3QHWB

Structure of a pcdk2/cyclina transition-state mimic
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
261
structure length
261
Chain Sequence
b'SNEVPDYQEDIHTYLREMEVKCKPKVGYMKRQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAPTVNQFLTQYFLHLQPANCKVESLAMFLGELSLIDADPYLKYLPSLIAGAAFHLALYTVTGQSWPESLAQQTGYTLESLKPCLVDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPETLSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein kinase 2
publication title Briefly Bound to Activate: Transient Binding of a Second Catalytic Magnesium Activates the Structure and Dynamics of CDK2 Kinase for Catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/protein binding
total genus 98
structure length 261
sequence length 261
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3qhwB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3qhwB02
2IW8B 2C5XB 1VINA 1URCB 2F2CA 4CRLB 3LQ5B 1JKWA 2X1NB 3K7AM 4EONB 2WPAB 5HBHB 2PMIB 4BCFB 4EC8B 4IMYB 1GY3B 4F6SB 1AD6A 1OL1B 4FX3B 1GUXB 1OIUB 2W2HA 4F7SB 4CFXB 4EOIB 1P5EB 1H1RB 2I53A 1JSUB 1E9HB 3BHVB 2UZBB 2WIHB 2WMBB 4BCQD 2C5VB 2CCIB 5FGKB 2JGZB 4G6LB 2CJMB 4ROEA 3TNIB 4CFUD 4II5B 3TN8B 2WXVB 4EOOB 3POMA 1OL2B 4EORB 3BHUB 4OGRB 5HVYB 1D3UB 1JOWA 1G3NC 2C6TB 4TTHA 4BCMB 1H1PB 4YOZA 3EOCB 1JSTB 2CCHB 5LMKB 4I3ZB 1PKDB 4BCIB 4EOPB 4EOMB 4YOOA 1O9KB 1H26B 2WMAB 2PHGA 5IDPB 2UZLB 3BHTB 3O0GD 4KRDB 4BCOB 2IW9B 3BLQB 5HBJB 3EJ1B 4F6WB 5IF1B 1H4LD 4EOQB 2UZEB 2B9RA 5HBEB 1QMZB 1OKWB 5IDNB 2WHBB 1FVVB 2I40B 3DDQB 2W96A 3EIDB 2IW6B 4BCND 4EOSB 3QHRB 4CFMB 2C4GB 3BLHB 4EOKB 4CFUB 3QHWB 3BLRB 1KXUA 5L2WB 3MY5B 4OR5B 4YC3B 2EUFA 2R7GA 2BKZB 4UN0A 2WEVB 4YOSA 2C5NB 5I5ZB 4F7JB 1H25B 1OGUB 1BU2A 4KRCB 4ELJA 2G9XB 1ZP2A 1H28B 3MY1B 3RGFB 1GUXA 3H4CA 5HQ0B 2UZDB 3F5XB 3TNWB 5EFQB 1OKVB 5ACBA 2IVXA 4RODA 1OIYB 4ROCA 1C9BA 1VOLA 4EC9B 4ELLA 1H27B 1XO2A 1UNHD 2V22B 5ICPB 1OI9B 4BCPB 4BCQB 5BNJB 4CFVB 4BCHB 1N4MA 4BCNB 5CYIB 1W98B 4NSTB 2W9ZA 3M03A 4BCGB 2W9FA 1UNGD 4F7NB 2QDJA 3MI9B 2WFYB 2C5OB 2PK9B 1O9KA 3TNHB 4CXAB 4CFNB 1TFBA 1F5QB 3DDPB 3DOGB 4Y72B 5HNBB 4EOJB 5CEIB 1UNLD 4F70B 4F6UB 1H1SB 2WIPB 2W99A 1AISB 1H24B 2BPMB 1VYWB 3G33B 3MIAB 1H1QB 4F7LB 1FINB 4BCJB 1GH6B 2PK2A 4EOLB 4BCMD 2UUEB 4BCKB 4CFWB 5LQFB
