DA 3H9EO 4EKIA 1CUCA 3WK5A 2PKEA 1OFTA 2Q5OA 3T7JA 3IUMA 1JKFA 5E4JA 3W6ZA 3IT1A 1YFKA 1LZLA 1JHVA 5H9VA 1O6GA 5AW5A 4OQEA 1Z8FA 2FX5A 1N6PA 5GOZA 1BCRA 1KEEB 1VM6A 2VUTA 4W8GA 5I9MA 1KI4A 2GHIA 3EVEA 5B2FA 1NOKA 4RS4A 3OF2A 3EXAA 3ZCRA 1J0BA 3AVXA 4D5EA 3H86A 4DKXA 1NQ5A 3HABA 2A1TS 2BR3A 2J1LA 2R6GA 1NJGA 4CDMA 4JQZA 2X6QA 2BI4A 2CCJA 4E33A 1JIIA 2AMLA 2EOAA 3KVVA 3GUHA 4XJXA 1KJ9A 2HC9A 5KJFA 4XDGA 4YJ3A 3ZTWA 2QL6A 1JMYA 3PG5A 4XM2A 4BNNA 3EEBA 1CRPA 2H7YA 1XTZA 2WV9A 4NYIR 3B9BA 3KJIA 1JHUA 3R7WA 4Z3DA 4MYCA 2GTPA 1QAQA 3BZUA 1OF1A 3WKBA 4MULA 1Y3CE 1ZR4A 4DDMA 5KOHA 1K3UB 3FF1A 3TNLA 3OJCA 1UBUS 2IEDA 4Y98A 2NAFA 5E6SA 1DJOA 5KNLA 2VP2A 4WLVA 2C83A 3QMWA 4LY3A 2HA3A 3COPA 1PLLA 4ZQCB 4DSTA 4MGYR 1QKJA 2C2HA 1Y42X 2FH5B 2CSUA 2AG0A 5FA6A 5LDHA 4IRUB 1IMOA 3LCMA 3GLQA 2HCJB 2EFYA 1KDPA 1DRWA 3VHXB 3D5QA 3OPNA 1Z75A 2NT3A 3JY6A 4BB9A 4IJWA 1LZKA 1COWA 4L8VA 4N8EA 5EMKA 2VQEB 1PGQA 5IDXA 3PVCA 1SPBS 5LZ2A 3WK7A 3ZNOA 1WEKA 3DZCA 1GKLA 2B92A 2YN4A 3MLAA 4MGIR 4B83A 3K0KA 4NBUA 1DBVO 1TT5A 3WSTA 2VJKA 3FGNA 3FM9A 1UPCA 3CUUA 2YUTA 3LYUA 3C16C 1C7QA 2REBA 1D2EA 1YC5A 1P1JA 1NMYA 4M9CA 4P3OA 2HMAA 1NQOA 1L1QA 2C9ZA 2KBFA 3IILA 4LVUA 1Z25A 3VU9B 1G3MA 2Z6UA 2P2DA 1V11A 5DISB 2G36A 3SXJA 3CFYA 5A9TA 1FFHA 3K5HA 2XQFA 2BFEA 3AC0A 3TAUA 5ED4A 1TE2A 4EG7A 4XZ3A 3X1JA 3FUXA 3WJAA 1W4CA 1U3WA 1YRAA 1I4TD 1E1MA 1PZNA 3OCVA 1ZU5A 3RU2A 3ZDBA 4LZZA 3C5CA 4INAA 1GHTA 3DKVA 2J0UA 1EM6A 3PUZA 4WCFB 5I7EA 2HDNB 2GNOA 2Y1XA 2VF5X 4U63A 3R3JA 3RYIB 5FH9A 2VHQA 2W2NA 3WL8A 2W58A 4H15A 5KYUB 3B60A 4OK3A 1EK2A 3ZIAD 4BYGA 1A7AA 2W98A 1EFHA 1LY1A 1J90A 1HLFA 3LHIA 1GDHA 4KLAA 5LUBA 4BLVA 3ESYA 4AJ1A 1JQDA 2VYCA 4UCQA 4B3JA 4AZVA 3L7LA 2W7TA 4MW1A 2VWPA 4BUCA 4OBEA 4UE6A 1VLQA 5EZYF 4DQ0A 2AYXA 3PGJA 4NPHA 4AKSA 1S4MA 4KXMA 3VPFA 5EJEA 3GLTA 3UXYA 3IBCA 2W8ZA 3L04A 3QVOA 5AJVB 2PU5A 1GGNA 3TUIC 5JRDS 1MO6A 2IU3A 2OWDA 4M55A 4EPRA 3S2SA 1GNPA 2IHJA 3UZUA 3W8FA 2GSDA 3NTQA 3F2VA 1YI1A 1U5CA 2P2GA 1K8QA 5IJAA 3F90A 4EAQA 2ACVA 5L45A 3QX7A 2E5LB 2YZ2A 4ERXA 1G98A 4NCJA 2HSDA 1L8QA 1M2OB 2YV2A 3NDPA 4JU8A 3O75A 2XB9A 1UKVY 5F3RA 2OXEA 1IH8A 1WSAA 3OU2A 2XTNA 4LEIA 4RE6A 3DLPX 2GVZC 3M6UA 3NC4A 3RYHB 2YZMA 3KSBC 4BX2A 3LFHA 4IXTA 1SBIA 2FV8A 3DUFB 3LX8A 1GTG1 1SCIA 4MVXA 2GXSA 2HJVA 1ISMA 3ZQJA 1RQNA 3N3BC 3IUBA 4PLCA 4WDRA 3ND8A 2VFAA 4PF1A 4IFIA 1AQ6A 2F3TA 1R3DA 4KVFA 1F51E 3DBLB 4MNTA 2Z08A 1C7EA 3LIPA 3BJEA 4HWRA 2Z1DA 4RZUA 1PVDA 4IDAA 1FNNA 3A04A 4LY9A 3ROGA 4RLQA 2J7PD 4M2LA 2ATEA 4FP9A 4G0PA 2RGUA 1YQGA 3GLVA 3QI2A 1D2RA 3W8RA 5GZ1A 4AUEA 