3QHZH

Crystal structure of human anti-influenza fab 2d1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
232
structure length
222
Chain Sequence
EVNLRESGPALVKPTQTLTLTCSFSGFSLSTSGMSVSWIRQPPGKALEWLALIDWDDDTYYITYSSSLKTRLTISKDTSKSQVVLTMTNMDPVDTATYYCARTLRVYVRDFDLWGRGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An insertion mutation that distorts antibody binding site architecture enhances function of a human antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Human monoclonal antibody del2D1, Fab Heavy Chain
total genus 40
structure length 222
sequence length 232
chains with identical sequence I
ec nomenclature
pdb deposition date 2011-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qhzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qhzH01
5IJKA 4YIQA 4OZIF 1FZJA 2NY2D 4WU7A 5C3TA 4UV4H 1LO5B 5FUCC 4H1LB 1KC5H 1X5YA 1N2RA 4OV6F 1D9KD 4OFKA 3L5XH 5E4EB 3QEGH 3TH4T 2FHBA 2IADA 2H1PL 2X9YA 4OCRL 2BY3A 1ACZA 1KLUB 3AB0C 2PO6A 4X6DE 2YRPA 5D1XD 4ZSOE 3SKUD 4I77L 1X5HA 1T2JA 3SO3B 4O02H 1QVOA 2VN7A 3SDDC 1YMMB 4J1UB 1CFSB 2YN3A 3VXUB 2GCYB 3SKJH 4BUGA 5K9JL 3RWIB 3M45A 3BN9D 1FVEA 3UPRA 4PRIE 4XNXH 1C08B 2GSGB 2DLIA 5BS0A 5HVFB 1IGCH 3P73A 2EIDA 1VFMA 5HJ3B 1D3CA 4G8FA 4YHIA 7FABL 4G7YL 2JE8A 4HUXB 4QRQA 3UYPA 3VFGL 1BVLA 1G1YA 2XNAB 2R0LL 3ZDYF 4XMPH 1ZHNB 1UWGH 3WD5L 3HNSH 1G6RH 4AM0B 5DR5L 3ARPA 1FGNH 1SMOA 3HZYB 1DBMH 2IAMC 3IGAA 4PBWD 2YMXL 5DEFB 5F88B 5MEPA 3EW3B 5EU4B 3DBXB 2IPTH 3S5LG 3GMMB 1RD6A 3BZ4A 4HG4K 4Z5RA 4MDIB 2Z91B 3C5JA 1Z2KA 5BVPH 1M4KA 3OTTA 5D2LA 5E1HB 4L4TE 1T7VA 4LCYA 5GS0D 4HZLA 3UTQA 4ZFOL 2GFBB 1B0GB 3LEVL 1JI2A 1ZEAL 1KTLB 4RGNB 4ZUTB 4BFIB 4LSDA 2PCPA 5JHLL 3MACL 3BPLB 1LD9A 1A7OL 1EEYB 3IKKA 2YBRA 4KC3B 4Z7NE 4WFFE 2DJ4A 4LPTA 4WJ5B 2NPLX 4PJDA 3MRRB 1D6EB 1XR9B 3EYVA 5ICZA 1FO0B 3OKKA 5E5MB 1QBAA 1MIEH 2FDBP 3GMLB 2YD2A 3PHQB 4Q58C 2CK0L 5CD3A 3EDEA 2R0KH 3N1MC 5I73B 1BD2B 3BDYH 5D96B 1IMHC 1DFBL 3LQAL 4PY8I 4P2OB 1OGTA 4WO4C 3RL1A 4LQFH 3O8XB 4Z78B 1E4WH 2CKNA 4M6ML 5DEFA 1N3NB 5H8DA 1VACA 2ILLA 1F02I 3GMNB 4JFEE 4XNYL 1AGCA 1YYML 3V6OE 2C26A 2R8SH 2YPLB 1TJIL 4JFDE 1MJUL 2O5XH 4KJPC 2B20A 3KNBB 4WUUE 1KCUH 4XRCA 2P43B 1DUYA 3MGAA 4D3CL 3ULUD 3EAKA 4KK8D 3WFDL 1E27A 4S1RL 1YN7B 1KJMB 4E0RB 1J12A 5B4MC 2YD7A 3UTSE 3ZKSD 4YHKL 3O6FB 1DQLL 1JPGA 3PGFH 2NXZB 5F6IC 3CXHJ 2WBJD 4PGJA 4LSSH 3IFOA 3BPOB 1NL0H 5IEKB 1RZGB 3LIZH 1TCMA 3ARDC 4L9LA 3HRZB 1CQYA 3RTQB 5JIPA 4JANB 5B8CB 3UZVB 4RFOH 4M5ZH 4YHKH 4NQSB 3RL2B 1C5CH 3QH3A 5E8PA 3D2UD 3TH3T 2VC2H 4MAUL 3IFLL 1WBXA 5D7LE 2VDRH 4OGYL 5F3BA 1OGTB 3ZO0A 4M5ZL 1KB5H 4EI5B 4F3FB 1FNEB 5IHBA 2OR7A 3CNKA 1UXSB 4K2UH 5C0IA 3D25A 1RULH 3D3VB 2A6JA 4I3GA 3FO0H 1FLRH 1ZS8A 1H3UA 4R26L 3VXQA 1FVDA 2C4FU 5L2KD 2YUXA 3RWFB 3BQUB 2YOCA 5DT1L 4HUWA 3VXSE 2D4DA 1QA9A 3E2HC 4F57H 2W65B 1FJ1A 1Y6MR 5IWLC 3GMQB 3MRCA 4PGCB 3RWGB 4HIIB 4NOFA 1CICD 4JG0L 4KVNL 4F80A 3AFLA 4LCWB 2VNCA 1MIEL 1N0XH 1BQHB 1X5JA 3QDGA 1MJ7L 1QACA 4GKZB 1RUAH 3BPCA 3QIWB 1E6OH 4CAGA 3MLPA 1NAKL 2IBGA 4WI2A 2AJVH 3CD4A 3GRWA 2FH6A 1N64H 4R4BA 4W4OA 4MZ3A 5ITFB 1NC2D 4U7MA 5DJZB 3LN5A 4LDLB 1NCBH 5CWSB 3VFNB 4ONFH 3BMVA 1C5BH 1ZTXL 3QXVA 4HK0B 4RMVA 5TDOB 2HT3C 4ODTL 3MTRA 4GAJH 1PAMA 1MY7A 1QEWB 5JQHC 1OSZA 1MFAH 2D0GA 4EUPA 3Q6GL 5IHLB 3ZLQC 3LEYL 1TJHH 4XBPA 2I25N 4NYLB 4ZUSB 3RI5K 4QF1A 1A7QL 2VQTA 3IDXH 5B39B 3H3BC 1A6AA 1K6QH 4D0DA 5CJQH 3QXTA 4HIIA 3BEWB 3GSNL 1FC1A 1VEMA 5FF6A 4K7FB 3BEVB 4EUPH 3VXRE 5BVPL 2D9QB 4JCMA 3GMOA 3D5OF 2AXGA 3O9WB 2DIJA 2ICCA 2MOVA 2EKSB 4BKLA 3G5ZB 2ESVB 2NW3A 3MNWA 2BNQA 1T1WB 2D31A 4GKSB 2BVYA 3VFPA 4OD3H 4MJID 3LB6D 3ARGB 3L7FA 1U8OB 4Z8FH 5D5MA 4ZPVA 1I3RA 4PJBE 4CVZB 3R06A 7FABH 1E4XL 1NANH 2R2HA 4PG9A 3WYRA 1KBGH 4PIRF 2VDPL 1DEDA 2CMRL 3NIFE 5IJKC 3ULVD 4DJMA 1I7ZB 3H42H 3RIFK 4Q9CA 5CZKA 1XGRA 4M03A 2MHAB 2XZAL 3TA3D 2BNUA 3BD3A 3EFFB 3O4LB 4PJFF 5C0RL 1QR1A 3VXNA 3CXHK 4HWNA 5AAWA 2Z8SA 2FIKB 2JIXD 5HHOB 2N7BA 3LPGA 5DUBA 3DYPA 3V4PL 1I3UA 3GMOB 1RU9L 3K1DA 4KMTH 1LD9B 2OR9H 4HT1L 4R26H 1F6FB 2FX7L 4LLYB 4B41A 1GOHA 4WNQB 5FYKD 2E8YA 4KK5C 2R4RH 2XRAL 4NT6B 5IMKB 4K94H 1LO2L 2A9ML 4HPYH 1CXEA 2VLJD 5D5MB 1HI6B 1H3TA 1IFHH 3D6GA 4M6OH 3REWA 3QUZD 2HLFC 3NPSC 4FQJL 3ZYJA 1NFDF 1DQML 3F65A 3LEXA 3IU4L 5L0QB 4HWUA 3IDGA 2EH7H 4W6YB 4UQ3B 1IBGL 1KIQA 1A5FL 3JUZA 5GGRY 4ODBD 4JHWL 5GGVY 3VWKC 2X4RB 2NY0C 3DUSB 3OR6B 2NX5E 4XI5D 3AMKA 4TTDC 3MLZH 4YBLC 1AD9B 1AGEA 4B5EA 3BYYA 2Q8AL 2X5PA 3Q5YA 4JRYE 4YC2B 3ES6A 1FFRA 3UYRL 2ID5A 1I8MA 1CVSC 3MYJB 3FT2A 4PRPD 4G8GA 4YO0B 5I1KH 5J57B 5DI8B 1Z9SA 1OQXA 1T1YB 1P1ZB 3L3GA 2VDQL 4ENEC 4ODSL 4FMKA 2FJFA 1JPGB 3D2UA 3FQUA 2MCG1 2IANE 4HIJB 5GJTL 4DUWA 5FAAA 1S8DA 4ELMB 3QG7H 1CQKA 4Y8AA 2BMKB 4J3OC 4YXKL 2XXCB 3MV9D 2QL1A 1GGTA 2PF6A 3G6JF 4NNYA 3I6KA 5F7WC 2AK4E 5BZWA 5KSAB 3SN6N 4AEIH 5JOPE 4NZJA 1QFOA 2WWMD 5GGVL 5FA4B 1CLOH 3OB8A 4PJCF 4JO4H 2FX9L 1K4CA 1NC4B 1I8KA 1HXYB 2R4RL 3VFOB 3BHBA 3RTQC 1PY4A 1QBLL 3ARDB 4MD5B 4PJCA 1MNUH 3FFCD 3QZWA 3CFEA 4KMTL 5IG7A 5CBAB 5I17A 3IJSA 4NNPL 1JHLL 1AY1L 1X5ZA 4X6FA 2YZ1A 2H26A 