3QHYA

Structural, thermodynamic and kinetic analysis of the picomolar binding affinity interaction of the beta-lactamase inhibitor protein-ii (blip-ii) with class a beta-lactamases
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
THKEFSQLEKKFDARLGVYAIDTGTNQTIAYRPNERFAFASTYKALAAGVLLQQNSTKKLDEVITYTKEDLVDYSPVTEKHVDTGMTLGEIAEAAVRYSDNTAGNILFHKIGGPKGYEKALRQMGDRVTMSDRFETELNEAIPGDIRDTSTAKAIATNLKAFTAGNALPNHKRNILTKWMKGNATGDKLIRAGVPTNWVVADKSGAGSYGTRNDIAIVWPPNRAPIIIAILSSKDEKGATYDNQLIAEAAEVIVNAFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Analysis of the binding forces driving the tight interactions between beta-lactamase inhibitory protein-II (BLIP-II) and class A beta-lactamases.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Hydrolase/hydrolase inhibitor
total genus 95
structure length 258
sequence length 258
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3qhyA00
3SS5A 4R4RA 1XXMA 2ZM8A 2H5SA 3RXXA 4QU3A 2Y2LA 4S2JA 4ZJ2A 4K0XA 4Z9QA 2ZM0A 4KZBA 2PU4A 3BEBA 4RX2A 4LCLA 2OV5A 2C6WB 2B5RA 4MBHA 4U3TA 1ES2A 1PW1A 5CTMA 3SS4A 1SDEA 1KGFA 1Q2PA 3LEZA 4KQOA 4U0XA 3VOYA 2WZZA 4KG5A 3TOIA 4N1HA 2V20A 3UY6A 4WZ5C 3FYZA 4OH0A 4E3OA 1FR6A 1KGEA 1SHVA 3HLBA 3ZG5A 1K6RA 2IWBA 4RYEA 2EX2A 5J8XA 1ZKJA 3HBRA 1BLSA 3UE3A 1BULA 1O07A 3C7UA 4ID4A 3V3RA 4JKTA 2EFUA 3I7JA 3NDGA 2OLVA 1IYQA 3N8LA 3NC8A 3DW0A 4ZTKA 2Y91A 3HUOA 2FFYA 5GLAA 2WYXA 4WBGA 1KE3A 2H0TA 2Y2IA 4XXRA 5EE8A 5HL1A 4DE0A 4QY5A 3ZHHA 2HDQA 4E3JA 2PU2A 1JTGA 4YFMA 2XGNA 3P98A 1ZG4A 4OPQA 5F1GA 3OPLA 4OP5A 3HREA 3GRJA 4E3IA 3WS4A 1W8YA 3C4OA 1SDNA 3O87A 1NYYA 1DJCA 3A3DA 4PM6A 5CGXA 2ZMAA 1FSWA 1E25A 4KG2A 1LL9A 5FAQA 3MFDA 3VFHA 1ES5A 4IVIA 4DE1A 5A93A 5F83A 3NBLA 1FCMA 2RL3A 1W79A 3EQVA 1RGZA 4IBXA 1ERMA 4S2NC 4UA6A 4M3KA 3UNWA 5E2FA 1K57C 5AQAA 1WYBA 3W8KA 4JXWA 1BLPA 1K6SA 3N7WA 3BLSA 3BECA 3HLWA 4KZ6A 4GN2A 2XFTA 2ZC4B 4FH2A 1ZC2A 5FQIA 3VOZA 1AXBA 1QMEA 4KZ3A 4WELA 4JXSA 2FFFB 1ONHA 3SOIA 4GZBA 3HLCA 4DKIA 2R9WA 2BLSA 4UA9A 4HEFA 3Q81A 4JF6A 1IYPA 5FI6A 4DRTA 4E3NA 3GMWA 2Y2NA 3CZDA 4Y0UA 4KG6A 4C75A 4R4SA 4FD8A 5FQJA 3SH9A 1K4EA 3QHYA 2XK1A 1PYYA 1VQQA 5GL9A 4WZ5A 3A3EA 2Y59A 1PIOA 2JBFA 4GNUA 3O86A 3M6HA 3HLEA 1CI8A 4KQQA 5TGFA 4R3JA 3PBQA 3IHBA 4P0MA 4Q8IA 3IXDA 3BM6A 2OLUA 4Y0TA 2WAEA 1I5QA 3VFFA 3N8SA 3ITAA 4EQIA 1FQGA 1TEMA 2G2WA 1KE4A 1SCWA 4QY6A 5FASA 2X71A 2Z2MB 3MXRA 1MY8A 3HLGA 1K25A 2Y4AA 1IEMA 4S2OA 1ES3A 3VMAA 3RXWA 3IT9A 3BFEA 2DRWA 5HW3A 3IWQA 5U47A 2HDSA 5L2FA 1K38A 3PBNA 1EROA 4U0TA 3QNBA 2WKIA 2WUQA 3M2KA 1GHIA 3N6IA 4LENA 5HX9A 4MNRA 2ZC6B 3CJMA 5D3OA 3W4OA 3OPHA 4R3BA 4S2PA 1LI0A 5GHYA 4E3KA 4P85A 4A5RA 4OPZA 4IBRA 4S2NA 5TFQA 1YQSA 5DVAA 3VP1A 1K57A 4PM8A 4BJPA 3HLFA 3ZVTA 3ZGAB 4ZAMA 4BD0A 3SS3A 2Y2GA 1BLCA 3QNCA 5IHVA 1HD8A 4S2IA 1DJAA 1YLYA 4FH4A 4JF5A 4E3MA 1N9BA 5TR7A 2VGKA 2J8YA 2Y2QA 1RGYA 3DTMA 4PM9A 1XPBA 1L2SA 2V1ZA 4XUZA 3VP0A 2V2FF 1WE4A 1E4DA 1EI5A 4EBPA 4JPMA 2JCHA 5M1AA 1VM1A 5A92A 4F94A 3VSKA 5GHXA 4GD8A 3FWLA 2EFXA 2IWDA 4KZ4A 3BFGA 1PWGA 4WMCD 1LHYA 5FQQA 1E3UD 3DWKA 4OQIA 3JYIA 4OOMA 2EXBA 4L0LA 1L0FA 1K55C 4D2OA 3IXGA 1MBLA 2OSUA 3SH8A 4HBUA 2ZC7A 2ZQ7A 4S2KA 3WS0A 2XR0A 1U60A 4GDNA 4EWFA 1PZOA 5EVID 3WRTA 1MWUA 3G4PA 5HAPA 4GKUA 1G6AA 1XGJA 4P6BA 2XQZA 2ZQCA 3WWXA 2Y2HA 2A49A 4CJNA 3A3JA 2WKHA 3NY4A 1IYSA 5AQ9A 1GA9A 4ZBEA 3BRMA 1LI9A 2J9OA 4X68A 3OPRA 4O7DA 4QHCA 1XP4A 1YLWA 4UA7A 3MZFA 1Q2QA 4X6TA 4BLMA 5GLDA 2Y2PA 1KVLA 2RCXA 3VP3A 5FAOA 3ZG0A 3UN7A 3WRZA 1K54C 4KENB 4QD4A 3W4QA 4KZ7A 5CHJA 5EOEA 1H8YA 3Q7ZA 4MEZA 1J9MA 5GHZA 1NZUA 1FOFA 4GD6A 3GR2A 1HTZA 1TDGA 4KZ8A 3G2ZA 3AGEA 3ZNTA 3HVFA 1KGGA 2HDRA 3PAGA 1PI4A 1RCJA 1QMFA 1XGIA 1YMXA 4X69A 3NIAA 3ZG9B 5EVIC 4LCMA 2DNSA 2HDUA 2ZD8A 3G31A 4EUZA 1YLJA 3WS1A 5HAQA 3Q07A 1MWRA 2H0YA 4DDSA 2QPNA 1M6KA 3PAEA 5EUAA 3G2YA 4MBKA 1JWPA 1PWCA 4NETA 2J7VA 2XD1A 5CTNA 3BFDA 4LV0A 3ZCZA 5CECA 5KZHA 3ZG7B 4FCFA 1MWSA 3IH9A 4HESA 1I2SA 2PBYA 2EXAA 2EX8A 4NK3A 5I94A 5CXWA 2Q9MA 2Y2MA 2WK0A 2ZQAA 4DDYA 5CGSA 2H10A 4RX3A 1BZAA 2QMIA 4DXBA 1K55A 3AGFA 4OOLA 2ZC3B 4DXCA 3PBRA 3S22A 3HLDA 2C5WB 2XEPA 4OQHA 1ONGA 2I72A 3S1YA 4JF4A 3CG5A 3UE1A 4KZ5A 1NXYA 1ES4A 3IWIA 4GDBA 5FI2A 4MBFA 4MLLA 5EVLA 3Q82A 4JLFA 2Q9NA 4WYYA 3OZHA 3Q7VB 4R23A 3M6BA 1JTDA 1N4OA 4OKPA 1FSYA 4OQGA 3LO7A 2WGWB 5DTSA 3VP4A 3Q1FA 5AQBA 3S4XA 5E2GA 4DF6A 5KSHA 2Y2KA 5FSRA 4C6YA 3IF6C 3UDIA 2UWXA 1W5DA 5KSCA 1JVJA 3BFFA 3ITBA 3PBTA 1MKIA 4OPYA 1K54A 1XA1A 2Y2OA 2R9XA 3G30A 4FSFA 4YINA 2P9VB 5M19A 4WMCA 3MBZA 3MKEA 4UHUA 1E3UA 2WGIA 2XDMA 3IF5A 5BOHA 1SKFA 5DTKA 1CEGA 2ZLYA 1YM1A 3D4FA 3NCKA 4IEDA 5FI7A 1H5XA 3UDFA 3FZCA 4S2MA 4N9KA 1K4FA 3FKVA 5A91A 3MXSA 4KZAA 4N9LA 5DF8A 5G18A 1O7EA 1KE0A 3IXHA 4OLDA 4WM9A 1KDSA 4X53A 5EVIA 3WS5A 4UAAA 5E43A 3V50A 5FQ9A 1GHMA 1K56D 3AGDA 5GLCA 3HL9A 1G68A 1RP5A 1W8QA 3BYDA 1CEFA 5DTTA 1PW8A 2ZQ9A 1IELA 4BL3A 5E2HA 4OOYA 4Y7PA 3GTCA 1KDWA 2QZ6A 1BSGA 3UPPA 4DE2A 5GLBA 1BT5A 2E8IA 3EQUA 3O88A 2WAFA 1FCNA 4E6WA 1MWTA 4BENA 2GDNA 4R0QA 1ALQA 5KMWA 3V3SA 4BQMA 1IKGA 5FQMA 2WKEA 1XKZA 3UPNA 4RA7A 4ZJ3A 5M18A 1L0DA 5CRFA 3PBSA 4QJGA 4HBTA 4LV2A 5EVIB 2ZQ8A 3FV7A 2A3UA 1EWZA 1BLHA 2WADA 1PWDA 1ERQA 3G35A 1CK3A 2ZM2A 4WEKA 4Y0OA 1BTLA 4N1XA 2Y55A 1YLTA 3HUNA 4CPKA 1GA0A 1TDLA 3B3XA 3LCEA 1IKIA 4KQRA 3MZDA 5F1FA 4K91A 1HZOA 4LV3A 3BFCA 4WZ4A 3O3VA 1W7FA 5E2EA 4ZDXA 3G32A 3IF6A 1KVMA 4RVAA 3RJUA 4X55A 1OMEA 2EX6A 3VSLA 4EV4A 4OPRA 4JXVA 4OLGA 3UO9A 3GV9A 3OC2A 3G34A 5FQKA 3NDEA 2XH9A 2ZQDA 1YMSA 3N8RA 1C3BA 1I2WA 5CGWA 4B4ZA 4EBNA 4JBFA 1NYMA 3C4PA 3UE0A 3A3IA 4OVDA 4S2LA 3TG9A 2EX9A 4BD1A 3HUMA 1XX2A 4X56A 5DF7A 5CERA 4OONA 1LLBA 2WGVA 3Q7VA 4B4XA 1DY6A 2HP6A 1JWZA 2XF3A 2XFSA 3LY3A 4IVKA 4BL2A 4PM5A 2X01A 4PMAA 1L0GA 2JE5A 1FCOA 2WZXA 2WGWA 1PZPA 3OCLA 4PM7A 4R1GA 3M2JA 3N4IA 3TSGA 4WEJA 2X02A 3IF6B 4N92A 4ZJ1A 1Y54A 2XD5A 3GQZA 3ZG8B 4C3QA 4GB7A 3V39A 3SH7A 3C7VA 5CHMA 3CMZA 5FAPA 2P9VA 3UPOA 3PTEA 3IQAA 3GVBA 5CEBA 1MPLA 5CHUA 1HVBA 5EPHA 2HP9A 1JWVA 3P09A 2Z2LB 5HFOA 3MZEA 1NRFA 3E2KA 4H8RA 2J9PA 3E2LA 3IHAA 3OCNA 3C5AA 1Z6FA 4XUXA 1DJBA 1NJ4A 1M40A 3DWZA 3A3FA 5EOOA 2IWCA 4P87A 5FATA 4K0WA 2Y2JA 1H8ZA 5F82A 4GOGA 3ZFZA 5JYOA 1S0WA 4LV1A 1WYCA 3ZNYA 2G2UA 2BG1A 3VP2A 4OP8A 1CI9A 2HP5A 4E6XA 1NY0A 2P74A 1GHPA 1K56A 1MXOA 2JC7A 3ISGA 5EECA 1NZOA 3ZDJA 3IWOA 2CC1A 3GSGA 1YLZA 1ESUA 3W4PA 1ZG6A 4PPRA 4DE3A 4QB8A 3FKWA 2ZJ9A 4EBLA 2HPBA 4E3LA 1IYOA 5A90A 2DCFA 1YT4A 2XLNA 2ZC5B 3IXBA 4JXGA 4OQ0A 4KZ9A 3PBOA 5DF9A 5CEDA 1PI5A 3LY4A 3OPPA 3V5MA 1XA7A 3UDXA 2VGJA 5HARA 3BLMA 1S6RA 1ESIA 3NI9A 4B88A 1LL5A 1L0EA 5AQ7A 5FDHA 5JYPA 3WS2A 3IH8A 5HAIA 1BUEA 1GCEA 1FR1A 1YLPA 3MKFA 5FA7A 3ZVWA 1TVFA
chains in the Genus database with same CATH superfamily
