3QHYA

Structural, thermodynamic and kinetic analysis of the picomolar binding affinity interaction of the beta-lactamase inhibitor protein-ii (blip-ii) with class a beta-lactamases
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
b'THKEFSQLEKKFDARLGVYAIDTGTNQTIAYRPNERFAFASTYKALAAGVLLQQNSTKKLDEVITYTKEDLVDYSPVTEKHVDTGMTLGEIAEAAVRYSDNTAGNILFHKIGGPKGYEKALRQMGDRVTMSDRFETELNEAIPGDIRDTSTAKAIATNLKAFTAGNALPNHKRNILTKWMKGNATGDKLIRAGVPTNWVVADKSGAGSYGTRNDIAIVWPPNRAPIIIAILSSKDEKGATYDNQLIAEAAEVIVNAFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
molecule tags Hydrolase/hydrolase inhibitor
source organism Bacillus anthracis
publication title Analysis of the binding forces driving the tight interactions between beta-lactamase inhibitory protein-II (BLIP-II) and class A beta-lactamases.
pubmed doi rcsb
total genus 95
structure length 258
sequence length 258
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3qhyA00
3M6HA 4LENA 4JXGA 5CERA 1IYPA 1CI9A 1JWVA 4OQHA 4X68A 5CHMA 4MNRA 3S22A 5CGXA 4E6XA 4EBNA 2Y2KA 5DVAA 2GDNA 2ZQAA 1SDEA 4DE1A 1VQQA 3FZCA 3Q82A 1E4DA 4Y0UA 5GHYA 1JTDA 4O7DA 3CG5A 4Q8IA 2JBFA 1XX2A 2Y2JA 4K0WA 1ES3A 2FFYA 1YM1A 2HDSA 2ZC4B 5GHZA 5CGWA 4C6YA 1L2SA 4WEKA 3SH7A 1BLHA 3WRZA 2BG1A 2X01A 2WAEA 2ZQ7A 4GOGA 1XGIA 3P09A 5DF9A 3OPPA 4HBUA 4EV4A 4R3BA 1K38A 4GD8A 5CRFA 5KSHA 5EVID 2ZC6B 1MWRA 3NIAA 1PI4A 3G35A 5EE8A 3RXWA 3BEBA 2WGVA 4RVAA 2DRWA 1AXBA 4RX2A 5F1FA 5FQKA 4WZ5C 3W4QA 4X56A 1I5QA 4GN2A 3HUOA 4Y7PA 1E3UA 1Y54A 5A90A 3IF6B 3G34A 4OPYA 3IXHA 2OLUA 4S2NA 1YLWA 1LLBA 1PW8A 3LY4A 4BENA 1XGJA 3TSGA 1EWZA 3IF6C 1ZG6A 2RCXA 3WS5A 4ZJ1A 1Q2PA 2H10A 3O3VA 4E3OA 1W8QA 5F1GA 2VGKA 2OV5A 4EUZA 5HARA 1ES2A 2EXAA 4KQRA 3PBNA 5GL9A 1K54A 4LV1A 1YT4A 5AQAA 1O07A 3BLSA 2Z2LB 3SH8A 2EXBA 2CC1A 4E3MA 4E3KA 2G2UA 1BZAA 4LV2A 1ALQA 1PYYA 3BFCA 3UDXA 4RA7A 4UHUA 3W4PA 1FSYA 1BLPA 4IVKA 4JXVA 1QMFA 2ZQCA 2ZM0A 3Q07A 4ZTKA 4YINA 1CK3A 3HVFA 3O88A 3MBZA 4HESA 3NCKA 3PBRA 4GD6A 3P98A 5A92A 3OPRA 4ZBEA 1NYMA 3VSLA 2WUQA 2Y2HA 3GSGA 3C4OA 1FCNA 2XD1A 1IKGA 3UPPA 4EQIA 1CI8A 1YQSA 5EVLA 1LI0A 3VMAA 4S2IA 1MXOA 3ZG5A 3HBRA 3IWOA 4UA9A 4FSFA 3ZVWA 1K56A 3FYZA 2V1ZA 3DTMA 2P74A 4RX3A 3UY6A 3G31A 1N9BA 5M19A 5TFQA 1ES4A 3VP1A 4YFMA 5FAPA 1H5XA 1MPLA 3HLWA 3ZDJA 4WEJA 3BYDA 1NY0A 1DJAA 4WMCA 1Q2QA 2A49A 4EWFA 3MKFA 1I2SA 2EFXA 5F82A 1KGFA 4HEFA 4R0QA 3VOZA 2ZD8A 4RYEA 1MKIA 1CEFA 1K6RA 1S6RA 3HREA 5AQ7A 3GVBA 5EUAA 3UNWA 4KZ3A 3E2LA 3MZFA 5FI7A 1PWGA 4C75A 1RP5A 4JKTA 4WM9A 4CJNA 1K6SA 1YLYA 5HAIA 2WADA 1MWSA 3EQVA 1G68A 3V3RA 4OKPA 3HLBA 4CPKA 3Q81A 1JTGA 1SCWA 1MY8A 1SHVA 3NBLA 4OPQA 1RGZA 1SKFA 1O7EA 4E6WA 2Z2MB 1VM1A 4DE3A 1ERQA 1ESIA 3I7JA 4OP8A 1XA7A 4F94A 1JWPA 2HDUA 1HD8A 3M2JA 1JVJA 1LL9A 5CGSA 3GQZA 4OPRA 1FSWA 3N8RA 1BULA 3ITBA 4LV3A 4R4SA 4WZ5A 3ZG8B 3MZEA 4DKIA 3LCEA 3ZVTA 4DE2A 1GHIA 5EECA 5CEDA 3OPHA 1FR6A 1NRFA 4WZ4A 4DDSA 3DW0A 4BL3A 5DTSA 3PAGA 4IBXA 1W79A 2ZC5B 4BD0A 2EFUA 1GA9A 3WS4A 3IF6A 4UA7A 4S2KA 4R4RA 2P9VA 1FCOA 3BM6A 3C5AA 1NZOA 3N7WA 3E2KA 4E3JA 3MKEA 4KZ9A 4Z9QA 1L0GA 1KGEA 2XEPA 2Q9NA 4BQMA 2Y2OA 4X55A 1OMEA 4IEDA 1BSGA 2HP6A 2XK1A 4XUXA 1YLJA 4QB8A 3ITAA 4PM9A 4WMCD 2X71A 5A93A 1K57A 2XDMA 4N9KA 4KZ6A 2PU4A 4OOMA 2Y4AA 1H8ZA 3G30A 4FH4A 2WZZA 3G4PA 1WYCA 3WS2A 4EBLA 1WYBA 3D4FA 4N1XA 1BUEA 1ZG4A 4GZBA 4QD4A 1BT5A 1TVFA 3HUMA 4HBTA 2WKIA 5FI2A 5FAOA 1EI5A 1NYYA 2PU2A 1LHYA 5FATA 5FQ9A 3SS3A 4KENB 3A3EA 4PM6A 3DWZA 1PZOA 1RGYA 3PBQA 3O87A 4WBGA 3BFEA 1EROA 1J9MA 1HTZA 2C5WB 2FFFB 2RL3A 3N8SA 4C3QA 3NI9A 4S2OA 3SOIA 2A3UA 2XR0A 5GLAA 4A5RA 3G2YA 5KSCA 2Y2QA 5EPHA 1ES5A 4DRTA 4FCFA 3VFFA 3PBTA 2WK0A 3IHAA 3PBSA 1XA1A 3UO9A 2ZQDA 4OOLA 2VGJA 2V20A 4KQQA 1FCMA 1K25A 1ONHA 3QNCA 3QNBA 4ID4A 4K91A 4XXRA 3VOYA 4D2OA 1YMXA 3BECA 4BJPA 1YLTA 3ZNTA 2Y2MA 3UDIA 4H8RA 1MWTA 2IWDA 2B5RA 1JWZA 3OCNA 1ONGA 3VFHA 1HVBA 5D3OA 1GHPA 1YLZA 1YMSA 4JLFA 4JPMA 5DF7A 3RXXA 3NDEA 1NZUA 1XXMA 2J9PA 4GNUA 4IBRA 3W8KA 1K55A 2DNSA 4MBHA 4ZAMA 3IXDA 5TGFA 5F83A 3OCLA 2XD5A 3M6BA 2ZC7A 3HLEA 1MBLA 3NDGA 4N92A 5AQBA 4MBFA 2EX9A 3VP3A 4DXBA 3SH9A 3HL9A 3MXRA 5HW3A 4KG5A 5FQQA 4X53A 5CTNA 2J9OA 1PWDA 3BRMA 2Y2NA 2J7VA 3ZG7B 2ZMAA 1GHMA 1E3UD 3SS5A 4E3LA 4EBPA 3VP4A 1KGGA 2OSUA 4KZ7A 1FOFA 2Y91A 4PM5A 3OPLA 2G2WA 4GDNA 3HLFA 2QZ6A 4UAAA 5FAQA 5FSRA 5JYPA 2HDRA 4JF5A 5G18A 3ZHHA 4E3IA 5E2GA 3LO7A 3FV7A 4B88A 5E43A 5HAPA 5FA7A 3IWQA 3V50A 5IHVA 2C6WB 5M18A 1IEMA 3DWKA 3FKVA 4OOYA 1C3BA 1PW1A 2I72A 3S1YA 3V39A 1U60A 2PBYA 3S4XA 2Y55A 3FKWA 4OQIA 5EOEA 5AQ9A 2XFSA 4GDBA 3N4IA 4LV0A 3UE0A 4WYYA 2ZQ8A 1DJBA 1QMEA 4DE0A 5KMWA 4OLDA 1IYQA 1L0EA 3AGFA 3N6IA 3NC8A 2ZC3B 1DY6A 3SS4A 3UN7A 2H0TA 1XKZA 3OZHA 3UPNA 5E2FA 1IYSA 2Q9MA 4MEZA 5EVIA 4PMAA 4QY6A 3VP0A 4P85A 5DF8A 4IVIA 1BLCA 3Q1FA 5HFOA 3WRTA 4P0MA 5M1AA 4DXCA 1KVLA 4QJGA 4S2PA 3ISGA 1K57C 3HLGA 1G6AA 1KDSA 2HPBA 1K4FA 4Y0TA 5CEBA 3A3JA 3OC2A 4U3TA 5J8XA 1W5DA 1MWUA 3RJUA 4OVDA 2UWXA 3ZCZA 2ZQ9A 3MXSA 1PWCA 1M40A 3BFDA 3A3DA 3ZFZA 5A91A 2WAFA 1PZPA 4BD1A 5L2FA 2Y2IA 3FWLA 3VSKA 4KZ5A 1YLPA 5FQMA 4GKUA 4P6BA 2HDQA 4KG6A 3IH8A 4BL2A 3GR2A 3GV9A 2ZM2A 4JXSA 3CZDA 1GCEA 3IH9A 4R23A 1K54C 3HLDA 5CHJA 1IELA 2HP5A 2H5SA 1BTLA 2EX6A 4KZAA 1IKIA 3UPOA 2WKEA 1RCJA 1KDWA 2WGWB 1K4EA 5E2EA 4WELA 2BLSA 3A3IA 3M2KA 1W8YA 3N8LA 5GLBA 3C4PA 4B4ZA 3UDFA 2P9VB 4QU3A 5JYOA 4KZ8A 1XP4A 2HP9A 4UA6A 3MFDA 2Y2PA 1ZC2A 3W4OA 2ZM8A 3Q7VB 5U47A 4S2NC 1E25A 3TG9A 1GA0A 4XUZA 3PAEA 2Y2LA 1NJ4A 1FQGA 2XFTA 4U0TA 3PBOA 2Y59A 3WS1A 3TOIA 5CXWA 3QHYA 4ZJ3A 4KZBA 3HUNA 4KQOA 2X02A 3ZGAB 4N9LA 4GB7A 3BFFA 4X6TA 1M6KA 3UE1A 1I2WA 5DTKA 5KZHA 2Y2GA 3B3XA 4OH0A 5EOOA 2XF3A 3BFGA 5HAQA 5BOHA 5I94A 3VP2A 1K55C 2J8YA 2EX8A 2XGNA 1TDLA 2DCFA 2IWCA 3HLCA 3PTEA 4R1GA 1N4OA 3C7VA 1DJCA 2JC7A 3UE3A 5FI6A 1FR1A 3EQUA 1IYOA 3CMZA 3IF5A 1NXYA 4FH2A 2XH9A 4OP5A 4X69A 2R9WA 1LI9A 4S2MA 5HX9A 3GMWA 5FASA 5GHXA 1KE3A 4DF6A 3JYIA 3IXBA 4R3JA 2XQZA 3G2ZA 5GLDA 1LL5A 5HL1A 3G32A 4U0XA 1HZOA 4MLLA 4OQ0A 4JF6A 4B4XA 4BLMA 1ERMA 1XPBA 3LY3A 3C7UA 3IWIA 4LCMA 1KVMA 3LEZA 4K0XA 5GLCA 3GTCA 4N1HA 3Q7ZA 4PPRA 1WE4A 1K56D 2WGIA 5TR7A 1TEMA 3Q7VA 5FDHA 5CHUA 1BLSA 2EX2A 1L0FA 2WGWA 3A3FA 3V3SA 5EVIB 4JF4A 1Z6FA 4LCLA 4JXWA 2ZJ9A 4S2LA 4ZDXA 2H0YA 5CTMA 3WS0A 1ESUA 3IT9A 1TDGA 4L0LA 4KG2A 3ZG9B 4S2JA 3IHBA 3GRJA 2WKHA 5EVIC 2JCHA 3WWXA 2WYXA 1KE0A 1CEGA 4QHCA 1L0DA 2JE5A 4KZ4A 5FQJA 3V5MA 4DDYA 4E3NA 2E8IA 2QMIA 4M3KA 5FQIA 1KE4A 3MZDA 5CECA 2V2FF 2R9XA 3ZNYA 3AGDA 3IXGA 2IWBA 1PI5A 2QPNA 3O86A 2XLNA 2WZXA 4NK3A 4OONA 4P87A 4PM7A 4ZJ2A 1SDNA 3NY4A 4PM8A 4Y0OA 4NETA 5E2HA 3ZG0A 1PIOA 1ZKJA 1W7FA 2ZLYA 4OLGA 3BLMA 4QY5A 5DTTA 3CJMA 3IQAA 4OPZA 4JBFA 4MBKA 1S0WA 4OQGA 4FD8A 1H8YA 3AGEA 2OLVA
chains in the Genus database with same CATH superfamily