2PUQT 1Q8MA 3MPCA 4LFHG 1SHMA 5D2NB 1WTLA 3FFDB 1NGZA 5H94A 4QOKE 1GSMA 2G60H 4PJHE 5FHAL 4HC1L 3DVNB 3KPPA 1CLYL 3TA3A 3V9FA 4JPIA 3HZMA 4UDUA 4HKBA 4JY6B 3O6ML 2AXGB 4GW5B 3T08A 3B9EA 4OTXL 3HUJE 5DURB 3KJ4C 1TETH 1YNLH 1ADQA 3PV7A 1JHTB 4B0MM 3E0GA 3P4LA 4R4BB 4TUKL 4G7YH 5E2WL 1LE5B 5IBLD 3HI1B 3TP4A 2ZG2A 3TVMB 3QO0B 1AGFB 1IC7L 1CL7L 2APFA 3QWOA 3C5JB 3MREA 4NM4L 3TA3C 5EO0B 3SKJL 3Q5OA 2R0WL 4PJIF 5HHVL 2O61A 4F33A 3NCJL 1OWWA 1NAMH 3G5XA 1BF2A 1J1PH 1OP5H 3QI9C 4X9IA 6CGTA 1JYXA 4YWGH 4XAKD 1AHWB 4TNVK 5JW3H 1IGJB 2VR4A 4O00A 3FQWB 3VXRA 2V2TA 2GK2A 2VMFA 2BRRH 3FO9A 1JCKA 1YNTB 1AO7D 4F9LA 1MRFL 3EYUL 1ZHBB 3QIBB 1BQUA 1ERNA 1U3HC 3QB7C 4YDLB 1KC5L 3CXDL 3QXUA 3RVWC 4HC1H 1XF3A 4ZAKB 3OJDA 5L88L 1C5DA 2FYYB 5EIQA 1I7UB 2HG5B 5CHNB 3MRQA 1XR8A 4NT6A 5JO5B 5DVKA 3S88L 1P4LA 1WLHA 4MQ7B 1G7HB 5E6YA 3RP1A 5EDXA 1D5BB 1IM9D 4DVBA 1BVKB 3EO0A 3THML 3G04A 4DN4L 1QBLH 2ZOKB 4IOFC 3V6BR 1G9ML 1YEJH 1LDPL 3WDHA 3FAXA 4NJ9L 5D8JH 1DBAL 5GGTH 4BQBA 2Q6WA 4PY7B 2BC4A 4X0KB 5FO8A 5GS0C 1J0KA 4U6HB 4J4PC 5D1QA 5CSZA 3MV7D 5C1MB 1A1NA 3ILPA 2H32B 4DCQA 3TIEA 2Q7YB 4GS7C 1B0RB 1CFSA 5D9SA 2ADFL 3G6DL 4LMQI 3V0WL 1NLDH 1QBMH 4PJEA 2CK2A 3IAGC 4NGHL 1Q0YH 3R1GH 5K9OA 2HKHL 4JANA 5E4EC 5HYSB 1CXFA 1IE5A 3NFNB 1RULL 2OTPA 2Q20A 2BRRL 2X4PB 5EZLB 5AAMA 2QEJA 5JMRA 2V7NA 2BCKB 3O6KH 4PRPE 3NCEB 5DUPH 4R3SA 4HXAL 3PUCA 2EYTA 4HMDA 4LGPB 4BH7A 3NACH 4GXVL 5FGBA 3KR3L 3C5SB 5CSGA 3OKEA 3UYRH 3U7YL 3C5ZB 3S36H 5HHMD 4IMLA 3TZVD 5C0DB 3WIFB 1DEEB 3DSFL 5D71L 2XZQH 4RAVB 4WW2F 4APQC 4ORGA 1WZMA 1PY9A 4OUUA 5TE4H 2QADD 5IBTL 2RR3A 4ZUTA 5C0BD 2DM4A 3NZ8A 3C9NB 2DJSA 4C56A 1R5WB 5INCA 1X6NA 5DRWA 4PJAB 3QEQB 1TTUA 3W39A 1ZANL 3LRGA 5I15H 3KLAA 4FA8A 1JWSA 2QHRH 4LF3B 4F7PB 4MWFA 4DVRH 1FORL 5FYKU 3RWCA 5GS0H 4OIAA 5AYUL 5DYOA 4LCWE 2Q3AA 1NGXA 2DI7A 1J8HB 3KYNA 4M7JH 5DQDL 5JLZB 4X7TB 1WBYA 3UTOA 3FFCA 4KDTC 3VW3H 2PTVA 4NFBA 2R39A 1T5WA 2IF7A 2AK4A 1FN4B 4HMEA 1WBXB 1ES0A 4XPAL 5KTEL 1QQDB 3STLB 2XZZA 3EJJX 3PL6A 1CLZH 2ZJSH 4G5ZL 4YXHH 2UWEA 5E24E 4F7TB 1XF1A 1YEKH 1P7QB 1RZIA 4RFEA 3MRIB 4Y16C 3CSYB 1NGQL 3FRPA 3QO0A 1PYWB 4PJCE 1ZANH 1D6VL 5T5NF 3HMXA 3LN9A 3MA9L 3QIWD 1A6AB 1CLOL 2W65A 5FIEA 3QIUA 4XC3H 2COQA 5M95B 3VRLE 4I5BB 1NMBL 5JHLH 1DANU 4HAFA 4E41D 2CO6B 4Y4KA 2GT9B 4CW1B 5I8CB 2B4CL 2XPGA 3NPZB 3FN9A 1ZKAA 1G9NC 1ZT7A 5F9WB 3OG6B 1NMAH 3VGBA 2EIZA 4A6YB 3WJJA 2AJYH 5H94B 5C0NC 1Y6NR 3QIWC 4D9QE 4X6CB 4K23L 3OF6D 5IB2B 4RGMB 3DVNA 1UB5A 2P49B 3QXAA 4FNLH 5I18H 3WNNA 2DQGH 1PLGL 2VSDA 4J4PA 1FGNL 1F3JA 3KPLB 2VWEC 3T4AB 1SY6H 4PRHA 4G8FB 1ZHKB 4YHIB 3UDWA 2QKIA 5T1KA 2W0LA 3I6LE 1BJ1J 3L9RA 4PGDA 4LKCB 1B4JH 4YDJB 3OAYK 3UPAA 5C09E 1F2QA 1KTDB 4IOIA 4NN6C 2XTLA 4XCNB 1TFHA 3MBEA 1VGKB 2IJ0C 5TQ2H 1MLBA 1K3ZA 3OX8A 4X80H 5SWSB 1XIWC 2ZKHL 5CP7B 2HFFA 3IU4H 5FDWB 3PV6A 3PIQB 2UVFA 3ESUF 4Y2OA 5HYSG 3UTQB 3I50H 2VXQL 4Z7WE 1WGOA 3RX5A 4R90L 2XTJD 4KV5F 3WHE1 5CILH 5F96H 3KLDA 3WL9A 4I3SH 4K94L 3TIEB 3KPRB 5C86A 1MCPH 3FO9B 4GG6A 1ZHLB 3ZTJG 1X3DA 5IGXL 1U3YA 3PHQA 4V1DE 3L1OL 1SMAA 3D39B 5H37G 4ZQKA 3MV7E 4ZUWB 5DMYA 2MNUA 2D03L 1MFDL 5IBUB 3BKMH 1C8PA 1YEGH 3DRTA 4JQIL 3W0WA 3O8XA 1UXWA 3RWHB 3ARFA 3V79C 1KXVC 1IGIL 3U9PL 4L4TA 4P5MB 4OLWH 4U0RC 1B0GA 2XV6B 1GPOL 5CJ5A 2GW5A 4XXCA 4QRPA 4Y4FC 1IM3A 3HI6H 5EBMB 3G9AB 3X13A 4APQB 1G6RA 5ALBL 2P48B 3WXWH 5H2BB 1T5XB 1OP3K 3RDTA 2VQ1B 3Q0HA 4W6XB 4L8SA 3ROLA 4NWTL 3WHE0 4V2BA 5IB4A 1QSED 3IDUA 2A0LC 2P44B 1ZA6B 4C56E 1SBSL 1E28A 4MAYB 3SJVA 3WNPA 4M8VA 1A6TA 2Y36L 2E9JA 4JFDD 2OR8A 3GSNA 2HTLC 2WV3A 4OZIE 2Z31D 3AGVA 4PP1C 1ORSA 4GAGH 1CN4A 4NUJB 3M17A 3RWDA 4RX4A 4L3CB 4LGRB 2X7LA 4OLUH 4FQLH 3U46B 4G6KL 4Z7WF 3BP6B 4LCIH 1IGFH 1NGPL 5CP3H 3DSNA 1MEXH 3LSOA 1Z3GH 1FC2D 3IDNB 1K85A 4AIXA 4QTHB 5HYQB 3WIHH 4FNLL 1O0VA 5I18L 4XH2B 5ICYA 5HHOD 5K33A 4YPJA 5EU3A 4MDJB 1E4KA 1P7QA 3TT3H 3VFWB 2FRGP 2R1YB 3RKDD 3CSGA 4PLKC 4P2RA 5CKGA 1ZTXH 3QJHA 3E3QC 1CG9B 3MV11 4F7EB 1G7LB 4LPXA 3N1PC 2JB6B 3OKLA 3SDAC 2NY2B 4YHYC 2WIIB 4LF3A 4F7PA 1RVFH 3GUTB 5BQ7B 3VRJA 5DC0A 2ARJB 2QQLH 1MJ7H 2XPGB 4OLVH 1TVDA 4XNQA 3PL6D 3ARDD 1AE6L 2V9RA 3M17B 4YAQB 4PR5A 4Y89A 4V2CB 2AV7A 2VISA 2I24N 3SDDB 3H9SA 3EDKA 4FS0A 2FECL 3ZE2E 3P77B 4K7PX 5HDOA 3AREC 4Y2DB 4PJEF 3EUUA 4MVBC 2EYRA 5KVFL 1KIPB 4EI5A 1CE1L 3MCG1 4ZOAA 1Q1JH 2R69H 2VXUL 2XWJA 4I0PB 2E9IA 1FORH 3GMQA 3IB4A 2VH5L 3HKFA 3SGJC 5D70H 3GSXA 2WBJA 3C6LD 1A2YB 1MHPL 2DWDA 4NZUH 4OCXL 3UJTL 2MSPA 4MQSB 4MNQE 1KGCE 4PJXA 4XP9H 3Q3GB 4QHKJ 1FJ1B 1FIGH 4OCMC 5GZOD 3U1SH 3HZKB 4KKAC 4F7CB 1IKNA 5C0AA 4U1MB 2FZ3B 2HLAA 5DJXB 1QUNA 5IJVA 5EU5B 1I75A 4NUGL 4RZCA 4KRPC 5GGRB 1TZHB 4MSWA 3MLZL 5AUMB 3BDXA 3QUMB 5HD8D 1WT5A 1YPZA 3S36L 5DJAB 2NTSP 4P3CH 1WZ1H 4G8IA 4K3HA 1VPOL 1YEGL 4MJ5A 5L2KA 5FUOL 2UUDK 5FV1L 3HFMH 4DZ8A 2VYRE 3WE6B 4TTGA 2F54A 2YWZA 4PRNA 3DX8A 4IJ3C 1KB9J 5EZOH 4RDQF 4X5XB 4HPYL 3SGEI 5BW7A 5CZXD 1T2XA 3LQZB 5DD3H 4LU5L 1ONQB 3BOVA 3CH8A 4L4VD 3KPQA 1VB9A 2Z31A 4ZYKA 5BS0D 5JHDE 3HR5A 2H3NB 5HGDB 4RX4D 1EEQA 3ELAT 4MXVE 4OIIH 4P46D 4WFEE 2VDML 3ZKND 5CILL 4MA3A 1FAIH 3D18A 