3QHYA

Structural, thermodynamic and kinetic analysis of the picomolar binding affinity interaction of the beta-lactamase inhibitor protein-ii (blip-ii) with class a beta-lactamases
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
b'THKEFSQLEKKFDARLGVYAIDTGTNQTIAYRPNERFAFASTYKALAAGVLLQQNSTKKLDEVITYTKEDLVDYSPVTEKHVDTGMTLGEIAEAAVRYSDNTAGNILFHKIGGPKGYEKALRQMGDRVTMSDRFETELNEAIPGDIRDTSTAKAIATNLKAFTAGNALPNHKRNILTKWMKGNATGDKLIRAGVPTNWVVADKSGAGSYGTRNDIAIVWPPNRAPIIIAILSSKDEKGATYDNQLIAEAAEVIVNAFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Analysis of the binding forces driving the tight interactions between beta-lactamase inhibitory protein-II (BLIP-II) and class A beta-lactamases.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Hydrolase/hydrolase inhibitor
total genus 95
structure length 258
sequence length 258
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3qhyA00
1GHPA 2H0TA 1NZOA 4DXCA 5KMWA 3AGDA 1MKIA 1MWRA 3OCNA 1PW8A 3DWZA 4QB8A 3LCEA 1HZOA 3S4XA 1CI9A 4KZ4A 4S2JA 4HEFA 2DCFA 4KZAA 3NC8A 3VP2A 4X53A 2J9OA 3ZHHA 4OKPA 4KG2A 4QD4A 1FSWA 4KZ8A 4JXSA 5I94A 1PZOA 3CJMA 3ITAA 1KE0A 1NZUA 1YLZA 1K54C 4KENB 3RJUA 1GA9A 2Y2OA 1FQGA 1K25A 2VGKA 2WZZA 1TDLA 2Y2HA 5D3OA 4Q8IA 3N4IA 3C4PA 1XKZA 4P0MA 4K91A 4WELA 2J7VA 1KGEA 3ZG7B 3SS4A 1FOFA 4DE2A 1ZKJA 4LV3A 4JPMA 5DF8A 4K0XA 4JF6A 4O7DA 5E2GA 1YLYA 2G2UA 4BQMA 4OH0A 2EX2A 2JC7A 3ZVWA 3UPOA 1E25A 4JKTA 2R9WA 2G2WA 4U0TA 4GN2A 2DRWA 2WKIA 1Z6FA 4P85A 1IKIA 4S2MA 3OPPA 3S22A 3ZG0A 2FFYA 1TVFA 4LV0A 4U0XA 5E2EA 2A3UA 4KZ5A 4ID4A 3BRMA 4L0LA 2P9VA 2QMIA 4Y0UA 3W8KA 5KZHA 2PU4A 4FSFA 1H5XA 3G31A 4PMAA 5IHVA 4ZJ2A 4S2NA 4LCLA 1K56D 3LO7A 3IT9A 4H8RA 4LENA 3RXWA 2XGNA 1KDWA 3WS2A 3GVBA 3HBRA 1XP4A 3CMZA 1SDEA 5KSCA 2H5SA 4R4RA 4X69A 1W5DA 3PBTA 3VOZA 5E2FA 5FI7A 3M6HA 4DE1A 3Q07A 5A91A 4OQIA 4WZ5A 3PAGA 1YLPA 1YLWA 4LCMA 4R3BA 4Y0TA 4HBTA 3O86A 1EI5A 1NYYA 4IVIA 5A93A 2C5WB 2C6WB 5E2HA 5AQ9A 2I72A 2XD1A 5EVID 4OQGA 3NIAA 1PWGA 4EV4A 3MZDA 1BT5A 3V3SA 4BENA 5BOHA 1ES4A 1M40A 4CJNA 3PBOA 4E3JA 4XUXA 4DDSA 4KZ3A 3IF5A 3CZDA 3UE3A 5EOEA 5HAPA 3DWKA 3OPLA 1Q2QA 5EPHA 1CI8A 3HLCA 1N4OA 4GDBA 4PM7A 4QY5A 1JTGA 5DVAA 4BL2A 3VSLA 1YT4A 1PI4A 2ZC4B 3P09A 4OVDA 2XDMA 1SDNA 5TGFA 2IWBA 4P87A 3ZNTA 3Q7ZA 1XX2A 2P74A 1NJ4A 2ZC5B 3O3VA 5U47A 4E3MA 4IVKA 3PBRA 4X6TA 1XPBA 2IWCA 5CTMA 3BFGA 1ES3A 2QZ6A 3PAEA 4RA7A 1W79A 4DRTA 3PBNA 2XFTA 1I5QA 3HUOA 1K6RA 4JLFA 3C7VA 3D4FA 4R3JA 4Y0OA 3UDFA 1IYOA 4B4XA 2Y2MA 2XFSA 5F1GA 1BLHA 1K4FA 3OZHA 3FV7A 4WEKA 4WZ5C 3WS5A 2HDQA 2XEPA 1LHYA 2EXBA 3I7JA 3MBZA 2EX8A 3OPHA 4OPZA 4U3TA 4WEJA 5DF7A 1JVJA 3HLFA 5DF9A 3ZCZA 3WWXA 1WYBA 3UE0A 1PZPA 3HUMA 1E4DA 5GL9A 5HARA 3G4PA 3UY6A 2IWDA 4QJGA 4KG5A 2B5RA 1WYCA 5EUAA 3BLMA 1PIOA 3A3IA 1Q2PA 2Q9NA 2WGWB 3OC2A 4UA9A 4OOYA 3QNBA 3NDGA 2Y91A 2Y2NA 4JBFA 5CERA 1U60A 2ZC3B 4E6WA 4WM9A 4LV1A 4QU3A 2OLVA 3SS5A 2WADA 3HLBA 1ONGA 1L0EA 1MPLA 1OMEA 1BUEA 1WE4A 3AGFA 3N8LA 4KQOA 4OQHA 3JYIA 1FR6A 3BECA 4PPRA 1AXBA 1HTZA 5FAQA 4GB7A 3SH7A 2ZC6B 3DTMA 1PWCA 4ZBEA 3WS4A 1K6SA 3UPNA 1MWSA 3IH9A 3IQAA 3ZNYA 4OPQA 5GLDA 3B3XA 1TDGA 3A3JA 1TEMA 3UDXA 4R23A 3FZCA 4N1HA 4OPYA 1FCMA 4X55A 5HFOA 1JWZA 3UPPA 4OPRA 4PM6A 5KSHA 4UA6A 3VOYA 5CGXA 3O88A 1CEGA 1ONHA 2WZXA 5FQKA 4DXBA 3QHYA 5FQ9A 3MXSA 5FI6A 4BL3A 5GHYA 5A90A 3BFFA 1K57A 2H10A 2X02A 3UNWA 4JXWA 4OLGA 4ZTKA 1RGYA 1MY8A 4E3OA 3LEZA 2H0YA 1YM1A 4UAAA 5CHJA 3AGEA 3NY4A 5F82A 1BZAA 1N9BA 3IXDA 3GTCA 4RYEA 4S2LA 3HLDA 3TG9A 4C3QA 1DJAA 1JWVA 2ZQ7A 1CEFA 2ZQ9A 1DJBA 1G6AA 3DW0A 3HLGA 4FCFA 5FAPA 5HX9A 2HP5A 3BFEA 2ZC7A 3C7UA 3ITBA 4EUZA 1KE3A 2Y2LA 4N1XA 4MBFA 2XR0A 5AQBA 1O7EA 2Y4AA 5HW3A 3G32A 1CK3A 3W4PA 4A5RA 1K38A 1PW1A 5EE8A 2Y2PA 2ZLYA 5CRFA 4S2IA 2XQZA 4RX3A 4GNUA 1XA7A 5GHXA 4GDNA 2V1ZA 4EBNA 3ZG8B 1XGIA 2V2FF 3GR2A 4MBKA 4S2KA 3WRZA 4IBRA 1NXYA 3IF6B 4UHUA 1GHIA 5AQAA 4R1GA 5J8XA 3ZVTA 1K57C 5M18A 2XF3A 3ZG5A 1ESIA 1L0FA 1KVMA 3BYDA 3VP1A 5GHZA 4BLMA 1LL9A 4N92A 4B88A 1KE4A 1QMFA 2UWXA 3M6BA 2JCHA 3MZEA 2HPBA 3V5MA 5JYOA 1XGJA 3BLSA 5GLBA 3UO9A 4C6YA 3GMWA 3IWOA 5A92A 5CEBA 1RP5A 3FKWA 3Q81A 3ZG9B 1SCWA 1JWPA 2XH9A 4YINA 4ZJ1A 1ES2A 5FASA 4YFMA 3SH9A 2RCXA 2RL3A 1H8ZA 3HUNA 1NYMA 5FATA 4Y7PA 2Y2GA 2XK1A 1ZG4A 3BEBA 1M6KA 1S6RA 2ZM8A 5EVIB 3PBSA 1O07A 2OSUA 4BJPA 1YMXA 2J8YA 4DKIA 3BM6A 1SHVA 1L0GA 4BD1A 3WS1A 4S2OA 3V50A 2WAFA 1IKGA 1IYSA 4E3LA 3W4OA 3E2KA 3G2ZA 4X68A 1ZG6A 3MKFA 1W8QA 2Y2JA 4P6BA 3MFDA 1LL5A 1C3BA 4OP5A 1GCEA 5FQMA 4QY6A 4EBPA 2VGJA 3QNCA 1L2SA 3TSGA 4RVAA 4F94A 5CXWA 2WGWA 5G18A 1S0WA 5GLCA 2V20A 1L0DA 4DE0A 3IH8A 3G2YA 3NBLA 3VP3A 4R4SA 2WGIA 5EVLA 4KZBA 5AQ7A 3V39A 1E3UA 4D2OA 2ZQAA 2WK0A 5M1AA 4GZBA 4WMCD 4R0QA 5E43A 1GA0A 3HREA 5FDHA 3NDEA 3SOIA 1PYYA 4WBGA 1ALQA 4E6XA 1I2SA 4K0WA 4UA7A 3CG5A 4IEDA 4PM9A 5CTNA 1ERQA 3N6IA 4GD6A 3HVFA 1ERMA 2WGVA 1KGFA 3FYZA 5GLAA 2XLNA 4KQQA 4MLLA 5F1FA 3UE1A 4EBLA 3IXBA 3RXXA 3Q7VB 3GSGA 4KQRA 3VSKA 2Y2IA 1DY6A 2Y2KA 4XXRA 4C75A 3P98A 4DE3A 4XUZA 3VMAA 3IWIA 3N8SA 3M2JA 2JBFA 4GKUA 4KG6A 2X01A 2FFFB 2EX9A 1IYQA 5FAOA 3VFHA 3MZFA 4ZAMA 1YMSA 3G30A 4X56A 2WKEA 4OONA 5CGWA 2BLSA 2HP9A 2Q9MA 4MNRA 1IELA 1NY0A 2WUQA 5FQIA 2J9PA 5FA7A 4DF6A 4GOGA 1LLBA 3FKVA 5FQJA 4FD8A 4BD0A 4RX2A 4NK3A 1QMEA 3UDIA 4B4ZA 1SKFA 1K55A 1VQQA 3EQVA 1JTDA 4Z9QA 3A3EA 1G68A 2WYXA 3EQUA 3NCKA 1RCJA 5TFQA 3Q82A 3TOIA 1PI5A 5FSRA 1FCOA 3WS0A 2HDSA 4DDYA 2ZD8A 4ZDXA 1IYPA 3IHBA 2ZM0A 3SS3A 2GDNA 3WRTA 4QHCA 3IF6A 1K4EA 4M3KA 2ZJ9A 3E2LA 1VM1A 3BFCA 3IHAA 3HLWA 3G35A 3OPRA 4MBHA 4OLDA 3ZFZA 1KDSA 1MWTA 2P9VB 4E3NA 1FSYA 1K56A 5CHMA 2X71A 2ZQCA 1KVLA 4JF5A 4FH4A 4OOMA 1LI9A 1HVBA 1W7FA 2WKHA 3G34A 1BLCA 4PM8A 3LY4A 3ZGAB 5FQQA 4MEZA 1RGZA 2HDRA 3VFFA 1XXMA 3Q1FA 2PBYA 1EWZA 2PU2A 5DTKA 3C5AA 1BSGA 2ZM2A 2Y55A 4EWFA 2Y59A 2Z2MB 5CEDA 4FH2A 3N7WA 1HD8A 3IXHA 5L2FA 1NRFA 3VP0A 1FCNA 5CHUA 1K55C 5EVIA 3S1YA 4JXVA 4JXGA 4WYYA 4CPKA 1ZC2A 5TR7A 5DTTA 2HDUA 3A3FA 1GHMA 3PTEA 1BULA 1J9MA 1IEMA 2DNSA 2HP6A 3C4OA 3HLEA 4S2PA 5M19A 1YQSA 3ZDJA 1FR1A 2OLUA 4NETA 1MBLA 4LV2A 4ZJ3A 3M2KA 1BLPA 2A49A 2EX6A 4HESA 4OQ0A 1H8YA 3N8RA 3IF6C 5F83A 2EFXA 2Y2QA 1EROA 1LI0A 2XD5A 2ZQDA 3VP4A 4E3IA 3HL9A 4S2NC 1ESUA 2Z2LB 1KGGA 3MXRA 5CECA 2ZMAA 2OV5A 1BLSA 4HBUA 3BFDA 4KZ6A 3A3DA 4N9LA 1ES5A 3O87A 3UN7A 1YLTA 1XA1A 3V3RA 3NI9A 1I2WA 3IWQA 5HAQA 3W4QA 4KZ9A 1K54A 5HL1A 3ISGA 5HAIA 5JYPA 4JF4A 3IXGA 3SH8A 2BG1A 1E3UD 1YLJA 2E8IA 3OCLA 3PBQA 4KZ7A 5EECA 5FI2A 2WAEA 1W8YA 1MWUA 2R9XA 4OP8A 5EVIC 4EQIA 3LY3A 2CC1A 4N9KA 4IBXA 4E3KA 3MKEA 5DTSA 2QPNA 2EFUA 1DJCA 5CGSA 1BTLA 2JE5A 2EXAA 3GQZA 1PWDA 2ZQ8A 4GD8A 3GV9A 1MXOA 4OOLA 3FWLA 3Q7VA 5EOOA 3GRJA 4WZ4A 1Y54A 4WMCA 4PM5A
chains in the Genus database with same CATH superfamily