3M6HA 4X68A 3VV4A 3S7OA 3LR3A 2ZQAA 3Q82A 1OTEA 2Y2JA 3SH7A 1DP8A 3WRZA 3E4OA 3OPPA 4HBUA 4ETZA 4EV4A 4R3BA 4WN5A 1K38A 4GD8A 2OAQ1 2A24B 1T1AA 1MWRA 3NIAA 5EE8A 4RVAA 5F1FA 3K3DA 3OOVA 4Y7PA 4S2NA 1LLBA 3H82A 1PW8A 1XGJA 1YSPA 1EWZA 3IF6C 4ZJ1A 4MMNA 2OV5A 4EUZA 3F1OB 2EXAA 1ODVA 3PBNA 5HL6A 3T50A 3BWLA 3SH8A 2G2UA 2J80A 1ALQA 1PYYA 3BFCA 3W4PA 3QP6A 1FSYA 1QMFA 4Y13A 1CK3A 3OPRA 3C4OA 2GJ3A 3ICYA 1YQSA 3VMAA 1LI0A 2JN7A 4S2IA 3HBRA 4FSFA 3FYZA 5G4YA 4RX3A 3T4KA 3CWFA 5M19A 4YFMA 4O01A 1NY0A 4EWFA 1Q2QA 2A49A 5F68A 4PHTA 5HDCA 2XRNA 4LFUA 4HEFA 5AVFA 1P0ZA 3HREA 1PWGA 1RP5A 2V8FA 1YLYA 4LRXC 5HAIA 1SHVA 3NBLA 1ERQA 1UGUA 1ESIA 4NXGA 2B95A 5F6AA 5DFYA 4HP9A 1LL9A 4AFIA 5HZHA 1SKOA 1BULA 3ZG8B 4R4SA 3MZEA 1S67L 3BY9A 3D3OA 4WZ4A 4DDSA 4CLCD 5DTSA 5AJGA 5EFWA 3IBRA 4UA7A 4S2KA 3N7WA 3A0SA 3E2KA 1L0GA 1KGEA 4B93A 3OLOA 2Y2OA 4X55A 4IEDA 1BSGA 2I9VA 1X0OA 3MJQA 2X71A 1K57A 2XDMA 4KZ6A 3G30A 3G4PA 1NLZA 4JGOA 1BT5A 5J7EA 5FI2A 3T4OA 5FQ9A 3SS3A 4PAUA 2O9BA 3F1PA 4XT2A 1P9WA 4WBGA 3BFEA 2C5WB 3IS2B 4E04A 1TS6A 3H82B 2XA7M 3B42A 3PHYA 5EPHA 1ES5A 4FCFA 2WK0A 3IHAA 3PBSA 3UO9A 2VA0A 4KQQA 2E8JA 5I5LA 3QNCA 4HP4A 3UDIA 4H8RA 1MWTA 3B33A 1TS8A 4EESA 2B5RA 1JWZA 1N9LA 3OCNA 1ONGA 4NKPA 1HVBA 1YMSA 4ME4A 1XXMA 2B02A 5F83A 2M1CA 3M6BA 2YKHA 2ZC7A 3MF0A 4MBFA 5HW3A 4X53A 3QP2A 1PWDA 3BRMA 2Y2NA 3ZG7B 2O0YA 4UEYA 2QWSA 3EWKA 2Y91A 4PM5A 2FH5A 2G2WA 3LI9A 4GDNA 5FAQA 2QZ6A 5JYPA 2HDRA 4JF5A 4R3AA 2KOIA 2HV1A 1XJ2A 5FA7A 1T1CA 3FC7A 3S1YA 5FL3A 4OQIA 2XFSA 3UE0A 4EUVA 2ZQ8A 1QMEA 5FDSA 1IYQA 5A8BA 2ZL1A 1DY6A 3D9YA 2A2LA 3CHWP 3SS4A 1XKZA 4GS9B 2A24A 1D06A 1KVLA 1YAXA 3ISGA 3IX3A 1F98A 4HJ4A 4L9FA 1K4FA 5CEBA 3OC2A 2VV8A 3R7WB 2QJ7A 3A3DA 3ZFZA 5L2FA 2Y2IA 3FWLA 1Y28A 3DTKA 3IH8A 4BL2A 3GR2A 4JXSA 2OWHA 2VV6A 3IH9A 3JVVA 1K54C 1IELA 4KZAA 1IKIA 2WKEA 1KDWA 2WGWB 2BLSA 3A3IA 4X1MA 4QU3A 1ZC2A 3R4KA 4O8GA 4DMZA 3LR4A 3PAEA 1FQGA 3PBOA 3TOIA 5IT5A 2X02A 3ZGAB 1F9IA 1FILA 4X6TA 1M6KA 5KZHA 4OH0A 3G6OA 5BOHA 1N9OA 1K55C 2XGNA 1TDLA 2IWCA 4WLAA 3DBAA 1DJCA 5TBMA 3UB5P 1FR1A 2D01A 4FH2A 4X69A 1LI9A 4RQ9A 5HL1A 4MLLA 4NXBA 1ERMA 3C30A 4LCMA 2QJ5A 3GTCA 1D7EA 1DP9A 2KDKA 3QP5A 2JKFA 2WGWA 4F3LA 3A3FA 2Z6CA 3V3SA 4IJGA 4JF4A 3T1RA 3NHQA 4KG2A 2YKFA 4GJ4A 3WWXA 2JCHA 2WYXA 1CEGA 4DDYA 3BY8A 4LRYC 4M3KA 1KE4A 5HDSA 2V2FF 2PYPA 2R9XA 5DKLA 2IWBA 1PI5A 2XLNA 4OONA 2JKTI 4PM7A 5E2HA 4NETA 1ZKJA 4OLGA 4DN0A 3CJMA 1MZUA 2JHEA 3AGEA 2OLVA 1E4DA 4LENA 1IYPA 1JWVA 2ZL1B 5L07A 4EBNA 5DVAA 1XJ4A 3U2AA 3QP1A 1JTDA 2VKSA 2PRFA 3CG5A 4D60A 1ES3A 2FFYA 2HDSA 5CGWA 4L9EA 1L2SA 2PD7A 1BLHA 1G5UA 2PR5A 2WAEA 2ZQ7A 1XGIA 3TE8A 1W63M 5KSHA 2ZC6B 3RXWA 3G35A 2G7UA 3MFXA 3CLOA 2DRWA 1AXBA 4WZ5C 4O0PA 4X56A 3W4QA 4GN2A 1Y54A 5DJUA 4H6JB 5A90A 4OPYA 3IXHA 1YLWA 3LUQA 3KSIA 3LY4A 3GDIA 4ETXA 1Q2PA 4HNBA 4E3OA 2VGKA 1ES2A 1K54A 3BJNA 3L9KA 2K7SA 4R6LA 1O07A 2Z2LB 2CC1A 4E3MA 3CUEA 1BZAA 4LV2A 3LR0A 4Y2FA 1OJ5A 3H7WB 5J4EA 4GD6A 3P98A 1NYMA 3VSLA 3GSGA 1FCNA 2XD1A 4EQIA 3T4TA 1V9ZA 5DKKA 3ZVWA 2V1ZA 3DTMA 3KSHA 3UY6A 1UWNX 4I39A 5TFQA 3VP1A 3KSGA 4WEJA 3BYDA 3T1XA 5EM0A 1DJAA 5F82A 1KGFA 4R0QA 4NXFA 3UNWA 5EUAA 3E2LA 4C75A 2PBDP 3MS6A 2P04A 3F1NA 4I3AA 5L10A 4OKPA 3HLBA 4CPKA 3Q81A 1JTGA 2HGVA 1O7EA 4EERA 4BBTA 1Y4OA 5CX7A 3MQQA 4F94A 1JWPA 1JVJA 1FSWA 4MN6A 2PR6A 4P6ZM 5CEDA 1FR6A 3PAGA 1W79A 4BD0A 1FCOA 1TD5A 3BM6A 3C2WA 3MKEA 4KZ9A 4BQMA 1ZHHB 2V8CA 2ACGA 3D72A 4EETB 3ITAA 2PU4A 4BBVA 2WZZA 1WYCA 1BUEA 1ZG4A 2W1TB 1TVFA 5FAOA 2PU2A 1LHYA 2JKGA 4HI4A 3A3EA 3DWZA 4DJ2A 3VE3A 1EROA 2QYBA 2RL3A 3LIAA 3F1NB 2A3UA 2WKPA 2KLIA 1YSQA 4DRTA 3E0YA 3VFFA 2W0NA 1PRQA 3RTYA 1TS0A 2V20A 1K25A 2PD8A 3QNBA 4XXRA 1YMXA 1YLTA 3ZNTA 1TF1A 2IWDA 3T4LA 2PAVP 3F1OA 4EW7A 3BQ8A 1GHPA 1YLZA 4JLFA 3NDEA 1NZUA 4G3KA 4IBRA 2Z6DA 1K55A 2DNSA 4ZAMA 5L09A 4CQHA 3HLEA 1MBLA 5AQBA 3VP3A 3SH9A 4KG5A 5FQQA 4DJ3A 5CTNA 2NUTC 2HJEA 2ZMAA 1E3UD 2VJWA 4HQAA 4EBPA 4KZ7A 3OPLA 3PR6A 2Q0OA 3HLFA 4UAAA 1IOUA 1UWPX 5G18A 3UB9A 4B88A 5E43A 3V50A 2C6WB 2LB5A 3V39A 1FIKA 2ZMVA 4PKYA 2AVXA 4GDBA 3UB6A 2O9CA 1DJBA 4DE0A 1S1YA 3NC8A 3AGFA 2VGLM 1YPRA 3UN7A 4F3LB 4NXEA 3UPNA 4PMAA 4L9GA 1BLCA 3Q1FA 3WRTA 1K57C 3HLGA 2HPBA 4U3TA 1MWUA 5F5YA 1XJ3A 1PWCA 1M40A 2L4RA 1P9RA 5A91A 1ACFA 4LRZE 4NG2A 4GKUA 2HJ9C 1GCEA 2VX8A 5CHJA 3UPOA 1V9YA 3MMHA 1K4EA 4NEED 4WELA 2W3DA 3M2KA 4FTXA 5KIZA 1XP4A 2H28A 4IHQA 2MJ6A 3A0VA 5U47A 1E25A 2BTFP 1NJ4A 4U0TA 2Y59A 4HH3A 3UB8A 3QHYA 4KZBA 2R78A 5I94A 3VP2A 3F1PB 2J3TC 2J8YA 3S7NA 3HLCA 3PTEA 2KX6A 1N4OA 1T19A 4Z1WA 4ARZB 1NXYA 1OTBA 2VLGA 5HX9A 3GMWA 1KE3A 4DF6A 4R3JA 2DMWA 3LFVA 1LL5A 3H7WA 1XFNA 3G32A 1HZOA 2M7UA 1H0MA 2W3GA 4KUKA 3LY3A 2V0WA 4YWZA 3T1QB 3UMDA 4K0XA 2QHKA 1K56D 4GS9A 1BLSA 1T18A 1L0FA 2EX2A 5EVIB 4YOFA 3T1SA 4B9OA 2H0YA 4CLCA 4S2JA 3IHBA 2WKHA 1KE0A 4WL9A 4QHCA 1L0DA 2ZMFA 2JE5A 3RFBA 2PYRA 1NWZA 2EWWA 5EV0A 4E3NA 2E8IA 5CECA 3IXGA 2QPNA 3HJIA 3KX0X 1SZVA 4Y0OA 3ZG0A 1PIOA 1W7FA 2ZLYA 1K0KA 1XJ6A 5DTTA 4GLQA 4OPZA 4FD8A 2HF6A 5G4ZA 3B47A 1CI9A 5CHMA 3VOLA 4OQHA 3S22A 5CGXA 2Y2KA 3CPTB 2GDNA 1S66L 4CLCC 1S4RA 4DE1A 2ZOIA 4Y0UA 1CF0A 1MC0A 2J3WA 5GHYA 4K0WA 1YM1A 2ZC4B 4WEKA 3IX8A 3KYEA 2BG1A 2X01A 2PHYA 3EEAA 5DF9A 3K2NA 5CRFA 5EVID 2JKRI 2W1RA 2WGVA 3T4SA 1OTIA 4RX2A 3S7QA 3HUOA 1E3UA 2OLUA 4BENA 4ARZA 4X25A 1ZG6A 2RCXA 2H10A 4QPRA 4X1LA 1W8QA 5F1GA 4Y5FA 5HWWA 1YT4A 3RH8B 1LSXA 3V67A 3BLSA 2D02A 2V0UA 4E3KA 5IS1A 2PT7A 4UHUA 5L8MA 4IVKA 5HSQA 4JXVA 2ZQCA 2QKPA 3Q07A 4ZTKA 4YINA 3HVFA 3O88A 3MBZA 3NCKA 5A92A 4ZBEA 2WUQA 2Y2HA 3NOTC 3HCYA 1IKGA 1GSXA 5FEFA 2OWJA 3UMEA 4HOIA 1MXOA 3ZG5A 4UA9A 3KYQA 1K56A 4HJ6A 3G31A 2LB9A 5FAPA 3ZDJA 3HLWA 3FPVA 3MKFA 1I2SA 2BASA 4RYEA 1MKIA 1K6RA 1S6RA 5HPIA 3GVBA 4KZ3A 1T1BA 2XSSA 4JKTA 4WM9A 4CJNA 1G6OA 1K6SA 3QP4A 3EOIA 3IS2A 1MWSA 1G68A 1LSVA 3T4JA 1SKFA 4E6WA 1VM1A 4OP8A 5CGSA 3N8RA 4LV3A 4DKIA 4DE2A 3ZVTA 3DTEA 3NOUC 1GSWA 1YKDA 2UV0E 4P6ZS 1CQAA 1PNEA 1GA9A 3IF6A 2GNXA 1N9NA 2P9VA 4CLCE 2XEPA 2Q9NA 2O99A 3H9WA 2EA9A 1OMEA 2XK1A 4QB8A 4WMCD 2Y4AA 4FH4A 3CI6A 5EVEA 3WS2A 4EBLA 3D4FA 4N1XA 4GZBA 2CMNA 3HUMA 4HBTA 2WKIA 2GX5A 1EI5A 1J3WA 4EQ1A 1RGYA 3S7PA 3ZYTA 2FFFB 2O9AA 3NI9A 4S2OA 3SOIA 5KSCA 3G2YA 2Y2QA 4GW9A 4R70A 3PBTA 1XA1A 1IFQA 2ZQDA 2VGJA 1FCMA 1ONHA 4K91A 3VOYA 3ULFA 1OT9A 2OAP1 5LBRA 3DTIA 3VFHA 5D3OA 5DF7A 1D1JA 3RXXA 2J9PA 2VEAA 4MBHA 1PFLA 3IXDA 5TGFA 3OCLA 4GHIB 2XD5A 3NDGA 4N92A 4DXBA 2EX9A 3MXRA 2WKQA 3VE4A 3LGOA 2P7JA 2J9OA 3EEHA 1KOUA 3VP4A 1KGGA 4UQIM 5FSRA 3ZHHA 3LO7A 2ZBBA 3PYPA 5HAPA 1DP6A 3IWQA 3FKVA 4OOYA 2I72A 1U60A 2PBYA 3HJKA 3FKWA 4Y15A 3N4IA 3LICA 2V1BA 4WYYA 1VEUB 4OLDA 4G3VA 4CLCB 2ZC3B 1AWIA 1STZA 3OZHA 2JKRM 1IYSA 2Q9MA 5EVIA 4QY6A 3VP0A 4P85A 4EEPA 1G28A 5HFOA 4P0MA 4DXCA 4JGPA 4S2PA 4MDZA 4Q0IA 1G6AA 4PKYG 2NUPC 2IA2A 4OVDA 3MXSA 2W27A 3BFDA 2WAFA 1A0KA 1L3LA 1H8MA 3VSKA 1YLPA 3E4QA 5FQMA 4HY8A 4Q0JA 2HDQA 5C5KA 4XT2B 3GV9A 2ZM2A 1ZTUA 2P08A 4R23A 4HHDA 2HP5A 2EX6A 1RCJA 3EGDC 4B4ZA 1W8YA 