2GIYA 2YD4A 3BSZH 5DDHA 1M7DB 1VESA 3I6LD 1XAUA 3BIKA 2R1XB 3IDIB 3WUZA 5C0RH 4IDJH 4JO2L 3BDYL 4WFHE 5JQ6L 4ZPTA 4K7FA 3FQWA 3L7FB 3LHPL 1JFQL 2OJZH 5HHOA 3RX7A 2BFVL 2Y5TA 3MCKB 4MA7L 4Y0GA 1FL5B 4JKKA 3G5ZA 4OGZA 4PJDF 4MNGB 4NQDA 2K7PA 4PJ7B 2KH2B 2V7HB 4CJ1A 3UBXA 3W81A 2F53D 3V8CA 4YHPA 3LPFA 3T0WA 1AXTH 3MJ8A 2HH0H 4XGZB 5IWLA 3O3EA 4AM0A 1FFQA 3ARFB 1EHAA 2J88H 3DHJA 3CK0H 3LVEA 4KTEH 1U2HA 1KTKE 1CDCA 3ZDXE 2HRPH 1QFWL 4PTUB 5CEZD 4OIBA 3PNWB 1ROWA 1N4XL 4AEEA 5DD1L 4OF6A 1MI5E 5C6WH 3FMGH 4PJGB 5J3HC 1UM6H 3T0BA 1EEUA 3OKOB 2A6IA 4KKBD 3HMWL 4EIGB 3L95B 5ISZB 1I9RL 2EDLA 1BLNB 5D7SH 2WINB 4GBXB 1FCGA 3NA9H 1S9XA 4Z7QF 5T1DH 5A3IC 4B7IA 2EYSA 2WUBL 3FOMA 1AKJA 2HYMA 3IDYB 1T4KB 3GSNB 4I2XE 5DXWA 3WO3B 4OD2A 4KJWD 3DX9B 1I4FB 4X8XA 3C8KB 5K9OB 3W9EB 1AC0A 3QEQE 3ZT7A 3ZHLA 4HLJA 7CGTA 4U1JB 2F15A 5KS9E 2V7NB 1HZHH 4K3EL 2EICA 3ARQA 4JY4B 4O02L 3QYCA 3RNQB 2FCBA 3V6FA 3TO4D 3SCMC 4FZ8H 4P2OA 1ND0A 2J8UF 2X7LB 3OAYH 4KQ4L 3GM0A 2X05A 1QKZH 4KK8C 3K4DA 4M5YL 4R4FH 3VW3L 4FXKB 3P77A 4PB0L 1U6AH 2ED9A 2R2EB 3LH2H 4NWUL 4XPGL 5B22A 1WBZB 2IGFL 2VXTH 4JO3H 1TNMA 1KG0A 5FM4A 4U4BA 4YXHL 3IU3A 4ISVB 3SGJA 1NQBA 5ESAB 1NDGA 4Y16D 3SDCC 2ICES 1F6AB 3MODH 5GRWA 2PCPB 2EO9A 4U6HA 1XF4A 4J6RH 3MRLB 4DAGH 2EDFA 1AY1H 4U1SA 5FYLH 1ZMYA 2PYEA 4M7JL 4MB3A 5DQDH 1QLRA 3JTSB 3KHQA 5IESL 2XN9B 3QUYB 3UO1H 2BZDA 3O41A 1NGZB 4KRPD 5DD5L 1UH2A 3DTXA 1RZGA 4ZFOB 2YN5A 3I6KB 4MMXC 4U1LB 1LEIB 2MKLC 2P8MB 3HHRB 3WN5A 5IOPB 3N50A 1HHHA 4JO4L 3TN0D 1EJOL 1YQVL 3BWUC 5KVEL 4YPGA 1JZ5A 2VXSL 4HKXA 3HAEB 2HLFD 4HGMA 2VDRL 3T1FA 1QP1A 2EXWC 3WV0A 5MENB 4P5KB 5DA4A 5GGSB 5T1DL 3RDTD 1UA6H 1YJDL 3A6OA 2OMBA 4NQCA 5CJBA 3OQ3B 3MFFB 2IFFL 5DA0B 4WVRA 3H7BB 3U0WH 2Y7QA 1CGSL 4H20H 5CMAA 4NFCA 4YIQB 1FFPB 1EPFA 4GRWB 2DWDB 3RTQD 3LQZA 4X6FB 3GKWL 1X44A 4KKNA 1JMZA 4X8JB 3JTTA 3TN0B 2VZVA 3SKOB 4ZFGL 5TH2B 1BZ7A 4I5BA 3HC4L 4PJXE 1BHGA 1FZKB 1NC2B 4ZXBD 1WK0A 3S34L 5T3ZL 4P23C 4WDIA 4N8VA 2PYEB 4JY5H 1F5WA 2OI9B 3MUGB 1X4ZA 2HKHH 4JN1H 3UJJL 3VI3F 1Q0YL 3UTZA 3IKCB 5F1IB 4Q6IA 3RX8A 3DJ9A 3O4LD 1MCOH 2XKNA 1RUKH 1KN2L 3PWUA 5KSVA 2VLMD 2NY6C 4LBEB 4YH6A 1LE5A 3NA9L 3U7WH 4OCSH 2BVQA 1TTFA 4F2MA 5EA0L 1FN4A 3OB0H 3SQOH 1F4XH 3QZWG 3EYQC 4RA0C 3QCVL 1J0HA 5JO5A 1YY8A 2DQFB 5I8KL 4QXUH 1DR9A 3S88H 4WFFD 4YJZL 3HZYA 2J2ZA 4Y8DC 4M48L 4OUOA 4JDVA 1H5BA 4OBRA 1ZLVK 4KRPB 5KOMC 1I9JL 1EGJA 3CDGB 1U8NB 4XBPB 3B9KB 5F7DA 5HDQL 1V3MA 3DXAE 3S4SG 3EYUH 4U33A 5F9JA 3W11C 4JJHA 1TITA 1RUML 2BVUA 1DLFL 4LDEB 3PHSA 3SE8L 2OL3L 1MF2L 2GT9A 4GMSL 4CW1A 3LEVH 5HBBA 5J6GB 4H26A 1SJEA 2J8UB 5I74B 2DJUA 3RZCA 5DUML 4ZUUB 1S7XB 1FZMB 4MJ2A 3ILPB 1MRDH 3TYFB 4ZMAT 4HLZG 3QDGB 3VFPB 1T4KA 2M8XA 3QHZH 1CICA 3PWUB 4LLMB 4BELD 4TVPE 3VXSD 2ADJB 3GMLA 4MNGA 4PJ7A 2X4OA 3PWPD 5HYJE 5D72H 4NP4L 4W4OC 1AGDA 5D7JD 5KS9A 1U8MA 1J1PL 5T33H 4YBHA 1FIGL 4WHYG 3K2UL 2D4FA 3F7RA 3E6HA 4ZODA 4YHLH 4PJFE 4NCDA 3MO1B 3PHOB 4IOFD 4LARL 1IC7H 1UM4H 1JZ8A 2NY5H 5C07E 1TQCB 2OK0H 4JKPL 1S9WB 3SDCB 2DWEB 1CE1H 4DCQB 2VXVH 4Z7OF 1X7QB 2IH1A 5FUOH 4PJGA 5BZDB 5IV2A 5ETUB 1A6ZA 4N0YH 2G2RB 3F7VB 4PBXA 2CLRA 4XCCL 3SDAA 5KBNC 4F8QA 4ORGB 3HG1E 2FJGB 3LS5H 1P2CB 3ULUL 4P23B 4ZSOA 1KELL 1XCQA 1QTYT 2CXKA 1LNUA 4PS4H 1FNHA 5D2LF 4GO6B 5DC4B 9CGTA 1LK3L 3AU1A 2IPUG 4UIKH 1D6EA 3EYVB 3QFJB 5J11B 1I3GH 5JPNB 4UT9H 1J05B 5AZEH 1OARH 2V5MA 5E00B 2VUOA 4OZFG 1SM3H 4OM0L 1Z0NA 1OLLA 1U2CA 4WEUD 3DV4B 1J8HA 4N90D 3SDCD 5I8KH 4JLRB 4CU8A 3QCVH 4X7DC 4WI3A 1BZ9A 1Z0MA 1EX0A 4XP5L 3IDYC 1EFXD 5C08E 1U93A 2IPKB 1RZJH 4PRAA 1EAPA 2Z4QB 3U9UA 43CAB 1BBDL 5C3LD 3LRSB 4XH2A 5ICYB 1OAUH 1P53A 1H15B 1YNKH 1MHCA 4YDVB 2A6JB 3L3JB 2BNRA 1ZGLB 3UJJH 1XCTA 1UB6A 3Q2CA 5CJXC 4J23A 2YRLA 3VWJB 3FHQA 1XIWB 2YPVL 1ZSDA 4ZFGH 3UTSA 5EU5A 5J1SC 3GM8A 3T0EB 3GJFK 2X09A 4JREC 4LCWA 1CTNA 3AAZA 4MSWB 5AUMA 4GW4A 1SJXA 3AU1B 4O5LH 5J4MA 5IMKA 4Z6AT 3W2DH 4M9OA 4G9FB 1OOAA 1FYTD 1H3WM 1HI6A 4QXGL 1GGBH 5HHPA 4ALAH 4KDVA 3PP3K 3QQ4B 1PEWA 4U1HA 1CGSH 3DUHA 4HK3N 1AHWC 3KPSB 3VFMB 3B5GA 4JHWH 5D1XA 4YHZH 1IBGH 1CFNB 4MD0A 1P7KA 2ATKA 2I60H 5JXED 4M1DL 5CMAB 3T0EC 2NY1B 4MS8D 4NQCE 5CIPA 1FDLH 4LVOB 4G8EA 2X41A 2DYPD 4HPOH 3DMMC 1BJ8A 1LK3H 3PL6B 3LZFH 2DBJA 3AM8A 4K71B 3U36B 2AERT 3P2TA 1YEDB 2ERJC 1HH9A 3VXSA 4LAQH 3EFDH 1CDGA 4YO0A 1UM5L 2GJJA 1QA9B 4N5EC 2NY1C 5TFSH 2P5WD 4YK4B 4G6KH 3ZE2F 4OLUL 1CE6B 3ZTNH 2D03H 4X8JA 1EA9C 5GIRB 4X6CA 1IEAB 3C08H 4W70A 2C3XA 5I1DA 1KCUL 5BQ7A 1LO2H 3VWKB 1WTGT 3RU8H 2JJWA 1TCRA 2OSLA 3HUJF 3HPJA 4JPIB 5T3ZD 2BNQE 5GGRA 1JGVL 1W0WA 3GIVB 5TGBB 4OLXL 1X4YA 4OM1L 1INEL 3B3IA 1QSEB 3E8UL 3QQ3B 1E4WL 3H9SB 3MC0A 5J1AB 1I8LA 4LLDB 1JHTA 3ZHKA 2EDRA 3S37L 2OLDA 1N7ML 3VFSB 1HDMA 3BAEL 4JKLA 1S9VB 1U8MB 3MBEB 3INUH 5DMGC 3GIZL 5CZXC 3FN3A 1YN6A 4Q6IC 1BX2B 4CRPA 4WI7A 1BBJB 2VZUA 4LSTH 1KTDA 2EDDA 4YUEL 4LP4A 1BAFH 2CMRH 5C07A 3VGGA 5ISZA 2GYSA 3RY6C 1VCAA 5JXAL 4GKNA 4H26B 3U6RA 2DTSA 2NZIA 3EOAB 5D1XC 4JM2B 5D2NA 5IB5A 3ECBA 2AJSL 1JHKH 2JJTA 5MHSE 5HDQH 1XGTB 5DRNA 2QTEA 1IJ9A 3BEVA 1MIML 4IRZH 5FOJA 2NY7H 3BRFA 4LVNB 3FQRB 3OGOE 3KYOA 