1OPXA 2PD8A 4QU3A 3EWKA 1EW0A 5A8BA 2A2LA 4Z1WA 1PW1A 3SS4A 3LEZA 4KG5A 3F1PA 4WZ5C 4E3OA 1FR6A 1SHVA 3ZG5A 1K6RA 5L10A 2GNXA 4IJGA 4PKYG 1BULA 4ARZB 3EEHA 4EQ1A 2FFYA 4WBGA 2H0TA 2GJ3A 5EE8A 5HL1A 2HDQA 5L09A 3UB8A 1ZG4A 2ZOIA 5F1GA 3OPLA 4OP5A 5CGXA 3A0RA 1P9RA 4L9FA 4IVIA 2RL3A 2INWA 1ERMA 2QYBA 4S2NC 1K57C 4QPRA 5AQAA 1BLPA 3N7WA 4GN2A 3IX3A 3VOZA 4WELA 4JXSA 3SOIA 1NRJA 1IYPA 5FI6A 3R7WA 4C75A 2PT7A 3MQQA 4MN7A 4P6ZM 1Z09A 1PYYA 3RTYA 1ACFA 3A3EA 1PIOA 4GNUA 3O86A 5TGFA 3MJQA 3PBQA 4LGWA 4BWIA 2OLUA 1I5QA 3ITAA 1TEMA 2G2WA 4LRZE 4QY6A 5FASA 2X71A 1IEMA 1ES3A 3BFEA 2R78A 5U47A 1EROA 4ETXA 3M2KA 3N6IA 3CJMA 3E4QA 5D3OA 1T19A 4HP9A 4R3BA 5TBMA 2B02A 4HI4A 3MQOA 4P85A 4A5RA 2VV6A 1XFNA 4HOIA 1PNEA 4PM8A 3HLFA 5J3WA 2Y2GA 5IHVA 1HD8A 2VZWA 1YLYA 4RQ9A 4E3MA 4GLQA 1S4SA 1H8MA 2PYPA 2Q0OA 2VGKA 1XPBA 4YWZA 4FUWA 5M1AA 2PRFA 3IS2B 4LFUA 5DJTA 5A92A 4K08A 2QJ5A 2IWDA 4EESA 5FQQA 4OQIA 5HWTA 3H7WA 3C8CA 2HGVA 1K55C 4D2OA 2WKPA 2ZC7A 2LB9A 4PAUA 4GDNA 3G4PA 1GSWA 4P6BA 3WWXA 2HJ9C 1TS0A 4O8GA 1GA9A 2JKTM 4UA7A 3MZFA 4X1MA 4BLMA 1VEUA 1KVLA 3VP3A 3ZG0A 1DP6A 3UN7A 3WRZA 4KENB 3LI8A 5CHJA 1OJGA 4NG2A 3F1OB 1P0ZA 1XGIA 3LI9A 4GJ4A 2VGLS 5EVIC 4CLCC 2OWHA 4DDSA 4MBKA 2XD1A 3NOUC 3SW1A 2EWWA 3BQ8A 4NK3A 2EXAA 5CXWA 2Q9MA 4DDYA 5CGSA 2H10A 1D7EA 5F5YA 2QMIA 3A0VA 1F2KA 4WUJA 2K2NA 1ONGA 2I72A 4JF4A 3LIEA 5F6AA 1ES4A 4MLLA 3Q82A 4JLFA 2Q9NA 4WYYA 3Q7VB 4R23A 1N4OA 3PXPA 3T1SA 4I3AA 2WGWB 3VP4A 5HSQA 5E2GA 4DF6A 2QKPA 4JGOA 5FSRA 3UDIA 4G3VA 2QHKA 2R9XA 4EU0A 5M19A 3MKEA 2M7VA 2XDMA 4HIAA 5DTKA 3CHWP 2ZLYA 4IEDA 4S2MA 5DF8A 4AFIA 5E43A 1G68A 1W8QA 5DTTA 1PW8A 2ZQ9A 4HHDA 3TW8A 3GTCA 2W0NA 3CUEC 3O88A 1FCNA 4E6WA 4R0QA 2WKEA 3UPNA 4ZJ3A 1L0DA 4QJGA 5EVIB 4CLCB 2WADA 1ERQA 3G35A 3HJIA 4Y0OA 2Y55A 3HUNA 1GA0A 1TDLA 3B3XA 3LCEA 1IKIA 4K91A 3BFCA 3O3VA 1W7FA 3B33A 3G32A 1OMEA 3VSLA 4EV4A 4OPRA 1OT9A 3KYZA 4NXFA 3GV9A 3F1PB 3N8RA 3C4PA 4E04A 4OVDA 2EX9A 5CERA 2WGVA 3LICA 4BL2A 3BY9A 1L0GA 4H6JB 4KQDA 1PZPA 3OCLA 3U4LP 3S7NA 2P08A 4WEJA 3ZG8B 3C7VA 3PTEA 3IQAA 5CEBA 1HVBA 1SKOB 2W3DA 3P09A 3E2KA 4H8RA 2W3HA 3IHAA 3E2LA 2W1TA 2Y2JA 1TD5A 1UWNX 4LV1A 1WYCA 2G2UA 4F3LA 1CI9A 1YPRA 4E6XA 4DN0A 5AVEA 3OOVA 3BWLA 3IWOA 1ESUA 1VHMA 2VKSA 2P7JA 2ZJ9A 2HPBA 1IYOA 2DCFA 2ZC5B 2VV7A 1HLUP 4KZ9A 3RFBA 3OPPA 1JNUA 1XA7A 5AQ7A 4Y5FA 5HAIA 2NUTC 1BUEA 1GCEA 1FR1A 3MKFA 3E98A 5FA7A 2WKQA 4R4RA 2H5SA 4S2JA 4L9EA 4K0XA 4KZBA 2PU4A 2VK3A 3LR0A 4LCLA 4BBVA 2C6WB 4U3TA 3FPVA 5CTMA 1KGFA 2WZZA 4OH0A 1KGEA 3HLBA 5TBMB 1ZKJA 3HBRA 3L7HA 5HZHA 1O07A 2BASA 3LIBA 3V3RA 3L9KA 1IYQA 3N8LA 4ZTKA 3HUOA 2WYXA 1XJ2A 1KE3A 3ZHHA 4YFMA 3VE4A 4OPQA 2PHYA 3HREA 4GW9A 3WS4A 1D1JA 1W8YA 1SDNA 3OBFA 4GCZA 1DJCA 1X0OA 3A3DA 1E25A 4KG2A 3DAVA 1LL9A 2KX6A 4JGQA 3VFHA 4DE1A 2VX8A 5F83A 5A93A 3NBLA 4X25A 3UMDA 1RGZA 4UA6A 4M3KA 3UNWA 3T1XA 5E2FA 1NLYA 3BLSA 1ZC2A 5FQIA 1AXBA 4KZ3A 1NLZA 4DKIA 4UA9A 4HEFA 4DRTA 4E3NA 3GMWA 4CQHA 4Y0UA 3QP8A 2QJ7A 1S1YA 1AWIA 5FQJA 1K4EA 1VQQA 2JN7A 5GL9A 1N9NA 1YAXA 1CI8A 3IHBA 4Q8IA 1OTBA 1XJ6A 2WAEA 3VFFA 4MDZA 1ZTUA 1MY8A 2YKHA 4LRXC 2VGLM 3F1NA 5HDCA 2ZL1A 2DRWA 5HW3A 5L2FA 2HDSA 2WKIA 1S67L 2ZC6B 1FIKA 1STZA 5C5KA 3W4OA 3OPHA 1MZUA 2PR6A 1TS6A 4IBRA 5TFQA 3T4KA 3VP1A 3ZGAB 4ZAMA 3SS3A 5EV0A 5TR7A 4GS9A 2Y2QA 2J8YA 1RGYA 3DTMA 5FDSA 3VP0A 2V2FF 1WE4A 1EI5A 3K3CA 4JPMA 3BQAA 1VM1A 2A24A 2V0UA 4DJ2A 2J80A 3FWLA 4KZ4A 4L0LA 1L0FA 2O9BA 3SH8A 4S2KA 2XR0A 1U60A 1DRMA 4EWFA 1PZOA 2ZQCA 4MMNA 2WKHA 3NY4A 3BRMA 3P01A 4X68A 4O7DA 4QHCA 3KYQA 4X6TA 5L8MA 4QD4A 2D01A 2D02A 3Q7ZA 1J9MA 5GHZA 1NZUA 4GD6A 2OAQ1 1S1ZA 2OAP1 1YSPA 3ZNTA 3QP6A 3HVFA 1KGGA 1LSXA 5F68A 1PI4A 1RCJA 4HQAA 4CLCE 4LCMA 3G31A 1YLJA 2H0YA 3PAEA 3G2YA 2UV0E 1PWCA 4G3WA 5CTNA 5KZHA 5CECA 4Y3IA 1MWSA 1I2SA 2ZBBA 4O0PA 2PBYA 4IUKA 2EX8A 5I94A 2Y2MA 2ZQAA 4HJ4A 4RX3A 3LYXA 5L07A 2ZC3B 3PBRA 3S22A 3EGXC 5IU1A 1VETA 1NXYA 4GDBA 3IWIA 3CWFA 1JTDA 1FSYA 4OQGA 3LO7A 5DTSA 4HY8A 5J4EA 5KSHA 2Z6DA 5EM0A 3JVVA 2JKRI 3NHQA 4C6YA 4FOFA 1JVJA 2V0WA 3IX4A 3BFFA 2J3TC 4Y13A 1K54A 1XA1A 4EXOA 3G30A 1S4RA 3MBZA 5BOHA 1OTDA 3NCKA 3UDFA 4N9KA 4DJ3A 4KUKA 3FKVA 5A91A 2KLIA 2BTFP 4N9LA 5G18A 1O7EA 3V50A 5FQ9A 3AGDA 2L1MA 3HL9A 5HDSA 5E2HA 3D3OA 4OOYA 3VE3A 2QZ6A 3EOIA 4DE2A 1BT5A 3EQUA 2MJ6A 2WAFA 5KIZA 4BENA 2GDNA 5FQMA 1PWDA 4IUHA 4WEKA 1BTLA 4CPKA 1P9WA 4HNBA 4KQRA 3IF6A 2EX6A 3OC2A 2ZQDA 4GHIB 1YMSA 3PR6A 3MXQA 4JBFA 3TG9A 4BD1A 3HUMA 1ZHHB 4X56A 5DF7A 4OONA 2PBDP 5HWWA 3H82A 2XF3A 2G7UA 4PM5A 1CJFA 4PM7A 1KOUA 4R1GA 1LSVA 3TJZC 2X02A 4N92A 3B47A 4C3QA 2P9VA 5J7EA 1MPLA 5EPHA 5HFOA 1JWVA 1Y4OA 2V1BA 2J9PA 3OCNA 1Z6FA 4XUXA 1DJBA 3DTIA 2IWCA 2PAVP 4P87A 1H8ZA 5JYOA 3VP2A 1GHPA 2JC7A 3GSGA 3W4PA 4DE3A 4O01A 4E3LA 5A90A 2XLNA 1YT4A 3PBOA 4UQIS 5DF9A 3PYPA 3V5MA 3BLMA 1ESIA 1LL5A 5AJGA 5JYPA 3ZVWA 4ARZA 1MKMA 5DKLA 2ZM8A 3RXXA 4ZJ2A 1K0KA 4Y15A 3KSFA 2ZM0A 3CPTB 3F1NB 2OV5A 1T1AA 2ZL1B 4MBHA 2VA0A 1ES2A 3LIAA 4LLOB 3MSHA 3VOYA 1SDEA 4KQOA 4U0XA 3NECA 3TOIA 4N1HA 2VLGA 2V20A 3LFVA 1CQAA 2EX2A 3UE3A 1LL8A 2I9VA 3CAXA 3C7UA 4ID4A 4JKTA 2K7SA 5LBRA 3I7JA 3DW0A 2Y91A 5HD3A 2Y2IA 3QP1A 4E3JA 3RH8B 1JTGA 4GS9B 2B95A 4E3IA 3O87A 1NYYA 4PM6A 2ZMAA 3B42A 1FSWA 5FAQA 3MFDA 3LIDA 5HWVA 3G6OA 1FCMA 1W79A 3LUQA 1WYBA 3W8KA 4JXWA 3HLWA 4KZ6A 2XFTA 4FH2A 3VV4A 1ONHA 3HLCA 3MMHA 4JF6A 3E0YA 3IBJA 3CZDA 1UWPX 3SH9A 3UB9A 2OWJA 4WZ5A 1OTAA 3K3DA 2JBFA 1L3LA 3PHYA 4R3JA 4P0MA 3MR0A 3BM6A 3N8SA 3T4OA 5HPIA 4EERA 1SCWA 1YKDA 3UB6A 3HLGA 1K25A 2Y4AA 3IBRA 3R7WB 3RXWA 3IT9A 2W3EA 3IWQA 1K38A 3PBNA 3QNBA 1N9OA 4LENA 5HX9A 3IS2A 4MNRA 1D06A 3DBAA 4S2PA 1LI0A 3LEQA 5GHYA 4S2NA 2LB5A 5DVAA 1K57A 4BJPA 3ZVTA 5EFWA 1BLCA 1VETB 4FH4A 2HV1A 1N9BA 4PM9A 5DFXA 1L2SA 2V1ZA 4XUZA 4B93A 1E4DA 2DMWA 4EBPA 1GSXA 2W27A 3VSKA 4GD8A 2XA7M 4Y2FA 3BFGA 1LHYA 3DWKA 3JYIA 2ZMVA 4BBTA 1H0MA 3IXGA 1MBLA 4HBUA 1MC0A 4M4XA 1W63M 4MN6A 5HPFA 3T4TA 5EVID 4CLCD 4GKUA 1G6AA 5AVFA 2XQZA 3A3JA 1IYSA 4ZBEA 1LI9A 2J9OA 4NKPA 3EEAA 3UB7A 2QWSA 4HH3A 2RCXA 5FAOA 3H7WB 3MF0A 4XT2A 1BYWA 4MEZA 5I5LA 2P04A 3SZTA 1F5MA 1FOFA 3GR2A 4KZ8A 3G2ZA 4HH2A 3PAGA 2HDRA 1SZVA 3NIAA 4PHTA 3T1QB 2FZ0A 2ZD8A 4EUZA 3WS1A 1MWRA 2QPNA 1M6KA 4YNRA 1JWPA 4NETA 2J7VA 4LV0A 3ZG7B 4FCFA 4HESA 1VEUB 2ACGA 3C2WA 2WK0A 4DXBA 1K55A 4OOLA 1DP9A 2XROA 3QP2A 4OQHA 3CG5A 3UE1A 4KZ5A 5FI2A 5EVLA 3OZHA 2Y8HA 3H82B 1S66L 4OKPA 5G4YA 5HDDA 3T4JA 3Q1FA 4I38A 3HCYA 1G6OA 2M1CA 2UWXA 4MCWA 5KSCA 4OPYA 4YINA 2Y2OA 3IX8A 2P9VB 3C38A 2VV8A 4UHUA 2M7UA 3IF5A 1SKFA 1CEGA 3D4FA 1YM1A 1H5XA 3FZCA 1LSWA 1K4FA 3S7QA 2NUPC 3D72A 4KZAA 1KE0A 3LR5A 4G3KA 4OLDA 1KDSA 4R70A 4WM9A 4X53A 5EVIA 3ULFA 2K31A 4CLCA 4UAAA 1F98A 2V8FA 3W2ZA 1K56D 3T4QA 3BYDA 1TF1A 1IELA 3UMEA 4Y7PA 1KDWA 4JGRA 1BSGA 2W1RA 5GLBA 4R6LA 2E8IA 2JKFA 4UQIM 3QP5A 5KMWA 3V3SA 4BQMA 1IKGA 3PBSA 4HBTA 4D60A 4LV2A 2ZQ8A 2HJEA 3FV7A 2A3UA 5DKKA 1BLHA 3CLOA 3U2AA 4KUOA 3MZDA 4H6JA 5F1FA 4LV3A 4WZ4A 5E2EA 1KVMA 4RVAA 4X55A 4OLGA 3UO9A 3G34A 3NOTC 2XH9A 4WN5A 3OLOA 1SKOA 1C3BA 