1XZDA 4E5YA 1MC1A 3IV6A 4GPEA 3TINA 4BTLA 3BWXA 1EE9A 2IHYA 1DS6A 1S4QA 4LJ8A 1ZRMA 1E7SA 2QD3A 4P92A 3RIGA 3KLPX 3OPQA 1C81A 3OE7A 2BGTA 1R37A 3CHYA 1SZDA 2IDMA 1NASA 3NRCA 1FMCA 4HP8A 4IG9A 3KOZA 1Y80A 4LN1A 1QJ4A 4E6EA 1WXQA 1G7CA 2FGKA 2WR8A 2CXHA 3LBYA 2ONZA 1X42A 3O9ZA 1CW2B 3EHEA 3F4BA 2GZ1A 1TUBB 1QQTA 2P9GA 4UVEA 4MWEA 5HKBA 1VG0B 4XIFA 2V0GA 2C88A 3DYBA 3ZN2A 4CDRA 1HTBA 2I3BA 2QI9C 1G55A 3LKBA 1JQJC 1DKUA 1Y34E 5TGTA 2HF2A 4U7FA 5LQNA 4CV1A 1BQ3A 1VYTA 4QUIA 4YAKA 5AVOA 4RSHA 2DBYA 4YLGA 2QN1A 4F84A 5C8XA 4ZOLF 1L7QA 4LF7B 1NW7A 5DTIA 2R6R1 3PLNA 4NX2A 3WLKX 1DIAA 3BORA 2X2OA 4B3MB 3U7EB 3JV7A 1YSCA 3D1LA 3MWKA 2QMEA 1A8SA 4QPPA 4O5OA 4D3YA 1SBCA 4F6CA 3IBSA 3NU1A 4LTDA 2B1IA 2P0YA 1U1DA 2RGAA 3F47A 3HNOA 1VMAA 1IBRA 2WAAA 3KD3A 5DSTA 3AI2A 5JSZA 3AUYA 1H4VB 2AQKA 2C82A 1ONBA 4I4NA 4UNNA 5DF1A 5HK9A 5K4GA 2DETA 3TIVA 2JL1A 1X7ZA 3MILA 4U8GA 1USVA 5GONF 2YBEA 1HNZB 1O8BA 1N5MA 1PR6A 2VDVE 3RIYA 5LMZA 3WLMA 1GU7A 4F56A 4DNPA 3EISA 3R7SA 1DIHA 2WP8J 2CJWB 3P96A 1KE2A 3CKKA 5JC8A 1OIVA 4HC4A 2BMVA 4MO9A 4ND4A 1SB8A 4P3KA 3HGMA 4P4SB 5EP1A 2JIMA 1TMOA 4ANFA 4NQZA 4OJMX 1KPIA 4RHFA 2OT3B 4AS3A 4ZYVA 5LZ5A 3M6LA 2NVUA 1NJ8A 3B8HA 1ADCA 2IBMA 5I7HA 2H92A 5GINE 1N2IA 2ZE6A 2E4XA 2OFWA 1JVNA 3QTLA 1TVKB 5AXCA 3CVUA 1FP4B 5BWBA 3HBFA 3WWPA 4LXGA 4DDVA 3QYFA 4JP1A 2ORED 3GMDA 2WVJA 3CNBA 4H1TA 1GZ5A 4TOIA 3VZSA 5B3JC 4JR0A 1W1WA 1OLXA 3IJEB 3SXUA 1KTVA 4CLRB 4DGQA 1HLPA 4E5UA 5J40A 1IXSB 2H17A 3HDYA 3SC2B 1NQXA 4YRSA 4GYJA 1QX4A 3NZEA 1FNBA 4X7BA 5EINA 2DX7A 2Q45A 3BGWA 4ZGBA 1CQWA 1RQXA 3IEPA 5IDYA 2YUIA 4E5DA 3NBZC 4Y9DA 1QZUA 5E0OA 2ZYHA 2DFDA 4B80A 3EA5A 4R9UC 4RJTA 1H9CA 5CCDA 4CHGA 4J75A 2XMCA 3P9ZA 1OBHA 3CGWA 1MB3A 3DTVA 5TARA 1E2KA 1YMQA 5TMPA 4IEFB 3WC4A 1V7ZA 4J0EA 3ZU6A 1BN6A 1X1AA 2NV2B 4BGVA 1SVOA 2C03A 4YGXB 4JX9A 3NAMA 1PT6A 3WNQA 3ZWBA 1ZNYA 3O73A 2ZUDA 4PGFA 2YY7A 2Q3JA 2VHUA 1KDOA 1BH2A 3V7FA 1B2LA 1L5MA 3U4QB 2YR0A 1UZLA 3GELA 3AHCA 1MG0A 3LUHA 1E1CA 2F67A 1SXIA 3PTZA 2Y0CA 4ZU3A 5LA6B 3D2BA 1VPLA 1JR6A 1SXJA 4BNVA 3FPSA 3KVNA 4LF4B 2Z8ZA 3M33A 3KLMX 1XWWA 4DWJA 3DULA 2OYRA 2QN2A 3UJPA 1ZBQA 4PM4A 3GG9A 3C3PA 1AKQA 3S68A 1BX0A 2ZXEA 3NEJA 1WABA 1FYFA 1RPZA 3JPWA 2P4QA 2HBRA 1P6XA 5DULA 2VJNA 3JATB 3QJYA 5A02A 1V4NA 2QQ5A 3KAPA 4EKYA 2PUBA 4GL2A 1SVIA 4ER0A 4YAIA 1FJGB 2E4UA 4D3SA 1EVLA 4BZQA 2I29A 2JCVA 3CZQA 4LE1A 2I3AA 1QC5A 1Q0PA 1UBJS 1YJAA 3IMKA 3NM5A 4J0KA 3UHAA 5HOQA 5E6UB 4KO1S 4ES6A 1IYZA 4KODA 2IDZA 4NK5A 3EPPA 4GKKB 3SP1A 3AYXB 1VSQA 1W6RA 3MUOA 2ZATA 4RK5A 4C01A 1J4AA 3ADDA 2VT6A 1T1IA 5J9FA 