4FOFA 3C4PA 3UDFA 3TRCA 1NRJA 1JNUA 2HP9A 4UA6A 1OT6A 2Y2PA 2ZM8A 4JGRA 3TG9A 3MR0A 2WKRA 1GA0A 4XUZA 4BWIA 3PXPA 4Y17A 5CXWA 4ZJ3A 3LYXA 3HUNA 3MSHA 4GB7A 3BFFA 4GCZA 1I2WA 4EU0A 3B3XA 5EOOA 5HAQA 1OTDA 5AVEA 3UE3A 3EQUA 1IYOA 3IF5A 4OP5A 4S2MA 4MCWA 5GHXA 3JYIA 3IXBA 2JKTM 4II7A 4B4XA 4BLMA 1XPBA 3C7UA 3LEZA 5GLCA 1HLUP 2V9AA 4N1HA 3Q7ZA 4PPRA 3CAXA 5FDHA 5CHUA 1OJGA 3SW1A 4LCLA 1XFQA 3O5YA 1ESUA 3IT9A 3ZG9B 4I3JA 3V5MA 5FQJA 2QMIA 5FQIA 3MZDA 3ZNYA 3T12B 2WZXA 4NK3A 2XROA 4ZJ2A 3NY4A 3R7WA 4QY5A 4JBFA 4MBKA 4BMWA 1H8YA 4JXGA 5CERA 4MNRA 4ZRRA 4E6XA 5J3WA 4MN7A 1SDEA 1VQQA 3FZCA 4O7DA 4UQIS 5TJJA 4Q8IA 2JBFA 3U4LP 1XX2A 5GHZA 4C6YA 5EM1A 2GZAA 4GOGA 2OOLA 3P09A 4Y3IA 3C38A 1TS7A 1PI4A 4I3IA 3BEBA 1GSVA 4YNRA 5FQKA 2VK3A 3MQ0A 1I5QA 1NLYA 3IF6B 3G34A 4MN5A 4GHIA 3FG8A 1LSWA 3TSGA 4KUOA 3WS5A 1S1ZA 3O3VA 1S4SA 1WA9A 2W3EA 4I38A 5HARA 3OBFA 3MQOA 4KQRA 3KYZA 5GL9A 4LV1A 3LIFA 5AQAA 2EXBA 3C8CA 3JVUA 3UDXA 4RA7A 2L0WA 1BLPA 3SZTA 2ZM0A 1P97A 3BW6A 3LIDA 4HESA 3PBRA 3W2ZA 3NULA 4Q0HA 4HJ3A 3UPPA 3JPUA 1CI8A 5EVLA 3IWOA 2B18A 2P74A 4G3WA 1N9BA 2XA7S 1ES4A 1H5XA 1MPLA 3KO6A 4WMCA 5HDDA 3P7NA 2EFXA 3VOZA 2ZD8A 1CEFA 3TW8A 5AQ7A 1LT0A 4FUWA 3MZFA 5FI7A 4QWOA 3KSFA 3IX4A 3L7HA 4I5SA 2Y8HA 2WADA 1VETB 3EQVA 3V3RA 1SCWA 1SKOB 2W1TA 1MY8A 4OPQA 1RGZA 2Z2MB 1EW0A 4DE3A 3I7JA 3FPWA 1XA7A 2HDUA 1HD8A 5F69A 3M2JA 3GQZA 4OPRA 1Z09A 1BYWA 3ITBA 4WZ5A 4LGWA 3A0RA 3LCEA 4H6JA 1GHIA 5EECA 3LI8A 3OPHA 1NRFA 3MXQA 3DW0A 3LEQA 4BL3A 3E98A 2PDRA 4IBXA 2ZC5B 2EFUA 3WS4A 4R4RA 4EXOA 3C5AA 1NZOA 4E3JA 4Z9QA 2HP6A 4XUXA 1YLJA 3T4QA 4PM9A 5K5BA 5A93A 4N9KA 4OOMA 1H8ZA 2VV7A 4BBUA 1WYBA 2W3HA 5IHVA 4QD4A 1OPXA 1NYYA 5FATA 4KENB 4PM6A 1PZOA 3PBQA 3O87A 1J9MA 1H3QA 1HTZA 3N8SA 4C3QA 5IU1A 2XR0A 5GLAA 4A5RA 5HWVA 2INWA 4M4XA 2FZ0A 5MC7A 5HD3A 4OOLA 4ID4A 4D2OA 3BECA 4BJPA 3UE6A 2K31A 2Y2MA 1VEUA 4HH2A 4JPMA 3CUEC 3NJAA 4GNUA 3EGXC 3W8KA 3K3CA 3IBJA 2VZWA 3HL9A 4WUJA 3P01A 1F5MA 2J7VA 1GHMA 3SS5A 4E3LA 4HIAA 2OSUA 1FOFA 4K08A 4ESPA 4E3IA 5E2GA 3FV7A 1CJFA 3NOPC 2V1AA 5M18A 1IEMA 3DWKA 1C3BA 1PW1A 3S4XA 5HPFA 2Y55A 5EOEA 5AQ9A 4LV0A 3DAVA 3CPTA 5KMWA 1L0EA 3N6IA 2H0TA 5E2FA 2Y79A 4MEZA 5DF8A 4IVIA 3TJZC 5M1AA 4QJGA 1OTAA 3LR5A 1KDSA 4Y0TA 3A3JA 3NECA 5J8XA 1W5DA 3RJUA 3ZCZA 2UWXA 2ZQ9A 2HZ5A 1PZPA 4BD1A 2L1MA 4KZ5A 4P6BA 4KG6A 5DJTA 3CITA 3CZDA 3HLDA 2M7VA 3LIBA 5TBMB 2H5SA 1BTLA 4LLOB 1VB6A 5E2EA 5GLBA 3N8LA 1LL8A 2P9VB 5JYOA 4KZ8A 3MFDA 3E4PA 3W4OA 4R38A 4JGQA 3Q7VB 4S2NC 3BQAA 2Y2LA 2XFTA 4WF0A 1VHMA 3WS1A 4KQOA 4N9LA 2ZOHA 3ZQ5A 3UE1A 5DTKA 4IUHA 2Y2GA 2XF3A 3BFGA 5HWTA 1DRMA 2EX8A 2DCFA 5FEGA 4R1GA 3C7VA 2JC7A 1MKMA 3QP8A 5FI6A 3CMZA 2XH9A 2R9WA 5DFXA 3UB7A 5FASA 2XQZA 1VETA 3G2ZA 5GLDA 2J3TD 3LIEA 4U0XA 4OQ0A 4JF6A 3IWIA 3GECA 4KQDA 1KVMA 1F2KA 1WE4A 2WGIA 5TR7A 1TEMA 3Q7VA 5HD5A 4EEUA 1Z6FA 2K2NA 4JXWA 2ZJ9A 4S2LA 4ZDXA 5CTMA 3WS0A 4LPZA 1TDGA 4L0LA 3GRJA 5EVIC 4KZ4A 4IUKA 3AGDA 2EWVA 2VGLS 2W3FA 3O86A 4P87A 1SDNA 4PM8A 3BLMA 3IQAA 1S0WA 4OQGA 1W63Q
chains in the Genus database with same CATH topology
3M6HA 4LENA 4JXGA 5CERA 1IYPA 1CI9A 1JWVA 4OQHA 4X68A 5CHMA 4MNRA 3S22A 5CGXA 4E6XA 4EBNA 2Y2KA 5DVAA 2GDNA 2ZQAA 1SDEA 4DE1A 1VQQA 3FZCA 3Q82A 1E4DA 4Y0UA 5GHYA 1JTDA 4O7DA 3CG5A 4Q8IA 2JBFA 1XX2A 2Y2JA 4K0WA 1ES3A 2FFYA 1YM1A 2HDSA 2ZC4B 5GHZA 5CGWA 4C6YA 1L2SA 4WEKA 3SH7A 1BLHA 3WRZA 2BG1A 2X01A 2WAEA 2ZQ7A 4GOGA 1XGIA 3P09A 5DF9A 3OPPA 4HBUA 4EV4A 4R3BA 1K38A 4GD8A 5CRFA 5KSHA 5EVID 2ZC6B 1MWRA 3NIAA 1PI4A 3G35A 5EE8A 3RXWA 3BEBA 2WGVA 4RVAA 2DRWA 1AXBA 4RX2A 5F1FA 5FQKA 4WZ5C 3W4QA 4X56A 1I5QA 4GN2A 3HUOA 4Y7PA 1E3UA 1Y54A 5A90A 3IF6B 3G34A 4OPYA 3IXHA 2OLUA 4S2NA 1YLWA 1LLBA 1PW8A 3LY4A 4BENA 1XGJA 3TSGA 1EWZA 3IF6C 1ZG6A 2RCXA 3WS5A 4ZJ1A 1Q2PA 2H10A 3O3VA 4E3OA 1W8QA 5F1GA 2VGKA 2OV5A 4EUZA 5HARA 1ES2A 2EXAA 4KQRA 3PBNA 5GL9A 1K54A 4LV1A 1YT4A 5AQAA 1O07A 3BLSA 2Z2LB 3SH8A 2EXBA 2CC1A 4E3MA 4E3KA 2G2UA 1BZAA 4LV2A 1ALQA 1PYYA 3BFCA 3UDXA 4RA7A 4UHUA 3W4PA 1FSYA 1BLPA 4IVKA 4JXVA 1QMFA 2ZQCA 2ZM0A 3Q07A 4ZTKA 4YINA 1CK3A 3HVFA 3O88A 3MBZA 4HESA 3NCKA 3PBRA 4GD6A 3P98A 5A92A 3OPRA 4ZBEA 1NYMA 3VSLA 2WUQA 2Y2HA 3GSGA 3C4OA 1FCNA 2XD1A 1IKGA 3UPPA 4EQIA 1CI8A 1YQSA 5EVLA 1LI0A 3VMAA 4S2IA 1MXOA 3ZG5A 3HBRA 3IWOA 4UA9A 4FSFA 3ZVWA 1K56A 3FYZA 2V1ZA 3DTMA 2P74A 4RX3A 3UY6A 3G31A 1N9BA 5M19A 5TFQA 1ES4A 3VP1A 4YFMA 5FAPA 1H5XA 1MPLA 3HLWA 3ZDJA 4WEJA 3BYDA 1NY0A 1DJAA 4WMCA 1Q2QA 2A49A 4EWFA 3MKFA 1I2SA 2EFXA 5F82A 1KGFA 4HEFA 4R0QA 3VOZA 2ZD8A 4RYEA 1MKIA 1CEFA 1K6RA 1S6RA 3HREA 5AQ7A 3GVBA 5EUAA 3UNWA 4KZ3A 3E2LA 3MZFA 5FI7A 1PWGA 4C75A 1RP5A 4JKTA 4WM9A 4CJNA 1K6SA 1YLYA 5HAIA 2WADA 1MWSA 3EQVA 1G68A 3V3RA 4OKPA 3HLBA 4CPKA 3Q81A 1JTGA 1SCWA 1MY8A 1SHVA 3NBLA 4OPQA 1RGZA 1SKFA 1O7EA 4E6WA 2Z2MB 1VM1A 4DE3A 1ERQA 1ESIA 3I7JA 4OP8A 1XA7A 4F94A 1JWPA 2HDUA 1HD8A 3M2JA 1JVJA 1LL9A 5CGSA 3GQZA 4OPRA 1FSWA 3N8RA 1BULA 3ITBA 4LV3A 4R4SA 4WZ5A 3ZG8B 3MZEA 4DKIA 3LCEA 3ZVTA 4DE2A 1GHIA 5EECA 5CEDA 3OPHA 1FR6A 1NRFA 4WZ4A 4DDSA 3DW0A 4BL3A 5DTSA 3PAGA 4IBXA 1W79A 2ZC5B 4BD0A 2EFUA 1GA9A 3WS4A 3IF6A 4UA7A 4S2KA 4R4RA 2P9VA 1FCOA 3BM6A 3C5AA 1NZOA 3N7WA 3E2KA 4E3JA 3MKEA 4KZ9A 4Z9QA 1L0GA 1KGEA 2XEPA 2Q9NA 4BQMA 2Y2OA 4X55A 1OMEA 4IEDA 1BSGA 2HP6A 2XK1A 4XUXA 1YLJA 4QB8A 3ITAA 4PM9A 4WMCD 2X71A 5A93A 1K57A 2XDMA 4N9KA 4KZ6A 2PU4A 4OOMA 2Y4AA 1H8ZA 3G30A 4FH4A 2WZZA 3G4PA 1WYCA 3WS2A 4EBLA 1WYBA 3D4FA 4N1XA 1BUEA 1ZG4A 4GZBA 4QD4A 1BT5A 1TVFA 3HUMA 4HBTA 2WKIA 5FI2A 5FAOA 1EI5A 1NYYA 2PU2A 1LHYA 5FATA 5FQ9A 3SS3A 4KENB 3A3EA 4PM6A 3DWZA 1PZOA 1RGYA 3PBQA 3O87A 4WBGA 3BFEA 1EROA 1J9MA 1HTZA 2C5WB 2FFFB 2RL3A 3N8SA 4C3QA 3NI9A 4S2OA 3SOIA 2A3UA 2XR0A 5GLAA 4A5RA 3G2YA 5KSCA 2Y2QA 5EPHA 1ES5A 4DRTA 4FCFA 3VFFA 3PBTA 2WK0A 3IHAA 3PBSA 1XA1A 3UO9A 2ZQDA 4OOLA 2VGJA 2V20A 4KQQA 1FCMA 1K25A 1ONHA 3QNCA 3QNBA 4ID4A 4K91A 4XXRA 3VOYA 4D2OA 1YMXA 3BECA 4BJPA 1YLTA 3ZNTA 2Y2MA 3UDIA 4H8RA 1MWTA 2IWDA 2B5RA 1JWZA 3OCNA 1ONGA 3VFHA 1HVBA 5D3OA 1GHPA 1YLZA 1YMSA 4JLFA 4JPMA 5DF7A 3RXXA 3NDEA 1NZUA 1XXMA 2J9PA 4GNUA 4IBRA 3W8KA 1K55A 2DNSA 4MBHA 4ZAMA 3IXDA 5TGFA 5F83A 3OCLA 2XD5A 3M6BA 2ZC7A 3HLEA 1MBLA 3NDGA 4N92A 5AQBA 4MBFA 2EX9A 3VP3A 4DXBA 3SH9A 3HL9A 3MXRA 5HW3A 4KG5A 5FQQA 4X53A 5CTNA 2J9OA 1PWDA 3BRMA 2Y2NA 2J7VA 3ZG7B 2ZMAA 1GHMA 1E3UD 3SS5A 4E3LA 4EBPA 3VP4A 1KGGA 2OSUA 4KZ7A 1FOFA 2Y91A 4PM5A 3OPLA 2G2WA 4GDNA 3HLFA 2QZ6A 4UAAA 5FAQA 5FSRA 5JYPA 2HDRA 4JF5A 5G18A 3ZHHA 4E3IA 5E2GA 3LO7A 3FV7A 4B88A 5E43A 5HAPA 5FA7A 3IWQA 3V50A 5IHVA 2C6WB 5M18A 1IEMA 3DWKA 3FKVA 4OOYA 1C3BA 1PW1A 2I72A 3S1YA 3V39A 1U60A 2PBYA 3S4XA 2Y55A 3FKWA 4OQIA 5EOEA 5AQ9A 2XFSA 4GDBA 3N4IA 4LV0A 3UE0A 4WYYA 2ZQ8A 1DJBA 1QMEA 4DE0A 5KMWA 4OLDA 1IYQA 1L0EA 3AGFA 3N6IA 3NC8A 2ZC3B 1DY6A 3SS4A 3UN7A 2H0TA 1XKZA 3OZHA 3UPNA 5E2FA 1IYSA 2Q9MA 4MEZA 5EVIA 4PMAA 4QY6A 3VP0A 4P85A 5DF8A 4IVIA 