3QHZH

Crystal structure of human anti-influenza fab 2d1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
232
structure length
222
Chain Sequence
EVNLRESGPALVKPTQTLTLTCSFSGFSLSTSGMSVSWIRQPPGKALEWLALIDWDDDTYYITYSSSLKTRLTISKDTSKSQVVLTMTNMDPVDTATYYCARTLRVYVRDFDLWGRGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An insertion mutation that distorts antibody binding site architecture enhances function of a human antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Human monoclonal antibody del2D1, Fab Heavy Chain
total genus 40
structure length 222
sequence length 232
chains with identical sequence I
ec nomenclature
pdb deposition date 2011-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qhzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qhzH01
1XCQB 1LDPH 4YDVA 1MJ7L 4IDJL 1AE6H 2ZCLH 1A6AB 3VFUA 1YYMH 3MRRB 2AERT 2EDEA 4CJ0A 4RFNC 1YQ2A 5C2BL 4U2YA 4PG9B 4CN6A 5F70A 2DM2A 4Z7NF 1NFDE 4WU7A 4FTVD 4O5LL 1QLEL 1OGAD 4JFZL 4JY5L 4Y1AE 1BGXL 4WEMB 3CMGA 4DAGL 4PLKD 1MVUB 1R3IH 4GAYB 5EOQL 4XI5C 5IBTL 2ZWLT 2DLIA 3VXSB 4QHKJ 3OXSA 1U3HC 4OCSL 4IMLB 4PJDB 1MJJA 5E8PA 1F4XL 3QDJB 4QHKI 1CR9H 2HFFB 3P0YH 4PJFA 4U6YB 5FUOL 2CRMA 1KIRA 4QXGH 1P7KB 3E0GA 4QYOB 3MLUL 1VFBB 1BREA 3KPNA 1CDBA 1FZMA 1EXUA 1EHLL 3MGTA 5B22A 4K3HA 1YNLL 5I18H 1NGQH 5IJVA 1UM6H 4NRZA 2Z35B 3PF2A 2HT4C 1S7VB 2V5SA 4KMQA 4NFCA 2W0FA 3QQ3A 1IE5A 5I1JH 4R3SA 3CFKB 4W6XB 5IBLD 2PO6A 1DVFA 4K7PH 3MPCA 4X0KB 4WUUB 1DLFL 4OZGB 3TFKD 4RIRA 2R0ZH 4YHOH 1I1AB 1RMFL 2H8PA 1FN4B 4PJGA 4N5ED 4PUBL 3H8NA 3RNQB 3RL2A 4R90H 5F9JB 3NABL 4G8GE 3QDME 1CF8H 1C5DA 3PUCA 4PJ9D 1BJ8A 2NY3D 3HAEB 3KG5A 4LCUB 3DVIA 3U1SL 2V2TB 4X6FB 3EYFA 3GMOB 1MY7A 1EEUA 4P9MH 1Q9KB 3WHXB 3TJHD 3RA7L 1HXMB 5CP3H 4A2LA 1CL7I 5K9QI 2Y5EA 1NSNH 2HFGH 1XZ0B 1GGIH 3SOBH 5HHXH 5HHNB 3ZTJG 3BDBA 4HJGA 2JIXA 3GRWA 3OKYA 1PSKL 5IR1A 1T89C 1T3FA 1A7RH 4YNYB 3UZVB 2R1WA 5DUPL 3KWWB 1N0XL 1OGAB 5I6XC 4WWKA 1RUPL 3EYSL 2PKDA 3V4PH 3DO7A 3HRZB 4X7TA 1G0YR 2XFXB 5E2UH 4E41B 1T20A 3MRGA 3TNMB 1K4DB 1RD6A 4BQBA 1Y6NR 5E9DE 5IB5A 3MACH 3HZVB 4U1HA 1Z0MA 3RTQD 4BH8B 1WZLA 1JHKH 2NY4D 4N8PA 4JPWL 5CCKH 1N6UA 1KIUA 4FABH 2YUXA 3GBML 2B2XH 4JY6B 1CG9A 2Q76A 4P2CG 5HGDA 2NW2A 1SBSL 1U0QA 1E6OL 2ZJSL 3WD5H 3PXHA 5HBBA 1TTGA 4R4FL 1UXWA 1KLGB 4EZMA 3BXNB 3OSKA 3VFOA 3KXFA 4A6YL 3CLEL 3L5WB 3DUUB 3CFJB 4XC1H 5F72S 5F96L 4ISVB 1MCPH 3LEXB 1G6RB 4CADB 3QPXL 2ZUXA 3RAJH 3VD5A 3WEXA 4ETQA 5D2NC 1KFAH 1MCNA 5FGSA 3MGOA 2YPLE 2MMXA 2R0KH 2P5EA 2F5BL 1X5YA 3BZFA 4QRPD 3S36H 4APQC 1B6UA 5H8DA 1QR4A 2X4SA 3T04D 1CBVL 5SWSD 5DLMH 1S9YA 4M43L 3VXSA 2VDOL 4J1UB 4I2XB 4IMLA 4PJDA 3B2VL 1XAUA 5CJ8A 4MNHB 1PGRB 1T04A 3PDDA 3FB7B 4XXCA 3VRJA 4L9LA 4KKAD 3IAPA 1AFVL 1H3WM 1QACA 4MJIB 2X5PA 5E7BA 1WBZA 3EOTL 1P4LB 5ENWB 4XGZA 3TIEB 1I3RA 1A4KA 2BCKA 3NCJH 1OAZH 2X6MA 5GSRA 3TBYA 4PP1D 1S7VA 2FIKA 3KYMB 4X6CF 1NMAL 4X7FC 1BD2A 5ETUB 3GSNA 4HJJL 4M4PA 2OR7A 4F7CB 2YPLA 4GMSH 2A2QT 1UQSA 3QULA 5C6TH 5DJ2B 5FYJH 2DDQL 4L5FH 5IEHA 1T03H 1C12B 2IEPA 1JV5B 1YMME 1RQ5A 4ZXBC 2BXYA 5D8JH 5I18L 1RI8A 1VACA 1F3DJ 4PJ8D 4Z7QF 1Q38A 4JGMA 4NQDA 1OVZA 1T0NB 3F58L 2X09A 5D7SH 4HLJA 5T1KB 5GSVA 4JFQB 4ODBD 1IEAB 5AWNL 1R3JB 3QQ4B 2GTWB 3AS1A 5C3LD 2ZP0T 2Q8AH 4R90L 1DQLH 3ARSA 3EYOB 5EU6A 1YMMB 3V4VH 1YPZF 1LO2L 4NN7B 1AR2A 2HFEB 3S7GA 2EE3A 1BX2B 2NY5C 2NX5A 3U1SH 1GIGL 4IRJB 3EIFA 4UQ3A 3EJZD 5K9KB 4P2RD 1BBDH 1K8DA 5FDWB 4F9PC 4H20L 1CGUA 