chains in the Genus database with same CATH superfamily
2IW8B 2C5XB 1VINA 4JX5A 4CRLB 3LQ5B 3QZ9B 5HBHB 3PO3S 2PMIB 4BCFB 4EC8B 4IMYB 1AD6A 2W2HA 4EOIB 1P5EB 2I53A 2BS2A 3VYGB 4AI6A 3A8HB 3DL1A 4OB1B 3POMA 1D3UB 3A8LB 4BCMB 2DD5B 1H1PB 4I3ZB 2CZ0B 4YOOA 2ZPEB 3O0GD 2IW9B 5HBJB 4M6VA 4F6WB 2CZ1B 4AKIA 2ZPFB 5HBEB 1ENWA 3KHIA 1OKWB 2I40B 2QF7A 3BLHB 4EOKB 4CFUB 2R7GA 2WEVB 2C5NB 4ELJA 2G9XB 3MY1B 1TD6A 3WVDB 3TNWB 5EFQB 2LW4A 3DJBA 2WJ9A 1OI9B 4AKGA 4CFVB 1N4MA 2DPPB 2QDJA 3DTOA 4CXAB 4CFNB 1TFBA 5HNBB 4EOJB 3BG9A 4ZGJB 1UNLD 4F70B 1H1SB 2WIPB 4MFEA 1H24B 4F7LB 4BCMD 2UUEB 4CFWB 3QYGB 1JKWA 2ZPIB 4EONB 4FX3B 1OIUB 1FKMA 4F7SB 4CFXB 1H1RB 3QYEA 1JSUB 5DQWA 2WIHB 2WMBB 2KR6A 2CCIB 5FGKB 4G6LB 1UGPB 4CFUD 1OL2B 4EORB 1G3NC 3X28B 4TTHA 4YOZA 3EOCB 5EJCA 1JSTB 1PKDB 3HB9A 1H26B 2WMAB 2UZLB 4BCOB 2DD4B 3EJ1B 1H4LD 2B9RA 3TW7A 4EOSB 3X26B 3QHWB 1KXUA 3MY5B 4OR5B 4YC3B 4FM4B 4YOSA 5I5ZB 2AHJB 4F7JB 1OGUB 1ZP2A 1IREB 3H4CA 5IHYA 1AHJB 5ACBA 2IVXA 4RODA 1VOLA 4ELLA 2CZ6B 3B57A 5BNJB 4BCHB 2DXCB 4Z6YA 4NSTB 3A8GB 3M03A 4BCGB 2W9FA 1UNGD 2C5OB 1UGSB 3DDPB 3BG3A 4LOCA 4F6UB 3X25B 1VYWB 3A8MB 2ZZDB 1GH6B 4JX6A 4EOLB 2ZPBB 1URCB 2F2CA 2X1NB 2G77A 2WPAB 2QDYB 1OL1B 1GUXB 3QZ5B 1E9HB 3BHVB 4BCQD 2C5VB 2JGZB 4HLQA 2CJMB 3TNIB 4EOOB 4II5B 3TN8B 3VYHB 4OGRB 2PJQA 2ZPHB 2C6TB 3WVEB 4BXXX 3HZJA 4EOPB 1O9KB 5IDPB 4KRDB 3BLQB 5IF1B 2UZEB 3GTMS 4BCKB 5LQFB 2WHBB 1FVVB 2W96A 3X24B 3QHRB 2CYZB 3BLRB 2BKZB 3BG5A 2UZDB 4MFDA 3F5XB 3QWLA 1OKVB 1C9BA 1H27B 2V22B 1UNHD 3QYHB 4BCPB 4BCQB 4OB2B 4AKHA 2BS3A 4BCNB 1W98B 1V29B 4JX4A 2CZ7B 4ZGDB 2PK9B 2DMEA 3DOGB 5CEIB 1AISB 3G33B 3HBLA 4BY1X 4OB3B 1E7PA 4HL4A 2IN3A 2QFZA 3VKHA 2QQ8A 3HHTB 3K7AM 1QLBA 1GY3B 4F6SB 2DXBB 2UZBB 2QGSA 3X20B 4BBRM 4ROEA 2WXVB 2D0QB 3BHUB 5HVYB 1JOWA 2CCHB 5LMKB 3QXEB 4BCIB 3QYBA 2PHGA 3HO8A 3BHTB 4BBSM 4EOQB 2BS4A 1QMZB 5IDNB 3DDQB 3A8OB 4BCND 3EIDB 2IW6B 5DQVA 4CFMB 2C4GB 4BY7X 5L2WB 2EUFA 4UN0A 2KMGA 3NDQA 1H25B 1BU2A 4KRCB 1H28B 3RGFB 1GUXA 5HQ0B 4OB0B 1OIYB 4HNUA 4EC9B 4QSHA 1XO2A 4HNTA 5ICPB 4MIMA 5CYIB 2W9ZA 4NC6A 4F7NB 3VKGA 3MI9B 2WFYB 3TW6A 1O9KA 3TNHB 1UGRB 1F5QB 4HNVA 4Y72B 2ZCFB 1UGQB 4ZGEB 2W99A 2BPMB 3MIAB 1H1QB 1FINB 4BCJB 2PK2A 2ZPGB 4ROCA 4EOMB