1GHPA 4MDZA 3MQQA 2JKGA 5KMWA 4QB8A 1CI9A 4S2JA 4HEFA 2DCFA 4I38A 3ULFA 3VP2A 2J3TC 2KX6A 4KZ8A 4Y2FA 4LRXC 2V1AA 4WUJA 1MC0A 2Y2OA 1FQGA 2VGKA 1XJ4A 5D3OA 4Q8IA 3N4IA 2M7UA 1XKZA 4P0MA 3NOTC 3ZG7B 3SS4A 1FOFA 4CLCA 1ZKJA 4JPMA 4CLCB 1H3QA 4GHIB 3T4SA 1YLYA 2G2UA 4BQMA 2JC7A 2FZ0A 2K7SA 2W3DA 2R9WA 4U0TA 3B33A 2ZL1B 2DRWA 2WKIA 1Z6FA 4S2MA 3OPPA 4U0XA 3W8KA 4ID4A 3BRMA 3NECA 1H5XA 3G31A 4PMAA 5IHVA 2PT7A 3RXWA 3IT9A 4LENA 3WS2A 3CUEA 3CMZA 2PD7A 3VE3A 1SDEA 4X69A 3UB8A 4XT2B 3PBTA 3VOZA 3M6HA 2YKHA 3LIEA 3CWFA 5A91A 4OQIA 4IHQA 4R3BA 4LLOB 4HBTA 4IVIA 2C6WB 5E2HA 2XD1A 4GCZA 5TBMA 4CLCC 1BT5A 2QJ7A 5BOHA 4LGWA 4XUXA 4DDSA 3LI9A 3UE3A 3OPLA 3ICYA 3H9WA 3IX4A 1T1CA 1N4OA 4I5SA 4PM7A 2Z6DA 5DVAA 4BL2A 5EM1A 5HDSA 1YT4A 3T4KA 2VKSA 5TGFA 2IWBA 4EU0A 3ZNTA 3Q7ZA 1STZA 3O3VA 1W63Q 4X6TA 4Z1WA 3CUEC 2QZ6A 1OJ5A 4GLQA 3PBNA 1I5QA 2XFTA 1BYWA 4B4XA 2W3GA 3OZHA 3FV7A 5F69A 1P97A 3MBZA 4GS9A 2LB5A 3HLFA 4L9EA 5HPIA 1NWZA 3UE0A 2Q9NA 2WGWB 4UA9A 3NDGA 4E6WA 2Y79A 2OLVA 3MQ0A 3VSKA 1FR6A 4KUKA 1AXBA 3CAXA 2O9CA 4GB7A 3KSIA 3WS4A 3UPNA 3IH9A 5GLDA 1TDGA 4OPYA 4X55A 2GNXA 4HY8A 4UA6A 5CGXA 5FQKA 2B95A 5FQ9A 1S67L 2H10A 4EESA 4FUWA 1MY8A 4E3OA 2V1BA 2WKRA 2D01A 2H0YA 2KOIA 1YM1A 4G3KA 5HZHA 2ZQ9A 1KE3A 2Y2LA 1OTDA 3T4QA 2XR0A 1O7EA 4Q0IA 2Y4AA 2L0WA 4H6JA 3W4PA 1K38A 5CX7A 1T1AA 2ZLYA 4Q0HA 1XA7A 5GHXA 2IA2A 2GX5A 2V2FF 3UB9A 3IS2B 1NXYA 2XF3A 3UB5P 3BYDA 5GHZA 4N92A 3A0SA 4B88A 1KE4A 2BASA 3M6BA 3MZEA 5JYOA 4D60A 3BLSA 1JWPA 5FASA 4YFMA 3A0VA 5FATA 2XK1A 3BEBA 1S4RA 5EVIB 2ZOHA 3BM6A 2J3TD 3LICA 4BD1A 1OTBA 1YKDA 3LR0A 4E3LA 3E2KA 4X68A 1W8QA 2Y2JA 3IX3A 4P6BA 5AVFA 1C3BA 4MN7A 1Y4OA 4QY6A 4EBPA 2VGJA 3QNCA 4RVAA 1VETB 4DE0A 3G2YA 4LPZA 5EVLA 3V39A 4ME4A 2VX8A 5FDSA 5FDHA 3SOIA 4HJ3A 1N9OA 3KSHA 2XROA 4GD6A 5GLAA 2WGVA 4KQQA 3P7NA 2PR6A 2Y2IA 4XXRA 5AJGA 4DE3A 2E8JA 3MMHA 3PHYA 4CLCD 2FFFB 2EX9A 3G30A 2HP9A 2Q9MA 1IELA 1VB6A 3FKVA 3F1NB 4NK3A 4RX2A 1SKFA 2JN7A 4GJ4A 4Z9QA 2KDKA 3KX0X 4KUOA 1RCJA 4II7A 4WLAA 2V0WA 1FILA 4ZDXA 2VA0A 3IHBA 3NOUC 2GDNA 4QHCA 3G35A 3OPRA 3ZFZA 2P9VB 4DMZA 2X71A 2L4RA 4FH4A 3D9YA 3BQAA 3LY4A 1RGZA 2PU2A 3TJZC 5IU1A 2Y55A 4EWFA 3CPTA 3H7WB 1L3LA 3B47A 3LIAA 5L2FA 4JXGA 4EQ1A 2HDUA 1J9MA 2HP6A 3LYXA 1YQSA 4NETA 3M2KA 4HESA 4HQAA 4MN5A 2HJEA 1EROA 1XJ6A 3HL9A 2V9AA 3EGDC 2ZMAA 2Y8HA 2OV5A 4KZ6A 3O87A 3UN7A 1XA1A 5HL1A 1K54A 3H82B 5FI2A 3RH8B 1G6OA 1W8YA 1MWUA 2R9XA 4OP8A 5EFWA 2CC1A 4N9KA 4IBXA 5DTSA 3U4LP 2EFUA 5J7EA 5CGSA 1BTLA 2JE5A 1D1JA 1CJFA 3LR5A 1MXOA 3GRJA 1Y54A 4WMCA 1DP9A 3LUQA 1NZOA 4DXCA 3OCNA 3LCEA 3QP4A 4KZAA 3NC8A 4NXBA 3OBFA 5I94A 1ZHHB 1NZUA 2L1MA 1K54C 3RJUA 5KSCA 1K25A 5HSQA 3C4PA 2V8FA 5DF8A 4K0XA 2PR5A 3NOPC 4OH0A 2EX2A 1E25A 2JKTM 3O5YA 2OWHA 4GN2A 1IKIA 3ZG0A 1TVFA 4LV0A 2V8CA 4X1MA 2PD8A 2PU4A 1OTAA 3KYEA 4LCLA 3LO7A 3LIBA 2XGNA 1KDWA 3GVBA 3HBRA 1XP4A 4ARZB 4NXGA 2H5SA 4HH3A 1W5DA 1F5MA 1ACFA 2QYBA 3Q07A 4Y0TA 4LCMA 4FOFA 1K0KA 3O86A 3T4LA 5EVID 3NULA 4EV4A 3EEAA 3MZDA 1MZUA 4BENA 4CJNA 1N9NA 2W1TB 4WL9A 1CI8A 3HLCA 4QY5A 3C8CA 4I39A 2ZC4B 4OVDA 1SDNA 2I9VA 4P87A 4E3MA 3PBRA 3CLOA 1ES3A 3PAEA 3LIFA 3C7VA 3D4FA 1IYOA 2W27A 2XFSA 5F1GA 2XEPA 1LHYA 3I7JA 5J3WA 4EEUA 3WWXA 3HUMA 3UY6A 4EEPA 4QJGA 3G4PA 4KG5A 1WYCA 5EUAA 3A3IA 2EA9A 2PHYA 2Y91A 1U60A 1JNUA 4JGPA 4LV1A 2WADA 3HLBA 1TS6A 1OMEA 1BUEA 4OQHA 1GSWA 1XFQA 3JYIA 4PPRA 3DTMA 2PAVP 3A3JA 3UDXA 4R23A 4N1HA 1PNEA 1JWZA 2B18A 3VOYA 1CEGA 2HGVA 4DXBA 2EWVA 3QHYA 5FI6A 4BL3A 1K57A 4ZTKA 5L10A 4UAAA 5CHJA 3AGEA 4GHIA 2P04A 3GTCA 3HLDA 2ZL1A 3D72A 3HLGA 2ZMVA 4NXEA 2JKRM 2ZC7A 5A8BA 3QP8A 3G32A 1PW1A 5HWTA 4R3AA 5CRFA 4S2IA 4O8GA 2XQZA 4CQHA 4XT2A 4O01A 2V1ZA 3E98A 4EBNA 1NLZA 1XGIA 4S2KA 3WRZA 2NUPC 3UMEA 2B02A 2OAP1 4QWOA 5AQAA 1GSXA 3ZVTA 1K57C 3ZG5A 1L0FA 4BWIA 1KVMA 1SZVA 4BLMA 1LL9A 4JGQA 3V5MA 4P6ZM 1XGJA 5HL6A 5F5YA 5GLBA 3GMWA 3IWOA 5A92A 3FKWA 3Q81A 3ZG9B 2XH9A 1ES2A 3LGOA 2RL3A 3HUNA 1D06A 5I5LA 1O07A 1OT9A 4DKIA 4Y17A 1P0ZA 3UE6A 1ZG6A 4UQIS 3MFDA 5IS1A 1J3WA 3KO6A 5FQMA 1L2SA 4F94A 2WGWA 2PRFA 2XA7M 1LL8A 3VP3A 2VV6A 4KZBA 3SW1A 3QP2A 4WMCD 1PRQA 4R0QA 5E43A 4WBGA 1S1ZA 4K0WA 3CG5A 1W63M 3ZQ5A 1S4SA 4LRYC 4ETZA 1SKOA 1SKOB 1ZTUA 3RTYA 3LR3A 3FYZA 2XLNA 4Y3IA 5F1FA 1P9WA 4BBUA 4EBLA 3IXBA 3Q7VB 3GSGA 5DKLA 4G3VA 1DY6A 3P98A 4IUKA 1T18A 4GKUA 2X01A 5FAOA 3MZFA 4ZAMA 2W0NA 1DP6A 4X56A 3T1SA 2O99A 5CGWA 4MNRA 2WUQA 1P9RA 3EWKA 4DF6A 4GOGA 4BD0A 2BTFP 1QMEA 1K55A 1VQQA 1JTDA 1TD5A 3A3EA 1G68A 2WYXA 3EQUA 1FCOA 3BQ8A 3WS0A 2UV0E 1V9YA 3WRTA 3IS2A 4M3KA 3L7HA 1EW0A 3EGXC 3IHAA 3HLWA 4OLDA 1PFLA 2QHKA 2ZQCA 1KVLA 4OOMA 1LI9A 4HJ6A 3VFFA 1EWZA 5DTKA 3T4JA 3C5AA 1BSGA 2Q0OA 2WKPA 1LT0A 4FH2A 3N7WA 3VP0A 1K55C 5EVIA 4WYYA 1ZC2A 5TR7A 3A3FA 1GHMA 3PTEA 2DNSA 4S2PA 5C5KA 1MBLA 5F68A 4YOFA 3N8RA 5FL3A 3F1PA 2ZQDA 2XD5A 3F1PB 5FEGA 4S2NC 1ESUA 1VEUB 3UB6A 1VETA 3BFDA 3MJQA 1YPRA 5HAQA 3K2NA 3W4QA 3ISGA 3IXGA 3PBQA 4KZ7A 5EVIC 3LY3A 4NKPA 3MKEA 3T4OA 2QPNA 1DJCA 2HV1A 2ZQ8A 4GD8A 3LFVA 5EOOA 4WZ4A 3BY8A 1LSWA 3C30A 2H0TA 5G4YA 1XJ2A 4NG2A 1MKIA 2JKFA 1PW8A 3DWZA 1HZOA 5K5BA 4KZ4A 1A0KA 4X53A 3ZHHA 4OKPA 4KG2A 2NUTC 4QD4A 4JXSA 5G4ZA 3CJMA 3ITAA 4KENB 1GA9A 3F1NA 2WZZA 1TDLA 4WELA 2J7VA 2K2NA 3R7WB 5E2GA 4BMWA 3MFXA 2PYRA 2P9VA 4Y0UA 2W3FA 4FSFA 4X25A 2P08A 4ZJ2A 1K56D 4H8RA 3W2ZA 4R4RA 5FI7A 4DE1A 3H7WA 3PAGA 1YLPA 1EI5A 4HOIA 5A93A 5AQ9A 5HPFA 1LSXA 4YNRA 1PWGA 3MR0A 3QP6A 3V3SA 2DMWA 4E3JA 4KZ3A 3IF5A 4UEYA 5EOEA 3DWKA 5EPHA 1GSVA 5DFXA 1JTGA 3VSLA 4LRZE 1XX2A 1UWPX 1NJ4A 2ZC5B 4ETXA 1XPBA 2ZBBA 2IWCA 3LI8A 3BFGA 3BJNA 4DRTA 1W79A 4Y0OA 3HUOA 1K6RA 3H82A 2QWSA 2Y2MA 3MQOA 1K4FA 4WEKA 3KYQA 2W3EA 3IBJA 4WEJA 2EXBA 3OPHA 2EX8A 5DF7A 1JVJA 1KOUA 3R4KA 5MC7A 3TE8A 5DF9A 3ZCZA 1WYBA 1PZPA 1E4DA 5GL9A 2IWDA 2B5RA 3BLMA 1PIOA 1Q2PA 1H0MA 4OOYA 4JBFA 5CERA 2ZC3B 4PKYG 4WM9A 3SS5A 3C38A 3OLOA 1MKMA 1ONGA 1MPLA 3AGFA 2VLGA 1HTZA 1T19A 4MCWA 2ZC6B 1PWCA 3ZNYA 4OPQA 1F2KA 4DJ2A 3FZCA 3UPPA 5KSHA 1ONHA 4G3WA 2WZXA 3GECA 3MXSA 1F9IA 1XFNA 5A90A 2X02A 3HJIA 4JXWA 4OLGA 3CITA 4IJGA 1TF1A 2PYPA 2O9AA 2FH5A 3NY4A 5F82A 1BZAA 1N9BA 2VZWA 2INWA 4RYEA 4C3QA 1DJAA 3S7PA 2ZQ7A 3EEHA 1DJBA 3DW0A 4KQDA 4FCFA 5FAPA 5HX9A 3ITBA 4EUZA 4MBFA 4NEED 3HCYA 5AQBA 3T4TA 3DTKA 2W3HA 4IUHA 1CK3A 3B42A 4ARZA 2JKTI 2J80A 4RX3A 4GNUA 3F1OA 4GDNA 4O0PA 4B9OA 3F1OB 4EUVA 3GR2A 1OTIA 4MBKA 4F3LA 4IBRA 3IF6B 4UHUA 4F3LB 2A2LA 1ESIA 5DKKA 5F6AA 5EM0A 3VP1A 2QKPA 1IOUA 5HDCA 1QMFA 2W1TA 2JCHA 2HPBA 2GJ3A 1RP5A 2V0UA 1SCWA 2EWWA 4YINA 4ZJ1A 3SH9A 2RCXA 1ZG4A 1T1BA 1S6RA 2P7JA 1CF0A 3PBSA 2J8YA 3MXQA 1Y28A 1L0GA 1NLYA 5EVEA 3WS1A 1IYSA 3W4OA 3G2ZA 4LFUA 2KLIA 4EXOA 3KSFA 1GCEA 2VV7A 2LB9A 4BBVA 5G18A 5GLCA 5HWVA 3BW6A 2VGLM 4R4SA 4HIAA 2WGIA 4D2OA 5M1AA 2A24A 4DN0A 2A24B 3NDEA 1PYYA 1I2SA 4IEDA 4PM9A 3HJKA 4HJ4A 4HI4A 1ERQA 3N6IA 1KGFA 4MLLA 3UE1A 2OAQ1 1YSQA 3RXXA 3KSGA 4KQRA 2Y2KA 2D02A 4I3IA 4C75A 2JBFA 3VV4A 4KG6A 1IYQA 2VV8A 3CI6A 4GW9A 2BLSA 5FA7A 4NXFA 4BBTA 4B4ZA 5DJUA 3L9KA 3NCKA 3TOIA 1PI5A 