1SH7A 1XZBA 5KYVA 3IAS1 1PQYA 3NI2A 3HI6A 4NWIA 5H81A 1C2TA 1G2PA 4CPDA 3LF2A 5ES4B 1TGVA 2AS0A 521PA 3AV0B 1E6WA 4FNOA 4E7PA 2CFIA 1MV8A 5LVAA 3U16A 2PBZA 5DK4A 4A8TA 4ND5A 3COJA 3RFCA 5FB3A 3HMQA 2EU8A 2CNDA 2JJYA 3O1JC 4OLBA 4LOKA 2A7XA 4L28A 1JBKA 4JB3A 5FBVB 1AVTA 3KKEA 4G0OA 5HKLA 3FZYA 1JLKA 1GL3A 1VRVA 3EMKA 2QUHA 4HAXA 5KAMA 4DE5A 1NHGA 2ILTA 2QGNA 3REQA 5C1PA 2ZT7A 1L4GA 1XNHA 3AGPA 3N86A 2XLBA 1VJ0A 2P9EA 4JBIA 2VHEA 4XJTA 2FEPA 1YS2X 3S2EA 3WXBA 4LOLA 3FUWA 3TEFA 4PSVA 4YI3A 4GL4A 4R2LA 1RI4A 3K92A 3CQ9A 4KN8A 1XVTA 3KPYA 2RC6A 4Y6SA 3N7UA 3BCHA 4O1IA 3SJZA 1AX9A 4A2QA 2C0PA 1CJSA 1UFOA 3G9ZA 3O83A 3M4YA 4C4YA 5M5BA 3T5BA 1C3VA 3B1KA 2B2NA 2C3MA 4Q3DA 4RK1A 5A03A 1GARA 3NTUA 3G5AA 1IEVA 2D2FA 3ZTYA 1K4MA 3CT4A 1EB8A 4ITVA 3RKRA 3CRNA 2IOQA 4N5NA 4CM9D 3S8YA 2OGWA 2WK1A 1F48A 1SMKA 4PLTA 5EZSA 4RKQA 4K26A 1RYNA 4HNRA 3RGWS 4QG3A 2NZYA 2AVDA 3DCJA 1VB3A 4QODA 2IPXA 1C8LA 2GEDA 3WJ1A 3QOWA 2CHGA 1V1MA 2C99A 4ZVKA 1Z5GA 5AW4A 3K9GA 1H2RS 1K97A 4R7TA 2OC4A 4MRNA 1YK1A 1JEEA 1FSZA 1Q44A 3MRXA 3DT8A 4F5EA 4CMEA 5E38A 3T5TA 4L6CA 5KOYA 2Z5FA 2YW2A 5G1PA 3IE2A 1NDUA 3R0IA 2DXIA 1U1EA 1RRCA 3T5AA 3VNRA 1UF9A 3ZD6A 2ZDHA 3RG8A 5ARCA 4BNXA 4A7PA 5D1NA 1Y9EA 1PT7A 4DR1B 4R41A 1AMNA 5PNTA 4DQXA 5IBCA 3IVMA 1LC3A 1ZEJA 2X0DA 1IY0A 3AP3A 4OHPA 2B6NA 4M1WA 1VL2A 1WZIA 4LSWA 5AOCA 5FLEX 3IUEA 1SU7A 1ZMBA 1SUIA 1CUJA 1W76A 5AKIA 1QFXA 3A2MA 3M4JA 2ZYRA 4DL9A 4Z2AA 1K1EA 2WMYA 2Q5EA 2PFGA 1P1FA 3B5JA 3TQQA 1Z62A 3USES 5JFGA 1OH5A 1M74A 3DAYA 4UUOA 1O6BA 2DHEA 1XAJA 5SYAA 2J41A 5CNJA 2VSOA 3O8RA 5BYJA 4CIWA 4C6RA 3ED1A 1ZVVA 2EHJA 3L5OA 4BKQA 2QRUA 2VLBA 4DCPA 4D8TA 2AFIA 4GWLA 4KQ9A 4QT0A 1V2GA 4XIYA 4BMPB 3R8FA 2BJWA 1ECLA 1E63A 1KAMA 3DYIA 2BIFA 1XKQA 2QIOA 3LC7O 5AI0A 5B7QA 4MB2A 1PJSA 2O3QA 3C3KA 4J7UA 3ROEA 4KP7A 4G0XA 3UQZA 2Z1NA 1RAFA 3F67A 2M1XA 5MGNA 4L8FA 1UJNA 4MVJP 3KFVA 5C32A 1UZUA 3TMYA 5JBQA 1U98A 5JSHA 5DM0A 4ER6A 3TBKA 5IVIA 4U2BA 1X6VA 4N5HX 4OUDA 2G17A 3JYOA 4MR9A 1V41E 3HJFA 2Q3BA 3GUUA 4V3CA 4Q9IA 1DAIA 1JSXA 4IV0A 1M8KA 5CG1A 2WT8A 1B42A 2W6ZA 3BQNB 2C2GA 4HPJB 1DDOA 4OJKA 1UFRA 1A5ZA 4J43A 3SKVA 2SCUB 2NTEA 4CKYA 3L01A 2AGVA 3M6WA 3TD6A 3PRHA 1E79A 4RVNA 4HDMA 1K8ZB 4NPCA 2RHWA 1EPUA 4O6VA 5HGXA 1U2DA 3O4VA 3U7IA 2AOVA 3IB6A 1OJ7A 3IUSA 1H42A 2LIVA 4EHDA 1M34A 2Q8NA 1MQSA 2V74B 2H2DA 1PV2A 2CXRA 5EC8A 3RAJA 1H0SA 3REFA 3A2NA 3U44B 3QWBA 1NY5A 2CLLB 2OG2A 2RHRA 2Q1SA 4LZWA 3RTDA 3HVJA 4R1SA 3DG9A 1YMUA 3N7TA 4QXRA 4K3UA 2AG8A 1I2CA 1FU4A 4D74A 4MLCA 4DR3B 2OA0A 5JAUA 1I2AA 2WFMA 4MUIA 4GKJB 2PSJA 1CHDA 