chains in the Genus database with same CATH topology
2IW8B 2C5XB 1VINA 1URCB 2F2CA 4CRLB 3LQ5B 1JKWA 2X1NB 3K7AM 4EONB 2WPAB 5HBHB 2PMIB 4BCFB 4EC8B 4IMYB 1GY3B 4F6SB 1AD6A 1OL1B 4FX3B 1GUXB 1OIUB 2W2HA 4F7SB 4CFXB 4EOIB 1P5EB 1H1RB 2I53A 1JSUB 1E9HB 3BHVB 2UZBB 2WIHB 2WMBB 4BCQD 2C5VB 2CCIB 5FGKB 2JGZB 4G6LB 2CJMB 4ROEA 3TNIB 4CFUD 4II5B 3TN8B 2WXVB 4EOOB 3POMA 1OL2B 4EORB 3BHUB 4OGRB 5HVYB 1D3UB 1JOWA 1G3NC 2C6TB 4TTHA 4BCMB 1H1PB 4YOZA 3EOCB 1JSTB 2CCHB 5LMKB 4I3ZB 1PKDB 4BCIB 4EOPB 4EOMB 4YOOA 1O9KB 1H26B 2WMAB 2PHGA 5IDPB 2UZLB 3BHTB 3O0GD 4KRDB 4BCOB 2IW9B 3BLQB 5HBJB 3EJ1B 4F6WB 5IF1B 1H4LD 4EOQB 2UZEB 2B9RA 5HBEB 1QMZB 1OKWB 5IDNB 2WHBB 1FVVB 2I40B 3DDQB 2W96A 3EIDB 2IW6B 4BCND 4EOSB 3QHRB 4CFMB 2C4GB 3BLHB 4EOKB 4CFUB 3QHWB 3BLRB 1KXUA 5L2WB 3MY5B 4OR5B 4YC3B 2EUFA 2R7GA 2BKZB 4UN0A 2WEVB 4YOSA 2C5NB 5I5ZB 4F7JB 1H25B 1OGUB 1BU2A 4KRCB 4ELJA 2G9XB 1ZP2A 1H28B 3MY1B 3RGFB 1GUXA 3H4CA 5HQ0B 2UZDB 3F5XB 3TNWB 5EFQB 1OKVB 5ACBA 2IVXA 4RODA 1OIYB 4ROCA 1C9BA 1VOLA 4EC9B 4ELLA 1H27B 1XO2A 1UNHD 2V22B 5ICPB 1OI9B 4BCPB 4BCQB 5BNJB 4CFVB 4BCHB 1N4MA 4BCNB 5CYIB 1W98B 4NSTB 2W9ZA 3M03A 4BCGB 2W9FA 1UNGD 4F7NB 2QDJA 3MI9B 2WFYB 2C5OB 2PK9B 1O9KA 3TNHB 4CXAB 4CFNB 1TFBA 1F5QB 3DDPB 3DOGB 4Y72B 5HNBB 4EOJB 5CEIB 1UNLD 4F70B 4F6UB 1H1SB 2WIPB 2W99A 1AISB 1H24B 2BPMB 1VYWB 3G33B 3MIAB 1H1QB 4F7LB 1FINB 4BCJB 1GH6B 2PK2A 4EOLB 4BCMD 2UUEB 4BCKB 4CFWB 5LQFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IW8 B;  2C5X B;  1VIN A;  1URC B;  2F2C A;  4CRL B;  3LQ5 B;  1JKW A;  2X1N B;  3K7A M;  4EON B;  2WPA B;  5HBH B;  2PMI B;  4BCF B;  4EC8 B;  4IMY B;  1GY3 B;  4F6S B;  1AD6 A;  1OL1 B;  4FX3 B;  1GUX B;  1OIU B;  2W2H A;  4F7S B;  4CFX B;  4EOI B;  1P5E B;  1H1R B;  2I53 A;  1JSU B;  1E9H B;  3BHV B;  2UZB B;  2WIH B;  2WMB B;  4BCQ D;  2C5V B;  2CCI B;  5FGK B;  2JGZ B;  4G6L B;  2CJM B;  4ROE A;  3TNI B;  4CFU D;  4II5 B;  3TN8 B;  2WXV B;  4EOO B;  3POM A;  1OL2 B;  4EOR B;  3BHU B;  4OGR B;  5HVY B;  1D3U B;  1JOW A;  1G3N C;  2C6T B;  4TTH A;  4BCM B;  1H1P B;  4YOZ A;  3EOC B;  1JST B;  2CCH B;  5LMK B;  4I3Z B;  1PKD B;  4BCI B;  4EOP B;  4EOM B;  4YOO A;  1O9K B;  1H26 B;  2WMA B;  2PHG A;  5IDP B;  2UZL B;  3BHT B;  3O0G D;  4KRD B;  