2QJ5A 4DDYA 2G7UA 2ZD8A 2JKRI 3LEQA 2ZM0A 4WN5A 3SS3A 3DAVA 1K4EA 2JHEA 2ZJ9A 3E2LA 3G6OA 3BFCA 4MBHA 1KDSA 1MWTA 1FSYA 1K56A 3T50A 4JF5A 3FPVA 4MN6A 1W7FA 3G34A 2O0YA 4MEZA 2HDRA 3D3OA 2Y59A 2Z2MB 3DTEA 5CEDA 3IXHA 3MF0A 3A0RA 1NRFA 5CHUA 2H28A 3E4QA 4JXVA 2K31A 4CPKA 5TBMB 3QP5A 1BULA 3HLEA 3UMDA 5HD3A 2OLUA 4LV2A 4L9FA 3NJAA 4OQ0A 1H8YA 5F83A 2PDRA 5HDDA 2MJ6A 4HBUA 3A3DA 2OWJA 5JYPA 1DRMA 4JF4A 1E3UD 2E8IA 4CLCE 1V9ZA 3T1RA 5EECA 1H8MA 4GS9B 4EQIA 1F98A 4HH2A 4EW7A 3DTIA 3GQZA 1PWDA 3E4OA 3GV9A 4OOLA 3FWLA 3Q7VA 3BWLA 1G5UA 3QP1A 3V67A 1TS7A 4R6LA 3AGDA 1MWRA 2M7VA 3S4XA 2Z6CA 5HD5A 3FC7A 2J9OA 1FSWA 4HNBA 1PZOA 5AVEA 1KE0A 1YLZA 4QPRA 2Y2HA 3OOVA 4K91A 1KGEA 2VK3A 2OOLA 4DE2A 4LV3A 4JF6A 4O7DA 3NHQA 2VEAA 3P01A 2VJWA 3ZVWA 3UPOA 1TS8A 2YKFA 3FPWA 4JKTA 3CHWP 2G2WA 4P85A 3S22A 2FFYA 4AFIA 5E2EA 2A3UA 4KZ5A 4L0LA 2QMIA 5KZHA 4MMNA 1TS0A 2W1RA 3JPUA 3TRCA 4S2NA 1LSVA 4H6JB 1CQAA 3BY9A 5E2FA 4WZ5A 1YLWA 4Y15A 1X0OA 4DJ3A 1NYYA 2C5WB 3TW8A 2I72A 3PYPA 4PAUA 1HLUP 4OQGA 3NIAA 1ES4A 1M40A 3PBOA 5J4EA 3CZDA 5HAPA 1Q2QA 1S1YA 3MSHA 1OPXA 1IFQA 4GDBA 4RQ9A 1FIKA 1PI4A 3P09A 2XDMA 1VEUA 2P74A 5U47A 4IVKA 1WA9A 2AVXA 5CTMA 4RA7A 3IX8A 4JLFA 4R3JA 3RFBA 3UDFA 2ZOIA 1BLHA 2XRNA 4WZ5C 3WS5A 2HDQA 4OPZA 4U3TA 3UB7A 5HARA 2HJ9C 1UWNX 3OC2A 3QNBA 2Y2NA 5TJJA 4QU3A 1DP8A 5EV0A 1L0EA 1WE4A 4KQOA 3N8LA 3BECA 4HHDA 5FAQA 3SH7A 4ZBEA 1K6SA 1MWSA 3IQAA 4M4XA 3B3XA 1TEMA 1FCMA 5HFOA 4OPRA 4PM6A 4Y13A 3O88A 5GHYA 4R70A 3BFFA 4E04A 3UNWA 1RGYA 3R7WA 3LEZA 3PXPA 4ESPA 4Y5FA 3IXDA 2M1CA 2HF6A 4S2LA 3TG9A 2VGLS 1JWVA 1CEFA 1G6AA 3SZTA 3EOIA 2HP5A 3BFEA 3C7UA 3S7QA 4N1XA 3E0YA 1YSPA 5HW3A 4A5RA 5EE8A 2Y2PA 2ACGA 1XJ3A 3S7NA 5L07A 3ZG8B 1GHIA 5J8XA 4R1GA 5M18A 4UQIM 3KYZA 1D7EA 2UWXA 1ODVA 3UO9A 2O9BA 4C6YA 4B93A 5CEBA 5DJTA 3CPTB 1H8ZA 4X1LA 1NYMA 4Y7PA 2Y2GA 1M6KA 2WKQA 3DBAA 2ZM8A 2OSUA 3ZYTA 4I3AA 1YMXA 4BJPA 1SHVA 2HZ5A 4S2OA 3V50A 2WAFA 1IKGA 4WF0A 2CMNA 3LIDA 3MKFA 1G28A 1LL5A 4OP5A 3TSGA 2R78A 5CXWA 2XSSA 4P6ZS 1S0WA 4L9GA 2V20A 1L0DA 3VOLA 3IH8A 4R38A 1Z09A 3NBLA 4K08A 2GZAA 5AQ7A 1E3UA 3IBRA 2ZQAA 2WK0A 3T1QB 1UGUA 4GZBA 1GA0A 3C2WA 3HREA 4I3JA 1OT6A 1ALQA 4E6XA 4UA7A 5FEFA 5CTNA 3T1XA 4EERA 1OJGA 3HVFA 1ERMA 3FG8A 1OTEA 4JGOA 4XUZA 3VMAA 3IWIA 2PBDP 3N8SA 3M2JA 3JVUA 4YWZA 3VFHA 2XA7S 1YMSA 4PHTA 2WKEA 4OONA 3E4PA 1NY0A 5FQIA 2J9PA 1LLBA 5FQJA 4FD8A 4JGRA 3VE4A 3UDIA 3EQVA 3LR4A 5TFQA 3Q82A 5KIZA 3MS6A 5FSRA 2HDSA 1IYPA 3JVVA 3IF6A 1VM1A 4E3NA 5LBRA 5CHMA 5L8MA 2J3WA 4Q0JA 4HP9A 1HVBA 2WKHA 1BLCA 4PM8A 3ZGAB 5HWWA 5FQQA 1XXMA 3Q1FA 2PBYA 1VHMA 2ZM2A 5L09A 1N9LA 2ZMFA 1AWIA 1HD8A 4FTXA 1NRJA 4PKYA 1FCNA 3S1YA 3T12B 5DTTA 1IEMA 3C4OA 5M19A 3ZDJA 1FR1A 4ZJ3A 1BLPA 2A49A 2EX6A 4ZRRA 3IF6C 2EFXA 2Y2QA 1LI0A 3VP4A 4E3IA 3S7OA 3K3CA 2Z2LB 1KGGA 3MXRA 5CECA 1BLSA 5DFYA 4N9LA 1ES5A 1YLTA 3V3RA 3NI9A 1I2WA 3IWQA 4KZ9A 5HAIA 3GDIA 3U2AA 3SH8A 2BG1A 3OCLA 1YLJA 3PR6A 1YAXA 2WAEA 4EETB 4E3KA 3K3DA 2EXAA 4HP4A 5IT5A 1S66L 4PM5A
chains in the Genus database with same CATH topology
1GHPA 2H0TA 1NZOA 4DXCA 5KMWA 3AGDA 1MKIA 1MWRA 3OCNA 1PW8A 3DWZA 4QB8A 3LCEA 1HZOA 3S4XA 1CI9A 4KZ4A 4S2JA 4HEFA 2DCFA 4KZAA 3NC8A 3VP2A 4X53A 2J9OA 3ZHHA 4OKPA 4KG2A 4QD4A 1FSWA 4KZ8A 4JXSA 5I94A 1PZOA 3CJMA 3ITAA 1KE0A 1NZUA 1YLZA 1K54C 4KENB 3RJUA 1GA9A 2Y2OA 1FQGA 1K25A 2VGKA 2WZZA 1TDLA 2Y2HA 5D3OA 4Q8IA 3N4IA 3C4PA 1XKZA 4P0MA 4K91A 4WELA 2J7VA 1KGEA 3ZG7B 3SS4A 1FOFA 4DE2A 1ZKJA 4LV3A 4JPMA 5DF8A 4K0XA 4JF6A 4O7DA 5E2GA 1YLYA 2G2UA 4BQMA 4OH0A 2EX2A 2JC7A 3ZVWA 3UPOA 1E25A 4JKTA 2R9WA 2G2WA 4U0TA 4GN2A 2DRWA 2WKIA 1Z6FA 4P85A 1IKIA 4S2MA 3OPPA 3S22A 3ZG0A 2FFYA 1TVFA 4LV0A 4U0XA 5E2EA 2A3UA 4KZ5A 4ID4A 3BRMA 4L0LA 2P9VA 2QMIA 4Y0UA 3W8KA 5KZHA 2PU4A 4FSFA 1H5XA 3G31A 4PMAA 5IHVA 4ZJ2A 4S2NA 4LCLA 1K56D 3LO7A 3IT9A 4H8RA 4LENA 3RXWA 2XGNA 1KDWA 3WS2A 3GVBA 3HBRA 1XP4A 3CMZA 1SDEA 5KSCA 2H5SA 4R4RA 4X69A 1W5DA 3PBTA 3VOZA 5E2FA 5FI7A 3M6HA 4DE1A 3Q07A 5A91A 4OQIA 4WZ5A 3PAGA 1YLPA 1YLWA 4LCMA 4R3BA 4Y0TA 4HBTA 3O86A 1EI5A 1NYYA 4IVIA 5A93A 2C5WB 2C6WB 5E2HA 5AQ9A 2I72A 2XD1A 5EVID 4OQGA 3NIAA 1PWGA 4EV4A 3MZDA 1BT5A 3V3SA 4BENA 5BOHA 1ES4A 1M40A 4CJNA 3PBOA 4E3JA 4XUXA 4DDSA 4KZ3A 3IF5A 3CZDA 3UE3A 5EOEA 5HAPA 3DWKA 3OPLA 1Q2QA 5EPHA 1CI8A 3HLCA 1N4OA 4GDBA 4PM7A 4QY5A 1JTGA 5DVAA 4BL2A 3VSLA 1YT4A 1PI4A 2ZC4B 3P09A 4OVDA 2XDMA 1SDNA 5TGFA 2IWBA 4P87A 3ZNTA 3Q7ZA 1XX2A 2P74A 1NJ4A 2ZC5B 3O3VA 5U47A 4E3MA 4IVKA 3PBRA 4X6TA 1XPBA 2IWCA 5CTMA 3BFGA 1ES3A 2QZ6A 3PAEA 4RA7A 1W79A 4DRTA 3PBNA 2XFTA 1I5QA 3HUOA 1K6RA 4JLFA 3C7VA 3D4FA 4R3JA 4Y0OA 3UDFA 1IYOA 4B4XA 2Y2MA 2XFSA 5F1GA 1BLHA 1K4FA 3OZHA 3FV7A 4WEKA 4WZ5C 3WS5A 2HDQA 2XEPA 1LHYA 2EXBA 3I7JA 3MBZA 2EX8A 3OPHA 4OPZA 4U3TA 4WEJA 5DF7A 1JVJA 3HLFA 5DF9A 3ZCZA 3WWXA 1WYBA 3UE0A 1PZPA 3HUMA 1E4DA 5GL9A 5HARA 3G4PA 3UY6A 2IWDA 4QJGA 4KG5A 2B5RA 1WYCA 5EUAA 3BLMA 1PIOA 3A3IA 1Q2PA 2Q9NA 2WGWB 3OC2A 4UA9A 4OOYA 3QNBA 3NDGA 2Y91A 2Y2NA 4JBFA 5CERA 1U60A 2ZC3B 4E6WA 4WM9A 4LV1A 4QU3A 2OLVA 3SS5A 2WADA 3HLBA 1ONGA 1L0EA 1MPLA 1OMEA 1BUEA 1WE4A 3AGFA 3N8LA 4KQOA 4OQHA 3JYIA 1FR6A 3BECA 4PPRA 1AXBA 1HTZA 5FAQA 4GB7A 3SH7A 2ZC6B 3DTMA 1PWCA 4ZBEA 3WS4A 1K6SA 3UPNA 1MWSA 3IH9A 3IQAA 3ZNYA 4OPQA 5GLDA 3B3XA 1TDGA 3A3JA 1TEMA 3UDXA 4R23A 3FZCA 4N1HA 4OPYA 1FCMA 4X55A 5HFOA 1JWZA 3UPPA 4OPRA 4PM6A 5KSHA 4UA6A 3VOYA 5CGXA 3O88A 1CEGA 1ONHA 2WZXA 5FQKA 4DXBA 3QHYA 5FQ9A 3MXSA 5FI6A 4BL3A 5GHYA 5A90A 3BFFA 1K57A 2H10A 2X02A 3UNWA 4JXWA 4OLGA 4ZTKA 1RGYA 1MY8A 4E3OA 3LEZA 2H0YA 1YM1A 4UAAA 5CHJA 3AGEA 3NY4A 5F82A 1BZAA 1N9BA 3IXDA 3GTCA 4RYEA 4S2LA 3HLDA 3TG9A 4C3QA 1DJAA 1JWVA 2ZQ7A 1CEFA 2ZQ9A 1DJBA 1G6AA 3DW0A 3HLGA 4FCFA 5FAPA 5HX9A 2HP5A 3BFEA 2ZC7A 3C7UA 3ITBA 4EUZA 1KE3A 2Y2LA 4N1XA 4MBFA 2XR0A 5AQBA 1O7EA 2Y4AA 5HW3A 3G32A 1CK3A 3W4PA 4A5RA 1K38A 1PW1A 5EE8A 2Y2PA 2ZLYA 5CRFA 4S2IA 2XQZA 4RX3A 4GNUA 1XA7A 5GHXA 4GDNA 2V1ZA 4EBNA 3ZG8B 1XGIA 2V2FF 3GR2A 4MBKA 4S2KA 3WRZA 4IBRA 1NXYA 3IF6B 4UHUA 1GHIA 5AQAA 4R1GA 5J8XA 3ZVTA 1K57C 5M18A 2XF3A 3ZG5A 1ESIA 1L0FA 1KVMA 3BYDA 3VP1A 5GHZA 4BLMA 1LL9A 4N92A 4B88A 1KE4A 1QMFA 2UWXA 3M6BA 2JCHA 3MZEA 2HPBA 3V5MA 5JYOA 1XGJA 3BLSA 5GLBA 3UO9A 4C6YA 3GMWA 3IWOA 5A92A 5CEBA 1RP5A 3FKWA 3Q81A 3ZG9B 1SCWA 1JWPA 2XH9A 4YINA 4ZJ1A 1ES2A 5FASA 4YFMA 3SH9A 2RCXA 2RL3A 1H8ZA 3HUNA 1NYMA 5FATA 4Y7PA 2Y2GA 2XK1A 1ZG4A 3BEBA 1M6KA 1S6RA 2ZM8A 5EVIB 3PBSA 1O07A 2OSUA 4BJPA 1YMXA 2J8YA 4DKIA 3BM6A 1SHVA 1L0GA 4BD1A 3WS1A 4S2OA 3V50A 2WAFA 1IKGA 1IYSA 4E3LA 3W4OA 3E2KA 3G2ZA 4X68A 1ZG6A 3MKFA 1W8QA 2Y2JA 4P6BA 3MFDA 1LL5A 1C3BA 4OP5A 1GCEA 5FQMA 4QY6A 4EBPA 2VGJA 3QNCA 1L2SA 3TSGA 4RVAA 4F94A 5CXWA 2WGWA 5G18A 1S0WA 5GLCA 2V20A 1L0DA 4DE0A 3IH8A 3G2YA 3NBLA 3VP3A 4R4SA 2WGIA 5EVLA 4KZBA 5AQ7A 3V39A 1E3UA 4D2OA 2ZQAA 2WK0A 5M1AA 4GZBA 4WMCD 4R0QA 5E43A 1GA0A 3HREA 5FDHA 3NDEA 3SOIA 1PYYA 4WBGA 