4B4ZA 4EETB 3UB5P 3UE0A 3A3IA 4S2LA 1N9LA 4NXBA 4DMZA 1XX2A 1LLBA 4B4XA 1DY6A 2HP6A 1JWZA 2XFSA 3LY3A 1CF0A 2JE5A 3QP4A 2WZXA 2KDKA 4BBUA 4ZJ1A 3GQZA 2ZMFA 3CUEA 4GB7A 3V39A 5CHMA 3CMZA 5FAPA 1TS7A 5CHUA 1NRFA 3C5AA 4QWOA 3KSHA 1NJ4A 3DWZA 3A3FA 4NEED 4HP4A 4K0WA 3KSIA 1LT0A 5F82A 3MQ0A 4GOGA 3ZFZA 1S0WA 4UEYA 3ZNYA 2BG1A 1V9ZA 2HP5A 1NY0A 3V67A 2JKTI 2P74A 1K56A 1Y28A 3ISGA 5EECA 1NZOA 2XA7S 2CC1A 4PPRA 3IXBA 4EEPA 2O9AA 4Y17A 4OQ0A 4WF0A 2W1TB 5CEDA 2KOIA 3UDXA 1IOUA 3LIFA 5HARA 3NI9A 4B88A 3WS2A 2WKRA 4F3LB 4X1LA 1YLPA 3S7OA 3SS5A 1XXMA 2Y2LA 3TRCA 4Z9QA 3BEBA 2XSSA 4RX2A 2VJWA 3C30A 2B5RA 4ETZA 1PFLA 1Q2PA 3UY6A 3FYZA 5MC7A 4Q0JA 2IWBA 4RYEA 5J8XA 1BLSA 4JGPA 1OJ5A 2EFUA 4BMWA 3NDGA 3KYEA 2OLVA 1ODVA 3NC8A 5GLAA 4XXRA 4Q0IA 4DE0A 4QY5A 2PU2A 2XGNA 3P98A 4R38A 3GRJA 4L9GA 4MN5A 1OT6A 3C4OA 1ES5A 4EW7A 3EQVA 2JKRM 4IBXA 2JKGA 4NXEA 1K6SA 3BECA 1P97A 4I3JA 3DTKA 3T4SA 2ZC4B 1QMEA 1UGUA 3CI6A 3K2NA 2FFFB 2PR5A 4GZBA 2R9WA 2BLSA 2V8CA 3Q81A 3VOLA 2Y2NA 4KG6A 4R4SA 4FD8A 3QHYA 2XK1A 1XJ4A 3TE8A 2FH5A 2Y59A 3NULA 3M6HA 1J3WA 3HLEA 4KQQA 1G28A 1YSQA 3IXDA 4Y0TA 4XT2B 5K5BA 4I3IA 4EQIA 1FQGA 1W63Q 1KE4A 4YOFA 2AVXA 2Z2MB 3MXRA 1WA9A 4S2OA 3VMAA 5EM1A 3T12B 4U0TA 2WUQA 1GHIA 3S7PA 2OOLA 3T1RA 4E3KA 4OPZA 1YQSA 3KSGA 1IFQA 4R3AA 2IA2A 4BD0A 3QNCA 4S2IA 3E4PA 2GX5A 1DJAA 4JF5A 2W3FA 2ZOHA 5IS1A 5HD5A 1PRQA 4WL9A 1T1CA 4EUVA 2JCHA 3FPWA 4F94A 5CX7A 5GHXA 2EFXA 1PWGA 4WMCD 1E3UD 1VB6A 4OOMA 2EXBA 4I39A 2L4RA 2OSUA 2ZQ7A 2E8JA 3KO6A 3WS0A 5TJJA 3WRTA 1MWUA 5HAPA 2CMNA 3DTEA 1XGJA 2Y2HA 2A49A 4CJNA 4LRYC 4P6ZS 5AQ9A 2A24B 3T50A 3OPRA 1H3QA 1XP4A 4B9OA 1YLWA 1Q2QA 3CITA 5GLDA 2Y2PA 3BY8A 1FILA 2PDRA 2B18A 1K54C 1GSVA 3T4LA 3W4QA 4KZ7A 1H8YA 3JPUA 1G5UA 1HTZA 2H28A 1TDGA 3AGEA 1QMFA 1YMXA 4X69A 3ZG9B 2DNSA 2HDUA 2YKFA 3LGOA 5HAQA 3Q07A 5EUAA 3BFDA 3ZCZA 3KX0X 3IH9A 2O0YA 2XRNA 2J3TD 3H9WA 1BZAA 3AGFA 3GECA 4Q0HA 4DXCA 3HLDA 2C5WB 2XEPA 3S1YA 1A0KA 5IT5A 2GZAA 3D9YA 4MBFA 5FEGA 3M6BA 2J3WA 3LR4A 3GDIA 2L0WA 3P7NA 5AQBA 2W3GA 3S4XA 2Y2KA 2JHEA 3IF6C 1W5DA 3E4OA 3ITBA 3PBTA 1MKIA 5EOEA 5EVEA 4FSFA 4EEUA 4WMCA 1E3UA 2WGIA 4PKYA 3LR3A 5FEFA 5FI7A 1XFQA 3MXSA 1TS8A 2HZ5A 3IXHA 3WS5A 2Z6CA 2O9CA 1GHMA 5GLCA 3UE6A 1RP5A 1CEFA 4BL3A 2Y79A 3A0SA 3O5YA 3UPPA 3BW6A 1NWZA 3ZQ5A 1MWTA 5G4ZA 1ALQA 4GHIA 1OTEA 1XJ3A 1XKZA 4RA7A 5M18A 5CRFA 3EGDC 3FG8A 4IHQA 3F1OA 1EWZA 1CK3A 2ZM2A 4N1XA 1YLTA 2HF6A 5DFYA 1HZOA 4ZDXA 4WLAA 2PD7A 3FC7A 3RJUA 1T18A 4NXGA 4JXVA 3ICYA 5FQKA 3NDEA 1OTIA 4I5SA 1I2WA 5CGWA 4EBNA 2VEAA 1NYMA 2PYRA 5FL3A 3MFXA 3Q7VA 2V9AA 4IVKA 5DJUA 2X01A 4PMAA 1FCOA 2WGWA 4ZRRA 3M2JA 3N4IA 3TSGA 3IF6B 1F9IA 1Y54A 2XD5A 2O99A 3SH7A 3MS6A 3NJAA 3BJNA 3ZYTA 3UPOA 3GVBA 4HJ6A 2EWVA 2HP9A 2Z2LB 3MZEA 1T1BA 5HL6A 1M40A 5EOOA 1DP8A 5FATA 4FTXA 5F69A 1V9YA 4OP8A 3JVUA 1MXOA 3HJKA 3ZDJA 1YLZA 3NOPC 4LPZA 3CPTA 1ZG6A 3R4KA 4II7A 4QB8A 3FKWA 4ESPA 4EBLA 4JXGA 2EA9A 1PI5A 3LY4A 4HJ3A 4ME4A 2VGJA 2V1AA 1S6RA 5FDHA 1L0EA 3IH8A 1TVFA
chains in the Genus database with same CATH topology
3SS5A 4R4RA 1XXMA 2ZM8A 2H5SA 3RXXA 4QU3A 2Y2LA 4S2JA 4ZJ2A 4K0XA 4Z9QA 2ZM0A 4KZBA 2PU4A 3BEBA 4RX2A 4LCLA 2OV5A 2C6WB 2B5RA 4MBHA 4U3TA 1ES2A 1PW1A 5CTMA 3SS4A 1SDEA 1KGFA 1Q2PA 3LEZA 4KQOA 4U0XA 3VOYA 2WZZA 4KG5A 3TOIA 4N1HA 2V20A 3UY6A 4WZ5C 3FYZA 4OH0A 4E3OA 1FR6A 1KGEA 1SHVA 3HLBA 3ZG5A 1K6RA 2IWBA 4RYEA 2EX2A 5J8XA 1ZKJA 3HBRA 1BLSA 3UE3A 1BULA 1O07A 3C7UA 4ID4A 3V3RA 4JKTA 2EFUA 3I7JA 3NDGA 2OLVA 1IYQA 3N8LA 3NC8A 3DW0A 4ZTKA 2Y91A 3HUOA 2FFYA 5GLAA 2WYXA 4WBGA 1KE3A 2H0TA 2Y2IA 4XXRA 5EE8A 5HL1A 4DE0A 4QY5A 3ZHHA 2HDQA 4E3JA 2PU2A 1JTGA 4YFMA 2XGNA 3P98A 1ZG4A 4OPQA 5F1GA 3OPLA 4OP5A 3HREA 3GRJA 4E3IA 3WS4A 1W8YA 3C4OA 1SDNA 3O87A 1NYYA 1DJCA 3A3DA 4PM6A 5CGXA 2ZMAA 1FSWA 1E25A 4KG2A 1LL9A 5FAQA 3MFDA 3VFHA 1ES5A 4IVIA 4DE1A 5A93A 5F83A 3NBLA 1FCMA 2RL3A 1W79A 3EQVA 1RGZA 4IBXA 1ERMA 4S2NC 4UA6A 4M3KA 3UNWA 5E2FA 1K57C 5AQAA 1WYBA 3W8KA 4JXWA 1BLPA 1K6SA 3N7WA 3BLSA 3BECA 3HLWA 4KZ6A 4GN2A 2XFTA 2ZC4B 4FH2A 1ZC2A 5FQIA 3VOZA 1AXBA 1QMEA 4KZ3A 4WELA 4JXSA 2FFFB 1ONHA 3SOIA 4GZBA 3HLCA 4DKIA 2R9WA 2BLSA 4UA9A 4HEFA 3Q81A 4JF6A 1IYPA 5FI6A 4DRTA 4E3NA 3GMWA 2Y2NA 3CZDA 4Y0UA 4KG6A 4C75A 4R4SA 4FD8A 5FQJA 3SH9A 1K4EA 3QHYA 2XK1A 1PYYA 1VQQA 5GL9A 4WZ5A 3A3EA 2Y59A 1PIOA 2JBFA 4GNUA 3O86A 3M6HA 3HLEA 1CI8A 4KQQA 5TGFA 4R3JA 3PBQA 3IHBA 4P0MA 4Q8IA 3IXDA 3BM6A 2OLUA 4Y0TA 2WAEA 1I5QA 3VFFA 3N8SA 3ITAA 4EQIA 1FQGA 1TEMA 2G2WA 1KE4A 1SCWA 4QY6A 5FASA 2X71A 2Z2MB 3MXRA 1MY8A 3HLGA 1K25A 2Y4AA 1IEMA 4S2OA 1ES3A 3VMAA 3RXWA 3IT9A 3BFEA 2DRWA 5HW3A 3IWQA 5U47A 2HDSA 5L2FA 1K38A 3PBNA 1EROA 4U0TA 3QNBA 2WKIA 2WUQA 3M2KA 1GHIA 3N6IA 4LENA 5HX9A 4MNRA 2ZC6B 3CJMA 5D3OA 3W4OA 3OPHA 4R3BA 4S2PA 1LI0A 5GHYA 4E3KA 4P85A 4A5RA 4OPZA 4IBRA 4S2NA 5TFQA 1YQSA 5DVAA 3VP1A 1K57A 4PM8A 4BJPA 3HLFA 3ZVTA 3ZGAB 4ZAMA 4BD0A 3SS3A 2Y2GA 1BLCA 3QNCA 5IHVA 1HD8A 4S2IA 1DJAA 1YLYA 4FH4A 4JF5A 4E3MA 1N9BA 5TR7A 2VGKA 2J8YA 2Y2QA 1RGYA 3DTMA 4PM9A 1XPBA 1L2SA 2V1ZA 4XUZA 3VP0A 2V2FF 1WE4A 1E4DA 1EI5A 4EBPA 4JPMA 2JCHA 5M1AA 1VM1A 5A92A 4F94A 3VSKA 5GHXA 4GD8A 3FWLA 2EFXA 2IWDA 4KZ4A 3BFGA 1PWGA 4WMCD 1LHYA 5FQQA 1E3UD 3DWKA 4OQIA 3JYIA 4OOMA 2EXBA 4L0LA 1L0FA 1K55C 4D2OA 3IXGA 1MBLA 2OSUA 3SH8A 4HBUA 2ZC7A 2ZQ7A 4S2KA 3WS0A 2XR0A 1U60A 4GDNA 4EWFA 1PZOA 5EVID 3WRTA 1MWUA 3G4PA 5HAPA 4GKUA 1G6AA 1XGJA 4P6BA 2XQZA 2ZQCA 3WWXA 2Y2HA 2A49A 4CJNA 3A3JA 2WKHA 3NY4A 1IYSA 5AQ9A 1GA9A 4ZBEA 3BRMA 1LI9A 2J9OA 4X68A 3OPRA 4O7DA 4QHCA 1XP4A 1YLWA 4UA7A 3MZFA 1Q2QA 4X6TA 4BLMA 5GLDA 2Y2PA 1KVLA 2RCXA 3VP3A 5FAOA 3ZG0A 3UN7A 3WRZA 1K54C 4KENB 4QD4A 3W4QA 4KZ7A 5CHJA 5EOEA 1H8YA 3Q7ZA 4MEZA 1J9MA 5GHZA 1NZUA 1FOFA 4GD6A 3GR2A 1HTZA 1TDGA 4KZ8A 3G2ZA 3AGEA 3ZNTA 3HVFA 1KGGA 2HDRA 3PAGA 1PI4A 1RCJA 1QMFA 1XGIA 1YMXA 4X69A 3NIAA 3ZG9B 5EVIC 4LCMA 2DNSA 2HDUA 2ZD8A 3G31A 4EUZA 1YLJA 3WS1A 5HAQA 3Q07A 1MWRA 2H0YA 4DDSA 2QPNA 1M6KA 3PAEA 5EUAA 3G2YA 4MBKA 1JWPA 1PWCA 4NETA 2J7VA 2XD1A 5CTNA 3BFDA 4LV0A 3ZCZA 5CECA 5KZHA 3ZG7B 4FCFA 1MWSA 3IH9A 4HESA 1I2SA 2PBYA 2EXAA 2EX8A 4NK3A 5I94A 5CXWA 2Q9MA 2Y2MA 2WK0A 2ZQAA 4DDYA 5CGSA 2H10A 4RX3A 1BZAA 2QMIA 4DXBA 1K55A 3AGFA 4OOLA 2ZC3B 4DXCA 3PBRA 3S22A 3HLDA 2C5WB 2XEPA 4OQHA 1ONGA 2I72A 3S1YA 4JF4A 3CG5A 3UE1A 4KZ5A 1NXYA 1ES4A 3IWIA 4GDBA 5FI2A 4MBFA 4MLLA 5EVLA 3Q82A 4JLFA 2Q9NA 4WYYA 3OZHA 3Q7VB 4R23A 3M6BA 1JTDA 1N4OA 4OKPA 1FSYA 4OQGA 3LO7A 2WGWB 5DTSA 3VP4A 3Q1FA 5AQBA 3S4XA 5E2GA 4DF6A 5KSHA 2Y2KA 5FSRA 4C6YA 3IF6C 3UDIA 2UWXA 1W5DA 5KSCA 1JVJA 3BFFA 3ITBA 3PBTA 1MKIA 4OPYA 1K54A 1XA1A 2Y2OA 2R9XA 3G30A 4FSFA 4YINA 2P9VB 5M19A 4WMCA 3MBZA 3MKEA 4UHUA 1E3UA 2WGIA 2XDMA 3IF5A 5BOHA 1SKFA 5DTKA 1CEGA 2ZLYA 1YM1A 3D4FA 3NCKA 4IEDA 5FI7A 1H5XA 3UDFA 3FZCA 4S2MA 4N9KA 1K4FA 3FKVA 5A91A 3MXSA 4KZAA 4N9LA 5DF8A 5G18A 1O7EA 1KE0A 3IXHA 4OLDA 4WM9A 1KDSA 4X53A 5EVIA 