2B39A 3NAAL 4J3OC 1GGIL 1YEJH 3U2SB 2E9IA 3X3FH 1SVCP 1QBLH 3ECBA 1SJVA 1RHHB 4YHZL 1NDMA 4XVJH 1RJZB 1NC2A 5LAXA 5LGJB 2E7BA 4UV4L 3LZFL 4JM2B 2AJZA 1U3JA 1V3LA 3HMWH 5HHQB 2YD3A 1S8DA 3C2SA 3M17A 2P43B 4WI4A 2JCCE 1KJVB 2A0LD 1JRHL 3U46A 5BJTB 3K1KC 4R26H 3JUYA 4U31A 4PJCF 4LCWE 5JR1L 3L3KB 3MA9L 2FX9H 5DD6A 4KQ3H 2HT2C 4HK0B 4IRSD 5F7HA 3BRGC 5B3JE 3V7MA 2PYED 1TQBC 4PYGA 5I66B 1JYVA 3L3GB 1P9MC 3MO1A 5TDNB 3QWRD 1IT9H 1AXSA 1QSFA 5I71B 2YBRA 4PJEA 3IGAB 1DCLA 3ARWA 3P0VL 1X5KA 2GTZA 2DQCL 1T04B 1KJ3L 3GSWA 3MRCA 3D18B 5ITFA 5F21B 3EYVB 3VH8A 1FORH 4RGOL 5CINL 2H45A 1OCWH 5E9DB 1HH6A 3FOLB 4JAMA 1HSBB 3ZE1F 2D4DA 2F8OA 4IOIA 5SX4H 5F7DB 1T20B 3MRGB 3TNMA 3T0AA 3MRLA 4I4WA 3MXVL 4LK4A 1GGUA 3WIHL 4K3DL 5TPWL 1CGVA 3KPSB 3C2AH 2HT2D 3FN0H 3HPJA 1MCQA 1PG7X 3JWNC 5IBUB 3QB7C 5JOFA 5EWIL 1LO5B 1CS6A 3I3BA 2P48B 3N06B 3H9SA 2FLBT 3MJ9A 3ZYIA 4KVNH 4AZ8A 4L29A 2BSED 3LKQB 4YLQT 3L3DA 3KLAB 4CU8A 2W0LA 5E6IA 2ATKA 4L3CA 3RVTC 3QP3A 2OMNA 3NA4A 5IVOA 1P84J 4NO3B 2BVQA 2Y36L 1ZHBB 3HUJB 2P5EB 4ELKA 3EJZC 1E27A 1WJ3A 5MP6L 3KPSE 4UQ3B 1NMBL 3ARYA 5MERA 5IG7A 5C0BA 2D0HA 5C0DB 4POYA 4N0RA 1NH6A 4HIEA 5DZNA 4KKNA 1J1XH 4LLMA 3P3YA 3VXQA 1KTDA 4BFEA 4D0BA 2IFGA 4XTRC 2BJML 1BIHA 2RFXB 4H0HB 3WLBA 5HYSA 4I0PC 3R06B 2MSPA 4WEBL 4H26B 4OZ4B 2ED8A 2OZ4A 3FO1A 4MD4B 2DOCA 4OZGA 3BH8A 4XP5L 3DNKA 1GVIA 4P3DA 5DC9B 1NQBA 1KJVA 3VGDA 2D9CA 2WWMD 3B43A 5HGAA 4Z77A 2BRRH 2DLFH 4U1SA 1BBDL 2RAMA 3ULUD 3V6ZA 4KJYB 1B0WA 1FYTE 3HR5A 4PGZA 1MOEA 5DJCB 3HAEA 3HC0A 3RPIA 4ORZC 3KLHC 3RVUC 1IM9D 3TVMC 4XWOD 3FCTB 1KENH 4YHZH 4XVUC 5GS1B 3LSOB 5DK0A 4JFEE 1U8HA 4JFYA 4OIAA 5KSBB 5J4MA 1HCFX 5DF0A 1CZ8L 5DQDH 1OSPH 3VA6A 2BOBB 1KACB 5KOMC 2VLRD 5T5FL 4NQSB 4GSDH 3MLTB 2NCMA 2A73A 2ZSWA 5GIRA 3IDMA 4JFQA 4N90E 1ZHLB 3ARBD 3MTRA 4M8VA 2PR4H 4KK5D 2DAVA 5BOPA 2D7QA 3UCRA 4NNYA 2F74A 4N0UA 4CBPA 1CFBA 2XZCH 2CUMA 1XR8B 3K4ZA 5F3BA 1MFEL 3QFDB 4BH8A 1ZHKB 4Z5RA 1I4FB 4UINH 5GS1C 1R3HA 2VWEE 5DJDB 3OGCB 2P8LB 4LSRH 1II4E 3V5HB 2X05A 5KJRL 2I27N 1GCFA 1JWUA 5DD5H 2DQIL 4J23A 1DEEA 5I0DA 2NTSP 3LS5L 1NBQA 3MQIA 5JMRA 1RZFH 4TN9A 3T65A 5GRJL 4HXBL 4G9DB 5HDBF 2CJUH 2Q20A 4XCFL 4Y2DB 2DIJA 5H35B 5I1AA 5LXGL 3PNWA 3GMQA 2NY6D 3TH3T 1I1AD 1MLBB 1V7MH 3PV6A 2NTFB 4QKXB 4PLNC 1CK0H 3EFFA 4HUNB 4KI5C 3UTTB 1T2QL 3GI8H 4LEXH 3ULUC 2P5WA 4GRLD 3MNVA 1S9YB 3C2AL 4RGNE 1K2DB 5D1ZD 1JL8A 1TJHL 4P2RE 3S4SG 3IFNH 1CLOH 4OAWA 1IGML 5FGRA 3M07A 4WUKL 5EC2B 3QIBA 2AK1L 4JGUA 3K2UL 1Q9WB 1A6WH 1XCTB 4HUKB 4W81A 1INQB 4LARL 3RWJB 2BSRA 4EBQL 2IANA 1R3LB 4XMKH 4HIEB 2KQNA 1NEZG 4QF1A 5DMIL 2CLRB 1B2WH 5HI4C 4ZXBD 4YEFA 4YHKL 4P23D 1JWMB 5C0GB 1IQDB 1KELH 1QO3B 4KGLA 5IVZA 1M6OB 5FOBA 2XXCB 1UFUA 1LDPL 3BW9B 4PREA 3D85D 1DDHA 4LHQB 1CFQB 5ICXB 5FA4B 4F58L 1IM3B 2CDEA 5DJ2A 5DJYB 1IAOB 4M7JH 1NMBH 4MA1B 3B9KB 2V2XB 4KRLB 3NGBC 5D7JA 1HSBA 5MHSE 1S9VB 5CEZE 1J1XL 4XPFH 3PQYA 2F9BT 4AENA 5I1DA 4JY5H 2OQJA 4HFWB 1CU4L 4X5WA 3KPLA 5E2WH 2HVKB 2OL3H 5IBTH 1YQVH 4WVRA 2EZ0D 1XF5A 4FQJH 3JWOC 2ESVB 1HN1A 2ZUYA 4GG6F 3D39B 3G5XA 1P4IL 3PHOB 2HH0H 5LGKA 2V9RA 3I6KA 4X4XA 5ANMB 1XGPA 3TH2T 2WUBH 4LVHB 4WJ5B 4HJ0C 1EO7A 3P11L 5GGSB 5TE6L 1OSZB 3WIFB 3WUZA 1MFBL 5EIIA 5I73C 4UBDD 5JO5B 1X6NA 1WAAA 3P77B 2WINA 4KFZC 3SCMB 5C0JA 5GXBB 3GDBA 2W38A 4IJ3C 1MCWM 3MV7A 1OPGL 4Z7VA 2RHEA 1EAJA 4QEGA 2XRAH 1QD0A 4HIXH 4YHOL 4MQ7B 5FKPA 2OZ4H 4DJMA 1LK3H 1OW0C 3U0TA 2DJSA 5MERB 5GJTL 4JKWA 2OMBA 1HIMH 4JPVH 