2ADIB 1H8NA 2GEEA 4J8RB 3U0PA 2FLBT 5HY9B 4DKDC 4P4KD 3D9AL 4F9PC 4PV9A 1NKRA 4XHJD 2X1PA 3GSNH 2GTWB 4OCSL 3O2WL 1HWGB 4WY7H 4L8DB 3MRBA 3C6LB 4FQXC 4XCEA 3REWB 1Q9KB 3HI1A 3W0WE 4N1HB 4ACPA 5EU4A 1T04A 2RB8A 4LGSB 1FGVH 2X70A 2ICWA 4YQXH 2GY7B 5E9DE 1OY3B 1B4JL 4YUEH 1A7PL 4MA7H 3DGCR 4BSVB 3GZKA 3P4OB 2Q6WB 5TDNB 3SE9L 4WHYH 5HYJD 4ONFL 4UV7H 2LU7A 1I1YA 2VLRB 1DDHB 5JIKA 5C9JB 3S37H 2EDOA 4MQXD 3D9AH 5BZDA 5IV2B 1LE9B 5FEBA 4EN3C 2V2TB 2D7QA 1DE4B 2GCYA 1S7UB 4K3GA 3BISA 5JDJA 1DL7L 5LGJA 3S96B 5I16B 3QNXB 4MCYB 1YECH 1KCKA 1OPGH 1OSPH 1FO0A 3OKKB 1LO3H 4LRIA 2ZUUA 1FL5A 5DD0H 5HYSA 4ELME 2MMXA 2HTKD 3H7LA 4ZUVB 4OQTL 3MRDB 3F58L 2QQQA 5IKCA 1R5VB 1V3KA 3OB0K 4LASH 4LSRH 5IVXA 2CH8A 1CDYA 1TPXB 1J88A 1A3RH 1BQSA 4I9WD 3ZL4L 1J8HE 3IFPA 3C08L 3RNQA 4LCCC 1TQBC 4PRAB 2YA2A 4P4KC 1DSFL 4NO0B 5D5ME 5C0CE 1FH5L 2GJ6D 4O2CB 3G04B 5IBTH 2YPLE 4TULH 1OP5K 4NRZA 1JRHL 3S5LA 3L3JA 3MBXL 2ENSA 1CFBA 5TQ0L 3HNVH 1OB1B 3EYFB 1HILB 5EH1A 4NBYB 5ID0B 4UILH 3U9UB 2YPKA 3KNBA 4BSVA 2YXFA 1CIDA 5ADOH 5KANG 4MD4A 3MYJA 4GRWE 5JDSB 3CMOL 3GI8H 3FB5A 4J3UA 1FYTA 4XX1E 5JOPD 4MAUH 4MLSA 3NACL 4OLXH 1IT9H 5DFWH 3FL7A 1YEHL 1PZ5B 3X11A 1CD8A 3D2UB 1DANT 1HE7A 1HEZA 1WAAA 1SEQL 2VZ3A 3C5ZD 4DVRL 4L29A 3P11L 3DMMA 4R96B 2A1WL 1NBVL 4PP2A 1MJUH 3MBEC 1FNSL 1BZQK 1IGYA 1T22A 1T20A 1DBBL 4LKXB 1INDH 4QGYA 2EKJA 5AG9A 3HC0A 1EERB 1F00I 2W0PA 4Z78A 3MUJA 4NJAH 5GRJH 1ZLWH 1ED3B 4ZXBB 3WEXA 1MHHB 4LAQL 3RBGA 2NR6C 3QUYD 4YE4L 3MFFA 5CJOL 2OYPA 1XGPA 3VXSB 5FA4A 4UMGA 1MELA 1G9EA 1U42A 3W82A 2CK0H 4U6YA 1R3HB 2BNQD 1IGMH 3RFZC 5E5UB 3OXSB 5DVLA 1S9YB 4KRMB 5JUEH 4JFXB 3IVKB 4PJ9C 1PGRB 4NIKB 1HSAB 3BIAX 4P2OD 3SDYH 3NA4A 1BBJA 1KLUA 4I3RL 1RZ7H 5D5MF 5FUCE 5TH2A 3O6KL 3DXAB 1FCCA 1EHXA 3MRJB 5D2NE 4MA3B 4HFWA 1PZ5A 1ZEAH 3WKMH 2H8PA 2ZUYA 1P4IH 1A14L 3K4AA 1OARL 1N5YL 4D94A 2XACC 4UUJB 1YNTA 3CK0L 4LLMA 2X4UB 4NQED 1UT9A 3DX8B 4BSWA 5GZOC 4UBDD 4DW2L 1MEXL 4DKEH 4LSUL 4WCYH 3KPLA 5DJDB 1REIA 4Y5YA 1UKTA 3L7EB 4XVTL 4G80B 5ENWA 2DQFA 3GSUB 3BGFB 3NABH 2YEZB 2PXYC 3CC5A 3CLEH 3PHOA 2YWYA 1LHZA 1IGCL 3CPLB 1X5XA 5GGTA 3ROOA 5JQ6H 4UOJA 3D18B 4GKNB 2FHFA 2K9UA 3UAJC 5ESVA 3L5WA 3TWCH 4G6JH 1SBSH 1SQ2N 4YNYA 5DJ2B 3JV5A 5D7JB 2DQHL 1WWCA 3VFGH 3NZHL 1I1FB 4QLRA 3L6FB 3GBLA 4TUKH 3TF7C 4ZTPL 4JQXC 3W0WD 4TRPH 3WUWG 1NSNL 2W0FB 3TVMC 3WXWL 4XNXL 3BIKB 3IDIA 1MRFH 4HDIB 1AR1C 4NQDE 4OSUH 1KEGL 2YA1A 1KELH 2WW8A 3O6MH 4B7LA 1CS6A 4FQ1H 5IBLC 5EC2B 5L2KE 4FP8L 3NH7H 4TOYH 4EXPX 4MCYA 1ZHLA 1FFOA 3HTLX 2X4UA 1CICB 3OJDB 5DRXA 4EBQL 4PRPA 4JFFA 4OF0A 3BFOA 4JLRA 4N8CL 3O6FD 3REVA 2VWEE 3JVGA 3GSQA 2DTMH 5FO7A 5CKAA 4GMSH 3TIDB 3LKSA 4X4XB 3SJVD 5FGCE 3EBAA 1P4BL 1JN6B 4NM4H 4Q2ZA 4E41A 4O58H 1MI5A 5J0BA 1K5NB 3J7HA 2ZOKA 3GMNA 4S1DC 2AKRA 1NSNH 1NFKA 2JCCE 4KMLB 3KYMB 3QJFA 2IAMD 5KSUB 1U9KA 4PY7A 4X0KA 1MWAB 5BJTB 2HKFH 3MRNB 1T5XA 4CBPA 4I9WE 1A6ZB 2WNGA 3I50L 4GT7A 3CFCH 5DQJB 1F4XL 4ZS7H 3SQOL 1DUYB 4XMLL 2IFGA 5SWQB 2CIKB 3ZE0F 5EN2B 2Z35A 2CRZA 4KXZI 2AJXH 5TQ2L 4PLJC 2HVJA 5F6HJ 3OXRB 3QULB 1TVBB 1BFVH 1UZ6F 5HHPB 5EOQL 5ACLA 3I6GA 3ZT6A 4ZNCD 5FKAA 2ICEB 3OZ9H 2RAMA 3WXVL 2J12B 4AK1A 2FJHB 3VWKD 4APQD 1DLFH 3D39A 4M3JA 2N56A 5KS9B 1EBAA 3NPSB 3MLYL 3BZFB 5L9DL 1T0MA 2XT1B 4Y4KC 4HCRH 4JRXD 3GI9L 4CJ0A 5AEAA 4GQPH 1RIHH 5KSAC 5TF1H 2Q76A 2QSCL 4NZDA 1NFDA 3F7QA 5GJSH 4RBPK 4NKDA 1VKXB 1O5DT 3MLVL 3WKML 1RVFL 3IS1X 3CU7A 1IC4H 3QDMA 2BNRB 3QRFM 2B1AL 3NGBB 5EB9A 2KL6A 1G7PB 1N6QH 4L8SB 1L7IL 3ROLB 1IVLA 5DUBB 1LDSA 3F7YA 2R15A 2EH7L 4WUUB 3I02A 4N0UB 4FXLA 1XCQB 3GUTA 2P8MA 3B8SA 2MQ0A 3H9YA 3JWOH 4HZAA 1A6TB 5LBSH 4NM8H 2A83B 3EKCA 1KYOJ 1LQSR 1CL7I 3UJIH 5GZNC 3QUYA 4HBCH 2BVEA 2H8PB 2R23B 4OI8A 1F11B 2NMSA 2ZUQB 2DLGA 1WWAX 2X1XR 1LEGB 4L1HA 4L3CA 1GIGL 1QHOA 4NCC2 2OR9L 4HT1H 4QY8A 4X5LA 5JLZA 3QEUA 3SO5A 1Y18B 4ZAKC 5F7LB 4Y88A 1JPTL 3C60B 1PG7H 3FFCB 4YBQC 3V4PH 1QSVA 1DP0A 3H9ZA 4XPAH 5IW3A 1T2QL 5DJZA 1WIPA 5E2VH 4G43A 1GHFH 5SWZD 1QSEE 4TSBL 4OFYD 4WV1C 4Z7OE 4LSPH 3RVUD 2DLFL 3S35X 2IC2A 1UZ6E 3QCUL 4EUPB 1OT1A 3KVQA 4KZEH 1U8LA 3RUGF 1QFPA 3RWJA 4YK4C 4JDVB 1FL3B 1YEHH 1D5MA 3LV3B 4WRLA 3TNNB 5KSBF 4MXQD 1WCBB 1U58A 3BUTA 1NBZB 2F54D 1G0XA 1KENH 4PJHB 2J1KA 4N5ED 3TN0A 3KXFE 4AQOA 4CNIB 4DGIH 4F15C 5DSCB 4Y2DD 3MCLH 3PQYE 1Y0LB 3GSOB 5GISL 3QNYB 5C92A 4DEPB 3HLAA 1YYLL 1UC6A 1I1FA 2V5YA 2A83A 4NQXA 3WIIL 5CGYD 1BQHA 4HULB 4RIRA 1HQRA 4DAGL 1D5ZA 1JWUA 3DRQA 2IBZX 2GK0A 1HINH 3AXLB 5D1XB 3MODL 2J6EH 3V52L 4YDKH 1P7KB 4RWYH 4H8WL 4KHXL 5C0AD 4OZFH 4LCUA 4RNRB 3TBSA 1HIMH 1ZA3A 5JW4N 3NH7L 4ZUWA 1I9RH 2OZ4A 1L0QA 1OPGL 3TO2A 1HOCA 4WIQA 4NQEA 3K2MC 4XVUD 1PEZA 2BHZA 4R90H 1OWRM 3K8KA 4D9RD 3TT1H 1UYWH 2BDNL 3SKNB 1QFWH 2JCCA 4OZFB 5HGHB 1UJ3A 2ADFH 3G6DH 1UACL 4G6MH 4X80L 5C9JA 4HKJA 2HMID 1BJ1H 1KSRA 4HJGA 4IIQB 3MNVA 5HDBE 3PV6B 4MXQC 4JZNA 1NDMB 3P9MB 4PJIE 1YMME 1IKFL 5LGJB 4XCYB 2RQ8A 3EHBC 3O2DA 3E6FB 4NNXB 1MQKH 1DLHA 4LHUA 1A4JA 3NFPA 5EORL 4HKZA 4GG6E 5FDYA 2DRUA 2BSRB 3ULVL 3HR6A 3F12B 4OV5A 2WLZA 2B5IC 1WF5A 2QADB 5GRUL 4PYHA 5E8EB 3MV8A 2EEDA 2VL5A 3SCMB 4M7KL 3VRLF 