1BLCA 3Q1FA 5HFOA 3WRTA 4P0MA 5M1AA 4DXCA 1KVLA 4QJGA 4S2PA 3ISGA 1K57C 3HLGA 1G6AA 1KDSA 2HPBA 1K4FA 4Y0TA 5CEBA 3A3JA 3OC2A 4U3TA 5J8XA 1W5DA 1MWUA 3RJUA 4OVDA 2UWXA 3ZCZA 2ZQ9A 3MXSA 1PWCA 1M40A 3BFDA 3A3DA 3ZFZA 5A91A 2WAFA 1PZPA 4BD1A 5L2FA 2Y2IA 3FWLA 3VSKA 4KZ5A 1YLPA 5FQMA 4GKUA 4P6BA 2HDQA 4KG6A 3IH8A 4BL2A 3GR2A 3GV9A 2ZM2A 4JXSA 3CZDA 1GCEA 3IH9A 4R23A 1K54C 3HLDA 5CHJA 1IELA 2HP5A 2H5SA 1BTLA 2EX6A 4KZAA 1IKIA 3UPOA 2WKEA 1RCJA 1KDWA 2WGWB 1K4EA 5E2EA 4WELA 2BLSA 3A3IA 3M2KA 1W8YA 3N8LA 5GLBA 3C4PA 4B4ZA 3UDFA 2P9VB 4QU3A 5JYOA 4KZ8A 1XP4A 2HP9A 4UA6A 3MFDA 2Y2PA 1ZC2A 3W4OA 2ZM8A 3Q7VB 5U47A 4S2NC 1E25A 3TG9A 1GA0A 4XUZA 3PAEA 2Y2LA 1NJ4A 1FQGA 2XFTA 4U0TA 3PBOA 2Y59A 3WS1A 3TOIA 5CXWA 3QHYA 4ZJ3A 4KZBA 3HUNA 4KQOA 2X02A 3ZGAB 4N9LA 4GB7A 3BFFA 4X6TA 1M6KA 3UE1A 1I2WA 5DTKA 5KZHA 2Y2GA 3B3XA 4OH0A 5EOOA 2XF3A 3BFGA 5HAQA 5BOHA 5I94A 3VP2A 1K55C 2J8YA 2EX8A 2XGNA 1TDLA 2DCFA 2IWCA 3HLCA 3PTEA 4R1GA 1N4OA 3C7VA 1DJCA 2JC7A 3UE3A 5FI6A 1FR1A 3EQUA 1IYOA 3CMZA 3IF5A 1NXYA 4FH2A 2XH9A 4OP5A 4X69A 2R9WA 1LI9A 4S2MA 5HX9A 3GMWA 5FASA 5GHXA 1KE3A 4DF6A 3JYIA 3IXBA 4R3JA 2XQZA 3G2ZA 5GLDA 1LL5A 5HL1A 3G32A 4U0XA 1HZOA 4MLLA 4OQ0A 4JF6A 4B4XA 4BLMA 1ERMA 1XPBA 3LY3A 3C7UA 3IWIA 4LCMA 1KVMA 3LEZA 4K0XA 5GLCA 3GTCA 4N1HA 3Q7ZA 4PPRA 1WE4A 1K56D 2WGIA 5TR7A 1TEMA 3Q7VA 5FDHA 5CHUA 1BLSA 2EX2A 1L0FA 2WGWA 3A3FA 3V3SA 5EVIB 4JF4A 1Z6FA 4LCLA 4JXWA 2ZJ9A 4S2LA 4ZDXA 2H0YA 5CTMA 3WS0A 1ESUA 3IT9A 1TDGA 4L0LA 4KG2A 3ZG9B 4S2JA 3IHBA 3GRJA 2WKHA 5EVIC 2JCHA 3WWXA 2WYXA 1KE0A 1CEGA 4QHCA 1L0DA 2JE5A 4KZ4A 5FQJA 3V5MA 4DDYA 4E3NA 2E8IA 2QMIA 4M3KA 5FQIA 1KE4A 3MZDA 5CECA 2V2FF 2R9XA 3ZNYA 3AGDA 3IXGA 2IWBA 1PI5A 2QPNA 3O86A 2XLNA 2WZXA 4NK3A 4OONA 4P87A 4PM7A 4ZJ2A 1SDNA 3NY4A 4PM8A 4Y0OA 4NETA 5E2HA 3ZG0A 1PIOA 1ZKJA 1W7FA 2ZLYA 4OLGA 3BLMA 4QY5A 5DTTA 3CJMA 3IQAA 4OPZA 4JBFA 4MBKA 1S0WA 4OQGA 4FD8A 1H8YA 3AGEA 2OLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M6H A;  4LEN A;  4JXG A;  5CER A;  1IYP A;  1CI9 A;  1JWV A;  4OQH A;  4X68 A;  5CHM A;  4MNR A;  3S22 A;  5CGX A;  4E6X A;  4EBN A;  2Y2K A;  5DVA A;  2GDN A;  2ZQA A;  1SDE A;  4DE1 A;  1VQQ A;  3FZC A;  3Q82 A;  1E4D A;  4Y0U A;  5GHY A;  1JTD A;  4O7D A;  3CG5 A;  4Q8I A;  2JBF A;  1XX2 A;  2Y2J A;  4K0W A;  1ES3 A;  2FFY A;  1YM1 A;  2HDS A;  2ZC4 B;  5GHZ A;  5CGW A;  4C6Y A;  1L2S A;  4WEK A;  3SH7 A;  1BLH A;  3WRZ A;  2BG1 A;  2X01 A;  2WAE A;  2ZQ7 A;  4GOG A;  1XGI A;  3P09 A;  5DF9 A;  3OPP A;  4HBU A;  4EV4 A;  4R3B A;  1K38 A;  4GD8 A;  5CRF A;  5KSH A;  5EVI D;  2ZC6 B;  1MWR A;  3NIA A;  1PI4 A;  3G35 A;  5EE8 A;  3RXW A;  3BEB A;  2WGV A;  4RVA A;  2DRW A;  1AXB A;  4RX2 A;  5F1F A;  5FQK A;  4WZ5 C;  3W4Q A;  4X56 A;  1I5Q A;  4GN2 A;  3HUO A;  4Y7P A;  1E3U A;  1Y54 A;  5A90 A;  3IF6 B;  3G34 A;  4OPY A;  3IXH A;  2OLU A;  4S2N A;  1YLW A;  1LLB A;  1PW8 A;  3LY4 A;  4BEN A;  1XGJ A;  3TSG A;  1EWZ A;  3IF6 C;  1ZG6 A;  2RCX A;  3WS5 A;  4ZJ1 A;  1Q2P A;  2H10 A;  3O3V A;  4E3O A;  1W8Q A;  5F1G A;  2VGK A;  2OV5 A;  4EUZ A;  5HAR A;  1ES2 A;  2EXA A;  4KQR A;  3PBN A;  5GL9 A;  1K54 A;  4LV1 A;  1YT4 A;  5AQA A;  1O07 A;  3BLS A;  2Z2L B;  3SH8 A;  2EXB A;  2CC1 A;  4E3M A;  4E3K A;  2G2U A;  1BZA A;  4LV2 A;  1ALQ A;  1PYY A;  3BFC A;  3UDX A;  4RA7 A;  4UHU A;  3W4P A;  1FSY A;  1BLP A;  4IVK A;  4JXV A;  1QMF A;  2ZQC A;  2ZM0 A;  3Q07 A;  4ZTK A;  4YIN A;  1CK3 A;  3HVF A;  3O88 A;  3MBZ A;  4HES A;  3NCK A;  3PBR A;  4GD6 A;  3P98 A;  5A92 A;  3OPR A;  4ZBE A;  1NYM A;  3VSL A;  2WUQ A;  2Y2H A;  3GSG A;  3C4O A;  1FCN A;  2XD1 A;  1IKG A;  3UPP A;  4EQI A;  1CI8 A;  1YQS A;  5EVL A;  1LI0 A;  3VMA A;  4S2I A;  1MXO A;  3ZG5 A;  3HBR A;  3IWO A;  4UA9 A;  4FSF A;  3ZVW A;  1K56 A;  3FYZ A;  2V1Z A;  3DTM A;  2P74 A;  4RX3 A;  3UY6 A;  3G31 A;  1N9B A;  5M19 A;  5TFQ A;  1ES4 A;  3VP1 A;  4YFM A;  5FAP A;  1H5X A;  1MPL A;  3HLW A;  3ZDJ A;  4WEJ A;  3BYD A;  1NY0 A;  1DJA A;  4WMC A;  1Q2Q A;  2A49 A;  4EWF A;  3MKF A;  1I2S A;  2EFX A;  5F82 A;  1KGF A;  4HEF A;  4R0Q A;  3VOZ A;  2ZD8 A;  4RYE A;  1MKI A;  1CEF A;  1K6R A;  1S6R A;  3HRE A;  5AQ7 A;  3GVB A;  5EUA A;  3UNW A;  4KZ3 A;  3E2L A;  3MZF A;  5FI7 A;  1PWG A;  4C75 A;  1RP5 A;  4JKT A;  4WM9 A;  4CJN A;  1K6S A;  1YLY A;  5HAI A;  2WAD A;  1MWS A;  3EQV A;  1G68 A;  3V3R A;  4OKP A;  3HLB A;  4CPK A;  3Q81 A;  1JTG A;  1SCW A;  1MY8 A;  1SHV A;  3NBL A;  4OPQ A;  1RGZ A;  1SKF A;  1O7E A;  4E6W A;  2Z2M B;  1VM1 A;  4DE3 A;  1ERQ A;  1ESI A;  3I7J A;  4OP8 A;  1XA7 A;  4F94 A;  1JWP A;  2HDU A;  1HD8 A;  3M2J A;  1JVJ A;  1LL9 A;  5CGS A;  3GQZ A;  4OPR A;  1FSW A;  3N8R A;  1BUL A;  3ITB A;  4LV3 A;  4R4S A;  4WZ5 A;  3ZG8 B;  3MZE A;  4DKI A;  3LCE A;  3ZVT A;  4DE2 A;  1GHI A;  5EEC A;  5CED A;  3OPH A;  1FR6 A;  1NRF A;  4WZ4 A;  4DDS A;  3DW0 A;  4BL3 A;  5DTS A;  3PAG A;  4IBX A;  1W79 A;  2ZC5 B;  4BD0 A;  2EFU A;  1GA9 A;  3WS4 A;  3IF6 A;  4UA7 A;  4S2K A;  4R4R A;  2P9V A;  1FCO A;  3BM6 A;  3C5A A;  1NZO A;  3N7W A;  3E2K A;  4E3J A;  3MKE A;  4KZ9 A;  4Z9Q A;  1L0G A;  1KGE A;  2XEP A;  2Q9N A;  4BQM A;  2Y2O A;  4X55 A;  1OME A;  4IED A;  1BSG A;  2HP6 A;  2XK1 A;  4XUX A;  1YLJ A;  4QB8 A;  3ITA A;  4PM9 A;  4WMC D;  2X71 A;  5A93 A;  1K57 A;  2XDM A;  4N9K A;  4KZ6 A;  2PU4 A;  4OOM A;  2Y4A A;  1H8Z A;  3G30 A;  4FH4 A;  2WZZ A;  3G4P A;  1WYC A;  3WS2 A;  4EBL A;  1WYB A;  3D4F A;  4N1X A;  1BUE A;  1ZG4 A;  4GZB A;  4QD4 A;  1BT5 A;  1TVF A;  3HUM A;  4HBT A;  2WKI A;  5FI2 A;  5FAO A;  1EI5 A;  1NYY A;  2PU2 A;  1LHY A;  5FAT A;  5FQ9 A;  3SS3 A;  4KEN B;  3A3E A;  4PM6 A;  3DWZ A;  1PZO A;  1RGY A;  3PBQ A;  3O87 A;  4WBG A;  3BFE A;  1ERO A;  1J9M A;  1HTZ A;  2C5W B;  2FFF B;  2RL3 A;  3N8S A;  4C3Q A;  3NI9 A;  4S2O A;  3SOI A;  2A3U A;  2XR0 A;  5GLA A;  4A5R A;  3G2Y A;  5KSC A;  2Y2Q A;  5EPH A;  1ES5 A;  4DRT A;  4FCF A;  3VFF A;  3PBT A;  2WK0 A;  3IHA A;  3PBS A;  1XA1 A;  3UO9 A;  2ZQD A;  4OOL A;  2VGJ A;  2V20 A;  4KQQ A;  1FCM A;  1K25 A;  1ONH A;  3QNC A;  3QNB A;  4ID4 A;  4K91 A;  4XXR A;  3VOY A;  4D2O A;  1YMX A;  3BEC A;  4BJP A;  1YLT A;  3ZNT A;  2Y2M A;  3UDI A;  4H8R A;  1MWT A;  2IWD A;  2B5R A;  1JWZ A;  3OCN A;  1ONG A;  3VFH A;  1HVB A;  5D3O A;  1GHP A;  1YLZ A;  1YMS A;  4JLF A;  4JPM A;  5DF7 A;  3RXX A;  3NDE A;  1NZU A;  1XXM A;  2J9P A;  4GNU A;  4IBR A;  3W8K A;  1K55 A;  2DNS A;  4MBH A;  4ZAM A;  3IXD A;  5TGF A;  5F83 A;  3OCL A;  2XD5 A;  3M6B A;  2ZC7 A;  3HLE A;  1MBL A;  3NDG A;  4N92 A;  5AQB A;  4MBF A;  2EX9 A;  3VP3 A;  4DXB A;  3SH9 A;  3HL9 A;  3MXR A;  5HW3 A;  4KG5 A;  5FQQ A;  4X53 A;  5CTN A;  2J9O A;  1PWD A;  3BRM A;  2Y2N A;  2J7V A;  3ZG7 B;  2ZMA A;  1GHM A;  1E3U D;  3SS5 A;  4E3L A;  4EBP A;  