4A6YA 3QO0B 1A5FH 1S8DB 3M17B 1KTDB 4PJEF 4KDTC 1BFTA 1GPOL 2XA8H 4WV1C 4U33A 4XX1E 4Z0XB 4HCRA 3B2UD 1KBGL 2Z31B 4J6RH 3RTQC 5F3HB 2WK2A 3F65A 5BVPL 5SX5K 2BC4B 3GJFB 1WFUA 4HS6A 2KH2B 4QWWC 2HFGL 2PW1A 4ZPTA 2J7LA 5FF6A 1JNNL 5CP7B 1B9ZA 2D7TH 1U92A 2H3NA 1F45A 2IFFH 4L8DB 5C86A 3MO1B 3O4OB 4YK4C 1YNTA 3RVUD 3WXWH 4DGIL 1J0JA 3LN5B 3O9WA 1Z3GL 4X8JA 4KMLB 3CK0H 1RZFL 3B5TA 1RIVL 3STZA 2BVEA 4Z7UB 2UZIL 1OTSC 1S5HA 2BSTB 2V7HB 3V4PL 3LSOA 3STLA 1NGXB 3IJSA 1U8HB 4QTIH 3MLPA 3VXMB 1BP3B 2HLFC 1KJ2B 5KSBA 1NLDL 1M7DB 1V7ML 3O2DH 1MCOH 4PJAB 1X5HA 4AQOA 3QIWC 2E27H 5DURD 2OM5A 1HOCA 4G42B 4U0RB 4FTVB 1BFVL 1IC4H 3KLHD 1DBMH 1HDMB 1P7QB 2FNBA 3O6KH 3PWJA 4Y0GA 4WUUE 5I71C 3TF7C 2OSLA 4LU5H 1WF5A 4B7IA 5JW3L 2XY2A 5IWLC 5I15H 4YDIL 4JAMB 1MF2L 1SJHB 1CLOL 4GRMA 4WUKH 3FQUA 5C07B 4PGBB 4XRCB 4XC1L 3H9ZA 1WV7T 2XN9D 4PRPD 3AY4C 1RK0A 2C4FU 2AJ3B 3GSRA 1INEL 3ABZA 5DQJB 2ILLA 2XOTA 3FKUS 4P2OC 4PJDE 3VFRA 5L2JB 4POZD 2R0KL 4XBGA 3NPSC 2CLVB 4YHKH 3X12A 1CXFA 5D96C 3VGBA 3LQZB 5DEFA 1TZIA 1MIEH 2EZ0C 1U95A 2X1XR 4HT1L 4L29B 1WSST 4JR9H 4L4VA 3MX0A 1G6RH 3PWLA 4YC2C 1EGJH 5C0CE 3QDGA 3PIQA 4FMFA 4LVOB 5KVEH 2JE8A 4F80A 2J88H 4ZUTB 4X4XB 3T0XA 5E5UB 1KT2A 3SGKC 5IHUL 2XKSA 4U1IA 4AM0A 1RJCA 4U1KB 4HAFA 3AS2A 4QXTA 2X4UB 2UYLA 1FVDB 2WV3A 3C5ZA 4LLUB 3LIZH 5ADPH 5DVNA 4XC3H 5E1AA 3CMOH 4P5TA 2JLLA 4XMPL 5CD5C 2VQ1B 3SE3C 3VDAA 1UZ6E 2HH0L 4MDIA 3ZSSA 3VD3A 5M95B 1PAMA 3QCUH 4JY4B 4B41A 4NM4L 3HG1A 1LEIA 4NQDE 3ULVH 2DDQH 4C4KT 5CFHA 3RIAF 1NCDL 3UBXB 4YXKH 1KCUH 4NP4H 3WUWG 2E6PA 1T80A 5DJ6B 4MSWB 5FHBL 5GPRA 1U2CA 4P46B 4RGNC 4OZIE 4MHHG 1CT8A 2IH3A 3D69B 2VUYA 3FRPA 3OV6A 5EU6E 1X9QA 2Z92A 1JIBA 4QTHA 3TO4A 1Q72H 4LHUG 3LH2H 5E95B 4JHZA 3P9MB 2FO4A 3VD7A 4C4KO 3UP1A 1T2JA 1IAOA 1BVZA 1DQLL 4OQTH 3IJHA 1OP3K 3GNMH 4DVRH 3MLRL 1O7VA 2VKXA 1G7PA 1LO2H 4DZBB 4IIQA 4OTXL 5KSBF 1ZK9A 1J88A 1JGVH 3STZB 4PBVC 4P9HC 4ELMF 2QKIA 4LVEA 5CILH 1KG0A 3L7EA 2I26N 4WHYG 2HVKA 1U8MA 3QUMB 5EA0H 1A6AA 1XF5B 4ZS7H 1XZ0A 5CEZH 1D7FA 5DRWA 4GXVH 1JPGB 4JRWA 5CD5D 1IARB 1IKFL 2NR6C 5ISZE 3L5HA 1HKFA 4OLXL 3SBWC 1FNAA 2H9GA 4DGIH 1XR8A 3QEQA 3FB6A 2H26A 3JXAA 3VXUA 1W0YT 1FP5A 5F6HI 3HMWL 3NPZB 15C8H 4BKLB 1TVDA 3CH1A 4L4VD 1NUDA 1D5MA 3O6ML 4GKSB 1BJ1J 3IFOA 4P4KA 1NUFA 1PG7W 1NCBL 3CDYA 4ZUSB 2BHUA 1BF2A 2VERN 2FX9L 1S7WB 1TMCB 4M5YL 2XT1B 1UADC 4UBDC 1G9NL 4G9DA 2E7LA 3MRKA 2IAMB 3QWOB 2Q86A 1EERB 4NO2B 2DB8A 2H2PD 2NW2B 3KLSA 4FQIH 5C0AD 3CSBA 4U7KA 2IPKA 3I02A 3RY6C 1FGNH 1DVFD 1EIBA 3RWHA 2CQVA 1N2RA 2P5WB 4ZODA 4PJGF 2CIKA 5DD1L 3MA7B 2NLJB 5JIIA 2WBWB 3N0PB 1KLGA 1XH3A 5FM5M 1NGYA 3VGAC 4MJ5B 2VABB 3T77B 4MLSA 1UEMA 1GHFH 4XBPA 2R4SL 3DUUA 1PD6A 1LO3H 3K4AA 1MI5D 4MA7L 4YHNA 4QRTA 4OLWH 4I0PD 1BWMA 3STLB 4R4BB 4LPVA 3D1MC 2EDQA 3G9VA 2YK1L 1I8MA 5I1LB 5TJWK 2OS7A 3H9SE 3BPOC 4AMKL 1SQ2N 2ADGB 4XAWH 4I2XA 4G8EB 3L5XH 2FIKB 3KYMA 5CIPA 1GGTA 5HDQH 1NLBL 2ADJB 4FQQA 1VB9A 5E5RB 1UKQA 4KQ4L 1AKJA 4NOBA 1FDLL 3RPKA 5F9WC 3AREC 5J6GA 5IM7A 4PJAE 4NUJB 2NMSA 5IQ7H 4I0KA 4XZUA 5C0BE 4HUMB 3BSZL 2DMBA 4MXWH 2FDBP 4MAYA 5L2JA 4XVSH 5EO9A 5L8LB 3HE7B 1BVKA 3R0NA 5GRUH 1CLCA 5IEHB 2C3XA 4LCIL 5IP4A 1C12A 2XWTA 1B6DA 3Q6FA 2X89A 4PJ7A 4QRRA 2EXYC 4NQCA 3QNZB 4RISH 2GSGA 5CUSH 1YMHA 4R0LB 3VWKB 4K7PL 5D71H 1EFQA 4KUCF 3MNZB 1MCRA 5J9PA 5KANG 1RMFH 1JGVL 3EO0B 3UZEA 4FHBD 2XIDA 4Y5YA 5GS0D 2EO1A 1OOAA 1CGSH 5DRZA 4NO0B 3BP5B 3T1WA 3KNBA 1W0VA 3U9PH 4EIZC 1X5GA 1OAYH 