1ALQA 4E6XA 1I2SA 4K0WA 4UA7A 3CG5A 4IEDA 4PM9A 5CTNA 1ERQA 3N6IA 4GD6A 3HVFA 1ERMA 2WGVA 1KGFA 3FYZA 5GLAA 2XLNA 4KQQA 4MLLA 5F1FA 3UE1A 4EBLA 3IXBA 3RXXA 3Q7VB 3GSGA 4KQRA 3VSKA 2Y2IA 1DY6A 2Y2KA 4XXRA 4C75A 3P98A 4DE3A 4XUZA 3VMAA 3IWIA 3N8SA 3M2JA 2JBFA 4GKUA 4KG6A 2X01A 2FFFB 2EX9A 1IYQA 5FAOA 3VFHA 3MZFA 4ZAMA 1YMSA 3G30A 4X56A 2WKEA 4OONA 5CGWA 2BLSA 2HP9A 2Q9MA 4MNRA 1IELA 1NY0A 2WUQA 5FQIA 2J9PA 5FA7A 4DF6A 4GOGA 1LLBA 3FKVA 5FQJA 4FD8A 4BD0A 4RX2A 4NK3A 1QMEA 3UDIA 4B4ZA 1SKFA 1K55A 1VQQA 3EQVA 1JTDA 4Z9QA 3A3EA 1G68A 2WYXA 3EQUA 3NCKA 1RCJA 5TFQA 3Q82A 3TOIA 1PI5A 5FSRA 1FCOA 3WS0A 2HDSA 4DDYA 2ZD8A 4ZDXA 1IYPA 3IHBA 2ZM0A 3SS3A 2GDNA 3WRTA 4QHCA 3IF6A 1K4EA 4M3KA 2ZJ9A 3E2LA 1VM1A 3BFCA 3IHAA 3HLWA 3G35A 3OPRA 4MBHA 4OLDA 3ZFZA 1KDSA 1MWTA 2P9VB 4E3NA 1FSYA 1K56A 5CHMA 2X71A 2ZQCA 1KVLA 4JF5A 4FH4A 4OOMA 1LI9A 1HVBA 1W7FA 2WKHA 3G34A 1BLCA 4PM8A 3LY4A 3ZGAB 5FQQA 4MEZA 1RGZA 2HDRA 3VFFA 1XXMA 3Q1FA 2PBYA 1EWZA 2PU2A 5DTKA 3C5AA 1BSGA 2ZM2A 2Y55A 4EWFA 2Y59A 2Z2MB 5CEDA 4FH2A 3N7WA 1HD8A 3IXHA 5L2FA 1NRFA 3VP0A 1FCNA 5CHUA 1K55C 5EVIA 3S1YA 4JXVA 4JXGA 4WYYA 4CPKA 1ZC2A 5TR7A 5DTTA 2HDUA 3A3FA 1GHMA 3PTEA 1BULA 1J9MA 1IEMA 2DNSA 2HP6A 3C4OA 3HLEA 4S2PA 5M19A 1YQSA 3ZDJA 1FR1A 2OLUA 4NETA 1MBLA 4LV2A 4ZJ3A 3M2KA 1BLPA 2A49A 2EX6A 4HESA 4OQ0A 1H8YA 3N8RA 3IF6C 5F83A 2EFXA 2Y2QA 1EROA 1LI0A 2XD5A 2ZQDA 3VP4A 4E3IA 3HL9A 4S2NC 1ESUA 2Z2LB 1KGGA 3MXRA 5CECA 2ZMAA 2OV5A 1BLSA 4HBUA 3BFDA 4KZ6A 3A3DA 4N9LA 1ES5A 3O87A 3UN7A 1YLTA 1XA1A 3V3RA 3NI9A 1I2WA 3IWQA 5HAQA 3W4QA 4KZ9A 1K54A 5HL1A 3ISGA 5HAIA 5JYPA 4JF4A 3IXGA 3SH8A 2BG1A 1E3UD 1YLJA 2E8IA 3OCLA 3PBQA 4KZ7A 5EECA 5FI2A 2WAEA 1W8YA 1MWUA 2R9XA 4OP8A 5EVIC 4EQIA 3LY3A 2CC1A 4N9KA 4IBXA 4E3KA 3MKEA 5DTSA 2QPNA 2EFUA 1DJCA 5CGSA 1BTLA 2JE5A 2EXAA 3GQZA 1PWDA 2ZQ8A 4GD8A 3GV9A 1MXOA 4OOLA 3FWLA 3Q7VA 5EOOA 3GRJA 4WZ4A 1Y54A 4WMCA 4PM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GHP A;  2H0T A;  1NZO A;  4DXC A;  5KMW A;  3AGD A;  1MKI A;  1MWR A;  3OCN A;  1PW8 A;  3DWZ A;  4QB8 A;  3LCE A;  1HZO A;  3S4X A;  1CI9 A;  4KZ4 A;  4S2J A;  4HEF A;  2DCF A;  4KZA A;  3NC8 A;  3VP2 A;  4X53 A;  2J9O A;  3ZHH A;  4OKP A;  4KG2 A;  4QD4 A;  1FSW A;  4KZ8 A;  4JXS A;  5I94 A;  1PZO A;  3CJM A;  3ITA A;  1KE0 A;  1NZU A;  1YLZ A;  1K54 C;  4KEN B;  3RJU A;  1GA9 A;  2Y2O A;  1FQG A;  1K25 A;  2VGK A;  2WZZ A;  1TDL A;  2Y2H A;  5D3O A;  4Q8I A;  3N4I A;  3C4P A;  1XKZ A;  4P0M A;  4K91 A;  4WEL A;  2J7V A;  1KGE A;  3ZG7 B;  3SS4 A;  1FOF A;  4DE2 A;  1ZKJ A;  4LV3 A;  4JPM A;  5DF8 A;  4K0X A;  4JF6 A;  4O7D A;  5E2G A;  1YLY A;  2G2U A;  4BQM A;  4OH0 A;  2EX2 A;  2JC7 A;  3ZVW A;  3UPO A;  1E25 A;  4JKT A;  2R9W A;  2G2W A;  4U0T A;  4GN2 A;  2DRW A;  2WKI A;  1Z6F A;  4P85 A;  1IKI A;  4S2M A;  3OPP A;  3S22 A;  3ZG0 A;  2FFY A;  1TVF A;  4LV0 A;  4U0X A;  5E2E A;  2A3U A;  4KZ5 A;  4ID4 A;  3BRM A;  4L0L A;  2P9V A;  2QMI A;  4Y0U A;  3W8K A;  5KZH A;  2PU4 A;  4FSF A;  1H5X A;  3G31 A;  4PMA A;  5IHV A;  4ZJ2 A;  4S2N A;  4LCL A;  1K56 D;  3LO7 A;  3IT9 A;  4H8R A;  4LEN A;  3RXW A;  2XGN A;  1KDW A;  3WS2 A;  3GVB A;  3HBR A;  1XP4 A;  3CMZ A;  1SDE A;  5KSC A;  2H5S A;  4R4R A;  4X69 A;  1W5D A;  3PBT A;  3VOZ A;  5E2F A;  5FI7 A;  3M6H A;  4DE1 A;  3Q07 A;  5A91 A;  4OQI A;  4WZ5 A;  3PAG A;  1YLP A;  1YLW A;  4LCM A;  4R3B A;  4Y0T A;  4HBT A;  3O86 A;  1EI5 A;  1NYY A;  4IVI A;  5A93 A;  2C5W B;  2C6W B;  5E2H A;  5AQ9 A;  2I72 A;  2XD1 A;  5EVI D;  4OQG A;  3NIA A;  1PWG A;  4EV4 A;  3MZD A;  1BT5 A;  3V3S A;  4BEN A;  5BOH A;  1ES4 A;  1M40 A;  4CJN A;  3PBO A;  4E3J A;  4XUX A;  4DDS A;  4KZ3 A;  3IF5 A;  3CZD A;  3UE3 A;  5EOE A;  5HAP A;  3DWK A;  3OPL A;  1Q2Q A;  5EPH A;  1CI8 A;  3HLC A;  1N4O A;  4GDB A;  4PM7 A;  4QY5 A;  1JTG A;  5DVA A;  4BL2 A;  3VSL A;  1YT4 A;  1PI4 A;  2ZC4 B;  3P09 A;  4OVD A;  2XDM A;  1SDN A;  5TGF A;  2IWB A;  4P87 A;  3ZNT A;  3Q7Z A;  1XX2 A;  2P74 A;  1NJ4 A;  2ZC5 B;  3O3V A;  5U47 A;  4E3M A;  4IVK A;  3PBR A;  4X6T A;  1XPB A;  2IWC A;  5CTM A;  3BFG A;  1ES3 A;  2QZ6 A;  3PAE A;  4RA7 A;  1W79 A;  4DRT A;  3PBN A;  2XFT A;  1I5Q A;  3HUO A;  1K6R A;  4JLF A;  3C7V A;  3D4F A;  4R3J A;  4Y0O A;  3UDF A;  1IYO A;  4B4X A;  2Y2M A;  2XFS A;  5F1G A;  1BLH A;  1K4F A;  3OZH A;  3FV7 A;  4WEK A;  4WZ5 C;  3WS5 A;  2HDQ A;  2XEP A;  1LHY A;  2EXB A;  3I7J A;  3MBZ A;  2EX8 A;  3OPH A;  4OPZ A;  4U3T A;  4WEJ A;  5DF7 A;  1JVJ A;  3HLF A;  5DF9 A;  3ZCZ A;  3WWX A;  1WYB A;  3UE0 A;  1PZP A;  3HUM A;  1E4D A;  5GL9 A;  5HAR A;  3G4P A;  3UY6 A;  2IWD A;  4QJG A;  4KG5 A;  2B5R A;  1WYC A;  5EUA A;  3BLM A;  1PIO A;  3A3I A;  1Q2P A;  2Q9N A;  2WGW B;  3OC2 A;  4UA9 A;  4OOY A;  3QNB A;  3NDG A;  2Y91 A;  2Y2N A;  4JBF A;  5CER A;  1U60 A;  2ZC3 B;  4E6W A;  4WM9 A;  4LV1 A;  4QU3 A;  2OLV A;  3SS5 A;  2WAD A;  3HLB A;  1ONG A;  1L0E A;  1MPL A;  1OME A;  1BUE A;  1WE4 A;  3AGF A;  3N8L A;  4KQO A;  4OQH A;  3JYI A;  1FR6 A;  3BEC A;  4PPR A;  1AXB A;  1HTZ A;  5FAQ A;  4GB7 A;  3SH7 A;  2ZC6 B;  3DTM A;  1PWC A;  4ZBE A;  3WS4 A;  1K6S A;  3UPN A;  1MWS A;  3IH9 A;  3IQA A;  3ZNY A;  4OPQ A;  5GLD A;  3B3X A;  1TDG A;  3A3J A;  1TEM A;  3UDX A;  4R23 A;  3FZC A;  4N1H A;  4OPY A;  1FCM A;  4X55 A;  5HFO A;  1JWZ A;  3UPP A;  4OPR A;  4PM6 A;  5KSH A;  4UA6 A;  3VOY A;  5CGX A;  3O88 A;  1CEG A;  1ONH A;  2WZX A;  5FQK A;  4DXB A;  3QHY A;  5FQ9 A;  3MXS A;  5FI6 A;  4BL3 A;  5GHY A;  5A90 A;  3BFF A;  1K57 A;  2H10 A;  2X02 A;  3UNW A;  4JXW A;  4OLG A;  4ZTK A;  1RGY A;  1MY8 A;  4E3O A;  3LEZ A;  2H0Y A;  1YM1 A;  4UAA A;  5CHJ A;  3AGE A;  3NY4 A;  5F82 A;  1BZA A;  1N9B A;  3IXD A;  3GTC A;  4RYE A;  4S2L A;  3HLD A;  3TG9 A;  4C3Q A;  1DJA A;  1JWV A;  2ZQ7 A;  1CEF A;  2ZQ9 A;  1DJB A;  1G6A A;  3DW0 A;  3HLG A;  4FCF A;  5FAP A;  5HX9 A;  2HP5 A;  3BFE A;  2ZC7 A;  3C7U A;  3ITB A;  4EUZ A;  1KE3 A;  2Y2L A;  4N1X A;  4MBF A;  2XR0 A;  5AQB A;  1O7E A;  2Y4A A;  5HW3 A;  3G32 A;  1CK3 A;  3W4P A;  4A5R A;  1K38 A;  1PW1 A;  5EE8 A;  2Y2P A;  2ZLY A;  5CRF A;  4S2I A;  2XQZ A;  4RX3 A;  4GNU A;  1XA7 A;  5GHX A;  4GDN A;  2V1Z A;  4EBN A;  3ZG8 B;  1XGI A;  2V2F F;  3GR2 A;  4MBK A;  4S2K A;  3WRZ A;  4IBR A;  1NXY A;  3IF6 B;  4UHU A;  1GHI A;  5AQA A;  4R1G A;  5J8X A;  3ZVT A;  1K57 C;  5M18 A;  2XF3 A;  3ZG5 A;  1ESI A;  1L0F A;  1KVM A;  3BYD A;  3VP1 A;  5GHZ A;  4BLM A;  1LL9 A;  4N92 A;  4B88 A;  1KE4 A;  1QMF A;  2UWX A;  3M6B A;  2JCH A;  3MZE A;  2HPB A;  3V5M A;  5JYO A;  1XGJ A;  3BLS A;  5GLB A;  3UO9 A;  4C6Y A;  3GMW A;  3IWO A;  5A92 A;  5CEB A;  1RP5 A;  3FKW A;  3Q81 A;  3ZG9 B;  1SCW A;  1JWP A;  2XH9 A;  4YIN A;  4ZJ1 A;  1ES2 A;  5FAS A;  4YFM A;  3SH9 A;  2RCX A;  2RL3 A;  1H8Z