1GFIA 2BGGA 1XELA 5J2TB 1MDFA 1Q95A 1W5TA 4IFEA 1H2ZA 2NXJA 3IFSA 3K4QA 4RXUA 1TC1A 4TTAA 4YFVA 5CLLA 3RUPA 4V24A 3HA5A 4EF6A 5AFSA 4JH0A 4BGIA 4G0UA 3U6BA 2G7MC 1IRXA 1MD9A 2JI4A 3E70C 1E0AA 1Z56C 4MWDA 3F4LA 2IVZA 3PEVA 4WX2B 2HT1A 1A7JA 5LYYA 4BN0A 5EYPB 4XB6B 5ALFA 1URPA 2RGXA 4PW0A 2EP8A 5HZMA 3HBNA 2BMFA 4Q3OA 2FVYA 2HT6A 3QUCA 2HM7A 1RM3A 1NJ6A 4JWTA 4AJ9A 3FIUA 4EB6B 3K30A 4OAOA 1HM5A 1JRLA 5DHFA 1W2HA 3OJXA 5D5PA 3NHKA 1HLGA 3ZIAA 4UUQA 1BRTA 1BFUA 2FU5C 5AH0A 1BIFA 2BGMA 3ICPA 4QNMA 1QP8A 1X80B 2GRAA 3IYLW 2QRVA 4JJIA 3ZKAA 4DCCA 4DCOA 3C3XA 5FR2A 3Q9NA 3GK3A 2IYXA 2ORVA 2WIKA 1KQNA 3CEAA 1GG5A 4K88A 4F5ZA 1QFSA 5KQRA 4JLSA 4H7HA 4EUSA 3FPBA 4X3PA 2VQ6A 1MCZA 2DPMA 1LD3A 3R7FA 4CDNA 1E6KA 2OVBA 3GZTB 1B0PA 3QV1A 4LYGA 1PCXA 5HK8A 1I01A 1P73A 2VSYA 5BW5A 3TGWA 3VGPA 1C5KA 4V0SA 4C14A 4U00A 4G1CA 2X2PA 3UWMA 4D6YA 1MFPA 1JJFA 4C7MA 2P9JA 2WNIA 1AO0A 2Y1FA 3Q72A 3OOHA 4IIXA 5K7SA 1XALA 2VXCA 3AOEC 2V3CC 2EFEB 3BCUA 4PR3A 1QIMA 1AB5A 1V35A 4ZV4A 1SUPA 5FDFA 5AKYA 3DPSA 1CLEA 4OLAA 2JFNA 4WN9B 2X42A 2Z2KA 3O9MA 3M6VA 1VHQA 4UBLA 3UT5A 4GKAA 3G7SA 3H0CA 4K9NA 3E1KA 4MIKA 1SD5A 2KW5A 3E7FA 4F38A 1Q0LA 1T8PA 2DT5A 1BWSA 1ICIA 3H1EA 5KTSA 4PX3A 3IDAA 4XVRA 5FHQA 2JIQA 4CCAA 2YV3A 3L0YA 4QSHA 4I8XA 4QUBA 1YA6A 2WWWA 4YP0A 1W4AA 1O6FA 1XMQB 2DLCX 1P33A 2Q0QA 4RTLA 5T41A 1P5HA 2C3OA 1CQIB 2OAQ1 1MVOA 3MWDA 4YN3A 2OM6A 1EG7A 2JS7A 2PT7A 4YV7A 2G25A 3GRVA 4F1KA 1RIIA 2ISSD 3P52A 4JUIA 3VV3A 3NOOA 3KVYA 1VA4A 4LNAA 2J3IA 3L7CA 4EPWA 3ENKA 3VI4B 4KQCA 1NZJA 2XQJA 4FE4A 3VU9A 2YHIA 1P4JA 1IQUA 4PSUA 1KFEB 4V1CI 3OCCA 1IB6A 5ICMA 3REOA 5JJKA 4CI9A 3BD6A 3OA2A 2V5UA 1SOAA 2UV8A 1T91A 3PKIA 4C06A 4EJFA 5B1YA 4EUEA 5C1DA 2J6IA 2BGKA 1PN3A 2QM7A 4MQEB 3AONB 1TO6A 4O4JF 3WLAA 3IUYA 3T7EA 3Q3HA 4E12A 3L9XA 2INGX 2GD1O 2Q0HA 1KY5A 4FK8A 1M2KA 2J0UB 4CNBA 2VWQA 3LX5A 4YP1A 5GIOE 4QC2A 3L1VA 3L46A 4UXIA 3H6HA 2VTEA 1EGVB 1OX6A 1PSWA 2H52A 5FWXA 1CKEA 2HB6A 1IWPB 2I66A 2QVCA 1H2WA 5D3ZA 3WVNA 3QOYA 1NBMA 4KSBA 3PHCA 1M1UA 1VHWA 2BKUA 4ZOLA 3TR6A 1G5QA 2FEXA 4H59A 3PX3A 3PFGA 4NESA 4MS1A 5EJIA 3TW0A 1FTYA 2YFHA 1D6JA 1Z08A 4DUGD 2VJMA 4GD3Q 4L8YA 1XEWY 2PGNA 1PNTA 4D6XA 1A4IA 3HP7A 1CVLA 4K6MA 4M46A 4JC4A 4QTUB 1JKXA 3BWCA 1KRWA 2PGIA 2SKEA 1NJ2A 2YINC 3VH2A 2XADA 4EKEA 3KOUA 3LP8A 4FB5A 5DKFA 4OY3A 2WWHA 2PCLA 5CVVA 2HFJA 3IVAA 3SJAA 2PUCA 4RZQA 4DSOA 5D1HA 1QLWA 2EW8A 2GVDC 2R60A 3A14A 3A9SA 3H05A 5DGTA 5E1DA 4MPDA 4QDOA 5HG0A 3RBVA 3SCZA 4BB0A 2C58A 4NCBA 4GPBA 4CG2A 2VPZA 2PFSA 3NBFA 3DPIA 4RY2A 1EWTA 4UEQA 3NVMB 2DB3A 1ZISA 1NP7A 4U9IS 