3WS5A 4UAAA 5E43A 3V50A 5FQ9A 1GHMA 1K56D 3AGDA 5GLCA 3HL9A 1G68A 1RP5A 1W8QA 3BYDA 1CEFA 5DTTA 1PW8A 2ZQ9A 1IELA 4BL3A 5E2HA 4OOYA 4Y7PA 3GTCA 1KDWA 2QZ6A 1BSGA 3UPPA 4DE2A 5GLBA 1BT5A 2E8IA 3EQUA 3O88A 2WAFA 1FCNA 4E6WA 1MWTA 4BENA 2GDNA 4R0QA 1ALQA 5KMWA 3V3SA 4BQMA 1IKGA 5FQMA 2WKEA 1XKZA 3UPNA 4RA7A 4ZJ3A 5M18A 1L0DA 5CRFA 3PBSA 4QJGA 4HBTA 4LV2A 5EVIB 2ZQ8A 3FV7A 2A3UA 1EWZA 1BLHA 2WADA 1PWDA 1ERQA 3G35A 1CK3A 2ZM2A 4WEKA 4Y0OA 1BTLA 4N1XA 2Y55A 1YLTA 3HUNA 4CPKA 1GA0A 1TDLA 3B3XA 3LCEA 1IKIA 4KQRA 3MZDA 5F1FA 4K91A 1HZOA 4LV3A 3BFCA 4WZ4A 3O3VA 1W7FA 5E2EA 4ZDXA 3G32A 3IF6A 1KVMA 4RVAA 3RJUA 4X55A 1OMEA 2EX6A 3VSLA 4EV4A 4OPRA 4JXVA 4OLGA 3UO9A 3GV9A 3OC2A 3G34A 5FQKA 3NDEA 2XH9A 2ZQDA 1YMSA 3N8RA 1C3BA 1I2WA 5CGWA 4B4ZA 4EBNA 4JBFA 1NYMA 3C4PA 3UE0A 3A3IA 4OVDA 4S2LA 3TG9A 2EX9A 4BD1A 3HUMA 1XX2A 4X56A 5DF7A 5CERA 4OONA 1LLBA 2WGVA 3Q7VA 4B4XA 1DY6A 2HP6A 1JWZA 2XF3A 2XFSA 3LY3A 4IVKA 4BL2A 4PM5A 2X01A 4PMAA 1L0GA 2JE5A 1FCOA 2WZXA 2WGWA 1PZPA 3OCLA 4PM7A 4R1GA 3M2JA 3N4IA 3TSGA 4WEJA 2X02A 3IF6B 4N92A 4ZJ1A 1Y54A 2XD5A 3GQZA 3ZG8B 4C3QA 4GB7A 3V39A 3SH7A 3C7VA 5CHMA 3CMZA 5FAPA 2P9VA 3UPOA 3PTEA 3IQAA 3GVBA 5CEBA 1MPLA 5CHUA 1HVBA 5EPHA 2HP9A 1JWVA 3P09A 2Z2LB 5HFOA 3MZEA 1NRFA 3E2KA 4H8RA 2J9PA 3E2LA 3IHAA 3OCNA 3C5AA 1Z6FA 4XUXA 1DJBA 1NJ4A 1M40A 3DWZA 3A3FA 5EOOA 2IWCA 4P87A 5FATA 4K0WA 2Y2JA 1H8ZA 5F82A 4GOGA 3ZFZA 5JYOA 1S0WA 4LV1A 1WYCA 3ZNYA 2G2UA 2BG1A 3VP2A 4OP8A 1CI9A 2HP5A 4E6XA 1NY0A 2P74A 1GHPA 1K56A 1MXOA 2JC7A 3ISGA 5EECA 1NZOA 3ZDJA 3IWOA 2CC1A 3GSGA 1YLZA 1ESUA 3W4PA 1ZG6A 4PPRA 4DE3A 4QB8A 3FKWA 2ZJ9A 4EBLA 2HPBA 4E3LA 1IYOA 5A90A 2DCFA 1YT4A 2XLNA 2ZC5B 3IXBA 4JXGA 4OQ0A 4KZ9A 3PBOA 5DF9A 5CEDA 1PI5A 3LY4A 3OPPA 3V5MA 1XA7A 3UDXA 2VGJA 5HARA 3BLMA 1S6RA 1ESIA 3NI9A 4B88A 1LL5A 1L0EA 5AQ7A 5FDHA 5JYPA 3WS2A 3IH8A 5HAIA 1BUEA 1GCEA 1FR1A 1YLPA 3MKFA 5FA7A 3ZVWA 1TVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SS5 A;  4R4R A;  1XXM A;  2ZM8 A;  2H5S A;  3RXX A;  4QU3 A;  2Y2L A;  4S2J A;  4ZJ2 A;  4K0X A;  4Z9Q A;  2ZM0 A;  4KZB A;  2PU4 A;  3BEB A;  4RX2 A;  4LCL A;  2OV5 A;  2C6W B;  2B5R A;  4MBH A;  4U3T A;  1ES2 A;  1PW1 A;  5CTM A;  3SS4 A;  1SDE A;  1KGF A;  1Q2P A;  3LEZ A;  4KQO A;  4U0X A;  3VOY A;  2WZZ A;  4KG5 A;  3TOI A;  4N1H A;  2V20 A;  3UY6 A;  4WZ5 C;  3FYZ A;  4OH0 A;  4E3O A;  1FR6 A;  1KGE A;  1SHV A;  3HLB A;  3ZG5 A;  1K6R A;  2IWB A;  4RYE A;  2EX2 A;  5J8X A;  1ZKJ A;  3HBR A;  1BLS A;  3UE3 A;  1BUL A;  1O07 A;  3C7U A;  4ID4 A;  3V3R A;  4JKT A;  2EFU A;  3I7J A;  3NDG A;  2OLV A;  1IYQ A;  3N8L A;  3NC8 A;  3DW0 A;  4ZTK A;  2Y91 A;  3HUO A;  2FFY A;  5GLA A;  2WYX A;  4WBG A;  1KE3 A;  2H0T A;  2Y2I A;  4XXR A;  5EE8 A;  5HL1 A;  4DE0 A;  4QY5 A;  3ZHH A;  2HDQ A;  4E3J A;  2PU2 A;  1JTG A;  4YFM A;  2XGN A;  3P98 A;  1ZG4 A;  4OPQ A;  5F1G A;  3OPL A;  4OP5 A;  3HRE A;  3GRJ A;  4E3I A;  3WS4 A;  1W8Y A;  3C4O A;  1SDN A;  3O87 A;  1NYY A;  1DJC A;  3A3D A;  4PM6 A;  5CGX A;  2ZMA A;  1FSW A;  1E25 A;  4KG2 A;  1LL9 A;  5FAQ A;  3MFD A;  3VFH A;  1ES5 A;  4IVI A;  4DE1 A;  5A93 A;  5F83 A;  3NBL A;  1FCM A;  2RL3 A;  1W79 A;  3EQV A;  1RGZ A;  4IBX A;  1ERM A;  4S2N C;  4UA6 A;  4M3K A;  3UNW A;  5E2F A;  1K57 C;  5AQA A;  1WYB A;  3W8K A;  4JXW A;  1BLP A;  1K6S A;  3N7W A;  3BLS A;  3BEC A;  3HLW A;  4KZ6 A;  4GN2 A;  2XFT A;  2ZC4 B;  4FH2 A;  1ZC2 A;  5FQI A;  3VOZ A;  1AXB A;  1QME A;  4KZ3 A;  4WEL A;  4JXS A;  2FFF B;  1ONH A;  3SOI A;  4GZB A;  3HLC A;  4DKI A;  2R9W A;  2BLS A;  4UA9 A;  4HEF A;  3Q81 A;  4JF6 A;  1IYP A;  5FI6 A;  4DRT A;  4E3N A;  3GMW A;  2Y2N A;  3CZD A;  4Y0U A;  4KG6 A;  4C75 A;  4R4S A;  4FD8 A;  5FQJ A;  3SH9 A;  1K4E A;  3QHY A;  2XK1 A;  1PYY A;  1VQQ A;  5GL9 A;  4WZ5 A;  3A3E A;  2Y59 A;  1PIO A;  2JBF A;  4GNU A;  3O86 A;  3M6H A;  3HLE A;  1CI8 A;  4KQQ A;  5TGF A;  4R3J A;  3PBQ A;  3IHB A;  4P0M A;  4Q8I A;  3IXD A;  3BM6 A;  2OLU A;  4Y0T A;  2WAE A;  1I5Q A;  3VFF A;  3N8S A;  3ITA A;  4EQI A;  1FQG A;  1TEM A;  2G2W A;  1KE4 A;  1SCW A;  4QY6 A;  5FAS A;  2X71 A;  2Z2M B;  3MXR A;  1MY8 A;  3HLG A;  1K25 A;  2Y4A A;  1IEM A;  4S2O A;  1ES3 A;  3VMA A;  3RXW A;  3IT9 A;  3BFE A;  2DRW A;  5HW3 A;  3IWQ A;  5U47 A;  2HDS A;  5L2F A;  1K38 A;  3PBN A;  1ERO A;  4U0T A;  3QNB A;  2WKI A;  2WUQ A;  3M2K A;  1GHI A;  3N6I A;  4LEN A;  5HX9 A;  4MNR A;  2ZC6 B;  3CJM A;  5D3O A;  3W4O A;  3OPH A;  4R3B A;  4S2P A;  1LI0 A;  5GHY A;  4E3K A;  4P85 A;  4A5R A;  4OPZ A;  4IBR A;  4S2N A;  5TFQ A;  1YQS A;  5DVA A;  3VP1 A;  1K57 A;  4PM8 A;  4BJP A;  3HLF A;  3ZVT A;  3ZGA B;  4ZAM A;  4BD0 A;  3SS3 A;  2Y2G A;  1BLC A;  3QNC A;  5IHV A;  1HD8 A;  4S2I A;  1DJA A;  1YLY A;  4FH4 A;  4JF5 A;  4E3M A;  1N9B A;  5TR7 A;  2VGK A;  2J8Y A;  2Y2Q A;  1RGY A;  3DTM A;  4PM9 A;  1XPB A;  1L2S A;  2V1Z A;  4XUZ A;  3VP0 A;  2V2F F;  1WE4 A;  1E4D A;  1EI5 A;  4EBP A;  4JPM A;  2JCH A;  5M1A A;  1VM1 A;  5A92 A;  4F94 A;  3VSK A;  5GHX A;  4GD8 A;  3FWL A;  2EFX A;  2IWD A;  4KZ4 A;  3BFG A;  1PWG A;  4WMC D;  1LHY A;  5FQQ A;  1E3U D;  3DWK A;  4OQI A;  3JYI A;  4OOM A;  2EXB A;  4L0L A;  1L0F A;  1K55 C;  4D2O A;  3IXG A;  1MBL A;  2OSU A;  3SH8 A;  4HBU A;  2ZC7 A;  2ZQ7 A;  4S2K A;  3WS0 A;  2XR0 A;  1U60 A;  4GDN A;  4EWF A;  1PZO A;  5EVI D;  3WRT A;  1MWU A;  3G4P A;  5HAP A;  4GKU A;  1G6A A;  1XGJ A;  4P6B A;  2XQZ A;  2ZQC A;  3WWX A;  2Y2H A;  2A49 A;  4CJN A;  3A3J A;  2WKH A;  3NY4 A;  1IYS A;  5AQ9 A;  1GA9 A;  4ZBE A;  3BRM A;  1LI9 A;  2J9O A;  4X68 A;  3OPR A;  4O7D A;  4QHC A;  1XP4 A;  1YLW A;  4UA7 A;  3MZF A;  1Q2Q A;  4X6T A;  4BLM A;  5GLD A;  2Y2P A;  1KVL A;  2RCX A;  3VP3 A;  5FAO A;  3ZG0 A;  3UN7 A;  3WRZ A;  1K54 C;  4KEN B;  4QD4 A;  3W4Q A;  4KZ7 A;  5CHJ A;  5EOE A;  1H8Y A;  3Q7Z A;  4MEZ A;  1J9M A;  5GHZ A;  1NZU A;  1FOF A;  4GD6 A;  3GR2 A;  1HTZ A;  1TDG A;  4KZ8 A;  3G2Z A;  3AGE A;  3ZNT A;  3HVF A;  1KGG A;  2HDR A;  3PAG A;  1PI4 A;  1RCJ A;  1QMF A;  1XGI A;  1YMX A;  4X69 A;  3NIA A;  3ZG9 B;  5EVI C;  4LCM A;  2DNS A;  2HDU A;  2ZD8 A;  3G31 A;  4EUZ A;  1YLJ A;  3WS1 A;  5HAQ A;  3Q07 A;  1MWR A;  2H0Y A;  4DDS A;  2QPN A;  1M6K A;  3PAE A;  5EUA A;  3G2Y A;  4MBK A;  1JWP A;  1PWC A;  4NET A;  2J7V A;  2XD1 A;  5CTN A;  3BFD A;  4LV0 A;  3ZCZ A;  5CEC A;  5KZH A;  3ZG7 B;  4FCF A;  1MWS A;  3IH9 A;  4HES A;  1I2S A;  2PBY A;  2EXA A;  2EX8 A;  4NK3 A;  5I94 A;  5CXW A;  2Q9M A;  2Y2M A;  2WK0 A;  2ZQA A;  4DDY A;  5CGS A;  2H10 A;  4RX3 A;  1BZA A;  2QMI A;  4DXB A;  1K55 A;  3AGF A;  4OOL A;  2ZC3 B;  4DXC A;  3PBR A;  3S22 A;  3HLD A;  2C5W B;  2XEP A;  4OQH A;  1ONG A;  2I72 A;  3S1Y A;  4JF4 A;  3CG5 A;  3UE1 A;  4KZ5 A;  1NXY A;  1ES4 A;  3IWI A;  4GDB A;  5FI2 A;  4MBF