A;  3HUN A;  1NYM A;  5FAT A;  4Y7P A;  2Y2G A;  2XK1 A;  1ZG4 A;  3BEB A;  1M6K A;  1S6R A;  2ZM8 A;  5EVI B;  3PBS A;  1O07 A;  2OSU A;  4BJP A;  1YMX A;  2J8Y A;  4DKI A;  3BM6 A;  1SHV A;  1L0G A;  4BD1 A;  3WS1 A;  4S2O A;  3V50 A;  2WAF A;  1IKG A;  1IYS A;  4E3L A;  3W4O A;  3E2K A;  3G2Z A;  4X68 A;  1ZG6 A;  3MKF A;  1W8Q A;  2Y2J A;  4P6B A;  3MFD A;  1LL5 A;  1C3B A;  4OP5 A;  1GCE A;  5FQM A;  4QY6 A;  4EBP A;  2VGJ A;  3QNC A;  1L2S A;  3TSG A;  4RVA A;  4F94 A;  5CXW A;  2WGW A;  5G18 A;  1S0W A;  5GLC A;  2V20 A;  1L0D A;  4DE0 A;  3IH8 A;  3G2Y A;  3NBL A;  3VP3 A;  4R4S A;  2WGI A;  5EVL A;  4KZB A;  5AQ7 A;  3V39 A;  1E3U A;  4D2O A;  2ZQA A;  2WK0 A;  5M1A A;  4GZB A;  4WMC D;  4R0Q A;  5E43 A;  1GA0 A;  3HRE A;  5FDH A;  3NDE A;  3SOI A;  1PYY A;  4WBG A;  1ALQ A;  4E6X A;  1I2S A;  4K0W A;  4UA7 A;  3CG5 A;  4IED A;  4PM9 A;  5CTN A;  1ERQ A;  3N6I A;  4GD6 A;  3HVF A;  1ERM A;  2WGV A;  1KGF A;  3FYZ A;  5GLA A;  2XLN A;  4KQQ A;  4MLL A;  5F1F A;  3UE1 A;  4EBL A;  3IXB A;  3RXX A;  3Q7V B;  3GSG A;  4KQR A;  3VSK A;  2Y2I A;  1DY6 A;  2Y2K A;  4XXR A;  4C75 A;  3P98 A;  4DE3 A;  4XUZ A;  3VMA A;  3IWI A;  3N8S A;  3M2J A;  2JBF A;  4GKU A;  4KG6 A;  2X01 A;  2FFF B;  2EX9 A;  1IYQ A;  5FAO A;  3VFH A;  3MZF A;  4ZAM A;  1YMS A;  3G30 A;  4X56 A;  2WKE A;  4OON A;  5CGW A;  2BLS A;  2HP9 A;  2Q9M A;  4MNR A;  1IEL A;  1NY0 A;  2WUQ A;  5FQI A;  2J9P A;  5FA7 A;  4DF6 A;  4GOG A;  1LLB A;  3FKV A;  5FQJ A;  4FD8 A;  4BD0 A;  4RX2 A;  4NK3 A;  1QME A;  3UDI A;  4B4Z A;  1SKF A;  1K55 A;  1VQQ A;  3EQV A;  1JTD A;  4Z9Q A;  3A3E A;  1G68 A;  2WYX A;  3EQU A;  3NCK A;  1RCJ A;  5TFQ A;  3Q82 A;  3TOI A;  1PI5 A;  5FSR A;  1FCO A;  3WS0 A;  2HDS A;  4DDY A;  2ZD8 A;  4ZDX A;  1IYP A;  3IHB A;  2ZM0 A;  3SS3 A;  2GDN A;  3WRT A;  4QHC A;  3IF6 A;  1K4E A;  4M3K A;  2ZJ9 A;  3E2L A;  1VM1 A;  3BFC A;  3IHA A;  3HLW A;  3G35 A;  3OPR A;  4MBH A;  4OLD A;  3ZFZ A;  1KDS A;  1MWT A;  2P9V B;  4E3N A;  1FSY A;  1K56 A;  5CHM A;  2X71 A;  2ZQC A;  1KVL A;  4JF5 A;  4FH4 A;  4OOM A;  1LI9 A;  1HVB A;  1W7F A;  2WKH A;  3G34 A;  1BLC A;  4PM8 A;  3LY4 A;  3ZGA B;  5FQQ A;  4MEZ A;  1RGZ A;  2HDR A;  3VFF A;  1XXM A;  3Q1F A;  2PBY A;  1EWZ A;  2PU2 A;  5DTK A;  3C5A A;  1BSG A;  2ZM2 A;  2Y55 A;  4EWF A;  2Y59 A;  2Z2M B;  5CED A;  4FH2 A;  3N7W A;  1HD8 A;  3IXH A;  5L2F A;  1NRF A;  3VP0 A;  1FCN A;  5CHU A;  1K55 C;  5EVI A;  3S1Y A;  4JXV A;  4JXG A;  4WYY A;  4CPK A;  1ZC2 A;  5TR7 A;  5DTT A;  2HDU A;  3A3F A;  1GHM A;  3PTE A;  1BUL A;  1J9M A;  1IEM A;  2DNS A;  2HP6 A;  3C4O A;  3HLE A;  4S2P A;  5M19 A;  1YQS A;  3ZDJ A;  1FR1 A;  2OLU A;  4NET A;  1MBL A;  4LV2 A;  4ZJ3 A;  3M2K A;  1BLP A;  2A49 A;  2EX6 A;  4HES A;  4OQ0 A;  1H8Y A;  3N8R A;  3IF6 C;  5F83 A;  2EFX A;  2Y2Q A;  1ERO A;  1LI0 A;  2XD5 A;  2ZQD A;  3VP4 A;  4E3I A;  3HL9 A;  4S2N C;  1ESU A;  2Z2L B;  1KGG A;  3MXR A;  5CEC A;  2ZMA A;  2OV5 A;  1BLS A;  4HBU A;  3BFD A;  4KZ6 A;  3A3D A;  4N9L A;  1ES5 A;  3O87 A;  3UN7 A;  1YLT A;  1XA1 A;  3V3R A;  3NI9 A;  1I2W A;  3IWQ A;  5HAQ A;  3W4Q A;  4KZ9 A;  1K54 A;  5HL1 A;  3ISG A;  5HAI A;  5JYP A;  4JF4 A;  3IXG A;  3SH8 A;  2BG1 A;  1E3U D;  1YLJ A;  2E8I A;  3OCL A;  3PBQ A;  4KZ7 A;  5EEC A;  5FI2 A;  2WAE A;  1W8Y A;  1MWU A;  2R9X A;  4OP8 A;  5EVI C;  4EQI A;  3LY3 A;  2CC1 A;  4N9K A;  4IBX A;  4E3K A;  3MKE A;  5DTS A;  2QPN A;  2EFU A;  1DJC A;  5CGS A;  1BTL A;  2JE5 A;  2EXA A;  3GQZ A;  1PWD A;  2ZQ8 A;  4GD8 A;  3GV9 A;  1MXO A;  4OOL A;  3FWL A;  3Q7V A;  5EOO A;  3GRJ A;  4WZ4 A;  1Y54 A;  4WMC A;  4PM5 A; 
#chains in the Genus database with same CATH topology
 1GHP A;  4MDZ A;  3MQQ A;  2JKG A;  5KMW A;  4QB8 A;  1CI9 A;  4S2J A;  4HEF A;  2DCF A;  4I38 A;  3ULF A;  3VP2 A;  2J3T C;  2KX6 A;  4KZ8 A;  4Y2F A;  4LRX C;  2V1A A;  4WUJ A;  1MC0 A;  2Y2O A;  1FQG A;  2VGK A;  1XJ4 A;  5D3O A;  4Q8I A;  3N4I A;  2M7U A;  1XKZ A;  4P0M A;  3NOT C;  3ZG7 B;  3SS4 A;  1FOF A;  4CLC A;  1ZKJ A;  4JPM A;  4CLC B;  1H3Q A;  4GHI B;  3T4S A;  1YLY A;  2G2U A;  4BQM A;  2JC7 A;  2FZ0 A;  2K7S A;  2W3D A;  2R9W A;  4U0T A;  3B33 A;  2ZL1 B;  2DRW A;  2WKI A;  1Z6F A;  4S2M A;  3OPP A;  4U0X A;  3W8K A;  4ID4 A;  3BRM A;  3NEC A;  1H5X A;  3G31 A;  4PMA A;  5IHV A;  2PT7 A;  3RXW A;  3IT9 A;  4LEN A;  3WS2 A;  3CUE A;  3CMZ A;  2PD7 A;  3VE3 A;  1SDE A;  4X69 A;  3UB8 A;  4XT2 B;  3PBT A;  3VOZ A;  3M6H A;  2YKH A;  3LIE A;  3CWF A;  5A91 A;  4OQI A;  4IHQ A;  4R3B A;  4LLO B;  4HBT A;  4IVI A;  2C6W B;  5E2H A;  2XD1 A;  4GCZ A;  5TBM A;  4CLC C;  1BT5 A;  2QJ7 A;  5BOH A;  4LGW A;  4XUX A;  4DDS A;  3LI9 A;  3UE3 A;  3OPL A;  3ICY A;  3H9W A;  3IX4 A;  1T1C A;  1N4O A;  4I5S A;  4PM7 A;  2Z6D A;  5DVA A;  4BL2 A;  5EM1 A;  5HDS A;  1YT4 A;  3T4K A;  2VKS A;  5TGF A;  2IWB A;  4EU0 A;  3ZNT A;  3Q7Z A;  1STZ A;  3O3V A;  1W63 Q;  4X6T A;  4Z1W A;  3CUE C;  2QZ6 A;  1OJ5 A;  4GLQ A;  3PBN A;  1I5Q A;  2XFT A;  1BYW A;  4B4X A;  2W3G A;  3OZH A;  3FV7 A;  5F69 A;  1P97 A;  3MBZ A;  4GS9 A;  2LB5 A;  3HLF A;  4L9E A;  5HPI A;  1NWZ A;  3UE0 A;  2Q9N A;  2WGW B;  4UA9 A;  3NDG A;  4E6W A;  2Y79 A;  2OLV A;  3MQ0 A;  3VSK A;  1FR6 A;  4KUK A;  1AXB A;  3CAX A;  2O9C A;  4GB7 A;  3KSI A;  3WS4 A;  3UPN A;  3IH9 A;  5GLD A;  1TDG A;  4OPY A;  4X55 A;  2GNX A;  4HY8 A;  4UA6 A;  5CGX A;  5FQK A;  2B95 A;  5FQ9 A;  1S67 L;  2H10 A;  4EES A;  4FUW A;  1MY8 A;  4E3O A;  2V1B A;  2WKR A;  2D01 A;  2H0Y A;  2KOI A;  1YM1 A;  4G3K A;  5HZH A;  2ZQ9 A;  1KE3 A;  2Y2L A;  1OTD A;  3T4Q A;  2XR0 A;  1O7E A;  4Q0I A;  2Y4A A;  2L0W A;  4H6J A;  3W4P A;  1K38 A;  5CX7 A;  1T1A A;  2ZLY A;  4Q0H A;  1XA7 A;  5GHX A;  2IA2 A;  2GX5 A;  2V2F F;  3UB9 A;  3IS2 B;  1NXY A;  2XF3 A;  3UB5 P;  3BYD A;  5GHZ A;  4N92 A;  3A0S A;  4B88 A;  1KE4 A;  2BAS A;  3M6B A;  3MZE A;  5JYO A;  4D60 A;  3BLS A;  1JWP A;  5FAS A;  4YFM A;  3A0V A;  5FAT A;  2XK1 A;  3BEB A;  1S4R A;  5EVI B;  2ZOH A;  3BM6 A;  2J3T D;  3LIC A;  4BD1 A;  1OTB A;  1YKD A;  3LR0 A;  4E3L A;  3E2K A;  4X68 A;  1W8Q A;  2Y2J A;  3IX3 A;  4P6B A;  5AVF A;  1C3B A;  4MN7 A;  1Y4O A;  4QY6 A;  4EBP A;  2VGJ A;  3QNC A;  4RVA A;  1VET B;  4DE0 A;  3G2Y A;  4LPZ A;  5EVL A;  3V39 A;  4ME4 A;  2VX8 A;  5FDS A;  5FDH A;  3SOI A;  4HJ3 A;  1N9O A;  3KSH A;  2XRO A;  4GD6 A;  5GLA A;  2WGV A;  4KQQ A;  3P7N A;  2PR6 A;  2Y2I A;  4XXR A;  5AJG A;  4DE3 A;  2E8J A;  3MMH A;  3PHY A;  4CLC D;  2FFF B;  2EX9 A;  3G30 A;  2HP9 A;  2Q9M A;  1IEL A;  1VB6 A;  3FKV A;  3F1N B;  4NK3 A;  4RX2 A;  1SKF A;  2JN7 A;  4GJ4 A;  4Z9Q A;  2KDK A;  3KX0 X;  4KUO A;  1RCJ A;  4II7 A;  4WLA A;  2V0W A;  1FIL A;  4ZDX A;  2VA0 A;  3IHB A;  3NOU C;  2GDN A;  4QHC