3A8TA 4LJ6A 3WWZA 2F4VB 3NQ41 4HNQA 5CVDA 3QOFA 3ST7A 4HFMA 4LDZA 3H2JA 1IBKB 2B30A 1TIBA 1Z6QA 4D96A 3DOFA 2HMUA 1CFZA 4RPHA 2ZBPA 4BXOB 3G02A 3IT2A 3PIRA 3RD5A 1LC0A 1NYTA 4KLNA 1AUQA 3MOIA 2OCKA 4PGMA 4RX1A 2XOXA 1KFBB 1O96B 1WM1A 2HQRA 3HJRA 4JQYA 3RSFA 1CUDA 1RP7A 1OPXA 4YUWA 1W96A 1AK9A 4YRDA 3ZYZA 1PRYA 1WB9A 3CH7A 3U7QA 3VR6H 3DOUA 2IQIA 1GAJA 3WADA 4RMJA 2AE1A 1OAAA 4BBZA 4DKJA 5I01A 1ZRHA 4CQLA 2X7HA 2QB5A 2XV1A 3BUSA 1I5OA 5HNKA 3CLTC 4Q3AA 3HP4A 3VVBA 4MRPA 4BO0A 2SKCA 1Y5MA 1Y1QA 3AETA 3QE0A 5LR6A 3UAXA 3DBVO 5KX5A 4BKOA 5JFOA 3MFQA 3T99A 3EODA 2R8ZA 3O93A 4X1OA 3STUA 1OYYA 4BVLA 5KYTA 1OXMA 2GLXA 3KKMA 2ZYDA 3L4BC 1V8PA 4TTSA 1SUBA 2FQXA 2V4UA 4CIDA 3MJCA 4CIVA 4M4SA 4FJ1A 4FUQA 4X1KB 1A5BB 5EJ8A 2FSIA 2XUDA 1TAHA 1ISFA 4O4IF 5BN5A 1BKSB 2ZIGA 4FR2A 2EJCA 1VJCA 2P9HA 3BMQB 3EVGA 2H3EA 3C6BA 3LGXA 1WHSA 1DHTA 3A6GA 1PP4A 3CKYA 1OWNA 3PD0A 4EHLA 5LQKA 3BIWA 4NNPA 2GDJA 3HDTA 3P9YA 3S81A 2BOVA 4L4SA 4EDHA 5JYDA 1T1EA 1MXFA 2QG4A 3Q7RA 4KDEA 3T3IA 2VA8A 2B2CA 4BUJA 1KJZA 1OREA 1ZJYA 2CDRA 3U40A 1F6DA 3N8IA 4N5DA 3ISTA 3O91A 3ZWVA 5JAMA 3BZBA 3BTUA 3NNNA 4ETNA 1E2GA 4C4AA 2REQB 2Q9UA 4XUGB 3RABA 4BNDA 3T1HB 3HXPA 3NEYA 4RELA 2F00A 2HK6A 2H0RA 1HKUA 1KS9A 1ZIOA 4TS3A 5D86A 1PGJA 3VJLA 1YKSA 1MENA 3BDAA 3RRXA 1UKAA 2G9QA 2OZPA 3DMHA 4GF5A 2VBGA 4LV5B 5KVCA 1HY3A 2N1BA 1TJ4A 3NWJA 2Z2XA 4NAHA 1II8B 3K0CC 5ECDA 5U4QA 4EG5A 4B17A 4JDPA 4DVJA 3AIIA 4Q3NA 3ZQUA 2Z04A 4QT4A 3EXEA 4AY4A 3GEBA 1YE8A 3P2KA 4DA6A 1YB7A 3WL6A 2FWIA 4KR7A 1XLUA 2PWBA 3OUTA 1BCSB 4REOA 1JIJA 2PXAA 1O77A 4H18A 1HNNA 2ZBVA 4KWTA 4Z9YA 4CU5A 4OX9Y 2EZTA 3NGLA 2IS4A 5F5NA 4MS3A 4UE3S 1NIPA 3DP7A 3K8YA 1QNLA 2I4LA 2WJZB 3DCYA 4PYQA 1KH2A 4UNSA 1CEQA 1F2TA 4FLMA 1Z63A 3ADOA 5EXSA 3VZQA 2WM3A 5IC4A 2EBFX 3IUNA 5KREA 2ZT5A 4NBNA 1SVKA 2DR2A 4JLAA 2I7DA 4OQLA 3EDOA 3PUIA 4R9VA 4X63A 1N0UA 1NVBA 1YZKA 1P4RA 3A6ZA 1K7CA 1Y1KE 3OZSA 4UCFA 4ZC8A 2HO5A 4MGHA 2Y1KA 1QP7A 3DE4X 5E4FA 4DR6B 1Z4LA 1JMKC 4P36A 1SURA 5FWDA 1D1TA 2IU4A 3B6IA 4L9SA 4DNXA 2CDCA 3WDKA 1D6NA 3QEJA 3DR5A 3MUNA 1Z2NX 4PZCA 1AF7A 2QAJA 4H7DA 5FBLB 1KK3A 5C5CA 1LBQA 1HEIA 3F4KA 4QYIB 1MAWA 1GA4A 1MO3A 1JTFA 1K98A 1QAMA 4OKNA 1MJGA 4JLDA 4DBLE 1DADA 1WBDA 4H6XA 4IQGA 1Q0HA 1LSJA 3OJLA 3M7IA 2ZBGA 3V1LA 4XIGS 1YIOA 3C98A 3R9KA 2WJWA 1J56A 4DLYA 5JWOA 4GUDA 2Q50A 4IIJB 2VAXA 4IF4A 4O59O 4D9CA 4E31A 4EEKA 2WINI 4BV9A 1ADJA 3WKDA 2Z2IA 1HYHA 2WSMA 5DI9A 4OYRA 1ZMRA 4DM3A 3X43A 1YS9A 3IQHX 1NSFA 4ZJUA 3IBGA 3L92A 3M2PA 4RGBA 2E82A 3ZCVA 2I80A 3G88A 4CMBA 2ZTMA 1WPQA 3GPLA 1KE1A 5KHOC 2QTVB 2V4MA 