A;  4MLL A;  5EVL A;  3Q82 A;  4JLF A;  2Q9N A;  4WYY A;  3OZH A;  3Q7V B;  4R23 A;  3M6B A;  1JTD A;  1N4O A;  4OKP A;  1FSY A;  4OQG A;  3LO7 A;  2WGW B;  5DTS A;  3VP4 A;  3Q1F A;  5AQB A;  3S4X A;  5E2G A;  4DF6 A;  5KSH A;  2Y2K A;  5FSR A;  4C6Y A;  3IF6 C;  3UDI A;  2UWX A;  1W5D A;  5KSC A;  1JVJ A;  3BFF A;  3ITB A;  3PBT A;  1MKI A;  4OPY A;  1K54 A;  1XA1 A;  2Y2O A;  2R9X A;  3G30 A;  4FSF A;  4YIN A;  2P9V B;  5M19 A;  4WMC A;  3MBZ A;  3MKE A;  4UHU A;  1E3U A;  2WGI A;  2XDM A;  3IF5 A;  5BOH A;  1SKF A;  5DTK A;  1CEG A;  2ZLY A;  1YM1 A;  3D4F A;  3NCK A;  4IED A;  5FI7 A;  1H5X A;  3UDF A;  3FZC A;  4S2M A;  4N9K A;  1K4F A;  3FKV A;  5A91 A;  3MXS A;  4KZA A;  4N9L A;  5DF8 A;  5G18 A;  1O7E A;  1KE0 A;  3IXH A;  4OLD A;  4WM9 A;  1KDS A;  4X53 A;  5EVI A;  3WS5 A;  4UAA A;  5E43 A;  3V50 A;  5FQ9 A;  1GHM A;  1K56 D;  3AGD A;  5GLC A;  3HL9 A;  1G68 A;  1RP5 A;  1W8Q A;  3BYD A;  1CEF A;  5DTT A;  1PW8 A;  2ZQ9 A;  1IEL A;  4BL3 A;  5E2H A;  4OOY A;  4Y7P A;  3GTC A;  1KDW A;  2QZ6 A;  1BSG A;  3UPP A;  4DE2 A;  5GLB A;  1BT5 A;  2E8I A;  3EQU A;  3O88 A;  2WAF A;  1FCN A;  4E6W A;  1MWT A;  4BEN A;  2GDN A;  4R0Q A;  1ALQ A;  5KMW A;  3V3S A;  4BQM A;  1IKG A;  5FQM A;  2WKE A;  1XKZ A;  3UPN A;  4RA7 A;  4ZJ3 A;  5M18 A;  1L0D A;  5CRF A;  3PBS A;  4QJG A;  4HBT A;  4LV2 A;  5EVI B;  2ZQ8 A;  3FV7 A;  2A3U A;  1EWZ A;  1BLH A;  2WAD A;  1PWD A;  1ERQ A;  3G35 A;  1CK3 A;  2ZM2 A;  4WEK A;  4Y0O A;  1BTL A;  4N1X A;  2Y55 A;  1YLT A;  3HUN A;  4CPK A;  1GA0 A;  1TDL A;  3B3X A;  3LCE A;  1IKI A;  4KQR A;  3MZD A;  5F1F A;  4K91 A;  1HZO A;  4LV3 A;  3BFC A;  4WZ4 A;  3O3V A;  1W7F A;  5E2E A;  4ZDX A;  3G32 A;  3IF6 A;  1KVM A;  4RVA A;  3RJU A;  4X55 A;  1OME A;  2EX6 A;  3VSL A;  4EV4 A;  4OPR A;  4JXV A;  4OLG A;  3UO9 A;  3GV9 A;  3OC2 A;  3G34 A;  5FQK A;  3NDE A;  2XH9 A;  2ZQD A;  1YMS A;  3N8R A;  1C3B A;  1I2W A;  5CGW A;  4B4Z A;  4EBN A;  4JBF A;  1NYM A;  3C4P A;  3UE0 A;  3A3I A;  4OVD A;  4S2L A;  3TG9 A;  2EX9 A;  4BD1 A;  3HUM A;  1XX2 A;  4X56 A;  5DF7 A;  5CER A;  4OON A;  1LLB A;  2WGV A;  3Q7V A;  4B4X A;  1DY6 A;  2HP6 A;  1JWZ A;  2XF3 A;  2XFS A;  3LY3 A;  4IVK A;  4BL2 A;  4PM5 A;  2X01 A;  4PMA A;  1L0G A;  2JE5 A;  1FCO A;  2WZX A;  2WGW A;  1PZP A;  3OCL A;  4PM7 A;  4R1G A;  3M2J A;  3N4I A;  3TSG A;  4WEJ A;  2X02 A;  3IF6 B;  4N92 A;  4ZJ1 A;  1Y54 A;  2XD5 A;  3GQZ A;  3ZG8 B;  4C3Q A;  4GB7 A;  3V39 A;  3SH7 A;  3C7V A;  5CHM A;  3CMZ A;  5FAP A;  2P9V A;  3UPO A;  3PTE A;  3IQA A;  3GVB A;  5CEB A;  1MPL A;  5CHU A;  1HVB A;  5EPH A;  2HP9 A;  1JWV A;  3P09 A;  2Z2L B;  5HFO A;  3MZE A;  1NRF A;  3E2K A;  4H8R A;  2J9P A;  3E2L A;  3IHA A;  3OCN A;  3C5A A;  1Z6F A;  4XUX A;  1DJB A;  1NJ4 A;  1M40 A;  3DWZ A;  3A3F A;  5EOO A;  2IWC A;  4P87 A;  5FAT A;  4K0W A;  2Y2J A;  1H8Z A;  5F82 A;  4GOG A;  3ZFZ A;  5JYO A;  1S0W A;  4LV1 A;  1WYC A;  3ZNY A;  2G2U A;  2BG1 A;  3VP2 A;  4OP8 A;  1CI9 A;  2HP5 A;  4E6X A;  1NY0 A;  2P74 A;  1GHP A;  1K56 A;  1MXO A;  2JC7 A;  3ISG A;  5EEC A;  1NZO A;  3ZDJ A;  3IWO A;  2CC1 A;  3GSG A;  1YLZ A;  1ESU A;  3W4P A;  1ZG6 A;  4PPR A;  4DE3 A;  4QB8 A;  3FKW A;  2ZJ9 A;  4EBL A;  2HPB A;  4E3L A;  1IYO A;  5A90 A;  2DCF A;  1YT4 A;  2XLN A;  2ZC5 B;  3IXB A;  4JXG A;  4OQ0 A;  4KZ9 A;  3PBO A;  5DF9 A;  5CED A;  1PI5 A;  3LY4 A;  3OPP A;  3V5M A;  1XA7 A;  3UDX A;  2VGJ A;  5HAR A;  3BLM A;  1S6R A;  1ESI A;  3NI9 A;  4B88 A;  1LL5 A;  1L0E A;  5AQ7 A;  5FDH A;  5JYP A;  3WS2 A;  3IH8 A;  5HAI A;  1BUE A;  1GCE A;  1FR1 A;  1YLP A;  3MKF A;  5FA7 A;  3ZVW A;  1TVF A; 
#chains in the Genus database with same CATH topology
 1OPX A;  2PD8 A;  4QU3 A;  3EWK A;  1EW0 A;  5A8B A;  2A2L A;  4Z1W A;  1PW1 A;  3SS4 A;  3LEZ A;  4KG5 A;  3F1P A;  4WZ5 C;  4E3O A;  1FR6 A;  1SHV A;  3ZG5 A;  1K6R A;  5L10 A;  2GNX A;  4IJG A;  4PKY G;  1BUL A;  4ARZ B;  3EEH A;  4EQ1 A;  2FFY A;  4WBG A;  2H0T A;  2GJ3 A;  5EE8 A;  5HL1 A;  2HDQ A;  5L09 A;  3UB8 A;  1ZG4 A;  2ZOI A;  5F1G A;  3OPL A;  4OP5 A;  5CGX A;  3A0R A;  1P9R A;  4L9F A;  4IVI A;  2RL3 A;  2INW A;  1ERM A;  2QYB A;  4S2N C;  1K57 C;  4QPR A;  5AQA A;  1BLP A;  3N7W A;  4GN2 A;  3IX3 A;  3VOZ A;  4WEL A;  4JXS A;  3SOI A;  1NRJ A;  1IYP A;  5FI6 A;  3R7W A;  4C75 A;  2PT7 A;  3MQQ A;  4MN7 A;  4P6Z M;  1Z09 A;  1PYY A;  3RTY A;  1ACF A;  3A3E A;  1PIO A;  4GNU A;  3O86 A;  5TGF A;  3MJQ A;  3PBQ A;  4LGW A;  4BWI A;  2OLU A;  1I5Q A;  3ITA A;  1TEM A;  2G2W A;  4LRZ E;  4QY6 A;  5FAS A;  2X71 A;  1IEM A;  1ES3 A;  3BFE A;  2R78 A;  5U47 A;  1ERO A;  4ETX A;  3M2K A;  3N6I A;  3CJM A;  3E4Q A;  5D3O A;  1T19 A;  4HP9 A;  4R3B A;  5TBM A;  2B02 A;  4HI4 A;  3MQO A;  4P85 A;  4A5R A;  2VV6 A;  1XFN A;  4HOI A;  1PNE A;  4PM8 A;  3HLF A;  5J3W A;  2Y2G A;  5IHV A;  1HD8 A;  2VZW A;  1YLY A;  4RQ9 A;  4E3M A;  4GLQ A;  1S4S A;  1H8M A;  2PYP A;  2Q0O A;  2VGK A;  1XPB A;  4YWZ A;  4FUW A;  5M1A A;  2PRF A;  3IS2 B;  4LFU A;  5DJT A;  5A92 A;  4K08 A;  2QJ5 A;  2IWD A;  4EES A;  5FQQ A;  4OQI A;  5HWT A;  3H7W A;  3C8C A;  2HGV A;  1K55 C;  4D2O A;  2WKP A;  2ZC7 A;  2LB9 A;  4PAU A;  4GDN A;  3G4P A;  1GSW A;  4P6B A;  3WWX A;  2HJ9 C;  1TS0 A;  4O8G A;  1GA9 A;  2JKT M;  4UA7 A;  3MZF A;  4X1M A;  4BLM A;  1VEU A;  1KVL A;  3VP3 A;  3ZG0 A;  1DP6 A;  3UN7 A;  3WRZ A;  4KEN B;  3LI8 A;  5CHJ A;  1OJG A;  4NG2 A;  3F1O B;  1P0Z A;  1XGI A;  3LI9 A;  4GJ4 A;  2VGL S;  5EVI C;  4CLC C;  2OWH A;  4DDS A;  4MBK A;  2XD1 A;  3NOU C;  3SW1 A;  2EWW A;  3BQ8 A;  4NK3 A;  2EXA A;  5CXW A;  2Q9M A;  4DDY A;  5CGS A;  2H10 A;  1D7E A;  5F5Y A;  2QMI A;  3A0V A;  1F2K A;  4WUJ A;  2K2N A;  1ONG A;  2I72 A;  4JF4 A;  3LIE A;  5F6A A;  1ES4 A;  4MLL A;  3Q82 A;  4JLF A;  2Q9N A;  4WYY A;  3Q7V B;  4R23 A;  1N4O A;  3PXP A;  3T1S A;  4I3A A;  2WGW B;  3VP4 A;  5HSQ A;  5E2G A;  4DF6 A;  2QKP A;  4JGO A;  5FSR A;  3UDI A;  4G3V A;  2QHK A;  2R9X A;  4EU0 A;  5M19 A;  3MKE A;  2M7V A;  2XDM A;  4HIA A;  5DTK A;  3CHW P;  2ZLY A;  4IED A;  4S2M A;  5DF8 A;  4AFI A;  5E43 A;  1G68 A;  1W8Q A;  5DTT A;  1PW8 A;  2ZQ9 A;  4HHD A;  3TW8 A;  3GTC A;  2W0N A;  3CUE C;  3O88 A;  1FCN A;  4E6W A;  4R0Q A;  2WKE A;  3UPN A;  4ZJ3 A;  1L0D A;  4QJG A;  5EVI B;  4CLC B;  2WAD A;  1ERQ A;  3G35 A;  3HJI A;  4Y0O A;  2Y55 A;  3HUN A;  1GA0 A;  1TDL A;  3B3X A;  3LCE A;  1IKI A;  4K91 A;  3BFC A;  3O3V A;  1W7F A;  3B33 A;  3G32 A;  1OME A;  3VSL A;  4EV4 A;  4OPR A;  1OT9 A;  3KYZ A;  4NXF A;  3GV9 A;  3F1P B;  3N8R A;  3C4P A;  4E04 A;  4OVD A;  2EX9 A;  5CER A;  2WGV A;  3LIC A;  4BL2 A;  3BY9 A;  1L0G A;  4H6J B;  4KQD A;  1PZP A;  3OCL A;  3U4L P;  3S7N A;  2P08 A;  4WEJ A;  3ZG8 B;  3C7V A;  3PTE A;  3IQA