3VP4 A;  1KGG A;  2OSU A;  4KZ7 A;  1FOF A;  2Y91 A;  4PM5 A;  3OPL A;  2G2W A;  4GDN A;  3HLF A;  2QZ6 A;  4UAA A;  5FAQ A;  5FSR A;  5JYP A;  2HDR A;  4JF5 A;  5G18 A;  3ZHH A;  4E3I A;  5E2G A;  3LO7 A;  3FV7 A;  4B88 A;  5E43 A;  5HAP A;  5FA7 A;  3IWQ A;  3V50 A;  5IHV A;  2C6W B;  5M18 A;  1IEM A;  3DWK A;  3FKV A;  4OOY A;  1C3B A;  1PW1 A;  2I72 A;  3S1Y A;  3V39 A;  1U60 A;  2PBY A;  3S4X A;  2Y55 A;  3FKW A;  4OQI A;  5EOE A;  5AQ9 A;  2XFS A;  4GDB A;  3N4I A;  4LV0 A;  3UE0 A;  4WYY A;  2ZQ8 A;  1DJB A;  1QME A;  4DE0 A;  5KMW A;  4OLD A;  1IYQ A;  1L0E A;  3AGF A;  3N6I A;  3NC8 A;  2ZC3 B;  1DY6 A;  3SS4 A;  3UN7 A;  2H0T A;  1XKZ A;  3OZH A;  3UPN A;  5E2F A;  1IYS A;  2Q9M A;  4MEZ A;  5EVI A;  4PMA A;  4QY6 A;  3VP0 A;  4P85 A;  5DF8 A;  4IVI A;  1BLC A;  3Q1F A;  5HFO A;  3WRT A;  4P0M A;  5M1A A;  4DXC A;  1KVL A;  4QJG A;  4S2P A;  3ISG A;  1K57 C;  3HLG A;  1G6A A;  1KDS A;  2HPB A;  1K4F A;  4Y0T A;  5CEB A;  3A3J A;  3OC2 A;  4U3T A;  5J8X A;  1W5D A;  1MWU A;  3RJU A;  4OVD A;  2UWX A;  3ZCZ A;  2ZQ9 A;  3MXS A;  1PWC A;  1M40 A;  3BFD A;  3A3D A;  3ZFZ A;  5A91 A;  2WAF A;  1PZP A;  4BD1 A;  5L2F A;  2Y2I A;  3FWL A;  3VSK A;  4KZ5 A;  1YLP A;  5FQM A;  4GKU A;  4P6B A;  2HDQ A;  4KG6 A;  3IH8 A;  4BL2 A;  3GR2 A;  3GV9 A;  2ZM2 A;  4JXS A;  3CZD A;  1GCE A;  3IH9 A;  4R23 A;  1K54 C;  3HLD A;  5CHJ A;  1IEL A;  2HP5 A;  2H5S A;  1BTL A;  2EX6 A;  4KZA A;  1IKI A;  3UPO A;  2WKE A;  1RCJ A;  1KDW A;  2WGW B;  1K4E A;  5E2E A;  4WEL A;  2BLS A;  3A3I A;  3M2K A;  1W8Y A;  3N8L A;  5GLB A;  3C4P A;  4B4Z A;  3UDF A;  2P9V B;  4QU3 A;  5JYO A;  4KZ8 A;  1XP4 A;  2HP9 A;  4UA6 A;  3MFD A;  2Y2P A;  1ZC2 A;  3W4O A;  2ZM8 A;  3Q7V B;  5U47 A;  4S2N C;  1E25 A;  3TG9 A;  1GA0 A;  4XUZ A;  3PAE A;  2Y2L A;  1NJ4 A;  1FQG A;  2XFT A;  4U0T A;  3PBO A;  2Y59 A;  3WS1 A;  3TOI A;  5CXW A;  3QHY A;  4ZJ3 A;  4KZB A;  3HUN A;  4KQO A;  2X02 A;  3ZGA B;  4N9L A;  4GB7 A;  3BFF A;  4X6T A;  1M6K A;  3UE1 A;  1I2W A;  5DTK A;  5KZH A;  2Y2G A;  3B3X A;  4OH0 A;  5EOO A;  2XF3 A;  3BFG A;  5HAQ A;  5BOH A;  5I94 A;  3VP2 A;  1K55 C;  2J8Y A;  2EX8 A;  2XGN A;  1TDL A;  2DCF A;  2IWC A;  3HLC A;  3PTE A;  4R1G A;  1N4O A;  3C7V A;  1DJC A;  2JC7 A;  3UE3 A;  5FI6 A;  1FR1 A;  3EQU A;  1IYO A;  3CMZ A;  3IF5 A;  1NXY A;  4FH2 A;  2XH9 A;  4OP5 A;  4X69 A;  2R9W A;  1LI9 A;  4S2M A;  5HX9 A;  3GMW A;  5FAS A;  5GHX A;  1KE3 A;  4DF6 A;  3JYI A;  3IXB A;  4R3J A;  2XQZ A;  3G2Z A;  5GLD A;  1LL5 A;  5HL1 A;  3G32 A;  4U0X A;  1HZO A;  4MLL A;  4OQ0 A;  4JF6 A;  4B4X A;  4BLM A;  1ERM A;  1XPB A;  3LY3 A;  3C7U A;  3IWI A;  4LCM A;  1KVM A;  3LEZ A;  4K0X A;  5GLC A;  3GTC A;  4N1H A;  3Q7Z A;  4PPR A;  1WE4 A;  1K56 D;  2WGI A;  5TR7 A;  1TEM A;  3Q7V A;  5FDH A;  5CHU A;  1BLS A;  2EX2 A;  1L0F A;  2WGW A;  3A3F A;  3V3S A;  5EVI B;  4JF4 A;  1Z6F A;  4LCL A;  4JXW A;  2ZJ9 A;  4S2L A;  4ZDX A;  2H0Y A;  5CTM A;  3WS0 A;  1ESU A;  3IT9 A;  1TDG A;  4L0L A;  4KG2 A;  3ZG9 B;  4S2J A;  3IHB A;  3GRJ A;  2WKH A;  5EVI C;  2JCH A;  3WWX A;  2WYX A;  1KE0 A;  1CEG A;  4QHC A;  1L0D A;  2JE5 A;  4KZ4 A;  5FQJ A;  3V5M A;  4DDY A;  4E3N A;  2E8I A;  2QMI A;  4M3K A;  5FQI A;  1KE4 A;  3MZD A;  5CEC A;  2V2F F;  2R9X A;  3ZNY A;  3AGD A;  3IXG A;  2IWB A;  1PI5 A;  2QPN A;  3O86 A;  2XLN A;  2WZX A;  4NK3 A;  4OON A;  4P87 A;  4PM7 A;  4ZJ2 A;  1SDN A;  3NY4 A;  4PM8 A;  4Y0O A;  4NET A;  5E2H A;  3ZG0 A;  1PIO A;  1ZKJ A;  1W7F A;  2ZLY A;  4OLG A;  3BLM A;  4QY5 A;  5DTT A;  3CJM A;  3IQA A;  4OPZ A;  4JBF A;  4MBK A;  1S0W A;  4OQG A;  4FD8 A;  1H8Y A;  3AGE A;  2OLV A; 
#chains in the Genus database with same CATH topology
 3M6H A;  4X68 A;  3VV4 A;  3S7O A;  3LR3 A;  2ZQA A;  3Q82 A;  1OTE A;  2Y2J A;  3SH7 A;  1DP8 A;  3WRZ A;  3E4O A;  3OPP A;  4HBU A;  4ETZ A;  4EV4 A;  4R3B A;  4WN5 A;  1K38 A;  4GD8 A;  2OAQ 1;  2A24 B;  1T1A A;  1MWR A;  3NIA A;  5EE8 A;  4RVA A;  5F1F A;  3K3D A;  3OOV A;  4Y7P A;  4S2N A;  1LLB A;  3H82 A;  1PW8 A;  1XGJ A;  1YSP A;  1EWZ A;  3IF6 C;  4ZJ1 A;  4MMN A;  2OV5 A;  4EUZ A;  3F1O B;  2EXA A;  1ODV A;  3PBN A;  5HL6 A;  3T50 A;  3BWL A;  3SH8 A;  2G2U A;  2J80 A;  1ALQ A;  1PYY A;  3BFC A;  3W4P A;  3QP6 A;  1FSY A;  1QMF A;  4Y13 A;  1CK3 A;  3OPR A;  3C4O A;  2GJ3 A;  3ICY A;  1YQS A;  3VMA A;  1LI0 A;  2JN7 A;  4S2I A;  3HBR A;  4FSF A;  3FYZ A;  5G4Y A;  4RX3 A;  3T4K A;  3CWF A;  5M19 A;  4YFM A;  4O01 A;  1NY0 A;  4EWF A;  1Q2Q A;  2A49 A;  5F68 A;  4PHT A;  5HDC A;  2XRN A;  4LFU A;  4HEF A;  5AVF A;  1P0Z A;  3HRE A;  1PWG A;  1RP5 A;  2V8F A;  1YLY A;  4LRX C;  5HAI A;  1SHV A;  3NBL A;  1ERQ A;  1UGU A;  1ESI A;  4NXG A;  2B95 A;  5F6A A;  5DFY A;  4HP9 A;  1LL9 A;  4AFI A;  5HZH A;  1SKO A;  1BUL A;  3ZG8 B;  4R4S A;  3MZE A;  1S67 L;  3BY9 A;  3D3O A;  4WZ4 A;  4DDS A;  4CLC D;  5DTS A;  5AJG A;  5EFW A;  3IBR A;  4UA7 A;  4S2K A;  3N7W A;  3A0S A;  3E2K A;  1L0G A;  1KGE A;  4B93 A;  3OLO A;  2Y2O A;  4X55 A;  4IED A;  1BSG A;  2I9V A;  1X0O A;  3MJQ A;  2X71 A;  1K57 A;  2XDM A;  4KZ6 A;  3G30 A;  3G4P A;  1NLZ A;  4JGO A;  1BT5 A;  5J7E A;  5FI2 A;  3T4O A;  5FQ9 A;  3SS3 A;  4PAU A;  2O9B A;  3F1P A;  4XT2 A;  1P9W A;  4WBG A;  3BFE A;  2C5W B;  3IS2 B;  4E04 A;  1TS6 A;  3H82 B;  2XA7 M;  3B42 A;  3PHY A;  5EPH A;  1ES5 A;  4FCF A;  2WK0 A;  3IHA A;  3PBS A;  3UO9 A;  2VA0 A;  4KQQ A;  2E8J A;  5I5L A;  3QNC A;  4HP4 A;  3UDI A;  4H8R A;  1MWT A;  3B33 A;  1TS8 A;  4EES A;  2B5R A;  1JWZ A;  1N9L A;  3OCN A;  1ONG A;  4NKP A;  1HVB A;  1YMS A;  4ME4 A;  1XXM A;  2B02 A;  5F83 A;  2M1C A;  3M6B A;  2YKH A;  2ZC7 A;  3MF0 A;  4MBF A;  5HW3 A;  4X53 A;  3QP2 A;  1PWD A;  3BRM A;  2Y2N A;  3ZG7 B;  2O0Y A;  4UEY A;  2QWS A;  3EWK A;  2Y91 A;  4PM5 A;  2FH5 A;  2G2W A;  3LI9 A;  4GDN A;  5FAQ A;  2QZ6 A;  5JYP A;  2HDR A;  4JF5 A;  4R3A A;  2KOI A;  2HV1 A;  1XJ2 A;  5FA7 A;  1T1C A;  3FC7 A;  3S1Y A;  5FL3 A;  4OQI A;  2XFS A;  3UE0 A;  4EUV A;  2ZQ8 A;  1QME A;  5FDS A;  1IYQ A;  5A8B A;  2ZL1 A;  1DY6 A;  3D9Y A;  2A2L A;  3CHW P;  3SS4 A;  1XKZ A;  4GS9 B;  2A24 A;  1D06 A;  1KVL A;  1YAX A;  3ISG A;  3IX3 A;  1F98 A;  4HJ4 A;  4L9F A;  1K4F A;  5CEB A;  3OC2 A;  2VV8 A;  3R7W B;  2QJ7 A;  3A3D A;  3ZFZ A;  5L2F A;  2Y2I A;  3FWL A;  1Y28 A;  3DTK A;  3IH8 A;  4BL2 A;  3GR2 A;  4JXS A;  2OWH A;  2VV6 A;  3IH9 A;  3JVV A;  1K54 C;  1IEL A;  4KZA A;  1IKI A;  2WKE A;  1KDW A;  2WGW B;  2BLS A;  3A3I A;  4X1M A;  4QU3 A;  1ZC2 A;  3R4K A;  4O8G A;  4DMZ A;  3LR4 A;  3PAE A;  1FQG A;  3PBO A;  3TOI A;  5IT5 A;  2X02 A;  3ZGA B;  1F9I A;  1FIL A;  4X6T A;  1M6K A;  5KZH A;  4OH0 A;  3G6O A;  5BOH A;  1N9O A;  1K55 C;  2XGN A;  1TDL A;  2IWC A;  4WLA A;  3DBA A;  