2GQHA 5GS3A 3SCMD 3QO0A 4Y4FC 4DUVA 5IJVB 3QXDA 2HN7B 4S10A 4Y19D 3TCXA 3SPVB 5INCB 1LE5B 4GXVL 3MOAH 3JVGC 3UTSE 2C1PA 2DI9A 1IAKB 5GGTH 3TT1L 2BVTA 1ES0A 3WNLA 3ARFA 2PTUA 1ETZA 4X7SL 3P40A 2NNAB 1F4YL 4PJIE 2ZUQC 2Z8VC 4K9EC 1MFAL 3P9LB 4WU5A 5GQBA 1C5BH 5ITBH 1A6ZB 1QPXA 4EN3C 5KOVC 3I02B 4GG8A 3D69A 3EUUA 2CRZA 2VJXA 4O5LH 4G8GA 2B5IB 3KPRB 1J12A 5AAMA 4IRSC 4EN3A 3DMMD 4JFZH 3LKNB 5L8JB 2NYYC 3V8OA 1BGXH 5DEZA 2YS4A 2EYRB 1G7IA 2Z91A 4ONFH 4G8IB 4YZFF 2XYCA 3QUZD 2WIIB 4Y19A 3WL9A 5E2UL 5L88L 3Q5TA 4CU6A 1RFDL 1FGVL 3V9FA 4OGZA 5TDPA 4FQIL 1I8LA 3JV4B 4QGTA 4V1DB 1CR9L 3P0YL 1AQKL 1FZOA 4HK0A 4LGSB 3VFNA 5BS0E 1DN2A 4P5MB 2JB5L 1HILB 3L7EB 3X3GL 2GUOB 1V05A 5IOPB 5IB4B 2GTWA 3V6FB 3T0WA 1QBBA 5CJXC 5C0ND 5D1ZC 4LLDB 4R4FH 2FYYA 4W4OA 3EYOA 2XFXA 5T1DH 1IGYA 3V0WL 5ACMA 4PV8B 2IGFH 2HFEA 1I7RA 1YUHB 4NYLA 5JORB 2F5AH 5E9DA 2OI9B 4V2CB 4UT6H 4ALAL 1ADQH 1D5IL 4MD5B 4HUXB 2X44D 5JNYB 1K3IA 4FQQB 4F37F 4AH2A 3NABH 5HHMB 3OKKB 5IWLA 2ZCKL 1M4KA 4XBGB 3UO1H 1ZSDA 1PLGH 2GT9A 1OM3H 4F7PA 3C6LD 4K94H 2NY6B 1WBXB 4OUUB 4AG4L 3FT2B 1CD1B 4LL9A 4RGMB 4Q74A 1UJTA 2OTWB 2YSSA 4KI5D 4LPXA 4X5XA 4KDTA 3OXRA 2YD8A 3PIQB 2QQNL 4P2RB 3IFPA 4TYUA 3RA7H 2MCPL 1G6RA 1IBGH 4LSSL 1L0YA 1HEZA 3PWPE 4JDTH 4JZJC 5J89A 2EXYD 4CVZB 4EBQH 4FQLH 5HJ3A 3VWKC 4XMKL 1RUKL 3RWGA 2OI9C 2AJSH 4K7FB 4TQEH 4LLUA 2XQYG 2DYPB 1IM9A 4GJTB 5EUOE 4HUVA 2NLJA 1E6JH 1IKNC 4YHLL 5I76B 4G5ZL 2I9TA 1C16A 5D70L 3O3BA 1GOHA 1JBJA 2ITDA 1T03L 3BZEA 3ULVE 2FD6H 1YEIH 1NFKA 2E7HA 3DTXA 4MDJA 3SO3B 5C0BB 3KGRA 4NN7C 5CCKL 2Z93A 4M03A 5D7IA 4MSWA 1GZQB 2R4RH 4ZFZA 2CLZB 2BFVH 4ZXBB 4NT6A 2H2SC 3D0VB 5C0AE 5GRXG 5FO9A 1ACZA 2VB5A 1RK1B 1FFNA 1BD2E 5CLTA 4EUPH 4U1JA 1T1WB 3EYQD 4XPBL 3T3MF 3LQMA 4ZUUA 4HDIA 4EXPX 5JDJA 5C0FB 2NY2D 2DRUA 3LD8B 1U9KA 1GYAA 2R2BA 3GMMB 3U9PL 3ZE2F 2VZSA 3VWJC 1KCVH 5BOZG 1VDGA 1WUNT 3LQAC 2Y6SC 2J6EA 4K3EH 5A16B 4NN5B 4MZ2A 3ES6B 3WLWC 4PP2A 5EUKA 4XVUD 3RPIB 4OF7A 5L2KA 4I13B 4E42A 3FTGB 4FFYL 4WGWB 4ODTL 4WHYH 5A2JH 3HPJB 1UZ8B 2CRIA 4U2ZA 4U1SB 2P8MA 1YN7B 3QUXA 1LP9A 3O3UN 3H9YA 1PKQA 3E2HB 1MHCA 2R56H 3O8XB 3LRSB 1EBAA 4TTDD 3W81A 5CKGA 1FZKA 4NKIH 1FYTB 3I50H 4LFHG 5DK0B 3LKQA 1HIML 4M6NH 1IC1A 5GGVY 1XT5A 5DQ9B 2FYYB 3GUTA 1QSFD 4P4KB 5DDHA 1C08A 3VE0B 5AYUH 2ZSWB 5GIRB 2N4IA 4U1GC 2CKBH 1DN0A 3ECBB 1B88A 4L5FL 1JNNH 4E41E 3NZHL 2PTVA 3DPBA 5IG7B 3VFWA 4JM2A 3ARFC 1KLUA 5C0DA 3WXWL 3MJGX 1A4JA 2IALB 3IXAB 2D4FA 2BNUB 2KUTA 4LCWD 3HC3L 4X7CC 5HYSB 4QOKE 2YWZA 3WFEH 1KTRL 4PTTB 3BH9A 1T22A 3OAYH 3IDYB 3WFHA 3GMLA 3KPPB 3BEVB 2CIKB 3QH3A 1WC7B 4WU5B 4YGAB 5C0RH 4X4YB 1TVHA 2Y4SA 4Z77B 5FOJA 1OM3L 2VABA 4DN3H 1DFBL 1R5WA 4P5KA 1BFVH 1IC4L 5J3HD 4JPIB 3EGSB 3GB7A 2NXYD 3VG9B 1PZ5A 43C9B 1UJ3A 2FWOA 2XTJC 1MAMH 2LV4A 3FCTA 3K8MA 2Q8BH 4Y19B 5HVHB 1FLRH 4LCWA 4OB5L 4R4BA 2DQUH 5EBLA 4ZO9A 3TA3A 4M1DL 5BMFL 2PYFA 3T0ED 1JFQH 2FX7H 1LEGB 5D96B 2GEEA 2GUOA 5GISH 4Y4FB 1J86A 4KY1L 1HH6B 4GQ9H 1MIEL 3C08L 3F6LA 4LQFH 2VLKD 4HT1H 3TP4A 4DVBA 5LWYL 4ZFGH 5J1AB 3WKML 2CO7B 2APFA 5IM7B 2MQCA 4Y88A 2GY7B 3SGEI 5E2VL 5IVNA 4H1LH 1S9VA 5IHUH 3H3PH 3TT3L 1J1PH 3PQYB 2BFVL 4B50A 3FL7A 5HGHB 3KDMA 2OLDA 1VEMA 3S3SA 3ZKXC 1EAPA 4D0CA 1JWUB 2F54D 2DLTA 4D2NA 3BDYL 1I9RL 4OZGF 4HZAA 4PB9L 4XPBH 5F1IB 1F6FB 4X5XB 4NQEA 4DKDC 1CGWA 2I5YL 2BRQA 1G9ML 2EKJA 3SEPA 4RFEB 2E6QA 5EBWB 3TH4T 1KCVL 1NCNA 3LRGA 4OCLC 4WEBH 2XWJA 3GKZA 3I6GA 3PP3H 5D1XD 1E4KC 4K3EL 4KRPC 3TM6A 