A;  5CEB A;  1HVB A;  1SKO B;  2W3D A;  3P09 A;  3E2K A;  4H8R A;  2W3H A;  3IHA A;  3E2L A;  2W1T A;  2Y2J A;  1TD5 A;  1UWN X;  4LV1 A;  1WYC A;  2G2U A;  4F3L A;  1CI9 A;  1YPR A;  4E6X A;  4DN0 A;  5AVE A;  3OOV A;  3BWL A;  3IWO A;  1ESU A;  1VHM A;  2VKS A;  2P7J A;  2ZJ9 A;  2HPB A;  1IYO A;  2DCF A;  2ZC5 B;  2VV7 A;  1HLU P;  4KZ9 A;  3RFB A;  3OPP A;  1JNU A;  1XA7 A;  5AQ7 A;  4Y5F A;  5HAI A;  2NUT C;  1BUE A;  1GCE A;  1FR1 A;  3MKF A;  3E98 A;  5FA7 A;  2WKQ A;  4R4R A;  2H5S A;  4S2J A;  4L9E A;  4K0X A;  4KZB A;  2PU4 A;  2VK3 A;  3LR0 A;  4LCL A;  4BBV A;  2C6W B;  4U3T A;  3FPV A;  5CTM A;  1KGF A;  2WZZ A;  4OH0 A;  1KGE A;  3HLB A;  5TBM B;  1ZKJ A;  3HBR A;  3L7H A;  5HZH A;  1O07 A;  2BAS A;  3LIB A;  3V3R A;  3L9K A;  1IYQ A;  3N8L A;  4ZTK A;  3HUO A;  2WYX A;  1XJ2 A;  1KE3 A;  3ZHH A;  4YFM A;  3VE4 A;  4OPQ A;  2PHY A;  3HRE A;  4GW9 A;  3WS4 A;  1D1J A;  1W8Y A;  1SDN A;  3OBF A;  4GCZ A;  1DJC A;  1X0O A;  3A3D A;  1E25 A;  4KG2 A;  3DAV A;  1LL9 A;  2KX6 A;  4JGQ A;  3VFH A;  4DE1 A;  2VX8 A;  5F83 A;  5A93 A;  3NBL A;  4X25 A;  3UMD A;  1RGZ A;  4UA6 A;  4M3K A;  3UNW A;  3T1X A;  5E2F A;  1NLY A;  3BLS A;  1ZC2 A;  5FQI A;  1AXB A;  4KZ3 A;  1NLZ A;  4DKI A;  4UA9 A;  4HEF A;  4DRT A;  4E3N A;  3GMW A;  4CQH A;  4Y0U A;  3QP8 A;  2QJ7 A;  1S1Y A;  1AWI A;  5FQJ A;  1K4E A;  1VQQ A;  2JN7 A;  5GL9 A;  1N9N A;  1YAX A;  1CI8 A;  3IHB A;  4Q8I A;  1OTB A;  1XJ6 A;  2WAE A;  3VFF A;  4MDZ A;  1ZTU A;  1MY8 A;  2YKH A;  4LRX C;  2VGL M;  3F1N A;  5HDC A;  2ZL1 A;  2DRW A;  5HW3 A;  5L2F A;  2HDS A;  2WKI A;  1S67 L;  2ZC6 B;  1FIK A;  1STZ A;  5C5K A;  3W4O A;  3OPH A;  1MZU A;  2PR6 A;  1TS6 A;  4IBR A;  5TFQ A;  3T4K A;  3VP1 A;  3ZGA B;  4ZAM A;  3SS3 A;  5EV0 A;  5TR7 A;  4GS9 A;  2Y2Q A;  2J8Y A;  1RGY A;  3DTM A;  5FDS A;  3VP0 A;  2V2F F;  1WE4 A;  1EI5 A;  3K3C A;  4JPM A;  3BQA A;  1VM1 A;  2A24 A;  2V0U A;  4DJ2 A;  2J80 A;  3FWL A;  4KZ4 A;  4L0L A;  1L0F A;  2O9B A;  3SH8 A;  4S2K A;  2XR0 A;  1U60 A;  1DRM A;  4EWF A;  1PZO A;  2ZQC A;  4MMN A;  2WKH A;  3NY4 A;  3BRM A;  3P01 A;  4X68 A;  4O7D A;  4QHC A;  3KYQ A;  4X6T A;  5L8M A;  4QD4 A;  2D01 A;  2D02 A;  3Q7Z A;  1J9M A;  5GHZ A;  1NZU A;  4GD6 A;  2OAQ 1;  1S1Z A;  2OAP 1;  1YSP A;  3ZNT A;  3QP6 A;  3HVF A;  1KGG A;  1LSX A;  5F68 A;  1PI4 A;  1RCJ A;  4HQA A;  4CLC E;  4LCM A;  3G31 A;  1YLJ A;  2H0Y A;  3PAE A;  3G2Y A;  2UV0 E;  1PWC A;  4G3W A;  5CTN A;  5KZH A;  5CEC A;  4Y3I A;  1MWS A;  1I2S A;  2ZBB A;  4O0P A;  2PBY A;  4IUK A;  2EX8 A;  5I94 A;  2Y2M A;  2ZQA A;  4HJ4 A;  4RX3 A;  3LYX A;  5L07 A;  2ZC3 B;  3PBR A;  3S22 A;  3EGX C;  5IU1 A;  1VET A;  1NXY A;  4GDB A;  3IWI A;  3CWF A;  1JTD A;  1FSY A;  4OQG A;  3LO7 A;  5DTS A;  4HY8 A;  5J4E A;  5KSH A;  2Z6D A;  5EM0 A;  3JVV A;  2JKR I;  3NHQ A;  4C6Y A;  4FOF A;  1JVJ A;  2V0W A;  3IX4 A;  3BFF A;  2J3T C;  4Y13 A;  1K54 A;  1XA1 A;  4EXO A;  3G30 A;  1S4R A;  3MBZ A;  5BOH A;  1OTD A;  3NCK A;  3UDF A;  4N9K A;  4DJ3 A;  4KUK A;  3FKV A;  5A91 A;  2KLI A;  2BTF P;  4N9L A;  5G18 A;  1O7E A;  3V50 A;  5FQ9 A;  3AGD A;  2L1M A;  3HL9 A;  5HDS A;  5E2H A;  3D3O A;  4OOY A;  3VE3 A;  2QZ6 A;  3EOI A;  4DE2 A;  1BT5 A;  3EQU A;  2MJ6 A;  2WAF A;  5KIZ A;  4BEN A;  2GDN A;  5FQM A;  1PWD A;  4IUH A;  4WEK A;  1BTL A;  4CPK A;  1P9W A;  4HNB A;  4KQR A;  3IF6 A;  2EX6 A;  3OC2 A;  2ZQD A;  4GHI B;  1YMS A;  3PR6 A;  3MXQ A;  4JBF A;  3TG9 A;  4BD1 A;  3HUM A;  1ZHH B;  4X56 A;  5DF7 A;  4OON A;  2PBD P;  5HWW A;  3H82 A;  2XF3 A;  2G7U A;  4PM5 A;  1CJF A;  4PM7 A;  1KOU A;  4R1G A;  1LSV A;  3TJZ C;  2X02 A;  4N92 A;  3B47 A;  4C3Q A;  2P9V A;  5J7E A;  1MPL A;  5EPH A;  5HFO A;  1JWV A;  1Y4O A;  2V1B A;  2J9P A;  3OCN A;  1Z6F A;  4XUX A;  1DJB A;  3DTI A;  2IWC A;  2PAV P;  4P87 A;  1H8Z A;  5JYO A;  3VP2 A;  1GHP A;  2JC7 A;  3GSG A;  3W4P A;  4DE3 A;  4O01 A;  4E3L A;  5A90 A;  2XLN A;  1YT4 A;  3PBO A;  4UQI S;  5DF9 A;  3PYP A;  3V5M A;  3BLM A;  1ESI A;  1LL5 A;  5AJG A;  5JYP A;  3ZVW A;  4ARZ A;  1MKM A;  5DKL A;  2ZM8 A;  3RXX A;  4ZJ2 A;  1K0K A;  4Y15 A;  3KSF A;  2ZM0 A;  3CPT B;  3F1N B;  2OV5 A;  1T1A A;  2ZL1 B;  4MBH A;  2VA0 A;  1ES2 A;  3LIA A;  4LLO B;  3MSH A;  3VOY A;  1SDE A;  4KQO A;  4U0X A;  3NEC A;  3TOI A;  4N1H A;  2VLG A;  2V20 A;  3LFV A;  1CQA A;  2EX2 A;  3UE3 A;  1LL8 A;  2I9V A;  3CAX A;  3C7U A;  4ID4 A;  4JKT A;  2K7S A;  5LBR A;  3I7J A;  3DW0 A;  2Y91 A;  5HD3 A;  2Y2I A;  3QP1 A;  4E3J A;  3RH8 B;  1JTG A;  4GS9 B;  2B95 A;  4E3I A;  3O87 A;  1NYY A;  4PM6 A;  2ZMA A;  3B42 A;  1FSW A;  5FAQ A;  3MFD A;  3LID A;  5HWV A;  3G6O A;  1FCM A;  1W79 A;  3LUQ A;  1WYB A;  3W8K A;  4JXW A;  3HLW A;  4KZ6 A;  2XFT A;  4FH2 A;  3VV4 A;  1ONH A;  3HLC A;  3MMH A;  4JF6 A;  3E0Y A;  3IBJ A;  3CZD A;  1UWP X;  3SH9 A;  3UB9 A;  2OWJ A;  4WZ5 A;  1OTA A;  3K3D A;  2JBF A;  1L3L A;  3PHY A;  4R3J A;  4P0M A;  3MR0 A;  3BM6 A;  3N8S A;  3T4O A;  5HPI A;  4EER A;  1SCW A;  1YKD A;  3UB6 A;  3HLG A;  1K25 A;  2Y4A A;  3IBR A;  3R7W B;  3RXW A;  3IT9 A;  2W3E A;  3IWQ A;  1K38 A;  3PBN A;  3QNB A;  1N9O A;  4LEN A;  5HX9 A;  3IS2 A;  4MNR A;  1D06 A;  3DBA A;  4S2P A;  1LI0 A;  3LEQ A;  5GHY A;  4S2N A;  2LB5 A;  5DVA A;  1K57 A;  4BJP A;  3ZVT A;  5EFW A;  1BLC A;  1VET B;  4FH4 A;  2HV1 A;  1N9B A;  4PM9 A;  5DFX A;  1L2S A;  2V1Z A;  4XUZ A;  4B93 A;  1E4D A;  2DMW A;  4EBP A;  1GSX A;  2W27 A;  3VSK A;  4GD8 A;  2XA7 M;  4Y2F A;  3BFG A;  1LHY A;  3DWK A;  3JYI A;  2ZMV A;  4BBT A;  1H0M A;  3IXG A;  1MBL A;  4HBU A;  1MC0 A;  4M4X A;  1W63 M;  4MN6 A;  5HPF A;  3T4T A;  5EVI D;  4CLC D;  4GKU A;  1G6A A;  5AVF A;  2XQZ A;  3A3J A;  1IYS A;  4ZBE A;  1LI9 A;  2J9O A;  4NKP A;  3EEA A;  3UB7 A;  2QWS A;  4HH3 A;  2RCX A;  5FAO A;  3H7W B;  3MF0 A;  4XT2 A;  1BYW A;  4MEZ A;  5I5L A;  2P04 A;  3SZT A;  1F5M A;  1FOF A;  3GR2 A;  4KZ8 A;  3G2Z A;  4HH2 A;  3PAG A;  2HDR A;  1SZV A;  3NIA A;  4PHT A;  3T1Q B;  2FZ0 A;  2ZD8 A;  4EUZ A;  3WS1 A;  1MWR A;  2QPN A;  1M6K A;  4YNR A;  1JWP A;  4NET A;  2J7V A;  4LV0 A;  3ZG7 B;  4FCF A;  4HES A;  1VEU B;  2ACG A;  3C2W A;  2WK0 A;  4DXB A;  1K55 A;  4OOL A;  1DP9 A;  2XRO A;  3QP2 A;  4OQH A;  3CG5 A;  3UE1 A;  4KZ5 A;  5FI2 A;  5EVL A;  3OZH A;  2Y8H A;  3H82 B;  1S66 L;  4OKP A;  5G4Y A;  5HDD A;  3T4J A;  3Q1F A;  4I38 A;  3HCY A;  1G6O A;  2M1C A;  2UWX A;  4MCW A;  5KSC A;  4OPY A;  4YIN A;  2Y2O A;  3IX8 A;  2P9V B;  3C38 A;  2VV8 A;  4UHU A;  2M7U A;  3IF5 A;  1SKF A;  1CEG A;  3D4F A;  1YM1 A;  1H5X A;  3FZC A;  1LSW A;  1K4F A;  3S7Q A;  2NUP C;  3D72 A;  4KZA A;  1KE0 A;  3LR5 A;  4G3K A;  4OLD A;  1KDS A;  4R70 A;  4WM9 A;  4X53 A;  5EVI A;  3ULF A;  2K31 A;  4CLC A;  