1DJC A;  5TBM A;  3UB5 P;  1FR1 A;  2D01 A;  4FH2 A;  4X69 A;  1LI9 A;  4RQ9 A;  5HL1 A;  4MLL A;  4NXB A;  1ERM A;  3C30 A;  4LCM A;  2QJ5 A;  3GTC A;  1D7E A;  1DP9 A;  2KDK A;  3QP5 A;  2JKF A;  2WGW A;  4F3L A;  3A3F A;  2Z6C A;  3V3S A;  4IJG A;  4JF4 A;  3T1R A;  3NHQ A;  4KG2 A;  2YKF A;  4GJ4 A;  3WWX A;  2JCH A;  2WYX A;  1CEG A;  4DDY A;  3BY8 A;  4LRY C;  4M3K A;  1KE4 A;  5HDS A;  2V2F F;  2PYP A;  2R9X A;  5DKL A;  2IWB A;  1PI5 A;  2XLN A;  4OON A;  2JKT I;  4PM7 A;  5E2H A;  4NET A;  1ZKJ A;  4OLG A;  4DN0 A;  3CJM A;  1MZU A;  2JHE A;  3AGE A;  2OLV A;  1E4D A;  4LEN A;  1IYP A;  1JWV A;  2ZL1 B;  5L07 A;  4EBN A;  5DVA A;  1XJ4 A;  3U2A A;  3QP1 A;  1JTD A;  2VKS A;  2PRF A;  3CG5 A;  4D60 A;  1ES3 A;  2FFY A;  2HDS A;  5CGW A;  4L9E A;  1L2S A;  2PD7 A;  1BLH A;  1G5U A;  2PR5 A;  2WAE A;  2ZQ7 A;  1XGI A;  3TE8 A;  1W63 M;  5KSH A;  2ZC6 B;  3RXW A;  3G35 A;  2G7U A;  3MFX A;  3CLO A;  2DRW A;  1AXB A;  4WZ5 C;  4O0P A;  4X56 A;  3W4Q A;  4GN2 A;  1Y54 A;  5DJU A;  4H6J B;  5A90 A;  4OPY A;  3IXH A;  1YLW A;  3LUQ A;  3KSI A;  3LY4 A;  3GDI A;  4ETX A;  1Q2P A;  4HNB A;  4E3O A;  2VGK A;  1ES2 A;  1K54 A;  3BJN A;  3L9K A;  2K7S A;  4R6L A;  1O07 A;  2Z2L B;  2CC1 A;  4E3M A;  3CUE A;  1BZA A;  4LV2 A;  3LR0 A;  4Y2F A;  1OJ5 A;  3H7W B;  5J4E A;  4GD6 A;  3P98 A;  1NYM A;  3VSL A;  3GSG A;  1FCN A;  2XD1 A;  4EQI A;  3T4T A;  1V9Z A;  5DKK A;  3ZVW A;  2V1Z A;  3DTM A;  3KSH A;  3UY6 A;  1UWN X;  4I39 A;  5TFQ A;  3VP1 A;  3KSG A;  4WEJ A;  3BYD A;  3T1X A;  5EM0 A;  1DJA A;  5F82 A;  1KGF A;  4R0Q A;  4NXF A;  3UNW A;  5EUA A;  3E2L A;  4C75 A;  2PBD P;  3MS6 A;  2P04 A;  3F1N A;  4I3A A;  5L10 A;  4OKP A;  3HLB A;  4CPK A;  3Q81 A;  1JTG A;  2HGV A;  1O7E A;  4EER A;  4BBT A;  1Y4O A;  5CX7 A;  3MQQ A;  4F94 A;  1JWP A;  1JVJ A;  1FSW A;  4MN6 A;  2PR6 A;  4P6Z M;  5CED A;  1FR6 A;  3PAG A;  1W79 A;  4BD0 A;  1FCO A;  1TD5 A;  3BM6 A;  3C2W A;  3MKE A;  4KZ9 A;  4BQM A;  1ZHH B;  2V8C A;  2ACG A;  3D72 A;  4EET B;  3ITA A;  2PU4 A;  4BBV A;  2WZZ A;  1WYC A;  1BUE A;  1ZG4 A;  2W1T B;  1TVF A;  5FAO A;  2PU2 A;  1LHY A;  2JKG A;  4HI4 A;  3A3E A;  3DWZ A;  4DJ2 A;  3VE3 A;  1ERO A;  2QYB A;  2RL3 A;  3LIA A;  3F1N B;  2A3U A;  2WKP A;  2KLI A;  1YSQ A;  4DRT A;  3E0Y A;  3VFF A;  2W0N A;  1PRQ A;  3RTY A;  1TS0 A;  2V20 A;  1K25 A;  2PD8 A;  3QNB A;  4XXR A;  1YMX A;  1YLT A;  3ZNT A;  1TF1 A;  2IWD A;  3T4L A;  2PAV P;  3F1O A;  4EW7 A;  3BQ8 A;  1GHP A;  1YLZ A;  4JLF A;  3NDE A;  1NZU A;  4G3K A;  4IBR A;  2Z6D A;  1K55 A;  2DNS A;  4ZAM A;  5L09 A;  4CQH A;  3HLE A;  1MBL A;  5AQB A;  3VP3 A;  3SH9 A;  4KG5 A;  5FQQ A;  4DJ3 A;  5CTN A;  2NUT C;  2HJE A;  2ZMA A;  1E3U D;  2VJW A;  4HQA A;  4EBP A;  4KZ7 A;  3OPL A;  3PR6 A;  2Q0O A;  3HLF A;  4UAA A;  1IOU A;  1UWP X;  5G18 A;  3UB9 A;  4B88 A;  5E43 A;  3V50 A;  2C6W B;  2LB5 A;  3V39 A;  1FIK A;  2ZMV A;  4PKY A;  2AVX A;  4GDB A;  3UB6 A;  2O9C A;  1DJB A;  4DE0 A;  1S1Y A;  3NC8 A;  3AGF A;  2VGL M;  1YPR A;  3UN7 A;  4F3L B;  4NXE A;  3UPN A;  4PMA A;  4L9G A;  1BLC A;  3Q1F A;  3WRT A;  1K57 C;  3HLG A;  2HPB A;  4U3T A;  1MWU A;  5F5Y A;  1XJ3 A;  1PWC A;  1M40 A;  2L4R A;  1P9R A;  5A91 A;  1ACF A;  4LRZ E;  4NG2 A;  4GKU A;  2HJ9 C;  1GCE A;  2VX8 A;  5CHJ A;  3UPO A;  1V9Y A;  3MMH A;  1K4E A;  4NEE D;  4WEL A;  2W3D A;  3M2K A;  4FTX A;  5KIZ A;  1XP4 A;  2H28 A;  4IHQ A;  2MJ6 A;  3A0V A;  5U47 A;  1E25 A;  2BTF P;  1NJ4 A;  4U0T A;  2Y59 A;  4HH3 A;  3UB8 A;  3QHY A;  4KZB A;  2R78 A;  5I94 A;  3VP2 A;  3F1P B;  2J3T C;  2J8Y A;  3S7N A;  3HLC A;  3PTE A;  2KX6 A;  1N4O A;  1T19 A;  4Z1W A;  4ARZ B;  1NXY A;  1OTB A;  2VLG A;  5HX9 A;  3GMW A;  1KE3 A;  4DF6 A;  4R3J A;  2DMW A;  3LFV A;  1LL5 A;  3H7W A;  1XFN A;  3G32 A;  1HZO A;  2M7U A;  1H0M A;  2W3G A;  4KUK A;  3LY3 A;  2V0W A;  4YWZ A;  3T1Q B;  3UMD A;  4K0X A;  2QHK A;  1K56 D;  4GS9 A;  1BLS A;  1T18 A;  1L0F A;  2EX2 A;  5EVI B;  4YOF A;  3T1S A;  4B9O A;  2H0Y A;  4CLC A;  4S2J A;  3IHB A;  2WKH A;  1KE0 A;  4WL9 A;  4QHC A;  1L0D A;  2ZMF A;  2JE5 A;  3RFB A;  2PYR A;  1NWZ A;  2EWW A;  5EV0 A;  4E3N A;  2E8I A;  5CEC A;  3IXG A;  2QPN A;  3HJI A;  3KX0 X;  1SZV A;  4Y0O A;  3ZG0 A;  1PIO A;  1W7F A;  2ZLY A;  1K0K A;  1XJ6 A;  5DTT A;  4GLQ A;  4OPZ A;  4FD8 A;  2HF6 A;  5G4Z A;  3B47 A;  1CI9 A;  5CHM A;  3VOL A;  4OQH A;  3S22 A;  5CGX A;  2Y2K A;  3CPT B;  2GDN A;  1S66 L;  4CLC C;  1S4R A;  4DE1 A;  2ZOI A;  4Y0U A;  1CF0 A;  1MC0 A;  2J3W A;  5GHY A;  4K0W A;  1YM1 A;  2ZC4 B;  4WEK A;  3IX8 A;  3KYE A;  2BG1 A;  2X01 A;  2PHY A;  3EEA A;  5DF9 A;  3K2N A;  5CRF A;  5EVI D;  2JKR I;  2W1R A;  2WGV A;  3T4S A;  1OTI A;  4RX2 A;  3S7Q A;  3HUO A;  1E3U A;  2OLU A;  4BEN A;  4ARZ A;  4X25 A;  1ZG6 A;  2RCX A;  2H10 A;  4QPR A;  4X1L A;  1W8Q A;  5F1G A;  4Y5F A;  5HWW A;  1YT4 A;  3RH8 B;  1LSX A;  3V67 A;  3BLS A;  2D02 A;  2V0U A;  4E3K A;  5IS1 A;  2PT7 A;  4UHU A;  5L8M A;  4IVK A;  5HSQ A;  4JXV A;  2ZQC A;  2QKP A;  3Q07 A;  4ZTK A;  4YIN A;  3HVF A;  3O88 A;  3MBZ A;  3NCK A;  5A92 A;  4ZBE A;  2WUQ A;  2Y2H A;  3NOT C;  3HCY A;  1IKG A;  1GSX A;  5FEF A;  2OWJ A;  3UME A;  4HOI A;  1MXO A;  3ZG5 A;  4UA9 A;  3KYQ A;  1K56 A;  4HJ6 A;  3G31 A;  2LB9 A;  5FAP A;  3ZDJ A;  3HLW A;  3FPV A;  3MKF A;  1I2S A;  2BAS A;  4RYE A;  1MKI A;  1K6R A;  1S6R A;  5HPI A;  3GVB A;  4KZ3 A;  1T1B A;  2XSS A;  4JKT A;  4WM9 A;  4CJN A;  1G6O A;  1K6S A;  3QP4 A;  3EOI A;  3IS2 A;  1MWS A;  1G68 A;  1LSV A;  3T4J A;  1SKF A;  4E6W A;  1VM1 A;  4OP8 A;  5CGS A;  3N8R A;  4LV3 A;  4DKI A;  4DE2 A;  3ZVT A;  3DTE A;  3NOU C;  1GSW A;  1YKD A;  2UV0 E;  4P6Z S;  1CQA A;  1PNE A;  1GA9 A;  3IF6 A;  2GNX A;  1N9N A;  2P9V A;  4CLC E;  2XEP A;  2Q9N A;  2O99 A;  3H9W A;  2EA9 A;  1OME A;  2XK1 A;  4QB8 A;  4WMC D;  2Y4A A;  4FH4 A;  3CI6 A;  5EVE A;  3WS2 A;  4EBL A;  3D4F A;  4N1X A;  4GZB A;  2CMN A;  3HUM A;  4HBT A;  2WKI A;  2GX5 A;  1EI5 A;  1J3W A;  4EQ1 A;  1RGY A;  3S7P A;  3ZYT A;  2FFF B;  2O9A A;  3NI9 A;  4S2O A;  3SOI A;  5KSC A;  3G2Y A;  2Y2Q A;  4GW9 A;  4R70 A;  3PBT A;  1XA1 A;  1IFQ A;  2ZQD A;  2VGJ A;  1FCM A;  1ONH A;  4K91 A;  3VOY A;  3ULF A;  1OT9 A;  2OAP 1;  5LBR A;  3DTI A;  3VFH A;  5D3O A;  5DF7 A;  1D1J A;  3RXX A;  2J9P A;  2VEA A;  4MBH A;  1PFL A;  3IXD A;  5TGF A;  3OCL A;  4GHI B;  2XD5 A;  3NDG A;  4N92 A;  4DXB A;  2EX9 A;  3MXR A;  2WKQ A;  3VE4 A;  3LGO A;  2P7J A;  2J9O A;  3EEH A;  1KOU A;  3VP4 A;  1KGG A;  4UQI M;  5FSR A;  3ZHH A;  3LO7 A;  2ZBB A;  3PYP A;  5HAP A;  1DP6 A;  3IWQ A;  3FKV A;  4OOY A;  2I72 A;  1U60 A;  2PBY A;  3HJK A;  3FKW A;  4Y15 A;  3N4I A;  3LIC A;  2V1B A;  4WYY A;  1VEU B;  4OLD A;  4G3V A;  4CLC B;  