4DGSA 5KVSA 3UPDA 2VZLA 4IX9A 1CY8A 2PZEA 4YRCA 3CX6A 3IE1A 1NQTA 4OQZA 4X5OA 4UTZA 8GPBA 1QQ5A 2IE8A 3FB1A 2FRDA 3RANA 2NO5A 3ULKA 3LX4A 1MZVA 4IHJB 4OXRA 4UDNA 2WTBA 1T25A 5H7XA 3S7TA 3FUVA 4E0BA 5C5EA 1RJGA 2HK7A 2HRRA 4KR9A 1ZJWA 3QIAA 5IZ4A 3OUZA 2EW2A 3NONA 4M0KA 3CW2A 2CBGA 4LDPA 2DUJA 4TYQA 1FYEA 4I9GA 4AJ4A 3T3NA 4ARAA 3KB1A 4LY6A 4GBJA 1O9HA 4PZZA 3E4DA 1LUAA 4H4EA 3T35A 1HQCA 4EEXA 3JTMA 2GD0A 2EVWX 3IXLA 2ZLBA 5KUTA 4UTOA 3D8BA 3CUTA 5H68A 3AKYA 4RHXA 1OBFO 3D31A 3EA4A 4J16A 2ZTUA 4KG7A 3TJRA 4F06A 4Q3BA 3UAYA 2BMDA 3KB8A 3LSTA 5JZ9A 4U2FA 3W2EA 1Q5PA 5TT1A 1I3LA 5AW9A 3EWAA 5E6RB 5JZSA 4RADA 1KIMA 2DYKA 5KJEA 3A6HA 4B44A 4CN8A 4OB6A 1K2WA 4GLLA 4GGOA 4IZ6A 3GIDA 1UBOS 5U1PA 4QDUA 3U81A 3ZJYA 4P2GA 3CVWA 3V7WA 3SGLA 3ABRB 3C39A 4KITB 5DLDA 5LA6F 3GCGA 4X91A 3X3HA 2RGCA 1SFRA 5B5SA 1TQ2A 4OU5A 4O4JB 3WK4A 3W5DA 1JG3A 1IVNA 3FFWA 3MCZA 4WEOA 5DLPA 3SYTA 3UJNA 2F9LA 3L3BA 2CF5A 2BEKA 2IYNA 2GN0A 2JBHA 1BQ4A 3FSGA 1WF6A 3FVQA 3OAAA 4DCJA 1QX3A 1FP4A 4WKCA 1KZYC 3UT6A 1EUDA 2COKA 3EIOA 2WE7A 3GRKA 2RHCA 2Z58A 2QGZA 4HWPA 5KSPA 1IAQA 5BOSA 5CA0F 2ONCA 3ZCTA 1E1NA 4EHAA 4ZFNA 2P6NA 5CG2A 1E0KA 1FU8A 1N25A 2V8OA 1FTGA 3C5WP 3O8DA 5D00A 4QYMA 5EVJA 3BJZA 3KLNA 2PN1A 5HFNA 3HCAA 3IKVA 4IVQA 3JQ7A 5A3JA 2ZZMA 1BN7A 2C2MA 1QRTA 2G77B 2IVFA 4W99A 3N0VA 2FNAA 3G79A 2G07A 1Z28A 3HRHA 3IUPA 5BOVA 4BVJA 4D9EA 1G41A 4HEA6 4B3IA 1AV7A 3ITDA 2IDKA 4F97A 4RPKA 3UANA 2GAAA 5CR9A 3VR3D 1Y1RA 3OZBA 1E9DA 3GH3A 1G7TA 1AZTA 1RYDA 2ENWA 2KYRA 1UBHS 4MGEA 1SHKA 4PX5A 3TLJA 4TVSA 5IHPA 1YE5A 3U09A 3SK0A 1M6YA 1X94A 1K8RA 3HY6A 4FOPA 4IICA 3ZLBA 4PLHA 1CF9A 1FRQA 1AHHA 1KC1A 4JSTA 4OA5A 4DIBA 1FX0A 1W8DA 3OIVA 3A4LA 1O8CA 3GJ5A 2JBAB 1RAEA 2OGSA 3TW4A 1QQ7A 1Y5NA 5CIQA 1QHXA 3VC1A 2EGUA 1SY7A 3KHKA 4MWSA 4ZTBA 3T4PA 3ZBPA 1VYVA 3ZXIA 3WLOA 2OBBA 2LZ0A 1MJHA 2QS9A 2OFFA 1OZHA 1LFAA 5BWMA 2EAUA 2RAPA 3L7KA 1F06A 4KAJA 4ALJA 3UK7A 1I13A 1QC5B 2CGEA 2YNMC 2IS1A 2F7SA 3KSRA 4MKGA 1UXJA 2DQZA 4JAVC 5ITSA 2IW3A 2A3RA 2C2ZA 4FLEA 4P08A 4YALA 1N5IA 1I4OA 3NHYA 6Q21A 2E21A 2UDPA 1YR2A 4HQOA 3QNWA 2FE4A 3DTYA 4FFNA 3VR2D 3D1VA 2G1AA 4DF3A 3SKYA 4IEIA 1P3JA 2ZREA 5DTMA 4QOEA 4LK3A 2YTZA 3VSDA 4EMBA 4BMCA 3THWB 4CM8B 3A2KA 4OYYA 4DVGA 4KTTE 5TS2A 4G01B 3PUWA 2Y66A 3A4NA 4ECEA 1QCYA 1K8YB 2WKSA 3DV2A 4Y6QA 4UVDA 1RLIA 4ZJYA 3KWFA 1IBMB 1YDFA 1U28C 2R00A 2QBYA 2PUDA 2AT1A 4MI1A 2X13A 2YFKA 2ZU6A 5A4JA 1DXOA 1ZITA 5ICGA 2QTGA 2M6SA 3O4IA 3WP0A 3KVOA 4MV6A 1IZ8A 4PC3A 1V96A 3WGNA 4F2PA 3VH4A 3LS2A 1QNFA 1XFAA 2C0CA 1GP2A 2JFFA 3IP1A 1TK2A 1FFWA 5C37A 