4EDXA 3MR9B 1W72A 4LAJH 3DV4A 1WWBX 4XNUH 4HX1B 4M8QB 4K23H 3G6AA 4ZYKB 1OB1A 4GRLC 3GHEH 2ICWB 4F9LC 1JGEA 3D0VB 3PABA 3I75B 4P48A 2CR3A 1EAPB 2Z4QA 43CAA 1YYLH 3ULVC 4UT6L 1IAII 1BM3H 4K2UL 2FJGA 2W59A 1T1XB 3MCLL 4OFVA 1DVFB 1T1ZB 4MJ6A 4GBXA 4PUBL 4K9EC 2H6PB 2HVKB 3TLRA 3I84A 4P2RB 5E4IA 1RUAL 1EEZA 4DGVH 1Q9OB 4NQCD 2F8OA 2PYFA 3OKNB 4JO1H 5HHMB 5IHZA 1SJHB 1AGBA 3FQTA 3I6GB 3UYOD 3ZMRA 4KZEL 5JTWA 3PF2A 5E5MA 4FFZL 5JW5A 4DOHE 4WUKL 3ZYOA 5F6HI 1OQOA 3VJ6A 2XQBL 5A43C 3QUXB 3ZT5A 4KWUA 3QUMH 2IPUK 2R23A 3IGAB 4XP1L 5BVJA 3FO1B 5CINL 1GXEA 1R3LB 2KQMA 2N7AA 4WHCA 2ZSWA 2D7TL 3I3DA 4PRDA 1VSCA 1YNLL 5LAXA 3RZCC 1TETL 1KCSH 4MDIA 5JORA 4NHCH 4IMLB 4RMUA 4BQCA 4XVJL 1U3HA 4Y4HB 4RGMC 5F9OL 4P5TC 4KGJA 2NZ9C 1S3KH 3K4ZA 1M7XA 1I8MB 1NDGB 3ZTNL 2NXYC 2A77H 1S9XB 1U8LB 2JKXA 3TPKA 3DVGB 3CMOH 3GI8L 4JRXE 1L7IH 3QNZA 2XQBH 5MEND 1S7UA 3IAPA 2C3VA 3O0RL 1HEZB 1HNGA 2EC9T 1IEAA 2R0KL 5E2TL 4L29B 2ARJA 1KCVH 4C59B 3ZKMC 1FDLL 1DTUA 3RHWF 4U1JA 2DQUH 4DGYH 2D9CA 1LP9A 1BOGA 2WANA 5FUZL 4D3CH 1U8IB 1AKJD 2YPVH 1QSFA 2BP3A 4QCIA 1W0YT 4TNWK 2CIIB 1ORQB 4OZIA 2FHCA 3X3GL 1MQ8A 2BHYA 3V4UH 1WISA 3B3IB 1DN2A 2VH5H 2X1QA 8CGTA 3BESR 1HH9B 5A2KH 3P9LB 4ETQA 2E7LC 1JJUA 1ZT4A 1YZZA 2BRQA 2R0ZL 2YKLL 1QNZL 3QQ9D 2KZWA 3VFOA 1BBDH 4P57B 3M8OL 4KUZH 4Y1AD 3TO2B 1N59A 4S0TD 5A16B 5EZJB 5I1HL 1MCBA 4X7FC 3RPIA 4FABL 4QOKA 4KDTA 3C60C 5MERB 4NC0B 1NBZA 4JHZA 2QSVA 4C83B 1G6VK 2MJWA 2B8OT 2P7TB 1OW0A 5KZCB 4HJGB 4POZD 2AI0H 5KSBB 5IB2A 1UEMA 1P6FA 4N0FB 1TCRB 5GSVB 3FB6A 3T04D 3MLUL 4NN7B 4WFED 4UIMA 5LCVL 3D3VD 1HQRB 2ADIA 4YC2C 2HWZL 3VXMD 2V7HA 4NQVB 1FG2A 2CO7B 5C8JB 5CWSA 3VFNA 5F7MC 4MJ5B 5L2KB 5I2IA 4MQ7A 4IOSD 1HQ4A 1P7HL 4EBQH 1JN6A 1CR9H 4OZGB 1I1CA 1KB5A 3QPXH 4AENA 3IRZA 1MCWM 4POYA 2AKRB 1NGWB 1I8IA 1T04B 2DI8A 3BZ4B 4PJGF 1UJ3B 3LS5L 4I48A 1JV5A 4IRZL 5B39A 2FR4B 4QRTB 1HIML 3T2NH 4X7EC 2X4TB 2YUVA 3L5WB 4IIQA 4TRPL 4Z7WB 4X4YB 1NEZB 3MYZA 5HGAB 1I1AC 4ZTPH 3VMNA 3BKML 1NAML 5MEOA 4ONOA 5HGHA 4OF5A 1UQSB 4JFQB 3FQRA 3BP4A 1YMMA 1CFVH 4JZNB 1IRAY 1XGTA 2Z9TA 3O3UN 1EFXA 2VKXA 3MLWH 3PP4H 3QXAB 4UBDC 1G7JA 2EDWA 3MJGX 3RGVB 5C0BB 4UI2A 3RIFF 3VD9A 4WUUD 1N0LA 3P73B 1D9KC 2D7OA 4X9HA 2O5ZL 3NIFF 1QRNA 4HWEH 1KT2B 4FQQA 5I1CH 2NY4D 3NCBB 4OAWB 1AGDB 4P2CG 4P59H 1KNOA 4I18C 4OM1H 2R29H 5I76B 1P84K 3NIGF 3MRHB 5EIVA 3E6HB 3BD4A 3O3AA 4OZGA 3I75A 2YSSA 4U1NA 1A1OA 5IQ9A 3QCUH 5LGHL 2WK2A 1A9BB 4D9QD 3C09C 4QHLB 1N5YH 3UTTB 2X9XA 2A0LD 3DROB 3T8XA 1WBZA 5C08B 1EMTL 3O4LE 1MFDH 4ZO9A 5HI4C 3RVXC 3S4SA 1NJ9B 1M6OA 43C9B 5DO2D 2OL3H 4NKMA 5GRZA 3HC3L 2R56L 2O93L 3CSPA 2YS4A 4WI4A 3VXUE 1T1ZA 2IEPA 3ARBB 1P5VA 1S7XA 2G75A 5FOBA 5EU6D 1ZVSB 5INCB 2H6PA 2HVKA 3SDYL 1T80A 2DQIL 3QNZB 4I3SL 3ARGA 3PDOB 5E8DL 1EFXB 3TJHC 1EBPA 1OAXH 4JFPA 1XF2B 2HVJB 4L3EA 5GGVH 1I4FA 4L9LC 1MAJA 3KJ4B 4OQ1A 3R0MA 3LEYH 2B2XL 3MFGB 3MNZA 5J9PB 4YE4H 4HS8H 5JR1H 4NO2B 5I1GL 3O81A 4MA8H 4LKXA 3C60A 1DVFC 1B90A 4X7SH 1IC1A 4LEXL 4V1DB 3IDGB 3G5VB 5JW4R 1BEYL 4GKOA 3HNTH 5IB3A 2BJMH 4KFZC 5E9DA 1OF2A 3RKDC 4QXGH 2P8PA 3MA7B 1QG3A 1QQDA 1MWAH 4EI5C 4KK6C 5I1LA 1AGEB 1TJGH 1G7IB 4ZTOH 1A7NL 2E7HA 1EZVX 3TNMB 3DPBA 4QHLA 2B4CC 1JVKA 1IM3B 2Y25A 1H3PH 1RHFA 1ZGLA 4TN9A 2M26A 4HUWB 2WBJC 2Y6SC 4RRPA 5E99H 1NUDA 5FM5M 1QFUL 5FV2A 5GQBA 4PP1D 4KHXH 1PX3A 4PJEE 1KJ3L 5DQJA 3CVHL 1OGAA 3FQUB 3GKWH 4P23A 4G6AD 3RY4A 2Q8AH 2AXHA 2G75B 3CU1A 3GRWH 5DJ0A 2DL9A 4TQEL 3X11B 3ZKMD 4X6CF 2OMNA 3LKQB 4F7MB 3FQNB 3OSKA 3IDJB 4HG4J 3ALPA 3RPKA 2AJXL 3DMMB 2BNRD 5AYUH 4W6WB 5EUOA 4KVCH 5F1OB 4DWHA 2EDQA 2ICEA 2DICA 1LP9E 3PGDA 4WEMB 5C0CA 3ZDYE 4XBGB 3VXPA 1KB5L 4NQUA 3LN5B 3ZL4H 4JFYA 3DUSA 1WEJL 4QCIB 1ZA3B 1A0QH 4MJIA 3HCVA 3WUWB 4IDLA 4TYUA 3WNMA 3GSRA 1CVRA 1F4WL 3LRSA 4C4KO 2B0SL 1G7QA 1S7VA 1YEKL 1A6UL 1ZS8B 2FGWH 1LO3L 4XMKH 1D5IL 4KY1L 5DZLA 5E2TH 5J11C 4PS4L 3C87A 1XCTB 1A3LH 1NMCC 3PWLB 2XA3A 4AL8L 4OZ4A 3PWNB 3MRJA 1VFAB 1XZ0B 5GZND 4C83A 1A4KB 4KQ4H 3O8XD 5FGRA 2BY0A 5B38B 5FYJD 3JXAA 2PXYD 3OWEA 4RAUA 3SDDD 4JKPH 3E3QE 3BN3B 4L5FH 2PW2B 3C5ZC 5FB8A 5DUPL 3VI4F 3VI4E 1J86A 3H42L 3OKDB 4M93B 1CZ8H 4KGLA 5EOCJ 4AEHH 3SDXB 4NQVA 1P84J 2VDPH 1HKFA 2PYEE 5EUOB 2CKBA 3FZUC 5JOFB 2E9WA 4F37F 4F8TA 4FZ8L 1OTUD 2DB8A 1T21A 4Z7NF 3HNTL 5C0BA 1SBBA 2E9BA 5HYJA 3K8MA 3K3QA 4DZ8B 3WIHA 2E7BA 4BQ8A 3VG9B 1Y6KR 4FFYL 3EIFA 3GBMH 1J0JA 4RNRA 4GRWF 5D7LA 2WQ8A 2ZP0T 4AZ8A 3L7EA 1CTOA 4LKCA 3ARFC 5SX4I 1TLKA 3FMGL 5MI0B 5IVOA 1MFBL 5EO0A 4LNRB 1SVCP 1KJ2L 3LKRA 5D7IE 5HGAA 3ZE1F 3BP5B 3NABL 3KR3H 1ZT1A 3GJFH 2VN4A 4HFUH 4XCNA 2NY6B 5GJSL 2P8LB 3NGBC 1RIHL 1OLZA 1A6WL 4P4KB 4R2GD 5I1JH 3T8XB 3P30H 2AJSH 2P4AB 3V0AC 1JF5A 3WSQL 1BM3L 1Y0LA 3CLFL 3KAAA 4MXVF 1TJHL 3Q5TA 5I1AA 4XCYA 4MGXA 3HAEH 3OKMB 4NGHH 1EMTH 3BVNB 1BFVL 5L88H 5DK0B 3ARFD 3KS0J 5CEZH 3EHBD 3QUZC 1KEML 4TSCH 5TGBA 2J88L 4NBXB 5I0DA 5FECB 1CDUA 3CLFH 3T3PE 1MPAH 3TIDA 4JFPB 3HUJB 1PG7X 4TNVF 3RKPA 1XF2A 5F21B 2EECA 3DO7B 5HYJB 5IB1A 1AP2B 3BSZL 1DBML 1I7RB 4MNQD 4EDXB 3HS0B 5DR5H 3FZUD 3O9WC 1LK2A 4TUOA 3LKPA 5E03A 2IAND 4I0CC 5EZIH 2Z8RA 4PJBF 4HUUA 1LILA 