4BCO B;  2IW9 B;  3BLQ B;  5HBJ B;  3EJ1 B;  4F6W B;  5IF1 B;  1H4L D;  4EOQ B;  2UZE B;  2B9R A;  5HBE B;  1QMZ B;  1OKW B;  5IDN B;  2WHB B;  1FVV B;  2I40 B;  3DDQ B;  2W96 A;  3EID B;  2IW6 B;  4BCN D;  4EOS B;  3QHR B;  4CFM B;  2C4G B;  3BLH B;  4EOK B;  4CFU B;  3QHW B;  3BLR B;  1KXU A;  5L2W B;  3MY5 B;  4OR5 B;  4YC3 B;  2EUF A;  2R7G A;  2BKZ B;  4UN0 A;  2WEV B;  4YOS A;  2C5N B;  5I5Z B;  4F7J B;  1H25 B;  1OGU B;  1BU2 A;  4KRC B;  4ELJ A;  2G9X B;  1ZP2 A;  1H28 B;  3MY1 B;  3RGF B;  1GUX A;  3H4C A;  5HQ0 B;  2UZD B;  3F5X B;  3TNW B;  5EFQ B;  1OKV B;  5ACB A;  2IVX A;  4ROD A;  1OIY B;  4ROC A;  1C9B A;  1VOL A;  4EC9 B;  4ELL A;  1H27 B;  1XO2 A;  1UNH D;  2V22 B;  5ICP B;  1OI9 B;  4BCP B;  4BCQ B;  5BNJ B;  4CFV B;  4BCH B;  1N4M A;  4BCN B;  5CYI B;  1W98 B;  4NST B;  2W9Z A;  3M03 A;  4BCG B;  2W9F A;  1UNG D;  4F7N B;  2QDJ A;  3MI9 B;  2WFY B;  2C5O B;  2PK9 B;  1O9K A;  3TNH B;  4CXA B;  4CFN B;  1TFB A;  1F5Q B;  3DDP B;  3DOG B;  4Y72 B;  5HNB B;  4EOJ B;  5CEI B;  1UNL D;  4F70 B;  4F6U B;  1H1S B;  2WIP B;  2W99 A;  1AIS B;  1H24 B;  2BPM B;  1VYW B;  3G33 B;  3MIA B;  1H1Q B;  4F7L B;  1FIN B;  4BCJ B;  1GH6 B;  2PK2 A;  4EOL B;  4BCM D;  2UUE B;  4BCK B;  4CFW B;  5LQF B; 
#chains in the Genus database with same CATH topology
 2IW8 B;  2C5X B;  1VIN A;  4JX5 A;  4CRL B;  3LQ5 B;  3QZ9 B;  5HBH B;  3PO3 S;  2PMI B;  4BCF B;  4EC8 B;  4IMY B;  1AD6 A;  2W2H A;  4EOI B;  1P5E B;  2I53 A;  2BS2 A;  3VYG B;  4AI6 A;  3A8H B;  3DL1 A;  4OB1 B;  3POM A;  1D3U B;  3A8L B;  4BCM B;  2DD5 B;  1H1P B;  4I3Z B;  2CZ0 B;  4YOO A;  2ZPE B;  3O0G D;  2IW9 B;  5HBJ B;  4M6V A;  4F6W B;  2CZ1 B;  4AKI A;  2ZPF B;  5HBE B;  1ENW A;  3KHI A;  1OKW B;  2I40 B;  2QF7 A;  3BLH B;  4EOK B;  4CFU B;  2R7G A;  2WEV B;  2C5N B;  4ELJ A;  2G9X B;  3MY1 B;  1TD6 A;  3WVD B;  3TNW B;  5EFQ B;  2LW4 A;  3DJB A;  2WJ9 A;  1OI9 B;  4AKG A;  4CFV B;  1N4M A;  2DPP B;  2QDJ A;  3DTO A;  4CXA B;  4CFN B;  1TFB A;  5HNB B;  4EOJ B;  3BG9 A;  4ZGJ B;  1UNL D;  4F70 B;  1H1S B;  2WIP B;  4MFE A;  1H24 B;  4F7L B;  4BCM D;  2UUE B;  4CFW B;  3QYG B;  1JKW A;  2ZPI B;  4EON B;  4FX3 B;  1OIU B;  1FKM A;  4F7S B;  4CFX B;  1H1R B;  