3G2NA 2O5RA 5DNVA 4MW4A 3IMGA 3VISA 3M49A 4ZCIA 4HFJA 4PNEA 2WWXA 5I4IA 4KXLA 4EHBA 3NIGB 4HXGA 4PZDA 1J9GA 1E3DA 2QAGB 4GVPA 4C0AC 4ER7A 1ULSA 5AUOB 2ZITA 4NDAA 1U3UA 3CSDA 1JFTA 1DOZA 1X39A 3COSA 3DMTC 2SCUA 3G2IA 4L2IB 2M6LA 1E20A 1LRKA 3R0JA 2NPIA 4FXPA 4TTVA 1HOXA 2F64A 1SCJA 1FX0B 3GWGA 3L8MA 1SQFA 1IWBB 3TZBA 1ADYA 3NDIA 3FVVA 1F8YA 1W9HA 4LCJA 3R7BA 1JFVA 4G1UC 4N7MA 2JVJA 1LQUA 1Q11A 2RHOA 3QYPA 4O4HF 3ECCA 5K01A 4P1ZA 4DJ5X 1UDAA 3HKBA 4LCEA 2AJLI 2NQ2C 2RGGA 1HSZA 1KEVA 3WWCA 2WD7B 2VDMB 5KHAA 2ENUA 1HYEA 3PHLA 4IDHA 1NJSA 1AOXA 3GNTA 4WV3A 5CT8A 1KK1A 5LIPA 4WGFA 3OWOA 3TQFA 1ONSA 3PF9A 2GPAA 3GFSA 3JRWA 4AJLA 4R7ZA 4CG1A 2VS1A 1LSSA 3B12A 3H5NA 4IUBS 5DNAA 1TCVA 3CW9A 1G0NA 1Z0UA 2WJ3A 1GQOA 2IYUA 4HYYA 4IO0A 3W34A 5A3QA 2GTHA 4EMSA 5EIXA 2HYIC 1V26A 3WHIA 3T9EA 1ZWLA 5AHOA 3EZ6A 5CT4A 2BP7A 2PRSA 1Z4QA 3B7PA 3DV9A 1PDVA 4FSXA 5B6IA 4X84A 4BEJA 2BGIA 4Z4FA 4R05A 2EBHX 2QZSA 4YCCA 2ZTLA 3RFVA 4ZCSA 3ERCA 4L76A 3E6AA 1B41A 4QTXA 5TMBA 4DPKA 3Q2KA 1E5LA 2EG5A 4AMUA 2FZVA 4HDSB 4NMHA 1KVSA 3R3SA 1MB2A 1W93A 2H6EA 4QUEA 2WG2A 1ZUIA 2HA7A 3FYHA 2YRXA 1XC7A 3AZQA 2CMFA 3F9IA 3R4CA 1KU0A 4I1VA 4YJ2F 5LBUA 3RNOA 5JECA 5EA2A 1CQJA 2J0VA 3ROZA 4EAAA 3K9WA 3D7NA 3D6MA 3NGMA 1U7ZA 5TEVA 4AG6A 1FJ2A 5BY2A 5L51A 2W70A 3LXMA 4LGYA 1U8FO 4U8HA 3C1AA 1GGJA 1RLJA 1ZUNA 4D0GA 2OD2A 1PR4A 4MRRA 4KO8A 2JFWA 4M7RA 2QUKA 2RARA 2R7KA 3LQ1A 1NBHA 3PGMA 1PTJA 4JENA 3T61A 2CMDA 5FADA 1WNTA 1A2OA 3C97A 5J4VA 2WIDA 1UKBA 4F9EA 4CR8A 4BJHB 3W3AD 4KVAA 5AVYA 3NBXX 2HV9A 4XGRA 1J22A 3ONDA 2HWYA 1WY7A 4OK5A 3TFWA 3G2QA 1RJ9A 4OJYA 1A7KA 3MGBA 1K3FA 2VQ3A 1TEVA 2G09A 1MX1A 3C8UA 3WQSB 3OLZA 4XD7A 1D6MA 1DMSA 2JZCA 3W3AH 1VL6A 2NGRA 1WPRA 4F4CA 2P27A 2HQOA 4Q15A 1QO0A 2RGNA 1Q77A 1GPWB 2VYQA 1ZPDA 4RORA 5E1BA 3SM9A 2ZI7A 5D3MB 1E61A 2QAIA 2Z6AA 1NSTA 1P2VA 4LXUA 1ESDA 2WF9A 1RBZA 3JARA 4GG1A 5CX1B 1DC6A 3HDHA 4D8XA 1GQQA 2J33A 1NTRA 4YA6A 4GX2A 4IIUA 4GPZA 4YRGA 1G8SA 1D5WA 1R74A 3AWIA 5TSDA 4IUCS 3RG2A 3ZY6A 3UKOA 1JTEA 1IB0A 4B7UA 4QPZA 2B4KA 4E5NA 5E1OA 1CR2A 1QHNA 2Y99A 1WVGA 4LSMA 3CLSC 5CLHA 5G1NA 3NTOA 1B3RA 2DQKA 3DTNA 2KS6A 4NYMQ 4NNJA 4TRJA 2M6KA 1N5OX 4R5HA 3AEYA 3TQTA 3W7AA 4L74A 2RJOA 3PP8A 1D2CA 5KZMB 5BT9A 3RADC 3KALA 4FFLA 1GAXA 1MOPA 3DMFA 4WLNA 1Q14A 4TTJA 5JYCA 1L3IA 4KKVA 4R0NA 4FS8A 2R751 4HEHA 5EY5B 2Z8XA 1A5AB 2DR3A 1YD7A 1Z0SA 4D6PA 1T8RA 4OUKX 2PG3A 2ZJ3A 3EWIA 3ZZNA 5K3EA 4MWBA 1LQ2A 4MI9A 2AJBA 3IRUA 3R0ZA 2DU8A 4LX0A 4II7A 4HK4A 3EHDA 4CW7A 1P0QA 1UMBA 3QKUA 4RV4A 2Y05A 1VLZA 4MQEA 3R8XA 1H2YA 1JDZA 4TN1A 4ZCPA 2XLCA 