1FORL 3KPSD 1NCDH 1CQKA 4X5WB 5HYJE 3FN3A 35C8L 3TYGL 3WO4C 3NOIA 5JW4M 1MHPH 5MENE 4HUUA 5T1LA 4GBXC 4KDVA 4YIQB 1RJYB 3KPQA 4ONGL 4JANB 3R1GH 1K9TA 2HN7A 5KVDL 1HHHB 3ISWA 4YH6A 1K2DA 5I76A 3ARDC 2ICCA 4WEUD 4HXAH 1NANI 2BVPB 3F62A 1Q9LA 2L0DA 4NQED 5TF0A 2P8PB 1EO5A 4K3DH 2PXYA 5E5MB 4ZUVB 4XTRD 2J1KA 2WMPA 4A6YB 5D7IB 3ESUF 4DVRL 3UC0L 2CLRA 4LIQE 1RZKC 3P73B 1E4XI 4KTDL 4GAJH 4GG8B 1QPPA 1G1CA 1M6OA 5CILL 4KVNL 5CJQL 3U0TB 3LKNA 1X4ZA 3FOMB 4ZTOH 1N26A 5DJ0B 5EA0L 4N0CD 3MBXH 2HRLA 1WC7A 2ARJQ 5DJYA 4Z9KB 4ZS7L 3VDBA 2PR4L 1TVHB 1HI6B 3UZQA 4CDGC 3B9KA 1BECA 4JFDA 4L8DA 5E6IC 4JVPA 3LKPA 4RAVB 4G6AD 4L9DA 4JFYB 2XZCL 3HMXL 3KYNB 4TULL 1TNNA 4F15C 5AAWA 2VO5A 3GJFA 4OF3A 4YDKH 4DGYH 2NZIA 15C8L 4HFUH 1HILA 1J1OH 1NFIA 1DE4A 2PW2A 3MRNA 1G7QB 1KIQB 5IOPA 5EBLB 32C2A 1LP9B 3RUGF 4PJFE 1A47A 3LN4A 4PRAA 3NCFB 3ARBC 4NNYB 4QWWD 4HUWA 1UA6H 2VE6B 2DI7A 3RWIB 1G9NH 3S35H 4Z5RB 1OARL 5EU4B 2ARWA 5T3ZL 5ECJE 4HC1L 3HKFA 3PWNB 4KUCD 5DQ9A 3CPLA 2JTDA 3RWFB 5IMMB 2YXMA 5I9QC 5IR1B 4S1SL 3K2MC 1FBIL 1A6PA 1DEEB 1KN4L 2EXWC 3U79A 1D5XB 1L9MA 3X11A 3KWWA 4JG1L 3GKWL 5BMFH 5FK9A 3HN3A 1JFQL 3T2NL 2Q7NA 4S1RH 4ZOAA 3T4AA 1IGMH 4YAQA 4LNVA 3E3QC 1U8OB 1KN2H 3HNSH 1EZVX 1JMXA 2A38A 1OSPL 5DZLA 3MRFA 5CZVH 1QBAA 1BHGA 2VSDA 3QAZB 3DOSA 4JQVC 5C0NC 4K7FA 4ZFGL 1ZT4A 4KDWA 3BZ4A 5C09B 1DUZB 1MCFA 3VRIB 4PJ8B 3BEVA 3AREA 3DHMA 1CXHA 1KT2B 3O4LD 3M8OH 1U58B 3BDXA 1TZIB 2XKUA 3H3PL 3TT3H 4JRYB 5IFAH 2BY3A 4WTZA 1YNTB 1XGTB 3JZ7A 1JNJA 4B5EA 5KSUA 4NNXB 4MDJB 4YIQA 4POZC 4UINL 43C9A 2X42A 4Z0BH 4ZFZB 2BMKB 2CIIA 4LCWB 1NGXA 5KJRH 3D6GA 5E8OB 4XNZB 5F1NB 1FFNB 3I75A 4LDEB 3NH7H 3VFMB 2JCCB 4TPRH 2HMIC 4UV7L 1WBZB 5ENWA 4QOKD 2CDEB 2WANA 3VXUD 4R96B 1F4WH 4Y4FA 1G9EA 5LXGH 5DD3L 4MDIB 5E6ZA 1ORSA 1TITA 4K3JH 5HI3D 2VZTA 5E0QA 4JHWL 2J12B 5D2LB 2B20A 5IKCA 2RGSA 4NBXB 5EU3B 4QGYA 2VDMH 1OTUC 1IMHC 4JFXB 4FP8H 3MUGA 3GI8L 5IW6B 4J3XA 4YXHL 4RISL 5DRXA 1FVCB 1OAXH 4Z78A 5FYJE 1ZEAH 2AJ3A 2B0SH 2O5ZL 5EZOH 2YD2A 4YC2B 4HIXL 1H15A 2J8UA 2NY5L 4KTDH 1MCJA 2AK1H 3K2UH 1C1EH 2R29L 1KNOA 3C6LB 1NDGB 4MNGA 4Z6AT 1CGSL 5J12B 3SDDB 1NFIB 2DQHH 5ACLA 1IGTA 5KTEH 3NPSB 3FQRA 1ULVA 4P57A 3S3JA 4V1DD 1VFOA 4PJIA 1WCQA 5DRWB 3RP1A 2BNQA 1UXSB 4IIQB 3GUTB 1GPOH 3SCMC 2I07A 5GRYA 3UDWA 1W0WB 3BHBB 2HRPH 1RZ8B 4LMQI 1JPST 4LBEA 1KG0B 2IC2A 3FB6B 1MWAB 2HKHL 4LSVH 3K80A 4X7SH 4Y16B 5I30H 1KGCE 3QQ4A 4YEEA 1H5BC 2FJHA 1JPGA 5KS9A 5HD8C 2IFFL 1NCUA 3SQBA 2R2EB 5DA0B 2XTLA 5CGYD 2VH5L 4MS8D 3D9AL 1QFWM 2F54E 1L4IA 4UDUA 1AD9B 2IMNA 4G9FA 3W0WA 1HKLL 4OFDA 1DSFH 4M6MH 3TVMA 3KPPA 4KK8D 3KXFE 3GZKA 3IU4H 4XX1G 3NA9H 1FGVH 1AY1L 3QH3B 5T3ZH 4PGJA 2VDQL 5DT1L 1MFDH 5E2JA 3B9KC 4KKCC 1DBML 4Y16C 3OJ2C 1RJZA 3X3GH 2IAMA 5J57B 5I15L 1ZVYA 2AJZB 3NFSH 3T2PA 4PG2A 5C0AA 2YZ1A 4RWYL 1U58A 3T2NH 1TCRB 5T1DL 1YECL 3IDIB 3NIGF 4MJ5A 3HMXA 2UWEB 1YEGL 2IGFL 5SV3A 1KN2L 3S96A 2ITCA 5DD6B 5KSBE 1UCTA 2F5AL 2EDNA 4L8BA 3N9GH 4JZJA 3QI9A 5F93C 4WI5A 2CKBA 3SE4C 1N5AB 1KIQA 4RMRA 3TZVD 4K2UH 5D1QC 5TDNA 3M8OL 4K3GA 2IAMD 4U6TA 4PB0L 3FFCE 2W65B 5DMJB 4R2GD 4J2XA 3RTQA 4EI6B 5ICYB 3CFEA 5BVPH 2GTZB 4IJ3B 3WFBH 3KYKL 4AY0A 2J88L 5JDSA 4B0MM 1QFUL 4ZTPH 4YDLC 2XQYK 1N5YH 1I1FB 3PWNA 4LSSH 3UDWC 4JN2A 5FIEA 5IMMA 2ATPB 3IFOB 1WZ1L 5HGHA 4PV9A 4QXWA 5EOTB 4U0RC 3SJVD 5HYEA 3MUGB 5I75B 4TQEL 2V17L 3U7YL 4S1DC 1RIVH 4Y4HD 4MXQC 3DROB 4RZCA 3AROA 4QT5A 1S9XA 4TVPH 1T7XA 2ORBH 3QDGE 3BMWA 4MWFA 