3QYE A;  1JSU B;  5DQW A;  2WIH B;  2WMB B;  2KR6 A;  2CCI B;  5FGK B;  4G6L B;  1UGP B;  4CFU D;  1OL2 B;  4EOR B;  1G3N C;  3X28 B;  4TTH A;  4YOZ A;  3EOC B;  5EJC A;  1JST B;  1PKD B;  3HB9 A;  1H26 B;  2WMA B;  2UZL B;  4BCO B;  2DD4 B;  3EJ1 B;  1H4L D;  2B9R A;  3TW7 A;  4EOS B;  3X26 B;  3QHW B;  1KXU A;  3MY5 B;  4OR5 B;  4YC3 B;  4FM4 B;  4YOS A;  5I5Z B;  2AHJ B;  4F7J B;  1OGU B;  1ZP2 A;  1IRE B;  3H4C A;  5IHY A;  1AHJ B;  5ACB A;  2IVX A;  4ROD A;  1VOL A;  4ELL A;  2CZ6 B;  3B57 A;  5BNJ B;  4BCH B;  2DXC B;  4Z6Y A;  4NST B;  3A8G B;  3M03 A;  4BCG B;  2W9F A;  1UNG D;  2C5O B;  1UGS B;  3DDP B;  3BG3 A;  4LOC A;  4F6U B;  3X25 B;  1VYW B;  3A8M B;  2ZZD B;  1GH6 B;  4JX6 A;  4EOL B;  2ZPB B;  1URC B;  2F2C A;  2X1N B;  2G77 A;  2WPA B;  2QDY B;  1OL1 B;  1GUX B;  3QZ5 B;  1E9H B;  3BHV B;  4BCQ D;  2C5V B;  2JGZ B;  4HLQ A;  2CJM B;  3TNI B;  4EOO B;  4II5 B;  3TN8 B;  3VYH B;  4OGR B;  2PJQ A;  2ZPH B;  2C6T B;  3WVE B;  4BXX X;  3HZJ A;  4EOP B;  1O9K B;  5IDP B;  4KRD B;  3BLQ B;  5IF1 B;  2UZE B;  3GTM S;  4BCK B;  5LQF B;  2WHB B;  1FVV B;  2W96 A;  3X24 B;  3QHR B;  2CYZ B;  3BLR B;  2BKZ B;  3BG5 A;  2UZD B;  4MFD A;  3F5X B;  3QWL A;  1OKV B;  1C9B A;  1H27 B;  2V22 B;  1UNH D;  3QYH B;  4BCP B;  4BCQ B;  4OB2 B;  4AKH A;  2BS3 A;  4BCN B;  1W98 B;  1V29 B;  4JX4 A;  2CZ7 B;  4ZGD B;  2PK9 B;  2DME A;  3DOG B;  5CEI B;  1AIS B;  3G33 B;  3HBL A;  4BY1 X;  4OB3 B;  1E7P A;  4HL4 A;  2IN3 A;  2QFZ A;  3VKH A;  2QQ8 A;  3HHT B;  3K7A M;  1QLB A;  1GY3 B;  4F6S B;  2DXB B;  2UZB B;  2QGS A;  3X20 B;  4BBR M;  4ROE A;  2WXV B;  2D0Q B;  3BHU B;  5HVY B;  1JOW A;  2CCH B;  5LMK B;  3QXE B;  4BCI B;  3QYB A;  2PHG A;  3HO8 A;  3BHT B;  4BBS M;  4EOQ B;  2BS4 A;  1QMZ B;  5IDN B;  3DDQ B;  3A8O B;  4BCN D;  3EID B;  2IW6 B;  5DQV A;  4CFM B;  2C4G B;  4BY7 X;  5L2W B;  2EUF A;  4UN0 A;  2KMG A;  3NDQ A;  1H25 B;  1BU2 A;  4KRC B;  1H28 B;  3RGF B;  1GUX A;  5HQ0 B;  4OB0 B;  1OIY B;  4HNU A;  4EC9 B;  4QSH A;  1XO2 A;  4HNT A;  5ICP B;  4MIM A;  5CYI B;  2W9Z A;  4NC6 A;  4F7N B;  3VKG A;  3MI9 B;  2WFY B;  3TW6 A;  1O9K A;  3TNH B;  1UGR B;  1F5Q B;  4HNV A;  4Y72 B;  2ZCF B;  1UGQ B;  4ZGE B;  2W99 A;  2BPM B;  3MIA B;  1H1Q B;  1FIN B;  4BCJ B;  2PK2 A;  2ZPG B;  4ROC A;  4EOM B; 