4X5WA 2DQCH 3BZFA 5EORH 1Z9MA 3MLRH 1JPFA 1MCOL 2BFVH 1ADQL 3NCJH 4X6BB 5C08A 2Q86B 2C9AA 4L4TB 3MO1A 3CFJB 5GRYA 3MV9E 4YDIH 4WTZG 5JHDB 1VDGA 3M07A 5DD3L 5F7UA 4O51B 3I9GL 2Q3ZA 1G7MA 3MMEB 1NKOA 5FA3B 5I19H 3TO4B 1AO7B 3QCTL 4OLZL 5EIIA 2WP3T 5D7KD 3C2AL 2RGSA 5IM7B 3TBWB 3VXUA 5T1KD 3VD5A 5ECJE 5LWYH 5TFSL 4L4VB 1YA5A 3V5HB 3WFHB 4OLEA 1ZSDB 3I02B 4OTXH 4LPUA 4P2QA 5DK3A 1T7WA 4RISL 4OLYH 1ZLSH 5IFAH 4PJBB 3QFJA 4QXTB 1AQDA 5EZOL 2EEBA 1QYGL 5IKCB 4HUNB 4WHDA 1CD1A 2LU3A 4JDTL 1A21A 1R5IB 2HTKC 3KYKL 2J6EL 5HYEA 4WGWB 2D7NA 4KUCD 3PGDB 1NFDE 3UJTH 5F7KC 3SHSA 5I30H 5FYJU 3QXWA 3C5ZA 4J3VA 2E7LA 2W60A 4YLQT 2P1YA 2E6JA 4LRIC 5ERWB 4O2FB 2WUCL 2CXGA 3JZ7A 4Z7VB 1OAZH 3TC9A 3DGGB 1S5HB 1RZJC 4NO5B 3VFUA 5F7HA 5I75B 1RIUH 5IHUH 2FNBA 3I3EA 5FYLL 4YDVA 6FABL 1YEFL 1T03H 5IK3B 1X4XA 4N0UA 4HQQL 1HXMA 3WJLC 1IQDA 2D0HA 3N85H 1MHPH 3U4BL 2FEDD 3KJ6L 4JREB 4PJAE 3QEHB 1KJ3H 4D9LH 5JA9A 2A74B 1E27B 4EI5D 1NAMB 5JMOC 4N0FA 1ZWIB 4YXKH 3TA3B 5HHXH 3QG7L 2UWEF 4LSPL 1RZJL 1F4HA 5DHXB 3OL2A 1D9KA 5TDPB 1KJVA 1Q9WB 4QYOA 1YEIL 4GRWH 3T2PA 1BEYH 3ULUE 1QSEA 3CH1A 2JJVA 1OL0A 2R4SH 3KWWB 3AXLA 5C0IB 4NRZB 2R2EA 1FVCB 1H3PL 3DYMA 4NDMA 4B53A 1JZ4A 3SOBL 1FL3A 3G08B 2MFNA 1U3HB 5LJYH 4OCWH 3VDBA 4ZTOL 4MYWB 2ZPKL 3KPRD 1MAKA 4S10A 4AMKH 2X4TA 5GGQH 3NAAL 1RMFH 5MP6H 2CDGB 2UYLB 5J6HA 4HUVA 4FQ2L 2DLHA 3C8HA 1EVTC 4RAUB 4Q9BA 1UJTA 3W11D 1CI5A 3JV6A 5IEHA 2Z0BA 5GSRB 3U6RB 1TZIA 3HMWH 1HCFX 3PGCA 4EDWL 4HFWB 4U1MA 2GJZA 5LKNA 5C0CD 2DQDH 3NTCH 2VABA 1NLBH 3T09A 4EQ2A 2VTFA 4JDZA 1FNSH 4K71C 2I07A 5K93A 4HKBB 4AIOA 4BM7A 1T3FA 1JNJA 3BT2L 4Y19A 1QRNB 1G6RL 4NQDB 4HCRL 5HJ3A 2XTJC 3BH9B 2FSEB 3QQ9C 5C0BE 2OP4H 1PQZB 3WEXB 4ZXBA 4HW6A 1PZUB 1MY5A 3HUJA 4ZDHB 3O6LL 3TBSB 4AG4H 4FOMA 3FT3B 4X6DA 5M94B 1F8TL 4X98B 4OLWL 4PTUA 3H0TA 2R9HC 1Q72L 2PYED 2CSPA 3MBXH 1OSZB 2W1NA 3PWPB 4NN5C 2PO6B 4YX2L 2EIBA 4NHUA 1RJCA 3UEZA 1JNLL 1NCWL 2EO1A 3T0VA 2VQUA 5CLWA 3AREB 4Y2DC 3O6FC 2WWKO 3MLSL 2A9MH 3O9WA 3GSWB 1C1EH 2DD8H 3LY6A 3WLWC 1IGIH 5J3HD 4IMKA 4X6CE 1I9JH 1AI1L 5BRZA 3FQTB 4Z7UA 1D5XA 3DI2B 3MLSH 4XXCC 2KPNA 4NZTH 4U6VH 3QPXL 2IQAB 3MROB 3QWRD 2PO6D 2XWTB 2GTWA 4QTIL 4PJFB 1FYHB 1LO4L 2P8PB 1KCRL 3W0WB 5E7FA 3QHFL 1JNNL 3IAQA 3T2OA 3H9HA 3KDMA 1A22B 5GGQL 4X6DB 1ZK9A 3O3DB 1MQKL 4D0DB 3TCXA 3GGWA 4NN7C 2DDQL 4UNUA 1V05A 3CUPB 3QIUC 2IQ9L 1O7VA 3QFJD 3WKNA 1RK1A 2VE6A 2F5AH 5CSZB 1IAMA 5GHWH 3RIAK 2QV2A 5ISZE 5TJWK 1CF8L 3WL9B 1HHIB 2CIKA 3ARBA 5BXFA 4OCYH 2VLRE 3BGFC 3BPLC 3TT1L 5IVZB 2OS7A 4JKWA 3ARZA 4GH7B 2I9TB 5DD6B 2NZ9D 3FN0L 4JHAL 1TPXC 3JWOC 1DN0A 4I0PD 3U4EB 1DCLA 1N0XL 3V5DB 2FH8A 2ZOLB 3WN5B 1HYSD 4UDTA 1BGXL 4PG9B 1R5VA 5HSFA 3HMXL 1JHKL 1A6VH 2KUTA 1RJZA 4PJ5D 5FO7B 3RL1B 4RWYL 2VZ1A 3DRTB 4I4WA 2C1PA 1MCSA 2OCFD 1H9VA 2ZPKH 3MRPA 2ENYA 2CDFB 4JPVH 3MLXH 4GUPB 3VXTA 3FONA 4UQ3A 2A2QT 2AJYL 2UVEA 2EIEA 5FYKE 4XNMB 1IAOB 1U95A 1RJYA 5BO1L 3FT2B 1FLRL 1HKLL 2E27H 5DI8A 3H6JA 1T7ZA 1DQTA 3H8NA 5ESAA 4UAOB 4V1DD 2FX8H 1NMBH 2V2XA 3AS3A 4BZYA 4EUPG 1OAQL 4I2XA 5FYLD 1FYTB 3H2WA 5DK2B 4HUVB 1NCDL 2AP2A 1RUPH 3QFDA 3QEQA 1EEYA 3AC0A 4HWZA 3MBED 1CYGA 3HB3D 1WWWX 1G84A 5ANMB 3WS3A 3RHWK 1I3GL 3JWNC 4F7MA 2ZJSL 4RISH 5IFAL 4OB5L 3VXOB 3RL2A 4TSBH 5DTFB 2CGRL 3VFTA 4Y19E 2MCPH 4S1QH 3LQMA 5CZVL 2D7TH 5ITFA 4Y2DA 1RJZB 1NBYA 5LWYL 3MGTA 4XZUB 4UT7L 1RIUL 2DLTA 5CINH 5DT1H 5C8JA 4XP1H 3HG1D 3VRIA 3MA7A 1OW0C 4C56D 2VOTA 2WP3O 5F9OH 5KSAA 2XWJB 2VIRA 1NBVH 3MRIA 3QZWB 2CRIA 3DUUB 4U1KB 1SJVA 3L3DB 3VFWA 3LV3A 4NN6B 5BOPA 4QHKI 4FTVA 4JRXA 4C58B 2DBLL 3KYKH 5E5RB 1IT9L 4KDWA 4I48B 3RWGA 1J1OH 5A40E 1J9CT 2I60L 2ZG1A 5GIRA 1R3JB 4YHZL 4ZXBC 3T0XA 4QOKB 4JDZB 1C12B 5I1DB 5ADOL 5INDA 4R7NA 4HIXL 4FG6C 1FL6A 1L6ZA 3MJ9L 1S78D 1QR4A 3W2DL 1H5BC 2PN5A 1NUNB 5F1IA 3AM8C 4KROC 5MEQB 4PLNC 1SVZA 5BCAA 3KPPB 1U8OA 5KVDL 2E7CA 4KTEL 2B5IB 1CBVL 2Y07L 3C2AH 3JVGC 4LLAA 4Z76A 4RGND 2X4OB 4AH2B 4HJ0D 1LO5A 3D85D 4G8EB 1KT2A 4FQQB 4ELKB 1AXTL 3P30L 2DL2A 1MCWW 1QEWA 4RAHA 4G80A 5DFVC 5KG9A 1GGYA 1BMGA 2HT3D 3OJ2C 3QHTC 1G9MH 1YEJL 3VI3E 5F96L 3P4NA 1Q9LB 1EO5A 2XICA 4QRPE 4RGNC 3BQUA 1FQ9C 2F53B 1F45A 3BP4B 5GGUA 3FFDA 4OFYA 1HHJB 5SV3A 2QR0A 3G5YB 4XWOD 4EQ3A 1FP5A 4JGMA 4P9ML 4R7NB 3BWAB 3MJ9A 4ODHL 4NZRH 3P4MB 5F8RC 3S6CA 1YMHB 4XHJC 1OHQA 4PJBA 4MQTB 4WNQA 3BW9A 3UCRA 3CFDB 4JPKH 3MRQB 3WFCL 1XIWD 2XY1A 1CGVA 2FD6H 4R2GB 4IRSB 5K59E 4QHMA 2IALB 3QHFH 4DOHB 2DTML 2VAAA 1N5AA 4G8GD 1AGFA 1VPOH 3EGSA 3DV6A 2W60B 1UGNA 3MRKB 2NW2A 2OK0L 1KPUA 4IMKC 4K07A 5A2IH 2BOBB 5CD5C 3ARVA 3QEGL 5SWSE 1D5IH 4KY1H 4NUGH 4PLKD 1KPVB 3U0WL 2QLVB 2ITDB 1ACYL 4JG1L 3QAZC 2MPAH 3BXNB 4OQTA 2CLZA 3PDDA 3S8WA 4X9FA 3O4OC 2AEIT 1RJYB 1A1NB 3LS4L 3N9GH 2P5EB 1LO0H 3C6SA 2FIKA 4U2ZA 4XP9L 1IILE 3SGKA 5IVZA 2SEBB 4U3XA 1KENL 5KN5B 1Q9OA 3QWRA 5DQ9B 3KGRA 4HC1A 1C08A 2GSGA 3NFNA 1SEBA 3DYOA 1YMHA 4DFHA 5JHDD 4GKSA 1BD2A 1MJ8L 1Q72H 4NFDA 4J7RA 3RNKA 4ORZC 1XGYL 1U8HA 4UT7H 1I85A 3MV7B 1P7QD 4QNPE 1PFCA 2V2WA 1DN0B 4PLOB 3CX2A 1LEGA 2XWBB 4KJQC 5CJXA 4JZOB 5ICXA 4JFFE 5I74C 2DIAA 3NVQA 5F93C 4GW1A 3UTSD 2LAAA 4JO3L 