A;  3G35 A;  3OPR A;  3ZFZ A;  2P9V B;  4DMZ A;  2X71 A;  2L4R A;  4FH4 A;  3D9Y A;  3BQA A;  3LY4 A;  1RGZ A;  2PU2 A;  3TJZ C;  5IU1 A;  2Y55 A;  4EWF A;  3CPT A;  3H7W B;  1L3L A;  3B47 A;  3LIA A;  5L2F A;  4JXG A;  4EQ1 A;  2HDU A;  1J9M A;  2HP6 A;  3LYX A;  1YQS A;  4NET A;  3M2K A;  4HES A;  4HQA A;  4MN5 A;  2HJE A;  1ERO A;  1XJ6 A;  3HL9 A;  2V9A A;  3EGD C;  2ZMA A;  2Y8H A;  2OV5 A;  4KZ6 A;  3O87 A;  3UN7 A;  1XA1 A;  5HL1 A;  1K54 A;  3H82 B;  5FI2 A;  3RH8 B;  1G6O A;  1W8Y A;  1MWU A;  2R9X A;  4OP8 A;  5EFW A;  2CC1 A;  4N9K A;  4IBX A;  5DTS A;  3U4L P;  2EFU A;  5J7E A;  5CGS A;  1BTL A;  2JE5 A;  1D1J A;  1CJF A;  3LR5 A;  1MXO A;  3GRJ A;  1Y54 A;  4WMC A;  1DP9 A;  3LUQ A;  1NZO A;  4DXC A;  3OCN A;  3LCE A;  3QP4 A;  4KZA A;  3NC8 A;  4NXB A;  3OBF A;  5I94 A;  1ZHH B;  1NZU A;  2L1M A;  1K54 C;  3RJU A;  5KSC A;  1K25 A;  5HSQ A;  3C4P A;  2V8F A;  5DF8 A;  4K0X A;  2PR5 A;  3NOP C;  4OH0 A;  2EX2 A;  1E25 A;  2JKT M;  3O5Y A;  2OWH A;  4GN2 A;  1IKI A;  3ZG0 A;  1TVF A;  4LV0 A;  2V8C A;  4X1M A;  2PD8 A;  2PU4 A;  1OTA A;  3KYE A;  4LCL A;  3LO7 A;  3LIB A;  2XGN A;  1KDW A;  3GVB A;  3HBR A;  1XP4 A;  4ARZ B;  4NXG A;  2H5S A;  4HH3 A;  1W5D A;  1F5M A;  1ACF A;  2QYB A;  3Q07 A;  4Y0T A;  4LCM A;  4FOF A;  1K0K A;  3O86 A;  3T4L A;  5EVI D;  3NUL A;  4EV4 A;  3EEA A;  3MZD A;  1MZU A;  4BEN A;  4CJN A;  1N9N A;  2W1T B;  4WL9 A;  1CI8 A;  3HLC A;  4QY5 A;  3C8C A;  4I39 A;  2ZC4 B;  4OVD A;  1SDN A;  2I9V A;  4P87 A;  4E3M A;  3PBR A;  3CLO A;  1ES3 A;  3PAE A;  3LIF A;  3C7V A;  3D4F A;  1IYO A;  2W27 A;  2XFS A;  5F1G A;  2XEP A;  1LHY A;  3I7J A;  5J3W A;  4EEU A;  3WWX A;  3HUM A;  3UY6 A;  4EEP A;  4QJG A;  3G4P A;  4KG5 A;  1WYC A;  5EUA A;  3A3I A;  2EA9 A;  2PHY A;  2Y91 A;  1U60 A;  1JNU A;  4JGP A;  4LV1 A;  2WAD A;  3HLB A;  1TS6 A;  1OME A;  1BUE A;  4OQH A;  1GSW A;  1XFQ A;  3JYI A;  4PPR A;  3DTM A;  2PAV P;  3A3J A;  3UDX A;  4R23 A;  4N1H A;  1PNE A;  1JWZ A;  2B18 A;  3VOY A;  1CEG A;  2HGV A;  4DXB A;  2EWV A;  3QHY A;  5FI6 A;  4BL3 A;  1K57 A;  4ZTK A;  5L10 A;  4UAA A;  5CHJ A;  3AGE A;  4GHI A;  2P04 A;  3GTC A;  3HLD A;  2ZL1 A;  3D72 A;  3HLG A;  2ZMV A;  4NXE A;  2JKR M;  2ZC7 A;  5A8B A;  3QP8 A;  3G32 A;  1PW1 A;  5HWT A;  4R3A A;  5CRF A;  4S2I A;  4O8G A;  2XQZ A;  4CQH A;  4XT2 A;  4O01 A;  2V1Z A;  3E98 A;  4EBN A;  1NLZ A;  1XGI A;  4S2K A;  3WRZ A;  2NUP C;  3UME A;  2B02 A;  2OAP 1;  4QWO A;  5AQA A;  1GSX A;  3ZVT A;  1K57 C;  3ZG5 A;  1L0F A;  4BWI A;  1KVM A;  1SZV A;  4BLM A;  1LL9 A;  4JGQ A;  3V5M A;  4P6Z M;  1XGJ A;  5HL6 A;  5F5Y A;  5GLB A;  3GMW A;  3IWO A;  5A92 A;  3FKW A;  3Q81 A;  3ZG9 B;  2XH9 A;  1ES2 A;  3LGO A;  2RL3 A;  3HUN A;  1D06 A;  5I5L A;  1O07 A;  1OT9 A;  4DKI A;  4Y17 A;  1P0Z A;  3UE6 A;  1ZG6 A;  4UQI S;  3MFD A;  5IS1 A;  1J3W A;  3KO6 A;  5FQM A;  1L2S A;  4F94 A;  2WGW A;  2PRF A;  2XA7 M;  1LL8 A;  3VP3 A;  2VV6 A;  4KZB A;  3SW1 A;  3QP2 A;  4WMC D;  1PRQ A;  4R0Q A;  5E43 A;  4WBG A;  1S1Z A;  4K0W A;  3CG5 A;  1W63 M;  3ZQ5 A;  1S4S A;  4LRY C;  4ETZ A;  1SKO A;  1SKO B;  1ZTU A;  3RTY A;  3LR3 A;  3FYZ A;  2XLN A;  4Y3I A;  5F1F A;  1P9W A;  4BBU A;  4EBL A;  3IXB A;  3Q7V B;  3GSG A;  5DKL A;  4G3V A;  1DY6 A;  3P98 A;  4IUK A;  1T18 A;  4GKU A;  2X01 A;  5FAO A;  3MZF A;  4ZAM A;  2W0N A;  1DP6 A;  4X56 A;  3T1S A;  2O99 A;  5CGW A;  4MNR A;  2WUQ A;  1P9R A;  3EWK A;  4DF6 A;  4GOG A;  4BD0 A;  2BTF P;  1QME A;  1K55 A;  1VQQ A;  1JTD A;  1TD5 A;  3A3E A;  1G68 A;  2WYX A;  3EQU A;  1FCO A;  3BQ8 A;  3WS0 A;  2UV0 E;  1V9Y A;  3WRT A;  3IS2 A;  4M3K A;  3L7H A;  1EW0 A;  3EGX C;  3IHA A;  3HLW A;  4OLD A;  1PFL A;  2QHK A;  2ZQC A;  1KVL A;  4OOM A;  1LI9 A;  4HJ6 A;  3VFF A;  1EWZ A;  5DTK A;  3T4J A;  3C5A A;  1BSG A;  2Q0O A;  2WKP A;  1LT0 A;  4FH2 A;  3N7W A;  3VP0 A;  1K55 C;  5EVI A;  4WYY A;  1ZC2 A;  5TR7 A;  3A3F A;  1GHM A;  3PTE A;  2DNS A;  4S2P A;  5C5K A;  1MBL A;  5F68 A;  4YOF A;  3N8R A;  5FL3 A;  3F1P A;  2ZQD A;  2XD5 A;  3F1P B;  5FEG A;  4S2N C;  1ESU A;  1VEU B;  3UB6 A;  1VET A;  3BFD A;  3MJQ A;  1YPR A;  5HAQ A;  3K2N A;  3W4Q A;  3ISG A;  3IXG A;  3PBQ A;  4KZ7 A;  5EVI C;  3LY3 A;  4NKP A;  3MKE A;  3T4O A;  2QPN A;  1DJC A;  2HV1 A;  2ZQ8 A;  4GD8 A;  3LFV A;  5EOO A;  4WZ4 A;  3BY8 A;  1LSW A;  3C30 A;  2H0T A;  5G4Y A;  1XJ2 A;  4NG2 A;  1MKI A;  2JKF A;  1PW8 A;  3DWZ A;  1HZO A;  5K5B A;  4KZ4 A;  1A0K A;  4X53 A;  3ZHH A;  4OKP A;  4KG2 A;  2NUT C;  4QD4 A;  4JXS A;  5G4Z A;  3CJM A;  3ITA A;  4KEN B;  1GA9 A;  3F1N A;  2WZZ A;  1TDL A;  4WEL A;  2J7V A;  2K2N A;  3R7W B;  5E2G A;  4BMW A;  3MFX A;  2PYR A;  2P9V A;  4Y0U A;  2W3F A;  4FSF A;  4X25 A;  2P08 A;  4ZJ2 A;  1K56 D;  4H8R A;  3W2Z A;  4R4R A;  5FI7 A;  4DE1 A;  3H7W A;  3PAG A;  1YLP A;  1EI5 A;  4HOI A;  5A93 A;  5AQ9 A;  5HPF A;  1LSX A;  4YNR A;  1PWG A;  3MR0 A;  3QP6 A;  3V3S A;  2DMW A;  4E3J A;  4KZ3 A;  3IF5 A;  4UEY A;  5EOE A;  3DWK A;  5EPH A;  1GSV A;  5DFX A;  1JTG A;  3VSL A;  4LRZ E;  1XX2 A;  1UWP X;  1NJ4 A;  2ZC5 B;  4ETX A;  1XPB A;  2ZBB A;  2IWC A;  3LI8 A;  3BFG A;  3BJN A;  4DRT A;  1W79 A;  4Y0O A;  3HUO A;  1K6R A;  3H82 A;  2QWS A;  2Y2M A;  3MQO A;  1K4F A;  4WEK A;  3KYQ A;  2W3E A;  3IBJ A;  4WEJ A;  2EXB A;  3OPH A;  2EX8 A;  5DF7 A;  1JVJ A;  1KOU A;  3R4K A;  5MC7 A;  3TE8 A;  5DF9 A;  3ZCZ A;  1WYB A;  1PZP A;  1E4D A;  5GL9 A;  2IWD A;  2B5R A;  3BLM A;  1PIO A;  1Q2P A;  1H0M A;  4OOY A;  4JBF A;  5CER A;  2ZC3 B;  4PKY G;  4WM9 A;  3SS5 A;  3C38 A;  3OLO A;  1MKM A;  1ONG A;  1MPL A;  3AGF A;  2VLG A;  1HTZ A;  1T19 A;  4MCW A;  2ZC6 B;  1PWC A;  3ZNY A;  4OPQ A;  1F2K A;  4DJ2 A;  3FZC A;  3UPP A;  5KSH A;  1ONH A;  4G3W A;  2WZX A;  3GEC A;  3MXS A;  1F9I A;  1XFN A;  5A90 A;  2X02 A;  3HJI A;  4JXW A;  4OLG A;  3CIT A;  4IJG A;  1TF1 A;  2PYP A;  2O9A A;  2FH5 A;  3NY4 A;  5F82 A;  1BZA A;  1N9B A;  2VZW A;  2INW A;  4RYE A;  4C3Q A;  1DJA A;  3S7P A;  2ZQ7 A;  3EEH A;  1DJB A;  3DW0 A;  4KQD A;  4FCF A;  5FAP A;  5HX9 A;  3ITB A;  4EUZ A;  4MBF A;  4NEE D;  3HCY A;  5AQB A;  3T4T A;  3DTK A;  2W3H A;  4IUH A;  1CK3 A;  3B42 A;  4ARZ A;  2JKT I;  2J80 A;  4RX3 A;  4GNU A;  3F1O A;  4GDN A;  4O0P A;  4B9O A;  3F1O B;  4EUV A;  3GR2 A;  1OTI A;  4MBK A;  4F3L A;  4IBR A;  3IF6 B;  4UHU A;  4F3L B;  2A2L A;  1ESI A;  5DKK A;  5F6A A;  5EM0 A;  3VP1 A;  2QKP A;  1IOU A;  5HDC A;  1QMF A;  2W1T A;  2JCH A;  2HPB A;  2GJ3 A;  1RP5 A;  2V0U A;  1SCW A;  2EWW A;  4YIN A;  4ZJ1 A;  3SH9 A;  2RCX A;  1ZG4 A;  1T1B A;  1S6R A;  2P7J A;  1CF0 A;  3PBS A;  2J8Y A;  3MXQ A;  1Y28 A;  1L0G A;  1NLY A;  5EVE A;  3WS1 A;  1IYS A;  3W4O A;  3G2Z A;  4LFU A;  2KLI A;  4EXO A;  3KSF A;  