4UAA A;  1F98 A;  2V8F A;  3W2Z A;  1K56 D;  3T4Q A;  3BYD A;  1TF1 A;  1IEL A;  3UME A;  4Y7P A;  1KDW A;  4JGR A;  1BSG A;  2W1R A;  5GLB A;  4R6L A;  2E8I A;  2JKF A;  4UQI M;  3QP5 A;  5KMW A;  3V3S A;  4BQM A;  1IKG A;  3PBS A;  4HBT A;  4D60 A;  4LV2 A;  2ZQ8 A;  2HJE A;  3FV7 A;  2A3U A;  5DKK A;  1BLH A;  3CLO A;  3U2A A;  4KUO A;  3MZD A;  4H6J A;  5F1F A;  4LV3 A;  4WZ4 A;  5E2E A;  1KVM A;  4RVA A;  4X55 A;  4OLG A;  3UO9 A;  3G34 A;  3NOT C;  2XH9 A;  4WN5 A;  3OLO A;  1SKO A;  1C3B A;  4B4Z A;  4EET B;  3UB5 P;  3UE0 A;  3A3I A;  4S2L A;  1N9L A;  4NXB A;  4DMZ A;  1XX2 A;  1LLB A;  4B4X A;  1DY6 A;  2HP6 A;  1JWZ A;  2XFS A;  3LY3 A;  1CF0 A;  2JE5 A;  3QP4 A;  2WZX A;  2KDK A;  4BBU A;  4ZJ1 A;  3GQZ A;  2ZMF A;  3CUE A;  4GB7 A;  3V39 A;  5CHM A;  3CMZ A;  5FAP A;  1TS7 A;  5CHU A;  1NRF A;  3C5A A;  4QWO A;  3KSH A;  1NJ4 A;  3DWZ A;  3A3F A;  4NEE D;  4HP4 A;  4K0W A;  3KSI A;  1LT0 A;  5F82 A;  3MQ0 A;  4GOG A;  3ZFZ A;  1S0W A;  4UEY A;  3ZNY A;  2BG1 A;  1V9Z A;  2HP5 A;  1NY0 A;  3V67 A;  2JKT I;  2P74 A;  1K56 A;  1Y28 A;  3ISG A;  5EEC A;  1NZO A;  2XA7 S;  2CC1 A;  4PPR A;  3IXB A;  4EEP A;  2O9A A;  4Y17 A;  4OQ0 A;  4WF0 A;  2W1T B;  5CED A;  2KOI A;  3UDX A;  1IOU A;  3LIF A;  5HAR A;  3NI9 A;  4B88 A;  3WS2 A;  2WKR A;  4F3L B;  4X1L A;  1YLP A;  3S7O A;  3SS5 A;  1XXM A;  2Y2L A;  3TRC A;  4Z9Q A;  3BEB A;  2XSS A;  4RX2 A;  2VJW A;  3C30 A;  2B5R A;  4ETZ A;  1PFL A;  1Q2P A;  3UY6 A;  3FYZ A;  5MC7 A;  4Q0J A;  2IWB A;  4RYE A;  5J8X A;  1BLS A;  4JGP A;  1OJ5 A;  2EFU A;  4BMW A;  3NDG A;  3KYE A;  2OLV A;  1ODV A;  3NC8 A;  5GLA A;  4XXR A;  4Q0I A;  4DE0 A;  4QY5 A;  2PU2 A;  2XGN A;  3P98 A;  4R38 A;  3GRJ A;  4L9G A;  4MN5 A;  1OT6 A;  3C4O A;  1ES5 A;  4EW7 A;  3EQV A;  2JKR M;  4IBX A;  2JKG A;  4NXE A;  1K6S A;  3BEC A;  1P97 A;  4I3J A;  3DTK A;  3T4S A;  2ZC4 B;  1QME A;  1UGU A;  3CI6 A;  3K2N A;  2FFF B;  2PR5 A;  4GZB A;  2R9W A;  2BLS A;  2V8C A;  3Q81 A;  3VOL A;  2Y2N A;  4KG6 A;  4R4S A;  4FD8 A;  3QHY A;  2XK1 A;  1XJ4 A;  3TE8 A;  2FH5 A;  2Y59 A;  3NUL A;  3M6H A;  1J3W A;  3HLE A;  4KQQ A;  1G28 A;  1YSQ A;  3IXD A;  4Y0T A;  4XT2 B;  5K5B A;  4I3I A;  4EQI A;  1FQG A;  1W63 Q;  1KE4 A;  4YOF A;  2AVX A;  2Z2M B;  3MXR A;  1WA9 A;  4S2O A;  3VMA A;  5EM1 A;  3T12 B;  4U0T A;  2WUQ A;  1GHI A;  3S7P A;  2OOL A;  3T1R A;  4E3K A;  4OPZ A;  1YQS A;  3KSG A;  1IFQ A;  4R3A A;  2IA2 A;  4BD0 A;  3QNC A;  4S2I A;  3E4P A;  2GX5 A;  1DJA A;  4JF5 A;  2W3F A;  2ZOH A;  5IS1 A;  5HD5 A;  1PRQ A;  4WL9 A;  1T1C A;  4EUV A;  2JCH A;  3FPW A;  4F94 A;  5CX7 A;  5GHX A;  2EFX A;  1PWG A;  4WMC D;  1E3U D;  1VB6 A;  4OOM A;  2EXB A;  4I39 A;  2L4R A;  2OSU A;  2ZQ7 A;  2E8J A;  3KO6 A;  3WS0 A;  5TJJ A;  3WRT A;  1MWU A;  5HAP A;  2CMN A;  3DTE A;  1XGJ A;  2Y2H A;  2A49 A;  4CJN A;  4LRY C;  4P6Z S;  5AQ9 A;  2A24 B;  3T50 A;  3OPR A;  1H3Q A;  1XP4 A;  4B9O A;  1YLW A;  1Q2Q A;  3CIT A;  5GLD A;  2Y2P A;  3BY8 A;  1FIL A;  2PDR A;  2B18 A;  1K54 C;  1GSV A;  3T4L A;  3W4Q A;  4KZ7 A;  1H8Y A;  3JPU A;  1G5U A;  1HTZ A;  2H28 A;  1TDG A;  3AGE A;  1QMF A;  1YMX A;  4X69 A;  3ZG9 B;  2DNS A;  2HDU A;  2YKF A;  3LGO A;  5HAQ A;  3Q07 A;  5EUA A;  3BFD A;  3ZCZ A;  3KX0 X;  3IH9 A;  2O0Y A;  2XRN A;  2J3T D;  3H9W A;  1BZA A;  3AGF A;  3GEC A;  4Q0H A;  4DXC A;  3HLD A;  2C5W B;  2XEP A;  3S1Y A;  1A0K A;  5IT5 A;  2GZA A;  3D9Y A;  4MBF A;  5FEG A;  3M6B A;  2J3W A;  3LR4 A;  3GDI A;  2L0W A;  3P7N A;  5AQB A;  2W3G A;  3S4X A;  2Y2K A;  2JHE A;  3IF6 C;  1W5D A;  3E4O A;  3ITB A;  3PBT A;  1MKI A;  5EOE A;  5EVE A;  4FSF A;  4EEU A;  4WMC A;  1E3U A;  2WGI A;  4PKY A;  3LR3 A;  5FEF A;  5FI7 A;  1XFQ A;  3MXS A;  1TS8 A;  2HZ5 A;  3IXH A;  3WS5 A;  2Z6C A;  2O9C A;  1GHM A;  5GLC A;  3UE6 A;  1RP5 A;  1CEF A;  4BL3 A;  2Y79 A;  3A0S A;  3O5Y A;  3UPP A;  3BW6 A;  1NWZ A;  3ZQ5 A;  1MWT A;  5G4Z A;  1ALQ A;  4GHI A;  1OTE A;  1XJ3 A;  1XKZ A;  4RA7 A;  5M18 A;  5CRF A;  3EGD C;  3FG8 A;  4IHQ A;  3F1O A;  1EWZ A;  1CK3 A;  2ZM2 A;  4N1X A;  1YLT A;  2HF6 A;  5DFY A;  1HZO A;  4ZDX A;  4WLA A;  2PD7 A;  3FC7 A;  3RJU A;  1T18 A;  4NXG A;  4JXV A;  3ICY A;  5FQK A;  3NDE A;  1OTI A;  4I5S A;  1I2W A;  5CGW A;  4EBN A;  2VEA A;  1NYM A;  2PYR A;  5FL3 A;  3MFX A;  3Q7V A;  2V9A A;  4IVK A;  5DJU A;  2X01 A;  4PMA A;  1FCO A;  2WGW A;  4ZRR A;  3M2J A;  3N4I A;  3TSG A;  3IF6 B;  1F9I A;  1Y54 A;  2XD5 A;  2O99 A;  3SH7 A;  3MS6 A;  3NJA A;  3BJN A;  3ZYT A;  3UPO A;  3GVB A;  4HJ6 A;  2EWV A;  2HP9 A;  2Z2L B;  3MZE A;  1T1B A;  5HL6 A;  1M40 A;  5EOO A;  1DP8 A;  5FAT A;  4FTX A;  5F69 A;  1V9Y A;  4OP8 A;  3JVU A;  1MXO A;  3HJK A;  3ZDJ A;  1YLZ A;  3NOP C;  4LPZ A;  3CPT A;  1ZG6 A;  3R4K A;  4II7 A;  4QB8 A;  3FKW A;  4ESP A;  4EBL A;  4JXG A;  2EA9 A;  1PI5 A;  3LY4 A;  4HJ3 A;  4ME4 A;  2VGJ A;  2V1A A;  1S6R A;  5FDH A;  1L0E A;  3IH8 A;  1TVF A; 
#chains in the Genus database with same CATH homology
 3SS5 A;  4R4R A;  1XXM A;  2ZM8 A;  2H5S A;  3RXX A;  4QU3 A;  2Y2L A;  4S2J A;  4ZJ2 A;  4K0X A;  4Z9Q A;  2ZM0 A;  4KZB A;  2PU4 A;  3BEB A;  4RX2 A;  4LCL A;  2OV5 A;  2C6W B;  2B5R A;  4MBH A;  4U3T A;  1ES2 A;  1PW1 A;  5CTM A;  3SS4 A;  1SDE A;  1KGF A;  1Q2P A;  3LEZ A;  4KQO A;  4U0X A;  3VOY A;  2WZZ A;  4KG5 A;  3TOI A;  4N1H A;  2V20 A;  3UY6 A;  4WZ5 C;  3FYZ A;  4OH0 A;  4E3O A;  1FR6 A;  1KGE A;  1SHV A;  3HLB A;  3ZG5 A;  1K6R A;  2IWB A;  4RYE A;  2EX2 A;  5J8X A;  1ZKJ A;  3HBR A;  1BLS A;  3UE3 A;  1BUL A;  1O07 A;  3C7U A;  4ID4 A;  3V3R A;  4JKT A;  2EFU A;  3I7J A;  3NDG A;  2OLV A;  1IYQ A;  3N8L A;  3NC8 A;  3DW0 A;  4ZTK A;  2Y91 A;  3HUO A;  2FFY A;  5GLA A;  2WYX A;  4WBG A;  1KE3 A;  2H0T A;  2Y2I A;  4XXR A;  5EE8 A;  5HL1 A;  4DE0 A;  4QY5 A;  3ZHH A;  2HDQ A;  4E3J A;  2PU2 A;  1JTG A;  4YFM A;  2XGN A;  3P98 A;  1ZG4 A;  4OPQ A;  5F1G A;  3OPL A;  4OP5 A;  3HRE A;  3GRJ A;  4E3I A;  3WS4 A;  1W8Y A;  3C4O A;  1SDN A;  3O87 A;  1NYY A;  1DJC A;  3A3D A;  4PM6 A;  5CGX A;  2ZMA A;  1FSW A;  1E25 A;  4KG2 A;  1LL9 A;  5FAQ A;  3MFD A;  3VFH A;  1ES5 A;  4IVI A;  4DE1 A;  5A93 A;  5F83 A;  3NBL A;  1FCM A;  2RL3 A;  1W79 A;  3EQV A;  1RGZ A;  4IBX A;  1ERM A;  4S2N C;  4UA6 A;  4M3K A;  3UNW A;  5E2F A;  1K57 C;  5AQA A;  1WYB A;  3W8K A;  4JXW A;  1BLP A;  1K6S A;  3N7W A;  3BLS A;  3BEC A;  3HLW A;  4KZ6 A;  4GN2 A;  2XFT A;  2ZC4 B;  4FH2 A;  1ZC2 A;  5FQI A;  3VOZ A;  1AXB A;  1QME A;  4KZ3 A;  4WEL A;  4JXS A;  2FFF B;  1ONH A;  3SOI A;  4GZB A;  3HLC A;  4DKI A;  2R9W A;  2BLS A;  4UA9 A;  4HEF A;  3Q81 A;  4JF6 A;  1IYP A;  5FI6 A;  4DRT A;  4E3N A;  3GMW A;  2Y2N A;  3CZD A;  4Y0U A;  4KG6 A;  4C75 A;  4R4S A;  4FD8 A;  5FQJ A;  3SH9 A;  