1ERNA 3JV5A 4I4WB 2OL3B 2FGWL 1K85A 3I6GB 1BVKB 1MCOL 2HKFH 2EKSB 3NTCH 1QYGL 1JZ6A 3TYFA 5ESVA 2UZYB 2D03H 1C7TA 3BPCB 5HHOB 2WWKT 3EFDL 5JTWA 2V5TA 3N1GC 2G5BA 3VRIA 5JW3H 1I8KB 3G5ZA 3B9VA 3VWKA 4HC1A 4XHJC 2FJFB 5BW7C 3LH2L 4C83B 1NGYB 2NY1D 4WI9A 4MB4A 3QHZL 4TSAL 1SJXA 1HHKB 1FCCA 5B39A 3KNBB 4OBSA 25C8H 1CFTB 5K9OB 2VXVL 4Q9RH 4ZFFA 1J18A 1E4WL 1TZHB 3PG2A 1CFSB 4LPCA 2DQJH 4AEHH 1ZGLB 1HWGB 3E1F1 1RZKH 4PJHF 3N1MC 1YNKL 2X4QB 1FL6A 3W0WB 1A2YB 3OTTA 1S9KC 4GW5A 1MIML 5ID0A 3UJIH 3MRPA 1NEZB 5C2BH 4TOYL 1NL0H 1IKFH 1UWXH 3T08A 3VFTA 4M9OA 3FRPG 3QPQC 1FZMB 1H0DB 3KYNA 5FGBC 1N4XH 4CVXA 4S1QH 1AKJD 3AXLA 3D9AH 1XGRA 3DBXB 4M8QB 3PGCA 5F8RC 3O6MH 1R3IL 1EEZB 2W0FB 3QQ3B 3W9EA 2EDOA 2Z8WC 3MRNB 3IDIA 4EJ1C 4IMKA 1FIEA 2CO6B 3IU4L 4P2OA 5C1MB 4Y1AB 3C09C 1JF5A 3CMOL 4GOSA 2A6KA 4XMPH 1I8LC 3LN4B 5DT1H 2FZ3A 3EO9H 4RIRB 4M61A 4YFEA 3BP7A 4X7EC 1V5JA 3VXSD 1PG7H 4LASH 2VE6A 1EHLH 4NN5C 5FDYA 5KAQF 2R9HC 5CWSA 4BKLA 3VXUE 4I0CC 2GSGB 4FG6C 1BIIA 3BHBA 5JQHC 8FABA 1DLFH 3MLTA 4TRPL 5JDSB 1AD0B 2ICES 3RJDA 1BQLH 1ZHLA 3O6FB 4CGTA 4P2OD 3ARDD 4XP6H 3LKOA 4JN2B 3HNTH 4O58H 3UTQA 3DV4A 3EYUH 2UWEE 1CF8L 1LE5A 4L9LC 5F3BB 3OF6D 2VOTA 5HVHC 1TTUA 4P23C 3OGCA 4WY7L 3DO7B 1FL5A 5I8OH 4I18B 4Y2DA 3CVHA 3OKKA 3PP4H 5D1XC 4OB5H 3VDCA 2APVA 1MLBA 3K74B 1N5YL 1TJIL 2RIKA 3QQ9D 2Q1EA 1U6AH 2OCFD 5ESVB 2YSSB 2O5YL 2Z8SA 4XAWL 3T77A 1Y18A 4QRPA 2UUDH 3OKLB 3DMMA 4EDWL 2G5BB 1Z2KA 5D1XB 1NAML 2LE9A 3O2VH 1KGCD 3T2QA 4G8IA 4J4PA 5CD3B 4BSVB 2GKIA 3NBNA 3C08H 4Y2DC 5DVLA 2I9TB 2UWEA 4M1CD 1OAKL 2FGWH 3AB0B 2YZ8A 4RGMC 2HKFL 1T1YA 5JMOC 1NCAH 2DQDL 2KBGA 3WDIA 1VKXB 4MCYB 4MXWL 3QJFB 3CZJA 1MRCL 3IDNA 3O2WH 5C0GA 1RK1A 4NM8H 5JHLH 5GRUL 1E6OH 1JZ8A 5HYQB 3R4DA 1A2YA 5FB8B 2R0WH 5JOPD 2IANB 3ARRA 3UPAA 4OGXH 2H32A 4PJFF 5A2FA 3K0WA 4RA0C 5DRXB 2VRAA 2YA1A 2B4CH 4OT1L 3BQUB 4TTGA 2I9LB 4HG4K 5IESL 1QVOA 4XZUB 1WITA 1CICB 2HG5B 3WFDL 1T1WA 4NWTL 3OKOA 4HZLB 3X14A 3CU7A 5TH2A 1ZSDB 5ID1A 4GMTL 4X5LA 1XEDA 2A83B 1QR1A 3K7UA 1PKOA 5GSRB 2R4SH 5C0FA 1MHPL 3GIZL 3DX7A 1ZLSH 1JYNA 2YPVH 1LD9B 5BV7H 1RUMH 2AXFB 4LKXA 4M43H 4QHMB 5CLWA 2QV2A 1HQ4A 2ESVA 3PL6B 4QRRB 1CXIA 4OLWL 4N0FA 1MRFH 3DURB 3MOAL 3NIFF 3QNZA 5E6ID 5IMOA 1I7ZA 4HS8H 1NKRA 1F13A 1XGPB 5KG9A 3LEVH 3HC4H 5F9WB 4CVZA 2DIBA 4E9LA 1NBYB 3KPTA 2Y06L 2ZSVB 3FFCD 4BK5A 2BY0A 2YKLL 4CU7A 5DVKA 4OZHB 1E4KA 1FE8H 3G5XB 5IGXH 1DBJL 4KXZH 4HUVB 3L1OH 3NN8A 3D85B 1OTUD 4K23H 4WU7B 1GC1L 5DURB 3MRHA 5JQ6H 4D9QE 1LO0L 4QHLA 5E24E 5GSVB 1FFPB 1F5WA 2HTLC 3KPRD 3GSQA 5IFJB 1A02N 2QADC 3MBXL 4PJGE 4OD1H 1LK2B 4KRPB 4LASL 2RB8A 5ALCH 4KKLD 5L88H 4BQ6A 3VFWB 5E2TL 1X4YA 3VXRD 4MHHI 4YGVB 4BYHA 2Y7QB 1SEBA 1A6ZA 5F44A 4XVSL 2B7DT 4WFFE 4G43A 4Z76A 4RRPA 1XGYH 2OR8A 3DV6B 5IHLB 3C87A 3OKEB 3IKCB 2X4QA 5I1GL 1ZA6A 5IW1A 2H8PB 4GRLB 3ILQD 3KR3L 2IADA 2O93L 1SEQH 4IRSA 3DO3A 3DSFH 2F19H 2R8SL 1UH3A 3FO9A 4Z0XA 3ARGA 5D2NB 4ZSOB 4P5KB 5F3HA 5BS0D 3GMLB 1L7IH 4WUUD 1ADQL 3RBGA 5EIQA 5ACZA 5TDOA 1ITBB 5CP7A 1KYOJ 2RCSL 2X9XA 3P0GB 4BSVA 5FM8A 3KYAA 1PJ9A 5I0ZA 1QLFA 1PLGL 4S1SH 1F3DH 5F97E 5IK3A 3VI4F 5GGRB 3VWJD 1MCWW 5JHDE 1R5IA 1MHCB 3I3DA 4NKDA 3TO2A 3GKWH 3N85L 4FQ1L 1XF2A 3DYPA 1XF1A 4RSVA 5IJKC 1TETL 1XF4A 3B6SA 4GKNB 2Z4QB 1YEKH 1NAMH 2LAGB 3O2VL 1IBGL 3TN0B 3EJYC 5JNYA 3BZDA 4XB7A 4HQQH 2F8XC 1J0YA 2A6JA 3RGVD 5FO7A 3Q6GL 4B7LA 4YHYC 2D7OA 2P49B 3QDJD 4LVOC 2HP4A 5T1KD 1RIHL 3VE0A 3RZCC 3U4BL 3BRDA 2G9HB 2FHCA 