1GCE A;  2VV7 A;  2LB9 A;  4BBV A;  5G18 A;  5GLC A;  5HWV A;  3BW6 A;  2VGL M;  4R4S A;  4HIA A;  2WGI A;  4D2O A;  5M1A A;  2A24 A;  4DN0 A;  2A24 B;  3NDE A;  1PYY A;  1I2S A;  4IED A;  4PM9 A;  3HJK A;  4HJ4 A;  4HI4 A;  1ERQ A;  3N6I A;  1KGF A;  4MLL A;  3UE1 A;  2OAQ 1;  1YSQ A;  3RXX A;  3KSG A;  4KQR A;  2Y2K A;  2D02 A;  4I3I A;  4C75 A;  2JBF A;  3VV4 A;  4KG6 A;  1IYQ A;  2VV8 A;  3CI6 A;  4GW9 A;  2BLS A;  5FA7 A;  4NXF A;  4BBT A;  4B4Z A;  5DJU A;  3L9K A;  3NCK A;  3TOI A;  1PI5 A;  2QJ5 A;  4DDY A;  2G7U A;  2ZD8 A;  2JKR I;  3LEQ A;  2ZM0 A;  4WN5 A;  3SS3 A;  3DAV A;  1K4E A;  2JHE A;  2ZJ9 A;  3E2L A;  3G6O A;  3BFC A;  4MBH A;  1KDS A;  1MWT A;  1FSY A;  1K56 A;  3T50 A;  4JF5 A;  3FPV A;  4MN6 A;  1W7F A;  3G34 A;  2O0Y A;  4MEZ A;  2HDR A;  3D3O A;  2Y59 A;  2Z2M B;  3DTE A;  5CED A;  3IXH A;  3MF0 A;  3A0R A;  1NRF A;  5CHU A;  2H28 A;  3E4Q A;  4JXV A;  2K31 A;  4CPK A;  5TBM B;  3QP5 A;  1BUL A;  3HLE A;  3UMD A;  5HD3 A;  2OLU A;  4LV2 A;  4L9F A;  3NJA A;  4OQ0 A;  1H8Y A;  5F83 A;  2PDR A;  5HDD A;  2MJ6 A;  4HBU A;  3A3D A;  2OWJ A;  5JYP A;  1DRM A;  4JF4 A;  1E3U D;  2E8I A;  4CLC E;  1V9Z A;  3T1R A;  5EEC A;  1H8M A;  4GS9 B;  4EQI A;  1F98 A;  4HH2 A;  4EW7 A;  3DTI A;  3GQZ A;  1PWD A;  3E4O A;  3GV9 A;  4OOL A;  3FWL A;  3Q7V A;  3BWL A;  1G5U A;  3QP1 A;  3V67 A;  1TS7 A;  4R6L A;  3AGD A;  1MWR A;  2M7V A;  3S4X A;  2Z6C A;  5HD5 A;  3FC7 A;  2J9O A;  1FSW A;  4HNB A;  1PZO A;  5AVE A;  1KE0 A;  1YLZ A;  4QPR A;  2Y2H A;  3OOV A;  4K91 A;  1KGE A;  2VK3 A;  2OOL A;  4DE2 A;  4LV3 A;  4JF6 A;  4O7D A;  3NHQ A;  2VEA A;  3P01 A;  2VJW A;  3ZVW A;  3UPO A;  1TS8 A;  2YKF A;  3FPW A;  4JKT A;  3CHW P;  2G2W A;  4P85 A;  3S22 A;  2FFY A;  4AFI A;  5E2E A;  2A3U A;  4KZ5 A;  4L0L A;  2QMI A;  5KZH A;  4MMN A;  1TS0 A;  2W1R A;  3JPU A;  3TRC A;  4S2N A;  1LSV A;  4H6J B;  1CQA A;  3BY9 A;  5E2F A;  4WZ5 A;  1YLW A;  4Y15 A;  1X0O A;  4DJ3 A;  1NYY A;  2C5W B;  3TW8 A;  2I72 A;  3PYP A;  4PAU A;  1HLU P;  4OQG A;  3NIA A;  1ES4 A;  1M40 A;  3PBO A;  5J4E A;  3CZD A;  5HAP A;  1Q2Q A;  1S1Y A;  3MSH A;  1OPX A;  1IFQ A;  4GDB A;  4RQ9 A;  1FIK A;  1PI4 A;  3P09 A;  2XDM A;  1VEU A;  2P74 A;  5U47 A;  4IVK A;  1WA9 A;  2AVX A;  5CTM A;  4RA7 A;  3IX8 A;  4JLF A;  4R3J A;  3RFB A;  3UDF A;  2ZOI A;  1BLH A;  2XRN A;  4WZ5 C;  3WS5 A;  2HDQ A;  4OPZ A;  4U3T A;  3UB7 A;  5HAR A;  2HJ9 C;  1UWN X;  3OC2 A;  3QNB A;  2Y2N A;  5TJJ A;  4QU3 A;  1DP8 A;  5EV0 A;  1L0E A;  1WE4 A;  4KQO A;  3N8L A;  3BEC A;  4HHD A;  5FAQ A;  3SH7 A;  4ZBE A;  1K6S A;  1MWS A;  3IQA A;  4M4X A;  3B3X A;  1TEM A;  1FCM A;  5HFO A;  4OPR A;  4PM6 A;  4Y13 A;  3O88 A;  5GHY A;  4R70 A;  3BFF A;  4E04 A;  3UNW A;  1RGY A;  3R7W A;  3LEZ A;  3PXP A;  4ESP A;  4Y5F A;  3IXD A;  2M1C A;  2HF6 A;  4S2L A;  3TG9 A;  2VGL S;  1JWV A;  1CEF A;  1G6A A;  3SZT A;  3EOI A;  2HP5 A;  3BFE A;  3C7U A;  3S7Q A;  4N1X A;  3E0Y A;  1YSP A;  5HW3 A;  4A5R A;  5EE8 A;  2Y2P A;  2ACG A;  1XJ3 A;  3S7N A;  5L07 A;  3ZG8 B;  1GHI A;  5J8X A;  4R1G A;  5M18 A;  4UQI M;  3KYZ A;  1D7E A;  2UWX A;  1ODV A;  3UO9 A;  2O9B A;  4C6Y A;  4B93 A;  5CEB A;  5DJT A;  3CPT B;  1H8Z A;  4X1L A;  1NYM A;  4Y7P A;  2Y2G A;  1M6K A;  2WKQ A;  3DBA A;  2ZM8 A;  2OSU A;  3ZYT A;  4I3A A;  1YMX A;  4BJP A;  1SHV A;  2HZ5 A;  4S2O A;  3V50 A;  2WAF A;  1IKG A;  4WF0 A;  2CMN A;  3LID A;  3MKF A;  1G28 A;  1LL5 A;  4OP5 A;  3TSG A;  2R78 A;  5CXW A;  2XSS A;  4P6Z S;  1S0W A;  4L9G A;  2V20 A;  1L0D A;  3VOL A;  3IH8 A;  4R38 A;  1Z09 A;  3NBL A;  4K08 A;  2GZA A;  5AQ7 A;  1E3U A;  3IBR A;  2ZQA A;  2WK0 A;  3T1Q B;  1UGU A;  4GZB A;  1GA0 A;  3C2W A;  3HRE A;  4I3J A;  1OT6 A;  1ALQ A;  4E6X A;  4UA7 A;  5FEF A;  5CTN A;  3T1X A;  4EER A;  1OJG A;  3HVF A;  1ERM A;  3FG8 A;  1OTE A;  4JGO A;  4XUZ A;  3VMA A;  3IWI A;  2PBD P;  3N8S A;  3M2J A;  3JVU A;  4YWZ A;  3VFH A;  2XA7 S;  1YMS A;  4PHT A;  2WKE A;  4OON A;  3E4P A;  1NY0 A;  5FQI A;  2J9P A;  1LLB A;  5FQJ A;  4FD8 A;  4JGR A;  3VE4 A;  3UDI A;  3EQV A;  3LR4 A;  5TFQ A;  3Q82 A;  5KIZ A;  3MS6 A;  5FSR A;  2HDS A;  1IYP A;  3JVV A;  3IF6 A;  1VM1 A;  4E3N A;  5LBR A;  5CHM A;  5L8M A;  2J3W A;  4Q0J A;  4HP9 A;  1HVB A;  2WKH A;  1BLC A;  4PM8 A;  3ZGA B;  5HWW A;  5FQQ A;  1XXM A;  3Q1F A;  2PBY A;  1VHM A;  2ZM2 A;  5L09 A;  1N9L A;  2ZMF A;  1AWI A;  1HD8 A;  4FTX A;  1NRJ A;  4PKY A;  1FCN A;  3S1Y A;  3T12 B;  5DTT A;  1IEM A;  3C4O A;  5M19 A;  3ZDJ A;  1FR1 A;  4ZJ3 A;  1BLP A;  2A49 A;  2EX6 A;  4ZRR A;  3IF6 C;  2EFX A;  2Y2Q A;  1LI0 A;  3VP4 A;  4E3I A;  3S7O A;  3K3C A;  2Z2L B;  1KGG A;  3MXR A;  5CEC A;  1BLS A;  5DFY A;  4N9L A;  1ES5 A;  1YLT A;  3V3R A;  3NI9 A;  1I2W A;  3IWQ A;  4KZ9 A;  5HAI A;  3GDI A;  3U2A A;  3SH8 A;  2BG1 A;  3OCL A;  1YLJ A;  3PR6 A;  1YAX A;  2WAE A;  4EET B;  4E3K A;  3K3D A;  2EXA A;  4HP4 A;  5IT5 A;  1S66 L;  4PM5 A; 
#chains in the Genus database with same CATH homology
 1GHP A;  2H0T A;  1NZO A;  4DXC A;  5KMW A;  3AGD A;  1MKI A;  1MWR A;  3OCN A;  1PW8 A;  3DWZ A;  4QB8 A;  3LCE A;  1HZO A;  3S4X A;  1CI9 A;  4KZ4 A;  4S2J A;  4HEF A;  2DCF A;  4KZA A;  3NC8 A;  3VP2 A;  4X53 A;  2J9O A;  3ZHH A;  4OKP A;  4KG2 A;  4QD4 A;  1FSW A;  4KZ8 A;  4JXS A;  5I94 A;  1PZO A;  3CJM A;  3ITA A;  1KE0 A;  1NZU A;  1YLZ A;  1K54 C;  4KEN B;  3RJU A;  1GA9 A;  2Y2O A;  1FQG A;  1K25 A;  2VGK A;  2WZZ A;  1TDL A;  2Y2H A;  5D3O A;  4Q8I A;  3N4I A;  3C4P A;  1XKZ A;  4P0M A;  4K91 A;  4WEL A;  2J7V A;  1KGE A;  3ZG7 B;  3SS4 A;  1FOF A;  4DE2 A;  1ZKJ A;  4LV3 A;  4JPM A;  5DF8 A;  4K0X A;  4JF6 A;  4O7D A;  5E2G A;  1YLY A;  2G2U A;  4BQM A;  4OH0 A;  2EX2 A;  2JC7 A;  3ZVW A;  3UPO A;  1E25 A;  4JKT A;  2R9W A;  2G2W A;  4U0T A;  4GN2 A;  2DRW A;  2WKI A;  1Z6F A;  4P85 A;  1IKI A;  4S2M A;  3OPP A;  3S22 A;  3ZG0 A;  2FFY A;  1TVF A;  4LV0 A;  4U0X A;  5E2E A;  2A3U A;  4KZ5 A;  4ID4 A;  3BRM A;  4L0L A;  2P9V A;  2QMI A;  4Y0U A;  3W8K A;  5KZH A;  2PU4 A;  4FSF A;  1H5X A;  3G31 A;  4PMA A;  5IHV A;  4ZJ2 A;  4S2N A;  4LCL A;  1K56 D;  3LO7 A;  3IT9 A;  4H8R A;  4LEN A;  3RXW A;  2XGN A;  1KDW A;  3WS2 A;  3GVB A;  3HBR A;  1XP4 A;  3CMZ A;  1SDE A;  5KSC A;  2H5S A;  4R4R A;  4X69 A;  1W5D A;  3PBT A;  3VOZ A;  5E2F A;  5FI7 A;  3M6H A;  4DE1 A;  3Q07 A;  5A91 A;  4OQI A;  4WZ5 A;  3PAG A;  1YLP A;  1YLW A;  4LCM A;  4R3B A;  4Y0T A;  4HBT A;  3O86 A;  1EI5 A;  1NYY A;  4IVI A;  5A93 A;  2C5W B;  2C6W B;  5E2H A;  5AQ9 A;  2I72 A;  2XD1 A;  5EVI D;  4OQG A;  3NIA A;  1PWG A;  4EV4 A;  3MZD A;  1BT5 A;  3V3S A;  4BEN A;  5BOH A;  1ES4 A;  1M40 A;  4CJN A;  3PBO A;  4E3J A;  4XUX A;  4DDS A;  4KZ3 A;  3IF5 A;  3CZD A;  3UE3 A;  5EOE A;  5HAP