1K4E A;  3QHY A;  2XK1 A;  1PYY A;  1VQQ A;  5GL9 A;  4WZ5 A;  3A3E A;  2Y59 A;  1PIO A;  2JBF A;  4GNU A;  3O86 A;  3M6H A;  3HLE A;  1CI8 A;  4KQQ A;  5TGF A;  4R3J A;  3PBQ A;  3IHB A;  4P0M A;  4Q8I A;  3IXD A;  3BM6 A;  2OLU A;  4Y0T A;  2WAE A;  1I5Q A;  3VFF A;  3N8S A;  3ITA A;  4EQI A;  1FQG A;  1TEM A;  2G2W A;  1KE4 A;  1SCW A;  4QY6 A;  5FAS A;  2X71 A;  2Z2M B;  3MXR A;  1MY8 A;  3HLG A;  1K25 A;  2Y4A A;  1IEM A;  4S2O A;  1ES3 A;  3VMA A;  3RXW A;  3IT9 A;  3BFE A;  2DRW A;  5HW3 A;  3IWQ A;  5U47 A;  2HDS A;  5L2F A;  1K38 A;  3PBN A;  1ERO A;  4U0T A;  3QNB A;  2WKI A;  2WUQ A;  3M2K A;  1GHI A;  3N6I A;  4LEN A;  5HX9 A;  4MNR A;  2ZC6 B;  3CJM A;  5D3O A;  3W4O A;  3OPH A;  4R3B A;  4S2P A;  1LI0 A;  5GHY A;  4E3K A;  4P85 A;  4A5R A;  4OPZ A;  4IBR A;  4S2N A;  5TFQ A;  1YQS A;  5DVA A;  3VP1 A;  1K57 A;  4PM8 A;  4BJP A;  3HLF A;  3ZVT A;  3ZGA B;  4ZAM A;  4BD0 A;  3SS3 A;  2Y2G A;  1BLC A;  3QNC A;  5IHV A;  1HD8 A;  4S2I A;  1DJA A;  1YLY A;  4FH4 A;  4JF5 A;  4E3M A;  1N9B A;  5TR7 A;  2VGK A;  2J8Y A;  2Y2Q A;  1RGY A;  3DTM A;  4PM9 A;  1XPB A;  1L2S A;  2V1Z A;  4XUZ A;  3VP0 A;  2V2F F;  1WE4 A;  1E4D A;  1EI5 A;  4EBP A;  4JPM A;  2JCH A;  5M1A A;  1VM1 A;  5A92 A;  4F94 A;  3VSK A;  5GHX A;  4GD8 A;  3FWL A;  2EFX A;  2IWD A;  4KZ4 A;  3BFG A;  1PWG A;  4WMC D;  1LHY A;  5FQQ A;  1E3U D;  3DWK A;  4OQI A;  3JYI A;  4OOM A;  2EXB A;  4L0L A;  1L0F A;  1K55 C;  4D2O A;  3IXG A;  1MBL A;  2OSU A;  3SH8 A;  4HBU A;  2ZC7 A;  2ZQ7 A;  4S2K A;  3WS0 A;  2XR0 A;  1U60 A;  4GDN A;  4EWF A;  1PZO A;  5EVI D;  3WRT A;  1MWU A;  3G4P A;  5HAP A;  4GKU A;  1G6A A;  1XGJ A;  4P6B A;  2XQZ A;  2ZQC A;  3WWX A;  2Y2H A;  2A49 A;  4CJN A;  3A3J A;  2WKH A;  3NY4 A;  1IYS A;  5AQ9 A;  1GA9 A;  4ZBE A;  3BRM A;  1LI9 A;  2J9O A;  4X68 A;  3OPR A;  4O7D A;  4QHC A;  1XP4 A;  1YLW A;  4UA7 A;  3MZF A;  1Q2Q A;  4X6T A;  4BLM A;  5GLD A;  2Y2P A;  1KVL A;  2RCX A;  3VP3 A;  5FAO A;  3ZG0 A;  3UN7 A;  3WRZ A;  1K54 C;  4KEN B;  4QD4 A;  3W4Q A;  4KZ7 A;  5CHJ A;  5EOE A;  1H8Y A;  3Q7Z A;  4MEZ A;  1J9M A;  5GHZ A;  1NZU A;  1FOF A;  4GD6 A;  3GR2 A;  1HTZ A;  1TDG A;  4KZ8 A;  3G2Z A;  3AGE A;  3ZNT A;  3HVF A;  1KGG A;  2HDR A;  3PAG A;  1PI4 A;  1RCJ A;  1QMF A;  1XGI A;  1YMX A;  4X69 A;  3NIA A;  3ZG9 B;  5EVI C;  4LCM A;  2DNS A;  2HDU A;  2ZD8 A;  3G31 A;  4EUZ A;  1YLJ A;  3WS1 A;  5HAQ A;  3Q07 A;  1MWR A;  2H0Y A;  4DDS A;  2QPN A;  1M6K A;  3PAE A;  5EUA A;  3G2Y A;  4MBK A;  1JWP A;  1PWC A;  4NET A;  2J7V A;  2XD1 A;  5CTN A;  3BFD A;  4LV0 A;  3ZCZ A;  5CEC A;  5KZH A;  3ZG7 B;  4FCF A;  1MWS A;  3IH9 A;  4HES A;  1I2S A;  2PBY A;  2EXA A;  2EX8 A;  4NK3 A;  5I94 A;  5CXW A;  2Q9M A;  2Y2M A;  2WK0 A;  2ZQA A;  4DDY A;  5CGS A;  2H10 A;  4RX3 A;  1BZA A;  2QMI A;  4DXB A;  1K55 A;  3AGF A;  4OOL A;  2ZC3 B;  4DXC A;  3PBR A;  3S22 A;  3HLD A;  2C5W B;  2XEP A;  4OQH A;  1ONG A;  2I72 A;  3S1Y A;  4JF4 A;  3CG5 A;  3UE1 A;  4KZ5 A;  1NXY A;  1ES4 A;  3IWI A;  4GDB A;  5FI2 A;  4MBF A;  4MLL A;  5EVL A;  3Q82 A;  4JLF A;  2Q9N A;  4WYY A;  3OZH A;  3Q7V B;  4R23 A;  3M6B A;  1JTD A;  1N4O A;  4OKP A;  1FSY A;  4OQG A;  3LO7 A;  2WGW B;  5DTS A;  3VP4 A;  3Q1F A;  5AQB A;  3S4X A;  5E2G A;  4DF6 A;  5KSH A;  2Y2K A;  5FSR A;  4C6Y A;  3IF6 C;  3UDI A;  2UWX A;  1W5D A;  5KSC A;  1JVJ A;  3BFF A;  3ITB A;  3PBT A;  1MKI A;  4OPY A;  1K54 A;  1XA1 A;  2Y2O A;  2R9X A;  3G30 A;  4FSF A;  4YIN A;  2P9V B;  5M19 A;  4WMC A;  3MBZ A;  3MKE A;  4UHU A;  1E3U A;  2WGI A;  2XDM A;  3IF5 A;  5BOH A;  1SKF A;  5DTK A;  1CEG A;  2ZLY A;  1YM1 A;  3D4F A;  3NCK A;  4IED A;  5FI7 A;  1H5X A;  3UDF A;  3FZC A;  4S2M A;  4N9K A;  1K4F A;  3FKV A;  5A91 A;  3MXS A;  4KZA A;  4N9L A;  5DF8 A;  5G18 A;  1O7E A;  1KE0 A;  3IXH A;  4OLD A;  4WM9 A;  1KDS A;  4X53 A;  5EVI A;  3WS5 A;  4UAA A;  5E43 A;  3V50 A;  5FQ9 A;  1GHM A;  1K56 D;  3AGD A;  5GLC A;  3HL9 A;  1G68 A;  1RP5 A;  1W8Q A;  3BYD A;  1CEF A;  5DTT A;  1PW8 A;  2ZQ9 A;  1IEL A;  4BL3 A;  5E2H A;  4OOY A;  4Y7P A;  3GTC A;  1KDW A;  2QZ6 A;  1BSG A;  3UPP A;  4DE2 A;  5GLB A;  1BT5 A;  2E8I A;  3EQU A;  3O88 A;  2WAF A;  1FCN A;  4E6W A;  1MWT A;  4BEN A;  2GDN A;  4R0Q A;  1ALQ A;  5KMW A;  3V3S A;  4BQM A;  1IKG A;  5FQM A;  2WKE A;  1XKZ A;  3UPN A;  4RA7 A;  4ZJ3 A;  5M18 A;  1L0D A;  5CRF A;  3PBS A;  4QJG A;  4HBT A;  4LV2 A;  5EVI B;  2ZQ8 A;  3FV7 A;  2A3U A;  1EWZ A;  1BLH A;  2WAD A;  1PWD A;  1ERQ A;  3G35 A;  1CK3 A;  2ZM2 A;  4WEK A;  4Y0O A;  1BTL A;  4N1X A;  2Y55 A;  1YLT A;  3HUN A;  4CPK A;  1GA0 A;  1TDL A;  3B3X A;  3LCE A;  1IKI A;  4KQR A;  3MZD A;  5F1F A;  4K91 A;  1HZO A;  4LV3 A;  3BFC A;  4WZ4 A;  3O3V A;  1W7F A;  5E2E A;  4ZDX A;  3G32 A;  3IF6 A;  1KVM A;  4RVA A;  3RJU A;  4X55 A;  1OME A;  2EX6 A;  3VSL A;  4EV4 A;  4OPR A;  4JXV A;  4OLG A;  3UO9 A;  3GV9 A;  3OC2 A;  3G34 A;  5FQK A;  3NDE A;  2XH9 A;  2ZQD A;  1YMS A;  3N8R A;  1C3B A;  1I2W A;  5CGW A;  4B4Z A;  4EBN A;  4JBF A;  1NYM A;  3C4P A;  3UE0 A;  3A3I A;  4OVD A;  4S2L A;  3TG9 A;  2EX9 A;  4BD1 A;  3HUM A;  1XX2 A;  4X56 A;  5DF7 A;  5CER A;  4OON A;  1LLB A;  2WGV A;  3Q7V A;  4B4X A;  1DY6 A;  2HP6 A;  1JWZ A;  2XF3 A;  2XFS A;  3LY3 A;  4IVK A;  4BL2 A;  4PM5 A;  2X01 A;  4PMA A;  1L0G A;  2JE5 A;  1FCO A;  2WZX A;  2WGW A;  1PZP A;  3OCL A;  4PM7 A;  4R1G A;  3M2J A;  3N4I A;  3TSG A;  4WEJ A;  2X02 A;  3IF6 B;  4N92 A;  4ZJ1 A;  1Y54 A;  2XD5 A;  3GQZ A;  3ZG8 B;  4C3Q A;  4GB7 A;  3V39 A;  3SH7 A;  3C7V A;  5CHM A;  3CMZ A;  5FAP A;  2P9V A;  3UPO A;  3PTE A;  3IQA A;  3GVB A;  5CEB A;  1MPL A;  5CHU A;  1HVB A;  5EPH A;  2HP9 A;  1JWV A;  3P09 A;  2Z2L B;  5HFO A;  3MZE A;  1NRF A;  3E2K A;  4H8R A;  2J9P A;  3E2L A;  3IHA A;  3OCN A;  3C5A A;  1Z6F A;  4XUX A;  1DJB A;  1NJ4 A;  1M40 A;  3DWZ A;  3A3F A;  5EOO A;  2IWC A;  4P87 A;  5FAT A;  4K0W A;  2Y2J A;  1H8Z A;  5F82 A;  4GOG A;  3ZFZ A;  5JYO A;  1S0W A;  4LV1 A;  1WYC A;  3ZNY A;  2G2U A;  2BG1 A;  3VP2 A;  4OP8 A;  1CI9 A;  2HP5 A;  4E6X A;  1NY0 A;  2P74 A;  1GHP A;  1K56 A;  1MXO A;  2JC7 A;  3ISG A;  5EEC A;  1NZO A;  3ZDJ A;  3IWO A;  2CC1 A;  3GSG A;  1YLZ A;  1ESU A;  3W4P A;  1ZG6 A;  4PPR A;  4DE3 A;  4QB8 A;  3FKW A;  2ZJ9 A;  4EBL A;  2HPB A;  4E3L A;  1IYO A;  5A90 A;  2DCF A;  1YT4 A;  2XLN A;  2ZC5 B;  3IXB A;  4JXG A;  4OQ0 A;  4KZ9 A;  3PBO A;  5DF9 A;  5CED A;  1PI5 A;  3LY4 A;  3OPP A;  3V5M A;  1XA7 A;  3UDX A;  2VGJ A;  5HAR A;  3BLM A;  1S6R A;  1ESI A;  3NI9 A;  4B88 A;  1LL5 A;  1L0E A;  5AQ7 A;  5FDH A;  5JYP A;  3WS2 A;  3IH8 A;  5HAI A;  1BUE A;  1GCE A;  1FR1 A;  1YLP A;  3MKF A;  5FA7 A;  3ZVW A;  1TVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...