3FB5B 1MRDL 3VCLB 2XKNA 1AD0A 4KHXL 4OZHF 3ARBB 4OLUL 5FUZH 3ZHKA 2I9LA 3P4OA 1YEFH 1WWWX 4Y4KA 4OLVH 2VLKA 3JTTB 3RGVB 3TBVA 1Q1JH 5I16A 1OQOA 3IDYC 4Y89A 1ZVSA 4YJZL 3X17A 1A4JB 1MCDA 3BWAB 3HZVA 3QG7L 1T83C 4EI5A 2YR3A 1R5VA 2VDNH 3C60A 3VXSE 2DF3A 3BH9B 4JKLA 3CVHB 4RX4A 1IM9B 3KHOA 2N1KA 5I1HL 3C5JA 4HHAA 4N9GB 5IVXE 1WAAE 3CAFA 4R7NB 3B5GA 5JW4R 3O4OC 4YK4B 3ZMRA 2EDHA 1DQQB 4XH2A 4UV7H 5T3XD 4M7ZC 2X4UA 4HAGA 4HUUB 4FNLH 2X1QA 3QUXD 2K7PA 3GB7B 5DC0A 5L6YH 2ZOLA 2RBLA 1HSAA 2GK0B 4U7MA 1YEDB 4J1UA 3WHE0 3QXUA 4JG0L 5CD3A 1TZHA 2APXA 1GC1C 4I3GA 4LCCB 4ZXBA 4FZEL 3TNNA 3R0MA 4U1KA 1E4XH 4K94L 3L7FB 5L8KB 3LEYH 5T1LD 3WIHA 3RZCD 4MNGE 3GSOB 4YXHH 1R0AH 1LGVA 3FB8B 5B3JF 2WWMC 4WRLA 1LEGA 2BVOA 2DQEH 1NEZA 3JV6B 1D9KB 2R56L 2A9NH 3IDNB 2CPCA 5D1QB 3DV6A 1LEIB 1GC1H 2G2RB 1G9MC 3PQYD 4LIQH 1CTNA 2EEBA 1O0VA 5C0CA 5DJ0A 1ODAA 4XPAH 3A67L 3DBXA 5FYJU 4I18C 4OD1L 1ZWIB 2IADB 3TBYB 1RIUL 3O45B 1AHWB 4ZO6A 1FFRA 1EEZA 3SDCD 3W9EB 4RFOH 5A2IH 1OHQA 3G6JE 3I85A 2P8MB 4GW1A 5CBEA 1QFPA 4EQ3A 5AYUL 1AO7E 1M7XA 4YHLH 5FUOH 2MKLC 5I1IL 1FYHB 4U6HB 2JK5A 2EEAA 4ODXA 3H7LA 2F54A 5I75C 2O26U 43CAA 2VLRA 4OZFB 2VDPH 2H2PC 5T1KA 2BY2A 2NY3C 1MCLA 1SEQL 1OTSD 2NY7H 4RFEA 2XWJB 4P9HL 2X4RB 1KB5B 2VDRH 3ARQA 1RPQA 2I25N 4GKNA 1W72L 3BYTA 1DSFL 4M6ML 2VIRA 1FHGA 2GIYA 1PYWB 4JQXC 3ULSB 1F3JB 3WSQL 5BVJA 4XCNA 4YFLF 2M1KA 2H1PL 3L6FA 1HK6A 4DTGL 3D85A 3IAQA 5L7XH 4W4OC 1YMMA 4O4YH 4YO0A 5HGGS 4OM0L 4YBQD 4IHOA 3GMRB 5EFIB 1MEXH 3GO1L 4XXDA 1GGCH 1CVRA 4FFYH 4Y4KB 4C54A 1IFHH 1CD8A 1KJ2H 3L3HB 2KPNA 3U36B 5EUOF 3FQTA 3RU8L 1KUMA 4MA3B 3TCLA 4X4ZA 3JVGA 4M1DH 5IHZB 5BJTA 5C71A 1J0ZA 3EJJX 4MAUL 2EYSB 5T5FH 3L3KA 5DJ8A 3BIBX 2X7LB 4N1CA 4L4JA 3OBAA 3CCHA 1RUPH 1YJDC 3RVWD 3HFML 4AT6B 4PJXB 4GRLA 4HCRH 4R7NA 4GQ9L 4MD0A 4YHML 3CX5K 4HLZH 5E8NA 1N3NA 4PB0H 3AFLA 3HAEG 3LKSB 4D9QD 4Y1AD 1MFEH 2CSPA 3QUYD 3RWHB 1DUZA 4PPTA 4XCEB 4QRTB 1VKXA 3L3JA 1T0MB 3HZMA 1SY6H 3F5WB 4Q0XL 3GSWB 2J6EH 5BXFB 2DQIH 4WFFD 4PB9H 4UIKL 2JCCA 3HC3H 1JHLH 3U7WH 3CZFA 2GSIA 4Y7MA 3O41A 2ZUWA 4B53A 1XF4B 2LABA 2ORBL 3B6SB 4G7YL 4I3SH 3TJEL 4X6CE 3EOYG 2OP4L 3TWCH 3QUKA 4YPGA 3QPXH 4FZ8H 1QVOB 3RAJL 2M8XA 1FH5L 2XQBH 5ESQB 2XTJE 4UMGA 3X14B 5C6PB 1IQWH 3SKUD 1CK0L 1W72B 4Z7WA 5ESAB 4LP5A 4PRHE 3X11B 4LAJH 1KEMH 2V6HA 4LP4A 2AV1B 4BSJA 5HI5D 4Z7OE 2VDOH 4QHMA 3REWB 1A8JH 4YHPB 2DQEL 4MAYB 2BDNL 3JTTA 4XMLH 3BE1H 1AR1C 4HXAL 5A2KH 3SE3A 4LKCB 4TSAH 1VHPA 5J13C 3EOTH 2FECI 1J0KA 4R7DA 2LTQC 1A6VL 1RIUH 3KLAA 3GGWA 4HWBA 2UV3A 4JLRA 2EDXA 1B2WL 5C09A 3UPRA 1WICA 4L3CB 4HKXB 3HE7A 4N1EA 4PRIB 3ME0A 2W59A 3KPLB 4TNVK 1ZLVH 3MLZH 2XWTB 2EEDA 3IDGA 1E27B 2OTUB 3RL1A 3ARUA 3H7BA 4Y5VB 5DSCB 3PHQB 5H37G 3G5VB 3ALXA 5KW9H 1A1MA 3GBLA 5DWUL 3SKOA 3CGTA 4LLMB 5EFIA 3QEHA 4WV1A 4LPWA 2ADIA 2FSEA 3UBXI 3EO0A 3SDDC 4UDUB 2AGJH 2VDRL 3FONB 2VDKL 5C3TA 3HAEH 4JFHD 1J10A 1NBVH 4R2GB 4IRSB 3SDYL 4Z7VB 4H1LA 2IQ9L 1BQUA 3L5IA 1UEYA 3WLBB 3OWEA 3V4VL 3Q1SL 1GSMA 3ZE1E 4U49A 2WUBL 4JB9L 1FAIH 1SY6A 5T3XE 3SDAC 3S35L 3CCHB 4PJ7E 1TLKA 3O9WD 4DEPB 4MYWB 2MFNA 1SMOA 5SWZE 3VXOA 5DO2C 3MROB 3G6JB 1T6VN 1I3VA 2WIIA 2VLJE 1T21A 1KJ2L 4U05A 1NAMB 2QSQA 3RU8H 1Z9LA 1JGLH 1FBIH 3HE7C 2AK4A 1ZLUH 4OZIB 3FFDA 4NHCL 4WHCA 4QOKB 1FZOB 3QI9B 3V0VA 2YD5A 4GRWF 4P99A 3HZMB 3O4LA 5F9JA 4RGND 4L3EE 3LZFH 1VFUA 3NFPB 1F4AA 2EIDA 3F5WA 3FQRB 3DIFB 1A7OL 3OJVC 2HTKD 5IHBA 4X6FA 4L8CA 4NUGH 3W9DA 2DN7A 4EDXB 3SE9L 5JLZA 