1SYSB 5IROC 2VDLL 1EZVY 1OCWH 2EDNA 3FTGA 1JYVA 3UZQA 3L3KA 1VFBB 1GHFL 3MRGB 1IAIH 2G9HA 2Q1EA 2WBJB 5DK2A 1XFPA 3FB7B 4H88L 2X10A 1BOYA 4MNHB 3BO8B 1JPSH 5IMLA 3SO3C 2FEEL 1PKOA 3S37X 5I16A 3MGOA 3CJJA 4WTXA 1MVUA 2IG2L 4PGBB 2AEQH 5E8OA 1R5WA 2B2XH 4GAFB 4JPVL 4UU9A 5E9DD 3LZFL 2GY5A 4FQIH 3W39B 4ONGH 3SKMB 2XIDA 4RFNC 1BVZA 2HFEB 4KH2A 1MFEH 4P9HH 2BSSA 3H9SE 2B1HL 3RA7H 1P9MC 3HMXH 2HRLA 2ZSVB 5C0GA 3X17A 3QRGH 3HE7C 3UDWC 3GO1L 5I1KL 4JJ5A 4UQ2B 3D48R 4H88H 4FFVD 5C0DA 5DFTA 3CSYA 1HILA 2EDBA 1R3HA 2A1WH 3QDHA 2Z31B 2ZCLL 1U8QB 1RURH 5HHXL 4N0RA 3D3VA 4IM8A 3EDFA 4I0KA 2OTUA 5L9DH 4NKIL 3DECA 2W9DH 4MA8L 4PJXB 2HH0L 4POUB 2ZG3A 3G6JA 3LN4B 5CBEB 4UTBL 5IVNA 1FNAA 1U8PA 1F42A 1UENA 2HKFL 4HWEL 4ONHA 1DBAH 4M1CD 3RUGA 4U1LA 1LEIA 5IROA 1YEFH 3BPCB 4UILL 1XGYH 5HVGB 2A73B 1OAZL 1BFTA 1FNFA 1KIRB 4Q0XL 2WUCH 3UMTA 4U31A 2BHUA 3BE1L 4XVSH 5MEQA 1DBJL 1U3HD 2AV1A 5F1NA 5GS3A 1FHGA 5F8QC 2AS5M 2Y7QB 2AXJA 2RBLA 1SM3L 4OM0H 1OT2A 5ENWB 3N9GL 1I9EA 1WZKA 3VFSA 1WFTA 2AEPH 4XTRC 3TBVA 1OCWL 5KZCD 3CAFA 4KKAD 4MHHI 1YC7A 2QKIB 1VGEL 5HHNB 1I8KB 2VXTL 4O58L 5KG9B 4UNTA 1MCIA 5EZJA 4O4YH 4W4NA 2HMIC 1MHEA 3P4OA 3PE9A 5CGYC 2Z93A 4JM2C 4XCCH 5D1QB 2NY4B 4N8VB 5E08L 2GJ6E 2XI9A 4OFIA 3TYGH 1MJ8H 2XZAH 3ME0A 2K1MA 3MJ7A 3JUYA 2JB5L 3VFVB 5EOCH 3CFDA 3BQUD 3MLWL 3WHXA 1ZHBA 2ATPA 4LARH 3DX9A 5DC9B 2H2SC 4YQXL 5DHVB 1R24A 2XA8H 1C5DB 2FYYA 3N1GC 3NN8A 3K74B 2BVOB 5I0ZA 1FV1B 1G9NH 1S7WA 4PV8A 3RY6A 4NZRL 3LKPB 1AQDB 5T33L 2R9HD 1FO0H 2XY2A 2R2CA 3TCLB 1BFOB 2VL5B 3SCMA 1WZLA 4NZUL 1I3RB 1I3VA 5ESQB 4JFEA 1PLGH 1RZKC 2CDFA 5FYKH 1RJLA 3TVMA 2MHAA 2GITA 2BXYA 4UB0L 1NGWA 2FB4L 3PNWA 5EUOF 4XPTL 3UTTA 5IVXF 2EH8L 1MRCH 1UWXK 2LTQC 4MX7A 5SWSA 1X5FA 1KPUB 3P0GB 5J13C 5DJ8B 5KSUA 5A2LH 2LFGA 1P4IL 2WAHA 5JHDA 1MFCL 3L6FA 5IMOA 1MJJB 1UCBL 3WJLA 4XP6L 1BREA 1JHLH 1IGTA 3WCYA 1GYAA 2NTFB 1PX4A 4BK5A 3EYOB 3T65B 4LSVH 1KF9B 4L4VA 5BXFB 4OCWL 5T5NG 3NIDE 3O3BA 4KKCC 1MFAL 1OD9A 4K3DL 2FL5B 15C8L 3UPRB 3QIBA 2A9NH 4BFGA 3MRFA 4IRJC 1MVUB 3DXAD 5E1AB 5I6XC 4IS6A 5ANME 3T77B 4HF5L 3TV3L 3RNKB 4KI5E 4D0CB 2G5RA 4LCCB 4JG0H 1TDQA 1VFOA 4TNWF 1ZHNA 4X4ZA 4EI6A 5TDPA 3V4VL 5D1QD 4M62H 3GDBA 3QIUD 2HFGL 4KPHL 2YSSB 1NFDB 2A77L 1KLGA 5AG8A 4U1GB 1DQDH 4XI5C 1J1XH 4LOUC 1F2XK 4LHJB 4ODVH 4RAVA 4XCFL 2AABH 4RMWA 4WO4B 3C60D 4CMMA 4F7EA 4LCIL 5IB4B 2EXWD 3HC4H 3FB5B 2C7UA 3RDTC 2QQNL 4EN3D 4BFIA 5DS8B 4HJJL 1E28B 4L3AA 3VD4A 2FEDC 1ZLVH 4OGXH 4XC1L 3EYOA 3T65A 1UG9A 4ZS6D 2EZ0D 5EO9B 5IVXE 2I9TA 3O45A 3WLBA 2HJLA 2ED8A 5CEYB 5DYOB 3LAFA 4EEEA 5JOEA 3P11H 4PGBA 3U46A 2BOCB 3PGFL 2I9LA 4HPOL 4U1IB 3S3SA 2IWGA 1A5FH 4U6XA 1J18A 3QBTB 1W2KT 5HXMA 3IF1A 5A2FA 2E7MA 2WIMA 4JDTH 1F3JB 1QSFB 3B2VL 3VXPB 5GGSA 5ALBH 2RCSH 2OBGA 1K8IB 1NUGA 1B6DA 4G6AC 4JM2F 1SYVA 4MD5A 3Q1SL 5J12C 3CCHB 1J1XL 4ODUB 1K8DB 1V7NL 3DUUA 2OTUB 4MXWL 4U1KA 3S35L 3KPOA 4JN2A 1OTSC 4S1RH 4J3SA 1GVIA 1HSAA 1W72H 3EOTL 3VWJA 1DL7H 1JV5B 2VLJA 3W5NA 5D7IB 4L8SC 2CGRH 1T89C 3L3HA 5DS8A 2CJUH 1NCUA 4LSRL 1DUZB 1LEKA 1RFDH 1SJEB 2J8UA 3LN4A 3K7UA 5CBEA 3Q3GA 2BMKA 4KZDH 2GJZB 4UTAL 4M4RA 3CGTA 4NJ9H 4WEBH 1UB5B 4Q6IB 2FSEA 4R6UA 4JHAH 2AV1B 5GS1C 3BKCH 4Z95H 1D5ZB 1VEOA 1B6UA 1I85C 3IDMB 1FGVL 4HD9A 4LLQA 4OCYL 3NIDF 1QRNE 1OAQH 4LRNL 4XVUC 3MACH 4XAWH 4UT6H 3REVB 3RWEA 4TSCL 4J12A 4LEXH 3WS6A 2JIXB 3KLHD 4MS8C 4K3DH 4OZGE 5I1IL 4OD3L 3MLXL 2AJZA 2OX5A 3NFSH 5DJCA 4LSVL 3DURA 2CLVB 1LWRA 4XNZB 3WIHL 5IQ9B 4UB0H 2CLZB 3O4LA 2DQJH 2YK1H 5F9JB 3QUXD 3ULUH 1M7DA 1AC6A 5GRUH 3RDTB 5ID1B 5D7JA 5IJVB 4YZFE 3UAJD 3VDAA 2P42B 2Z93B 1DQQB 1W8NA 4EIZC 1AJ7H 5DHVA 1D5XB 1MCKA 3OPZH 2OL3B 4LHUB 4L4VE 3Q6GH 4BH8A 2NXYB 1BVLB 1NMAL 1XR8B 3MV7A 5DF0A 4WWID 2DS4A 3AMLA 1AR1D 4OF3A 4F9PA 1L0XA 4LLDA 5AWNH 5BMFL 4OJFL 5F72S 4G6ML 3VXUD 1XGUA 3U0TA 1AP2A 3GSQB 3GEWB 5DHVH 3KXFD 3QWOB 4U0QB 3RZWA 2NX5A 4DKFH 1S7QB 2J8HA 2Q8BH 4JFOA 5KANI 3HI6L 4M61B 5SX4H 4S2SB 3B9AA 4BZ1H 5IB3B 2FBJL 3WNKA 2C1PB 3W9DA 2JB5H 1N8ZA 1MI5B 3BZDA 2XOTA 2BNRE 3UTTE 3NIGE 2ARWA 4PG2C 2F8VA 1A9EB 1N7MH 4PY8J 3MUY1 4G3YH 4YDKL 3V52H 3CFBA 5IMLB 4QXWA 4K7PL 4NRYA 2CLRB 2HFFB 3BEWA 5H37H 2ITCA 2IANA 3DI3B 3WDJA 1JPTH 5IGXH 2MQ3A 3P9WB 1SJHA 2J5LC 2NY4C 1XF3B 1VGEH 2X4SB 4Z7UE 3D85B 3FO0L 1MNUL 2NW3B 4Y16A 2BK8A 1OD7A 3C09B 1PKQB 5GISH 1CDHA 3MRRA 3ZKXB 4L4TD 4YBLB 1NBQA 1P9MA 4IRSA 1MH5B 1F58H 3SEPA 4UTBH 2XFXB 3G9VA 5C0CB 5FM5O 4ZQKB 5DRZA 4D0CA 1WZ1L 2OXGA 4HUUB 4X5WB 5DGQA 3G6AB 2HT4D 3DSFH 5D71H 5IUSA 2QQKL 2BVPA 1HCVA 3QDME 2ZCLH 1IC4L 1VKXA 3FRUA 3BHBB 3OGCB 5FO8B 3U36A 3VXTB 2APXA 4OUUB 4O51A 1K2DA 5F97E 4JZJC 1YUHA 4J3TA 3L3DA 2QSCH 1KG0B 2P5EA 4Y5VA 3BO8A 2F58L 3G6JB 2NY0D 4PJEB 1J8HD 5EO9A 1A4KA 4OD2B 3KLAB 4HWBA 4LLVA 4K8RC 4L8CB 5D70L 2ZUSA 3VRJB 5B38A 2C4FT 5HHME 4PP2B 4RQQB 3QPQD 3R1GL 4Y16B 3MXWH 5E8OB 4ZFZB 4JFHD 1TZHA 1PKQA 1QLRB 2ADGA 5EUOE 3TGXA 1QNZH 5L2JB 4IRJA 1JF6A 4KK6D 1OTSD 3VGHA 2RIKA 4EJ1C 4P5KA 2B4CH 4XP5H 1C7TA 1E0OB 1FPTL 2P5WA 4L3EE 3RVTC 2Y06H 4FQJH 4KTDH 1RMFL 4Y5VC 2AQ1A 5DWUH 5J1AA 5MP6L 2UZYB 3BD5A 3HE7D 4PB9L 3TBYA 2GUOB 1Z5LA 4JB9L 