A;  3DWK A;  3OPL A;  1Q2Q A;  5EPH A;  1CI8 A;  3HLC A;  1N4O A;  4GDB A;  4PM7 A;  4QY5 A;  1JTG A;  5DVA A;  4BL2 A;  3VSL A;  1YT4 A;  1PI4 A;  2ZC4 B;  3P09 A;  4OVD A;  2XDM A;  1SDN A;  5TGF A;  2IWB A;  4P87 A;  3ZNT A;  3Q7Z A;  1XX2 A;  2P74 A;  1NJ4 A;  2ZC5 B;  3O3V A;  5U47 A;  4E3M A;  4IVK A;  3PBR A;  4X6T A;  1XPB A;  2IWC A;  5CTM A;  3BFG A;  1ES3 A;  2QZ6 A;  3PAE A;  4RA7 A;  1W79 A;  4DRT A;  3PBN A;  2XFT A;  1I5Q A;  3HUO A;  1K6R A;  4JLF A;  3C7V A;  3D4F A;  4R3J A;  4Y0O A;  3UDF A;  1IYO A;  4B4X A;  2Y2M A;  2XFS A;  5F1G A;  1BLH A;  1K4F A;  3OZH A;  3FV7 A;  4WEK A;  4WZ5 C;  3WS5 A;  2HDQ A;  2XEP A;  1LHY A;  2EXB A;  3I7J A;  3MBZ A;  2EX8 A;  3OPH A;  4OPZ A;  4U3T A;  4WEJ A;  5DF7 A;  1JVJ A;  3HLF A;  5DF9 A;  3ZCZ A;  3WWX A;  1WYB A;  3UE0 A;  1PZP A;  3HUM A;  1E4D A;  5GL9 A;  5HAR A;  3G4P A;  3UY6 A;  2IWD A;  4QJG A;  4KG5 A;  2B5R A;  1WYC A;  5EUA A;  3BLM A;  1PIO A;  3A3I A;  1Q2P A;  2Q9N A;  2WGW B;  3OC2 A;  4UA9 A;  4OOY A;  3QNB A;  3NDG A;  2Y91 A;  2Y2N A;  4JBF A;  5CER A;  1U60 A;  2ZC3 B;  4E6W A;  4WM9 A;  4LV1 A;  4QU3 A;  2OLV A;  3SS5 A;  2WAD A;  3HLB A;  1ONG A;  1L0E A;  1MPL A;  1OME A;  1BUE A;  1WE4 A;  3AGF A;  3N8L A;  4KQO A;  4OQH A;  3JYI A;  1FR6 A;  3BEC A;  4PPR A;  1AXB A;  1HTZ A;  5FAQ A;  4GB7 A;  3SH7 A;  2ZC6 B;  3DTM A;  1PWC A;  4ZBE A;  3WS4 A;  1K6S A;  3UPN A;  1MWS A;  3IH9 A;  3IQA A;  3ZNY A;  4OPQ A;  5GLD A;  3B3X A;  1TDG A;  3A3J A;  1TEM A;  3UDX A;  4R23 A;  3FZC A;  4N1H A;  4OPY A;  1FCM A;  4X55 A;  5HFO A;  1JWZ A;  3UPP A;  4OPR A;  4PM6 A;  5KSH A;  4UA6 A;  3VOY A;  5CGX A;  3O88 A;  1CEG A;  1ONH A;  2WZX A;  5FQK A;  4DXB A;  3QHY A;  5FQ9 A;  3MXS A;  5FI6 A;  4BL3 A;  5GHY A;  5A90 A;  3BFF A;  1K57 A;  2H10 A;  2X02 A;  3UNW A;  4JXW A;  4OLG A;  4ZTK A;  1RGY A;  1MY8 A;  4E3O A;  3LEZ A;  2H0Y A;  1YM1 A;  4UAA A;  5CHJ A;  3AGE A;  3NY4 A;  5F82 A;  1BZA A;  1N9B A;  3IXD A;  3GTC A;  4RYE A;  4S2L A;  3HLD A;  3TG9 A;  4C3Q A;  1DJA A;  1JWV A;  2ZQ7 A;  1CEF A;  2ZQ9 A;  1DJB A;  1G6A A;  3DW0 A;  3HLG A;  4FCF A;  5FAP A;  5HX9 A;  2HP5 A;  3BFE A;  2ZC7 A;  3C7U A;  3ITB A;  4EUZ A;  1KE3 A;  2Y2L A;  4N1X A;  4MBF A;  2XR0 A;  5AQB A;  1O7E A;  2Y4A A;  5HW3 A;  3G32 A;  1CK3 A;  3W4P A;  4A5R A;  1K38 A;  1PW1 A;  5EE8 A;  2Y2P A;  2ZLY A;  5CRF A;  4S2I A;  2XQZ A;  4RX3 A;  4GNU A;  1XA7 A;  5GHX A;  4GDN A;  2V1Z A;  4EBN A;  3ZG8 B;  1XGI A;  2V2F F;  3GR2 A;  4MBK A;  4S2K A;  3WRZ A;  4IBR A;  1NXY A;  3IF6 B;  4UHU A;  1GHI A;  5AQA A;  4R1G A;  5J8X A;  3ZVT A;  1K57 C;  5M18 A;  2XF3 A;  3ZG5 A;  1ESI A;  1L0F A;  1KVM A;  3BYD A;  3VP1 A;  5GHZ A;  4BLM A;  1LL9 A;  4N92 A;  4B88 A;  1KE4 A;  1QMF A;  2UWX A;  3M6B A;  2JCH A;  3MZE A;  2HPB A;  3V5M A;  5JYO A;  1XGJ A;  3BLS A;  5GLB A;  3UO9 A;  4C6Y A;  3GMW A;  3IWO A;  5A92 A;  5CEB A;  1RP5 A;  3FKW A;  3Q81 A;  3ZG9 B;  1SCW A;  1JWP A;  2XH9 A;  4YIN A;  4ZJ1 A;  1ES2 A;  5FAS A;  4YFM A;  3SH9 A;  2RCX A;  2RL3 A;  1H8Z A;  3HUN A;  1NYM A;  5FAT A;  4Y7P A;  2Y2G A;  2XK1 A;  1ZG4 A;  3BEB A;  1M6K A;  1S6R A;  2ZM8 A;  5EVI B;  3PBS A;  1O07 A;  2OSU A;  4BJP A;  1YMX A;  2J8Y A;  4DKI A;  3BM6 A;  1SHV A;  1L0G A;  4BD1 A;  3WS1 A;  4S2O A;  3V50 A;  2WAF A;  1IKG A;  1IYS A;  4E3L A;  3W4O A;  3E2K A;  3G2Z A;  4X68 A;  1ZG6 A;  3MKF A;  1W8Q A;  2Y2J A;  4P6B A;  3MFD A;  1LL5 A;  1C3B A;  4OP5 A;  1GCE A;  5FQM A;  4QY6 A;  4EBP A;  2VGJ A;  3QNC A;  1L2S A;  3TSG A;  4RVA A;  4F94 A;  5CXW A;  2WGW A;  5G18 A;  1S0W A;  5GLC A;  2V20 A;  1L0D A;  4DE0 A;  3IH8 A;  3G2Y A;  3NBL A;  3VP3 A;  4R4S A;  2WGI A;  5EVL A;  4KZB A;  5AQ7 A;  3V39 A;  1E3U A;  4D2O A;  2ZQA A;  2WK0 A;  5M1A A;  4GZB A;  4WMC D;  4R0Q A;  5E43 A;  1GA0 A;  3HRE A;  5FDH A;  3NDE A;  3SOI A;  1PYY A;  4WBG A;  1ALQ A;  4E6X A;  1I2S A;  4K0W A;  4UA7 A;  3CG5 A;  4IED A;  4PM9 A;  5CTN A;  1ERQ A;  3N6I A;  4GD6 A;  3HVF A;  1ERM A;  2WGV A;  1KGF A;  3FYZ A;  5GLA A;  2XLN A;  4KQQ A;  4MLL A;  5F1F A;  3UE1 A;  4EBL A;  3IXB A;  3RXX A;  3Q7V B;  3GSG A;  4KQR A;  3VSK A;  2Y2I A;  1DY6 A;  2Y2K A;  4XXR A;  4C75 A;  3P98 A;  4DE3 A;  4XUZ A;  3VMA A;  3IWI A;  3N8S A;  3M2J A;  2JBF A;  4GKU A;  4KG6 A;  2X01 A;  2FFF B;  2EX9 A;  1IYQ A;  5FAO A;  3VFH A;  3MZF A;  4ZAM A;  1YMS A;  3G30 A;  4X56 A;  2WKE A;  4OON A;  5CGW A;  2BLS A;  2HP9 A;  2Q9M A;  4MNR A;  1IEL A;  1NY0 A;  2WUQ A;  5FQI A;  2J9P A;  5FA7 A;  4DF6 A;  4GOG A;  1LLB A;  3FKV A;  5FQJ A;  4FD8 A;  4BD0 A;  4RX2 A;  4NK3 A;  1QME A;  3UDI A;  4B4Z A;  1SKF A;  1K55 A;  1VQQ A;  3EQV A;  1JTD A;  4Z9Q A;  3A3E A;  1G68 A;  2WYX A;  3EQU A;  3NCK A;  1RCJ A;  5TFQ A;  3Q82 A;  3TOI A;  1PI5 A;  5FSR A;  1FCO A;  3WS0 A;  2HDS A;  4DDY A;  2ZD8 A;  4ZDX A;  1IYP A;  3IHB A;  2ZM0 A;  3SS3 A;  2GDN A;  3WRT A;  4QHC A;  3IF6 A;  1K4E A;  4M3K A;  2ZJ9 A;  3E2L A;  1VM1 A;  3BFC A;  3IHA A;  3HLW A;  3G35 A;  3OPR A;  4MBH A;  4OLD A;  3ZFZ A;  1KDS A;  1MWT A;  2P9V B;  4E3N A;  1FSY A;  1K56 A;  5CHM A;  2X71 A;  2ZQC A;  1KVL A;  4JF5 A;  4FH4 A;  4OOM A;  1LI9 A;  1HVB A;  1W7F A;  2WKH A;  3G34 A;  1BLC A;  4PM8 A;  3LY4 A;  3ZGA B;  5FQQ A;  4MEZ A;  1RGZ A;  2HDR A;  3VFF A;  1XXM A;  3Q1F A;  2PBY A;  1EWZ A;  2PU2 A;  5DTK A;  3C5A A;  1BSG A;  2ZM2 A;  2Y55 A;  4EWF A;  2Y59 A;  2Z2M B;  5CED A;  4FH2 A;  3N7W A;  1HD8 A;  3IXH A;  5L2F A;  1NRF A;  3VP0 A;  1FCN A;  5CHU A;  1K55 C;  5EVI A;  3S1Y A;  4JXV A;  4JXG A;  4WYY A;  4CPK A;  1ZC2 A;  5TR7 A;  5DTT A;  2HDU A;  3A3F A;  1GHM A;  3PTE A;  1BUL A;  1J9M A;  1IEM A;  2DNS A;  2HP6 A;  3C4O A;  3HLE A;  4S2P A;  5M19 A;  1YQS A;  3ZDJ A;  1FR1 A;  2OLU A;  4NET A;  1MBL A;  4LV2 A;  4ZJ3 A;  3M2K A;  1BLP A;  2A49 A;  2EX6 A;  4HES A;  4OQ0 A;  1H8Y A;  3N8R A;  3IF6 C;  5F83 A;  2EFX A;  2Y2Q A;  1ERO A;  1LI0 A;  2XD5 A;  2ZQD A;  3VP4 A;  4E3I A;  3HL9 A;  4S2N C;  1ESU A;  2Z2L B;  1KGG A;  3MXR A;  5CEC A;  2ZMA A;  2OV5 A;  1BLS A;  4HBU A;  3BFD A;  4KZ6 A;  3A3D A;  4N9L A;  1ES5 A;  3O87 A;  3UN7 A;  1YLT A;  1XA1 A;  3V3R A;  3NI9 A;  1I2W A;  3IWQ A;  5HAQ A;  3W4Q A;  4KZ9 A;  1K54 A;  5HL1 A;  3ISG A;  5HAI A;  5JYP A;  4JF4 A;  3IXG A;  3SH8 A;  2BG1 A;  1E3U D;  1YLJ A;  2E8I A;  3OCL A;  3PBQ A;  4KZ7 A;  5EEC A;  5FI2 A;  2WAE A;  1W8Y A;  1MWU A;  2R9X A;  4OP8 A;  5EVI C;  4EQI A;  3LY3 A;  2CC1 A;  4N9K A;  4IBX A;  4E3K A;  3MKE A;  5DTS A;  2QPN A;  2EFU A;  1DJC A;  5CGS A;  1BTL A;  2JE5 A;  2EXA A;  3GQZ A;  1PWD A;  2ZQ8 A;  4GD8 A;  3GV9 A;  1MXO A;  4OOL A;  3FWL A;  3Q7V A;  5EOO A;  3GRJ A;  4WZ4 A;  1Y54 A;  4WMC A;  4PM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...