3L4KA 5LDGA 2P69A 1W8IA 1G5HA 1ZJJA 2A7QA 2VWHA 2WYOA 1ORHA 4GO1A 4CMEC 1HSOA 1FNSA 1QHIA 4GECA 2FOIA 1OT5A 1IOLA 4NYJQ 4WZ6A 4XI9A 3ZUPA 4B79A 1AKRA 1U0RA 3KQQA 3QMMA 5J2TA 2EJTA 2FSSA 3PQ5A 4BNFA 1KQOA 3MWYW 5L95A 4EYSA 2C3PA 4WZBE 5IVHA 2GM4A 4G0WA 4XYEA 4JL5A 3P1JA 4QOJA 1X7XB 5K9ZA 1OC4A 2GYWA 2OAP1 1HETA 4I9UA 5AJXA 5DP1A 1GRVA 1FUEA 2YRWA 2EL9A 2G6BA 3DMYA 1Y7HA 3BWEA 3KUCA 4JL8A 4OYLA 1F0KA 1WXEA 4CCWA 1Q22A 1Q1QA 3FYCA 2VTDA 4WXMA 5EYPA 4WIAA 3E7PA 2ADOA 2Z56A 5CLJA 4MVJM 4UUAA 2WYHA 4QJ5A 1GRRA 4L02A 3JWJA 2XNCA 3W5BA 2HLNA 3OQMA 2YKGA 1H8HA 3HZRA 3I5XA 4IDEA 4XRRA 2I78A 3A1CA 2DECA 2D1RA 4L8LA 5FTLA 2F4NA 3K2QA 1FTWA 1H8EA 2FRVA 3DKKA 2VO1A 5T64A 3UK0A 3ZV7A 3EQ6A 1C30B 4N6NA 3RQIA 4BMYA 2WYUA 4FFRA 3OG9A 1EFDN 1U2DC 2YS7A 1YR1A 3WYCA 1LS1A 1XDUA 3TB6A 4HVCA 4PYMA 1RWVA 1MX5A 2VDQB 1SCQA 4UHHA 1T13A 2ZBRA 1H66A 3F6RA 1W6UA 1OX4B 2X1LA 4L4XA 2HLPA 2BHRA 5FEUA 3PQ6A 3PXAA 3UAVA 4AYXA 1T5TA 4HAUA 4BQSA 3DE0X 4BEBA 1DAMA 2VZ8A 2WLTA 5B7NA 4LWOA 3AVQA 3FOBA 5AI9A 5IAJA 1W5BA 4G5FA 1G8AA 4PG8A 2Q3MA 3FMFA 4M9QA 1U0OC 2IE0A 2DHQA 1NXSA 5CFPA 3O92A 1XZFA 4RD4A 4RNDB 2H3HA 3JYPA 1JUDA 4B6SA 3ZV6A 5JBNA 2C9OA 3LL4A 3ILHA 4DCMA 3WKEA 2CYCA 3BB1A 1T4CA 2GEUA 2WA1A 4KGVA 3EAGA 2H1CA 3D4IA 3BH7A 2ZG6A 5L4NA 4XH9B 4XAQA 2CLKB 4K2AA 4ECAA 3RRNA 2FXIA 1A8PA 3D43A 2QDKA 1PTJC 3ETHA 4Z53A 1V4BA 1EVZA 3PCRB 4EY8A 2GPJA 3SVLA 1MB9A 3CF4G 2GPYA 1T1GA 5I6DA 1YZUA 3EGOA 1NF3A 3BG5A 4H6PA 1PEKE 1THGA 3DFZA 3VSBA 5JZOA 4BO3A 4FI3F 5JASA 4D0NA 3ZW9A 1YE3A 5JLJA 3R1IA 1KXJA 2I7XA 3BGDA 1C50A 1YUNA 4FZ5A 2D59A 4YIKA 4K5QA 5H82A 1Q6ZA 2HKIA 1VHTA 1XVVA 3WBBA 4IMIB 1IXYA 4YP5A 3I28A 3WL4A 2Y1GA 4EG4A 3DV0B 1HMYA 1GG9A 4KUHA 3DE1X 9ATCA 3LKZA 1P62B 2EFHB 4A6EA 4RTPA 2H1SA 1IIBA 4G8JA 1IQ0A 2VZEA 2QN3A 3OLYA 3CF4A 2I76A 3PSHA 2D0DA 5DYNA 1YQUA 3O26A 2C94A 3F7MA 3FTPA 2NWQA 1SIUA 4AJJA 3VHRA 4S04A 1N78A 5IMSA 1S2NA 2K4MA 1U0HC 5A4FS 2Y92A 4HB4A 1TEZA 2BKAA 2HCTA 3EZFA 5A9SB 4H4DA 1IG3A 2CBXA 2FSGA 4RABA 3LA6A 3VOBA 3W9UA 1UJBA 2XVZA 3QNUA 3VPXA 3I01A 1IUOA 1NFRA 1SK8A 2AVNA 4OQYA 4OSEA 3WMGA 3PEYA 2QJTA 4MQFB 1N2ZA 2I71A 5C80A 5IJ9A 2D2XA 1C7JA 2UVPB 4Z9BA 3U3ZA 3LO8A 4ISBA 2D62A 2J9FB 3V8VA 1KETA 1TK9A 4MS1B 3MEQA 1UBTS 1T4CB 2AFHE 3E9CA 1BFDA 3ZI7A 3RAEC 2WJ6A 4UZFA 2XUZA 3KSUA 3WIBA 3L8GA 4DIOA 1D1QA 1H2BA 1RKUA 1ZSNA 4M38A 5G1OA 5JWHA 5KNCD 2YOHA 1HZZA 4EKNB 3OTIA 1XD9A 4Q6BA 4EZBA 3GN1A 2VAWA 3RRFA 2C96A 3HKEB 4MEAA 1R4NA 2AE2A 2OR3A 3I30X 5E0KB 4Z0HO 1CUEA 4NEQA 5J4HA 3GQBB 3SICE 1J0DA 1KKMA 2ZE7A 4TLDA 1M5UA 3ELUA 1R9MA 1SXJE 3LLMA 2P7HA