2ZC3 B;  1AWI A;  1STZ A;  3OZH A;  2JKR M;  1IYS A;  2Q9M A;  5EVI A;  4QY6 A;  3VP0 A;  4P85 A;  4EEP A;  1G28 A;  5HFO A;  4P0M A;  4DXC A;  4JGP A;  4S2P A;  4MDZ A;  4Q0I A;  1G6A A;  4PKY G;  2NUP C;  2IA2 A;  4OVD A;  3MXS A;  2W27 A;  3BFD A;  2WAF A;  1A0K A;  1L3L A;  1H8M A;  3VSK A;  1YLP A;  3E4Q A;  5FQM A;  4HY8 A;  4Q0J A;  2HDQ A;  5C5K A;  4XT2 B;  3GV9 A;  2ZM2 A;  1ZTU A;  2P08 A;  4R23 A;  4HHD A;  2HP5 A;  2EX6 A;  1RCJ A;  3EGD C;  4B4Z A;  1W8Y A;  4FOF A;  3C4P A;  3UDF A;  3TRC A;  1NRJ A;  1JNU A;  2HP9 A;  4UA6 A;  1OT6 A;  2Y2P A;  2ZM8 A;  4JGR A;  3TG9 A;  3MR0 A;  2WKR A;  1GA0 A;  4XUZ A;  4BWI A;  3PXP A;  4Y17 A;  5CXW A;  4ZJ3 A;  3LYX A;  3HUN A;  3MSH A;  4GB7 A;  3BFF A;  4GCZ A;  1I2W A;  4EU0 A;  3B3X A;  5EOO A;  5HAQ A;  1OTD A;  5AVE A;  3UE3 A;  3EQU A;  1IYO A;  3IF5 A;  4OP5 A;  4S2M A;  4MCW A;  5GHX A;  3JYI A;  3IXB A;  2JKT M;  4II7 A;  4B4X A;  4BLM A;  1XPB A;  3C7U A;  3LEZ A;  5GLC A;  1HLU P;  2V9A A;  4N1H A;  3Q7Z A;  4PPR A;  3CAX A;  5FDH A;  5CHU A;  1OJG A;  3SW1 A;  4LCL A;  1XFQ A;  3O5Y A;  1ESU A;  3IT9 A;  3ZG9 B;  4I3J A;  3V5M A;  5FQJ A;  2QMI A;  5FQI A;  3MZD A;  3ZNY A;  3T12 B;  2WZX A;  4NK3 A;  2XRO A;  4ZJ2 A;  3NY4 A;  3R7W A;  4QY5 A;  4JBF A;  4MBK A;  4BMW A;  1H8Y A;  4JXG A;  5CER A;  4MNR A;  4ZRR A;  4E6X A;  5J3W A;  4MN7 A;  1SDE A;  1VQQ A;  3FZC A;  4O7D A;  4UQI S;  5TJJ A;  4Q8I A;  2JBF A;  3U4L P;  1XX2 A;  5GHZ A;  4C6Y A;  5EM1 A;  2GZA A;  4GOG A;  2OOL A;  3P09 A;  4Y3I A;  3C38 A;  1TS7 A;  1PI4 A;  4I3I A;  3BEB A;  1GSV A;  4YNR A;  5FQK A;  2VK3 A;  3MQ0 A;  1I5Q A;  1NLY A;  3IF6 B;  3G34 A;  4MN5 A;  4GHI A;  3FG8 A;  1LSW A;  3TSG A;  4KUO A;  3WS5 A;  1S1Z A;  3O3V A;  1S4S A;  1WA9 A;  2W3E A;  4I38 A;  5HAR A;  3OBF A;  3MQO A;  4KQR A;  3KYZ A;  5GL9 A;  4LV1 A;  3LIF A;  5AQA A;  2EXB A;  3C8C A;  3JVU A;  3UDX A;  4RA7 A;  2L0W A;  1BLP A;  3SZT A;  2ZM0 A;  1P97 A;  3BW6 A;  3LID A;  4HES A;  3PBR A;  3W2Z A;  3NUL A;  4Q0H A;  4HJ3 A;  3UPP A;  3JPU A;  1CI8 A;  5EVL A;  3IWO A;  2B18 A;  2P74 A;  4G3W A;  1N9B A;  2XA7 S;  1ES4 A;  1H5X A;  1MPL A;  3KO6 A;  4WMC A;  5HDD A;  3P7N A;  2EFX A;  3VOZ A;  2ZD8 A;  1CEF A;  3TW8 A;  5AQ7 A;  1LT0 A;  4FUW A;  3MZF A;  5FI7 A;  4QWO A;  3KSF A;  3IX4 A;  3L7H A;  4I5S A;  2Y8H A;  2WAD A;  1VET B;  3EQV A;  3V3R A;  1SCW A;  1SKO B;  2W1T A;  1MY8 A;  4OPQ A;  1RGZ A;  2Z2M B;  1EW0 A;  4DE3 A;  3I7J A;  3FPW A;  1XA7 A;  2HDU A;  1HD8 A;  5F69 A;  3M2J A;  3GQZ A;  4OPR A;  1Z09 A;  1BYW A;  3ITB A;  4WZ5 A;  4LGW A;  3A0R A;  3LCE A;  4H6J A;  1GHI A;  5EEC A;  3LI8 A;  3OPH A;  1NRF A;  3MXQ A;  3DW0 A;  3LEQ A;  4BL3 A;  3E98 A;  2PDR A;  4IBX A;  2ZC5 B;  2EFU A;  3WS4 A;  4R4R A;  4EXO A;  3C5A A;  1NZO A;  4E3J A;  4Z9Q A;  2HP6 A;  4XUX A;  1YLJ A;  3T4Q A;  4PM9 A;  5K5B A;  5A93 A;  4N9K A;  4OOM A;  1H8Z A;  2VV7 A;  4BBU A;  1WYB A;  2W3H A;  5IHV A;  4QD4 A;  1OPX A;  1NYY A;  5FAT A;  4KEN B;  4PM6 A;  1PZO A;  3PBQ A;  3O87 A;  1J9M A;  1H3Q A;  1HTZ A;  3N8S A;  4C3Q A;  5IU1 A;  2XR0 A;  5GLA A;  4A5R A;  5HWV A;  2INW A;  4M4X A;  2FZ0 A;  5MC7 A;  5HD3 A;  4OOL A;  4ID4 A;  4D2O A;  3BEC A;  4BJP A;  3UE6 A;  2K31 A;  2Y2M A;  1VEU A;  4HH2 A;  4JPM A;  3CUE C;  3NJA A;  4GNU A;  3EGX C;  3W8K A;  3K3C A;  3IBJ A;  2VZW A;  3HL9 A;  4WUJ A;  3P01 A;  1F5M A;  2J7V A;  1GHM A;  3SS5 A;  4E3L A;  4HIA A;  2OSU A;  1FOF A;  4K08 A;  4ESP A;  4E3I A;  5E2G A;  3FV7 A;  1CJF A;  3NOP C;  2V1A A;  5M18 A;  1IEM A;  3DWK A;  1C3B A;  1PW1 A;  3S4X A;  5HPF A;  2Y55 A;  5EOE A;  5AQ9 A;  4LV0 A;  3DAV A;  3CPT A;  5KMW A;  1L0E A;  3N6I A;  2H0T A;  5E2F A;  2Y79 A;  4MEZ A;  5DF8 A;  4IVI A;  3TJZ C;  5M1A A;  4QJG A;  1OTA A;  3LR5 A;  1KDS A;  4Y0T A;  3A3J A;  3NEC A;  5J8X A;  1W5D A;  3RJU A;  3ZCZ A;  2UWX A;  2ZQ9 A;  2HZ5 A;  1PZP A;  4BD1 A;  2L1M A;  4KZ5 A;  4P6B A;  4KG6 A;  5DJT A;  3CIT A;  3CZD A;  3HLD A;  2M7V A;  3LIB A;  5TBM B;  2H5S A;  1BTL A;  4LLO B;  1VB6 A;  5E2E A;  5GLB A;  3N8L A;  1LL8 A;  2P9V B;  5JYO A;  4KZ8 A;  3MFD A;  3E4P A;  3W4O A;  4R38 A;  4JGQ A;  3Q7V B;  4S2N C;  3BQA A;  2Y2L A;  2XFT A;  4WF0 A;  1VHM A;  3WS1 A;  4KQO A;  4N9L A;  2ZOH A;  3ZQ5 A;  3UE1 A;  5DTK A;  4IUH A;  2Y2G A;  2XF3 A;  3BFG A;  5HWT A;  1DRM A;  2EX8 A;  2DCF A;  5FEG A;  4R1G A;  3C7V A;  2JC7 A;  1MKM A;  3QP8 A;  5FI6 A;  3CMZ A;  2XH9 A;  2R9W A;  5DFX A;  3UB7 A;  5FAS A;  2XQZ A;  1VET A;  3G2Z A;  5GLD A;  2J3T D;  3LIE A;  4U0X A;  4OQ0 A;  4JF6 A;  3IWI A;  3GEC A;  4KQD A;  1KVM A;  1F2K A;  1WE4 A;  2WGI A;  5TR7 A;  1TEM A;  3Q7V A;  5HD5 A;  4EEU A;  1Z6F A;  2K2N A;  4JXW A;  2ZJ9 A;  4S2L A;  4ZDX A;  5CTM A;  3WS0 A;  4LPZ A;  1TDG A;  4L0L A;  3GRJ A;  5EVI C;  4KZ4 A;  4IUK A;  3AGD A;  2EWV A;  2VGL S;  2W3F A;  3O86 A;  4P87 A;  1SDN A;  4PM8 A;  3BLM A;  3IQA A;  1S0W A;  4OQG A;  1W63 Q; 
#chains in the Genus database with same CATH homology
 3M6H A;  4LEN A;  4JXG A;  5CER A;  1IYP A;  1CI9 A;  1JWV A;  4OQH A;  4X68 A;  5CHM A;  4MNR A;  3S22 A;  5CGX A;  4E6X A;  4EBN A;  2Y2K A;  5DVA A;  2GDN A;  2ZQA A;  1SDE A;  4DE1 A;  1VQQ A;  3FZC A;  3Q82 A;  1E4D A;  4Y0U A;  5GHY A;  1JTD A;  4O7D A;  3CG5 A;  4Q8I A;  2JBF A;  1XX2 A;  2Y2J A;  4K0W A;  1ES3 A;  2FFY A;  1YM1 A;  2HDS A;  2ZC4 B;  5GHZ A;  5CGW A;  4C6Y A;  1L2S A;  4WEK A;  3SH7 A;  1BLH A;  3WRZ A;  2BG1 A;  2X01 A;  2WAE A;  2ZQ7 A;  4GOG A;  1XGI A;  3P09 A;  5DF9 A;  3OPP A;  4HBU A;  4EV4 A;  4R3B A;  1K38 A;  4GD8 A;  5CRF A;  5KSH A;  5EVI D;  2ZC6 B;  1MWR A;  3NIA A;  1PI4 A;  3G35 A;  5EE8 A;  3RXW A;  3BEB A;  2WGV A;  4RVA A;  2DRW A;  1AXB A;  4RX2 A;  5F1F A;  5FQK A;  4WZ5 C;  3W4Q A;  4X56 A;  1I5Q A;  4GN2 A;  3HUO A;  4Y7P A;  1E3U A;  1Y54 A;  5A90 A;  3IF6 B;  3G34 A;  4OPY A;  3IXH A;  2OLU A;  4S2N A;  1YLW A;  1LLB A;  1PW8 A;  3LY4 A;  4BEN A;  1XGJ A;  3TSG A;  1EWZ A;  3IF6 C;  1ZG6 A;  2RCX A;  3WS5 A;  4ZJ1 A;  1Q2P A;  2H10 A;  3O3V A;  4E3O A;  1W8Q A;  5F1G A;  2VGK A;  2OV5 A;  4EUZ A;  5HAR A;  1ES2 A;  2EXA A;  4KQR A;  3PBN A;  5GL9 A;  1K54 A;  4LV1 A;  1YT4 A;  5AQA A;  1O07 A;  3BLS A;  2Z2L B;  3SH8 A;  2EXB A;  2CC1 A;  4E3M A;  4E3K A;  2G2U A;  1BZA A;  4LV2 A;  1ALQ A;  1PYY A;  3BFC A;  3UDX A;  4RA7 A;  4UHU A;  3W4P A;  1FSY A;  1BLP A;  4IVK A;  4JXV A;  1QMF A;  2ZQC A;  2ZM0 A;  3Q07 A;  4ZTK A;  4YIN A;  1CK3 A;  3HVF A;  3O88 A;  3MBZ A;  4HES A;  3NCK A;  3PBR A;  4GD6 A;  3P98 A;  5A92 A;  3OPR A;  4ZBE A;  1NYM A;  3VSL A;  2WUQ A;  2Y2H A;  3GSG A;  3C4O A;  1FCN A;  2XD1 A;  1IKG A;  3UPP A;  4EQI A;  1CI8 A;  1YQS A;  5EVL A;  1LI0 A;  3VMA A;  4S2I A;  1MXO A;  3ZG5 A;  3HBR A;  3IWO