#chains in the Genus database with same CATH homology
 2IW8 B;  2C5X B;  1VIN A;  1URC B;  2F2C A;  4CRL B;  3LQ5 B;  1JKW A;  2X1N B;  3K7A M;  4EON B;  2WPA B;  5HBH B;  2PMI B;  4BCF B;  4EC8 B;  4IMY B;  1GY3 B;  4F6S B;  1AD6 A;  1OL1 B;  4FX3 B;  1GUX B;  1OIU B;  2W2H A;  4F7S B;  4CFX B;  4EOI B;  1P5E B;  1H1R B;  2I53 A;  1JSU B;  1E9H B;  3BHV B;  2UZB B;  2WIH B;  2WMB B;  4BCQ D;  2C5V B;  2CCI B;  5FGK B;  2JGZ B;  4G6L B;  2CJM B;  4ROE A;  3TNI B;  4CFU D;  4II5 B;  3TN8 B;  2WXV B;  4EOO B;  3POM A;  1OL2 B;  4EOR B;  3BHU B;  4OGR B;  5HVY B;  1D3U B;  1JOW A;  1G3N C;  2C6T B;  4TTH A;  4BCM B;  1H1P B;  4YOZ A;  3EOC B;  1JST B;  2CCH B;  5LMK B;  4I3Z B;  1PKD B;  4BCI B;  4EOP B;  4EOM B;  4YOO A;  1O9K B;  1H26 B;  2WMA B;  2PHG A;  5IDP B;  2UZL B;  3BHT B;  3O0G D;  4KRD B;  4BCO B;  2IW9 B;  3BLQ B;  5HBJ B;  3EJ1 B;  4F6W B;  5IF1 B;  1H4L D;  4EOQ B;  2UZE B;  2B9R A;  5HBE B;  1QMZ B;  1OKW B;  5IDN B;  2WHB B;  1FVV B;  2I40 B;  3DDQ B;  2W96 A;  3EID B;  2IW6 B;  4BCN D;  4EOS B;  3QHR B;  4CFM B;  2C4G B;  3BLH B;  4EOK B;  4CFU B;  3QHW B;  3BLR B;  1KXU A;  5L2W B;  3MY5 B;  4OR5 B;  4YC3 B;  2EUF A;  2R7G A;  2BKZ B;  4UN0 A;  2WEV B;  4YOS A;  2C5N B;  5I5Z B;  4F7J B;  1H25 B;  1OGU B;  1BU2 A;  4KRC B;  4ELJ A;  2G9X B;  1ZP2 A;  1H28 B;  3MY1 B;  3RGF B;  1GUX A;  3H4C A;  5HQ0 B;  2UZD B;  3F5X B;  3TNW B;  5EFQ B;  1OKV B;  5ACB A;  2IVX A;  4ROD A;  1OIY B;  4ROC A;  1C9B A;  1VOL A;  4EC9 B;  4ELL A;  1H27 B;  1XO2 A;  1UNH D;  2V22 B;  5ICP B;  1OI9 B;  4BCP B;  4BCQ B;  5BNJ B;  4CFV B;  4BCH B;  1N4M A;  4BCN B;  5CYI B;  1W98 B;  4NST B;  2W9Z A;  3M03 A;  4BCG B;  2W9F A;  1UNG D;  4F7N B;  2QDJ A;  3MI9 B;  2WFY B;  2C5O B;  2PK9 B;  1O9K A;  3TNH B;  4CXA B;  4CFN B;  1TFB A;  1F5Q B;  3DDP B;  3DOG B;  4Y72 B;  5HNB B;  4EOJ B;  5CEI B;  1UNL D;  4F70 B;  4F6U B;  1H1S B;  2WIP B;  2W99 A;  1AIS B;  1H24 B;  2BPM B;  1VYW B;  3G33 B;  3MIA B;  1H1Q B;  4F7L B;  1FIN B;  4BCJ B;  1GH6 B;  2PK2 A;  4EOL B;  4BCM D;  2UUE B;  4BCK B;  4CFW B;  5LQF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...