1EO8H 4K8RL 5DVOA 1WC7A 2X4RA 1FVDB 4OGAD 2X44D 3A67L 3U7AA 1QRKA 3RWFA 15C8H 4FQCH 4KU1A 3QI9D 2YZ8A 3QA3A 2X6MA 4F33B 1WIUA 2L7JA 1AXIB 1RY7B 2V5RA 1CLZL 2UY6A 3MRLA 5HI3D 4JN2B 3OF6A 3PQYA 4XP6H 1QRND 1FZKA 1M7IB 3KHOA 2VL4A 2Z8VC 3T0EE 3FJTA 4PJIB 2F53A 2EIZB 1I1AB 3TT3L 1OP3H 4J1UA 3OAUL 1V5JA 3MX0A 4ZG1A 4YEFA 5DRNB 3FCTA 4G9FE 2JELH 3QIWA 4PRBA 3QUMA 5JNYA 2A6KB 2H32H 1S7TB 1UM4L 3BQUC 3B2UD 3GBNL 4PB0H 5I75C 4Q97A 4PJXF 4FQXD 3UBXB 2YMXH 1JWUB 2X40A 3N85L 3U4BH 4NQCB 4OV5B 3STLA 2IAMB 1HSBB 1U8JB 1CT8A 4N0YL 3NCCB 5E8EA 4BK4A 4EN3A 1XGPB 4KUCF 4OJFH 3OKYA 1Z5LB 3OMZA 3PWVA 3RVUC 2CDEB 1KIPA 4PRHB 2CLVA 3A6CL 2NXZD 2F5BL 4MAYD 3I9GH 5TPWH 2Y36H 3ARTA 3LKOA 1I7ZA 3SGDI 4PJ9A 3ZKNC 3VFRB 4HIHA 2OZ4H 2VLME 3BYTA 3SKNA 2ZUQC 4DZBB 2GKIA 4XB8A 4Q7DA 1JZ7A 3ZHDA 2OTWA 1EFQA 5IB5B 1DDHA 5FCUL 4DEPC 1X9QA 1HHJA 2ESVA 4LSUH 4HSQA 1RPQA 2DYPB 5DJXA 1GPOH 1UM6L 4OZHF 3PWJA 1JBJA 2WBWB 1A4JB 3NFPB 5DK0A 4UV4L 3FOLB 3T77A 4CGTA 3V0WH 4YHPB 3JV4B 2X42A 4HS6B 1BIIA 2VZTA 3O3EB 4K94C 1MUJB 3QCTH 4KKLD 4OLZH 3V6FB 4NCC1 4U3CA 3WSQH 4WV1B 3WFCH 4E5XA 4Y5YC 4YHOH 4O2EA 1IQWH 3BZEB 5I1JL 3CVIH 2MKWA 1JTOA 3KS0H 2PW1B 5FO9B 3FO2A 2VLKE 4WWKC 1Z9LA 1IEHA 5ICXB 2VDKH 1ADQH 4HH9A 4O9HH 4XT1C 3QDJA 5GXBB 1B2WH 1GL4B 1QSFD 3QJFB 4CMHB 1X7QA 3HAEG 1UKSA 4ZD3H 1RZKH 1WJ3A 1X5KA 4S1DD 4PFEA 4NO5A 3H9SD 3VFUB 2Y06L 5T3XD 2H2SD 4HGKC 4U7SA 4D0BA 3VE0A 4PJ8A 4Z0BH 2ZKHH 5C2UB 5I1HH 4NJAL 4PJAA 1IEBB 5FOBB 2VDMH 1KUMA 1W72L 3WBDA 4YFLF 3RVVC 4M3KB 1Q94B 5D1ZC 3NMEA 3RWIA 1V7NH 1RIVH 4LSQH 5EBWB 4OZGF 5ICZB 5C07D 3SJVB 4N68A 1NCNA 3QH3B 1MFNA 2ZOLA 4WO4D 4K55A 4CADA 5JW3L 1KIQB 4ELMA 5I66A 2RCSL 5FUZH 1QO3B 5E6IB 2DAVA 3TN0C 1F4YH 2JJUA 4NBZB 3O3AB 4P9HL 5JUEL 2UUDH 4R0LC 4M7LH 5M7QA 2DQGL 3MRPB 4W81A 4PRDB 3KPTA 2A6DA 3U2SB 3HZVB 1NCTA 3IS0X 3VA6A 1SYSA 2ZCKL 1T1YA 2R1YA 1M6OB 3ZZ1A 4Z7VE 5BJTA 1AXSA 1S7SB 1JWMB 4R4NC 1U92A 4N0UE 3VXME 4XC1H 3VH8A 3GNMH 3VDCA 3U1SL 1MJJA 3FB8B 3SKOA 3L3OA 4I2XB 1QHPA 4OZHB 4X7CC 5BRZD 1FH5H 3IFNH 4Q6YA 1HXMB 3PXHA 4M6OL 5L8KB 1MCNA 1IFHL 3IJSB 3FKUS 1QLFA 3TEUA 5E6ID 5CS7A 3T0EA 4MCZB 4LLWB 2EYSB 3FOMB 5D9SB 2VB5A 1NFIB 1NGQH 4LASL 5HHQB 1IARB 1GZQA 2NR6D 3QUYC 1VERA 3FFCE 1N6VA 3IDMA 3VWJD 4N1CA 5KSVB 3LH2L 4NQSA 3F6IA 4NWUH 4XPGH 5KVFH 4TQEH 5IFHL 3TBYB 4ENED 5E2VL 2EYTB 4K7PY 3MGTB 4PR5B 3NCMA 4A2LA 4G3YL 2JIXA 5DMKB 2OQJB 4QKXB 3I2CH 3OKEB 5EU6E 3HNVL 5EU7E 1CDBA 1ZVYA 4AIZB 1YEDA 4EN3B 5CP3A 5BO1H 3LOWA 4ZUSA 4FQCL 2QQLL 5B39G 3PWLA 1RAMA 1MLBB 3KPNA 3TFKC 1MWAL 2JB6A 3OKLB 3B2UC 1JGUL 1I1AA 1XIWA 4YFEA 3OAZH 3QUXC 1UCBH 2H45A 1XF4B 3K0WA 1A1MA 3PQYB 5TE4L 5AWNL 1E6JL 5C7XH 1IM9A 1HH6A 3N1QC 1IZKA 5EOTA 4BJLA 4XBEL 4MCZA 1YEEL 1FL6B 2CKBH 4U6TA 4CU6A 4HIEB 4NPYB 4HWBL 2EH8H 4G42A 4MWFB 3ARWA 3PJSA 3R8BB 3MXWL 4KK9D 2XQYG 5F1NB 3H3KA 1HHGA 2ATPB 1KFAH 4RGOL 5E8DH 5FYKL 1F3RB 2DQIH 3EDJA 4U6XB 5TF1L 4PJ8C 3QI9A 4UV7L 4PJ9D 1IGFL 1NGPH 1J5OL 4KAQH 5C09A 4XB7A 2IQAA 3MROA 4X4MA 5MENA 4OAWA 2IAMA 4JQVC 1E4JA 4X83A 5CHNA 2VKWA 2LAGB 3DHMA 4U49A 3H3PH 3PQYD 4MVBD 2R56H 3O8XC 2DDQH 2F54B 1BX2A 4GS7B 1B88A 1EK3A 3BPOC 1H3GA 4ZOEA 1VFUA 3MOBH 4TVPL 5FO9A 1RZ8A 4JVWA 4XP4H 5D2LB 2P24B 3HE6B 1YQ2A 2VQ1A 1J11A 4NWTH 5SV4A 2QR0B 1RI8A 4LRNH 3DETD 1OTUC 3KXFB 3ARBC 1VEPA 4JM4L 5IW6B 5HVHB 4ZUUA 5BW7C 4C4KT 3BP7A 1EAJA 5J89A 4H25B 4KXZH 1IGJA 1OAYL 3SDXA 2VDOL 5L8LB 1R3IL 1G7JB 4M43L 4Y4HD 2EC9U 5KJRH 4JM2D 1QPXA 4CVXB 4PRNB 5ESQA 4GMTH 3VMPA 5BS0B 3C6LA 4GBXC 5E1AA 5F71A 3EO1B 3MR9A 5B3JF 2X4QA 4LHUG 3R06B 5C70A 5KVMC 2X89A 1P4LB 3MJ8B 2PKDA 3HFML 2DMKA 5F89B 2OM5A 4JE4B 2EE3A 4XWGL 5E9DB 3BZEA 3FRUB 3GSVB 1A8JH 3Q1SH 4FP8H 4WENB 3BAEH 3X12A 1B3JA 5IMOB 2VUYA 2ICWJ 1AGCB 4WHTA 1KB9K 2R29L 3BXNA 3O6LH 3QDMB 4P46C 3CUPA 2BSTA 1NCWH 5DJ8A 1CR9L 5I1EL 2Q7YA 2NNAB 1II4E 3V5KA 5IMMA 4WO4A 4L8BA 3OKNA 1BLNA 1P2CA 1DBKL 2W9EL 1M71B 2FO4B 5IBUG 1IGTB 3WJJC 5L7XH 3MLTB 5CD3B 3WFBL 3PDGA 5HY9A 1T1WA 1GGBL 2D31B 3AAZB 1LE9A 4S1SH 1ZGLM 3D85A 3RU8L 3TYFA 1CL7H 2LABA 3O2DH 5I8OL 5ANMA 1CFQB 3VGAC 1NLBL 4GG6B 1EDQA 1NFIA 3SE4A 2R69L 1U8HB 4YXLH 4CVXA 4YAQA 5BV7H 2P45B 1NGXB 5B8CA 3GJFA 3MOQA 1FZOA 3ZYZA 4G9DA 2R2HB 3WO4C 5J1TC 5ACMA 3J8F7 4HX1A 4M8QA 4OT1L 4ZO7A 2AABL 4GOSA 4KJYA 1UCTA 1KN4L 1KOAA 1OTTC 4X6DF 2FBOJ 2YUWA 3SE3A 1ND0B 3NAAH 1XF5A 1A7QH 1MCQA 4OF7A 1S7SA 5ID0A 3RRQA 4GRLA 3CFKA 5F3HB 5F7EL 3GSVA 1BD2D 1YYMH 1GOGA 3QT2A 2P47B 1G7QB 4XRCB 2WINA 5HDBF 4KQ3H 4AIZA 2JTDA 1FNLA 4F58L 4M1DH 3RAJL 1O7SA 4ODTH 5IM7A 3KPOB 2ZUXA 1ZLUK 5EO1B 1PYWA 5C6PB 5C0AE 1LP9F 3U30C 4KJQD 2ZCHL 1F13A 3HE7A 5CJ8A 1YEIH 1WITA 3CX5K 4MD4B 3TESA 1UEYA 2ORBL 4P2RE 4AT6B 3UTPD 4Z7VF 1T66C 4LLVB 4L8CA 3MLVH 3HZMB 5GRVL 1HH6B 2DQUL 4RQQA 4ESKA 3B9KD 2XN9A 2R4SL 4LFHD 3VGEA 2EDYA 2YA0A 4KZDL 4DFIA 4PB9H 1GZQB 1ES0B 5L6YH 5E94B 4MLIA 3KYNB 1GH7A 4HK3J 1K9TA 3LEXB 4G9DB 4ERSL 4YFLI 5D2NC 1IAKA 1MCDA 3BUYB 3HAEA 4MJ4A 1G0DA 4X5XA 2GUOA 4G6FD 1J7VR 4M1GL 1EHLH 2R0ZH 2YKLH 4ELKA 1L4IA 5DMKA 1A02N 4Q74A 3OGCA 4LCWD 1INDL 2JCCF 1RZIB 2QHRL 5F6IB 1M05A 4H5SB 4MNQA 3QA3B 5F7NC 4FTVE 3ORJA 4M02A