A;  4UA9 A;  4FSF A;  3ZVW A;  1K56 A;  3FYZ A;  2V1Z A;  3DTM A;  2P74 A;  4RX3 A;  3UY6 A;  3G31 A;  1N9B A;  5M19 A;  5TFQ A;  1ES4 A;  3VP1 A;  4YFM A;  5FAP A;  1H5X A;  1MPL A;  3HLW A;  3ZDJ A;  4WEJ A;  3BYD A;  1NY0 A;  1DJA A;  4WMC A;  1Q2Q A;  2A49 A;  4EWF A;  3MKF A;  1I2S A;  2EFX A;  5F82 A;  1KGF A;  4HEF A;  4R0Q A;  3VOZ A;  2ZD8 A;  4RYE A;  1MKI A;  1CEF A;  1K6R A;  1S6R A;  3HRE A;  5AQ7 A;  3GVB A;  5EUA A;  3UNW A;  4KZ3 A;  3E2L A;  3MZF A;  5FI7 A;  1PWG A;  4C75 A;  1RP5 A;  4JKT A;  4WM9 A;  4CJN A;  1K6S A;  1YLY A;  5HAI A;  2WAD A;  1MWS A;  3EQV A;  1G68 A;  3V3R A;  4OKP A;  3HLB A;  4CPK A;  3Q81 A;  1JTG A;  1SCW A;  1MY8 A;  1SHV A;  3NBL A;  4OPQ A;  1RGZ A;  1SKF A;  1O7E A;  4E6W A;  2Z2M B;  1VM1 A;  4DE3 A;  1ERQ A;  1ESI A;  3I7J A;  4OP8 A;  1XA7 A;  4F94 A;  1JWP A;  2HDU A;  1HD8 A;  3M2J A;  1JVJ A;  1LL9 A;  5CGS A;  3GQZ A;  4OPR A;  1FSW A;  3N8R A;  1BUL A;  3ITB A;  4LV3 A;  4R4S A;  4WZ5 A;  3ZG8 B;  3MZE A;  4DKI A;  3LCE A;  3ZVT A;  4DE2 A;  1GHI A;  5EEC A;  5CED A;  3OPH A;  1FR6 A;  1NRF A;  4WZ4 A;  4DDS A;  3DW0 A;  4BL3 A;  5DTS A;  3PAG A;  4IBX A;  1W79 A;  2ZC5 B;  4BD0 A;  2EFU A;  1GA9 A;  3WS4 A;  3IF6 A;  4UA7 A;  4S2K A;  4R4R A;  2P9V A;  1FCO A;  3BM6 A;  3C5A A;  1NZO A;  3N7W A;  3E2K A;  4E3J A;  3MKE A;  4KZ9 A;  4Z9Q A;  1L0G A;  1KGE A;  2XEP A;  2Q9N A;  4BQM A;  2Y2O A;  4X55 A;  1OME A;  4IED A;  1BSG A;  2HP6 A;  2XK1 A;  4XUX A;  1YLJ A;  4QB8 A;  3ITA A;  4PM9 A;  4WMC D;  2X71 A;  5A93 A;  1K57 A;  2XDM A;  4N9K A;  4KZ6 A;  2PU4 A;  4OOM A;  2Y4A A;  1H8Z A;  3G30 A;  4FH4 A;  2WZZ A;  3G4P A;  1WYC A;  3WS2 A;  4EBL A;  1WYB A;  3D4F A;  4N1X A;  1BUE A;  1ZG4 A;  4GZB A;  4QD4 A;  1BT5 A;  1TVF A;  3HUM A;  4HBT A;  2WKI A;  5FI2 A;  5FAO A;  1EI5 A;  1NYY A;  2PU2 A;  1LHY A;  5FAT A;  5FQ9 A;  3SS3 A;  4KEN B;  3A3E A;  4PM6 A;  3DWZ A;  1PZO A;  1RGY A;  3PBQ A;  3O87 A;  4WBG A;  3BFE A;  1ERO A;  1J9M A;  1HTZ A;  2C5W B;  2FFF B;  2RL3 A;  3N8S A;  4C3Q A;  3NI9 A;  4S2O A;  3SOI A;  2A3U A;  2XR0 A;  5GLA A;  4A5R A;  3G2Y A;  5KSC A;  2Y2Q A;  5EPH A;  1ES5 A;  4DRT A;  4FCF A;  3VFF A;  3PBT A;  2WK0 A;  3IHA A;  3PBS A;  1XA1 A;  3UO9 A;  2ZQD A;  4OOL A;  2VGJ A;  2V20 A;  4KQQ A;  1FCM A;  1K25 A;  1ONH A;  3QNC A;  3QNB A;  4ID4 A;  4K91 A;  4XXR A;  3VOY A;  4D2O A;  1YMX A;  3BEC A;  4BJP A;  1YLT A;  3ZNT A;  2Y2M A;  3UDI A;  4H8R A;  1MWT A;  2IWD A;  2B5R A;  1JWZ A;  3OCN A;  1ONG A;  3VFH A;  1HVB A;  5D3O A;  1GHP A;  1YLZ A;  1YMS A;  4JLF A;  4JPM A;  5DF7 A;  3RXX A;  3NDE A;  1NZU A;  1XXM A;  2J9P A;  4GNU A;  4IBR A;  3W8K A;  1K55 A;  2DNS A;  4MBH A;  4ZAM A;  3IXD A;  5TGF A;  5F83 A;  3OCL A;  2XD5 A;  3M6B A;  2ZC7 A;  3HLE A;  1MBL A;  3NDG A;  4N92 A;  5AQB A;  4MBF A;  2EX9 A;  3VP3 A;  4DXB A;  3SH9 A;  3HL9 A;  3MXR A;  5HW3 A;  4KG5 A;  5FQQ A;  4X53 A;  5CTN A;  2J9O A;  1PWD A;  3BRM A;  2Y2N A;  2J7V A;  3ZG7 B;  2ZMA A;  1GHM A;  1E3U D;  3SS5 A;  4E3L A;  4EBP A;  3VP4 A;  1KGG A;  2OSU A;  4KZ7 A;  1FOF A;  2Y91 A;  4PM5 A;  3OPL A;  2G2W A;  4GDN A;  3HLF A;  2QZ6 A;  4UAA A;  5FAQ A;  5FSR A;  5JYP A;  2HDR A;  4JF5 A;  5G18 A;  3ZHH A;  4E3I A;  5E2G A;  3LO7 A;  3FV7 A;  4B88 A;  5E43 A;  5HAP A;  5FA7 A;  3IWQ A;  3V50 A;  5IHV A;  2C6W B;  5M18 A;  1IEM A;  3DWK A;  3FKV A;  4OOY A;  1C3B A;  1PW1 A;  2I72 A;  3S1Y A;  3V39 A;  1U60 A;  2PBY A;  3S4X A;  2Y55 A;  3FKW A;  4OQI A;  5EOE A;  5AQ9 A;  2XFS A;  4GDB A;  3N4I A;  4LV0 A;  3UE0 A;  4WYY A;  2ZQ8 A;  1DJB A;  1QME A;  4DE0 A;  5KMW A;  4OLD A;  1IYQ A;  1L0E A;  3AGF A;  3N6I A;  3NC8 A;  2ZC3 B;  1DY6 A;  3SS4 A;  3UN7 A;  2H0T A;  1XKZ A;  3OZH A;  3UPN A;  5E2F A;  1IYS A;  2Q9M A;  4MEZ A;  5EVI A;  4PMA A;  4QY6 A;  3VP0 A;  4P85 A;  5DF8 A;  4IVI A;  1BLC A;  3Q1F A;  5HFO A;  3WRT A;  4P0M A;  5M1A A;  4DXC A;  1KVL A;  4QJG A;  4S2P A;  3ISG A;  1K57 C;  3HLG A;  1G6A A;  1KDS A;  2HPB A;  1K4F A;  4Y0T A;  5CEB A;  3A3J A;  3OC2 A;  4U3T A;  5J8X A;  1W5D A;  1MWU A;  3RJU A;  4OVD A;  2UWX A;  3ZCZ A;  2ZQ9 A;  3MXS A;  1PWC A;  1M40 A;  3BFD A;  3A3D A;  3ZFZ A;  5A91 A;  2WAF A;  1PZP A;  4BD1 A;  5L2F A;  2Y2I A;  3FWL A;  3VSK A;  4KZ5 A;  1YLP A;  5FQM A;  4GKU A;  4P6B A;  2HDQ A;  4KG6 A;  3IH8 A;  4BL2 A;  3GR2 A;  3GV9 A;  2ZM2 A;  4JXS A;  3CZD A;  1GCE A;  3IH9 A;  4R23 A;  1K54 C;  3HLD A;  5CHJ A;  1IEL A;  2HP5 A;  2H5S A;  1BTL A;  2EX6 A;  4KZA A;  1IKI A;  3UPO A;  2WKE A;  1RCJ A;  1KDW A;  2WGW B;  1K4E A;  5E2E A;  4WEL A;  2BLS A;  3A3I A;  3M2K A;  1W8Y A;  3N8L A;  5GLB A;  3C4P A;  4B4Z A;  3UDF A;  2P9V B;  4QU3 A;  5JYO A;  4KZ8 A;  1XP4 A;  2HP9 A;  4UA6 A;  3MFD A;  2Y2P A;  1ZC2 A;  3W4O A;  2ZM8 A;  3Q7V B;  5U47 A;  4S2N C;  1E25 A;  3TG9 A;  1GA0 A;  4XUZ A;  3PAE A;  2Y2L A;  1NJ4 A;  1FQG A;  2XFT A;  4U0T A;  3PBO A;  2Y59 A;  3WS1 A;  3TOI A;  5CXW A;  3QHY A;  4ZJ3 A;  4KZB A;  3HUN A;  4KQO A;  2X02 A;  3ZGA B;  4N9L A;  4GB7 A;  3BFF A;  4X6T A;  1M6K A;  3UE1 A;  1I2W A;  5DTK A;  5KZH A;  2Y2G A;  3B3X A;  4OH0 A;  5EOO A;  2XF3 A;  3BFG A;  5HAQ A;  5BOH A;  5I94 A;  3VP2 A;  1K55 C;  2J8Y A;  2EX8 A;  2XGN A;  1TDL A;  2DCF A;  2IWC A;  3HLC A;  3PTE A;  4R1G A;  1N4O A;  3C7V A;  1DJC A;  2JC7 A;  3UE3 A;  5FI6 A;  1FR1 A;  3EQU A;  1IYO A;  3CMZ A;  3IF5 A;  1NXY A;  4FH2 A;  2XH9 A;  4OP5 A;  4X69 A;  2R9W A;  1LI9 A;  4S2M A;  5HX9 A;  3GMW A;  5FAS A;  5GHX A;  1KE3 A;  4DF6 A;  3JYI A;  3IXB A;  4R3J A;  2XQZ A;  3G2Z A;  5GLD A;  1LL5 A;  5HL1 A;  3G32 A;  4U0X A;  1HZO A;  4MLL A;  4OQ0 A;  4JF6 A;  4B4X A;  4BLM A;  1ERM A;  1XPB A;  3LY3 A;  3C7U A;  3IWI A;  4LCM A;  1KVM A;  3LEZ A;  4K0X A;  5GLC A;  3GTC A;  4N1H A;  3Q7Z A;  4PPR A;  1WE4 A;  1K56 D;  2WGI A;  5TR7 A;  1TEM A;  3Q7V A;  5FDH A;  5CHU A;  1BLS A;  2EX2 A;  1L0F A;  2WGW A;  3A3F A;  3V3S A;  5EVI B;  4JF4 A;  1Z6F A;  4LCL A;  4JXW A;  2ZJ9 A;  4S2L A;  4ZDX A;  2H0Y A;  5CTM A;  3WS0 A;  1ESU A;  3IT9 A;  1TDG A;  4L0L A;  4KG2 A;  3ZG9 B;  4S2J A;  3IHB A;  3GRJ A;  2WKH A;  5EVI C;  2JCH A;  3WWX A;  2WYX A;  1KE0 A;  1CEG A;  4QHC A;  1L0D A;  2JE5 A;  4KZ4 A;  5FQJ A;  3V5M A;  4DDY A;  4E3N A;  2E8I A;  2QMI A;  4M3K A;  5FQI A;  1KE4 A;  3MZD A;  5CEC A;  2V2F F;  2R9X A;  3ZNY A;  3AGD A;  3IXG A;  2IWB A;  1PI5 A;  2QPN A;  3O86 A;  2XLN A;  2WZX A;  4NK3 A;  4OON A;  4P87 A;  4PM7 A;  4ZJ2 A;  1SDN A;  3NY4 A;  4PM8 A;  4Y0O A;  4NET A;  5E2H A;  3ZG0 A;  1PIO A;  1ZKJ A;  1W7F A;  2ZLY A;  4OLG A;  3BLM A;  4QY5 A;  5DTT A;  3CJM A;  3IQA A;  4OPZ A;  4JBF A;  4MBK A;  1S0W A;  4OQG A;  4FD8 A;  1H8Y A;  3AGE A;  2OLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...