5HYJA 2FEDC 1I85C 1GGYA 3RGVC 5EORL 1HINH 2L7UA 3ARDB 3HHRB 4HH9A 1EMTH 2FX8L 2PETA 4HEME 4PJAA 3WN5C 1FPTH 3SJVB 5DHVH 2EICA 5C09D 4Q0XH 3OR7B 1ORQA 1W72A 4Z7WB 2O5YH 3HMXH 4BFGA 5J1SC 2E7LC 3K46A 4FTVA 1FVEB 1OB1A 3BO8A 4BSWA 1IRAY 1Z3GH 3S36X 2OSLB 4H88H 1OGAA 2IWGA 3SDAD 2AI0L 3EZJB 1I4FA 1MQKH 4QT5B 3LKRA 3U83A 3O4LE 3C5SA 5KVFH 2ENSA 3WN5B 3ET9F 3D87B 4GRMB 3TWCL 5H37H 4P0DA 3LS4L 1OP3H 4MNQE 4TPRL 1U42A 4S2SB 2IF7A 2NTFA 2X89D 4Y4HA 1DBBH 3DROA 1XGTA 1AC6A 3X13B 2VDLH 3BPCA 4HKBA 2X7LA 1KEML 1F4WL 3P9WB 4HV8A 3UPRB 1A7NL 4PRDA 5KAQG 1MRCH 1OARH 4PLJD 4K3JL 1RSFA 1Z9OA 2Z31C 5JHLL 2C3VB 4LCYA 1YDPA 3S4SB 3PWUA 3MBED 5DFTA 3TZVB 1FRGL 4PY8J 4XNZC 4MXQD 1IGCH 1KSRA 1CLZH 1AP2A 4N8VB 5F1NA 4LLWA 3TBTB 4PRPB 3BGFB 2YRLA 3BPLB 5J11C 5K9OA 4K9EH 1KXVC 3GSOA 3G5VA 1CD9B 4MGXA 1K6QH 1FFQA 2B0SL 5IUSA 4XP9L 5EULV 1N5AA 4QY8B 3QFJE 3F12A 4GMTH 3ORJA 1F6LL 2X4SB 3GIZH 5FYLE 5B39B 2VXQL 3VI3F 3BW9A 2QADD 3QEGL 4PRIE 1TXKA 3QDMA 1YJDH 1C7SA 1EGJL 3RTQB 2A6IA 4P5TB 3MRPB 3O45A 1T4KB 4H1LB 5C08D 4V2BA 5D7LD 3ALPA 3JWDC 3HG1B 1TFHA 2C3HA 4TUKH 3TZVC 4PR5B 3HC4L 4WFED 2VLME 1DQJA 1G7MB 4PREB 4G9FD 3SE8H 5GS2H 3MCG1 4W6YB 5E6YA 4ZUUB 2JK5B 3V5KB 4L1DA 1DQDL 1MHHB 5DHYB 2VLRB 4OZFA 2YXFA 1BAFH 3G5YB 5FYKU 4HSQA 5I1EH 4K23L 1NBVL 2WP3T 5INDA 4P3CH 2DYPD 3RVVC 2YA2A 3CVIH 4HKJB 4J8RB 1JK8A 3QFJA 1NC4A 4JRYD 4M8QA 1NJ9A 1FZKB 4RAUA 1WTLA 3O4LB 2IPTH 2XTJB 5CHNA 5FGCB 1TPXC 1S7SB 3PV7A 3NA9L 4PJHE 4XNMA 1VACB 2G5RA 2VDQH 4FQXC 3SGKA 1F4HA 1PKQB 4XBEL 3O9WC 4PJ7F 4C56A 5DDHB 5J3HC 5GHWL 4JHWH 5DO2D 1Q8MA 4U4BA 3AU1B 5J6HA 2XTJD 4OLYL 4DGVH 1OY3B 4C83A 4NPYB 3HLAA 1N8ZA 4BFIB 3DRTA 4FP8L 3H7BB 3KXFD 4JFFB 3ARFD 1KENL 3QIUA 1HQRB 1T6WA 1YECH 3HE6B 4ZFFB 1MNUH 4CN1A 3F6IA 5FUCC 3TC9A 2O5ZH 2ADFL 1U91B 1CI5A 3D39E 1L7IL 3N9GL 1RJLA 2AXJA 4PUBH 1JNLH 1VFBA 2VQTA 1ZLUK 2WQ8A 4KGJA 1HWHB 4OFPA 1BZ7A 1F6AB 1LEKA 2DQHL 3FONA 2ICWJ 4POUB 5EORH 4C56D 1OW0A 4PD4K 5KSVA 5KN5A 1L0QA 1EMTL 4QHNB 3H42L 5E8NB 1ADQA 4OCXH 1RHHA 4OCWH 5FO8A 5I2IA 4JQIH 4NZDA 1G9NC 5EO0A 4CUCA 3KPRE 1X5JA 4I18A 1VGKA 4WHTB 4KAQL 2R2HA 1NSNL 4KV5E 3RY6A 4WDIB 4J3SA 2ZPKL 1RHFA 3PABB 2GJZB 1YDPB 5CMAB 3S4SA 1IJ9A 1PSKH 1F2XK 3B8SA 2ESVD 4I0PA 1CE1L 1G7HB 2A9MH 1JPSL 3E2HC 4Z7VE 3S98A 2J8UE 3FFDB 1N0XH 3DMMB 1NKOA 2X4OA 3CFDB 3DHJA 4M3KB 4OLUH 5FUZL 3UTSB 2VAJA 4XAKD 5F89B 2Z0BA 1AO7A 5FUCE 3MUZ1 3NFPA 3WCYA 4Z7OF 3QUKB 4YPGB 1ZT7A 4UZGA 3MACL 3ARTA 1BOGA 4HJGB 4NZRH 1VENA 3DMMC 4LLYB 4OD2B 4K55A 3MRBB 3GSUA 5C8JA 1RU9L 1OD7A 4DVBB 1YYML 4ZYKB 2HMID 3MJ7B 5C9KA 4HPOH 4HF5H 4YHIB 3UTTE 4RWYH 1SBSH 5E1HB 1WIUA 2MOVA 2HG5A 1S9XB 4RMTA 5EB9A 1JP5A 3QIWB 4WWKC 3WS3B 4PY8I 3FQUB 5EU6D 4D9RE 1U8IB 5HPOA 1FNSL 4DAGH 1GHFL 1GOGA 1XR9A 3SGEH 2VXVH 4PY7B 2E7MA 4DCQA 1RK0B 3D2UA 3BKJH 3MJ6A 1KFAL 1E4WH 2W1NA 3BKCH 4N0FB 3BEWA 1F8TH 3QT2A 3ROOA 5D72L 3MLYL 3E6FA 5EBWA 3CUPA 5HSFA 5IB2B 1NJ9B 1CBVH 4APQD 3NFNA 5F1IA 3SE8L 1A1NA 3PWLB 2YWYA 4XP1H 1HQ4B 3X13A 2COQA 5IIEA 2WSKA 3CFJA 3WFZA 3WNMA 4Q9CA 2YPLD 1LP9F 4UT7L 3LDBB 4NFBA 4ZUTA 3QCTL 4HIJA 2D2OA 5C0IA 1J8HA 2GJ6D 5J6HB 5HDQL 1NLBH 2YC1B 1WZ1H 3I84A 5L9DH 2WLYA 3UYOD 3QXWA 4KV5F 5GS2D 3FO2A 4URTB 5I19L 4RAHA 4UNTA 5J7CC 3PGDA 3NN8B 3MV01 4HJJH 3KHQA 4JANA 4L4VE 3VW3L 2Y7QA 4MCYA 4TVPL 3EO9L 1DUYA 2V2WB 1CDYA 1FFPA 5T3ZD 3OZ9L 4E5XB 4LQ1A 1Q9LB 1CLYH 3QWRA 2DICA 1FIGL 4MJIA 1J05A 1T66C 3GHBH 4HIIA 1T7WA 1P4BH 4U6VL 3QPQD 3MROA 1LQSR 1CE6B 2DJUA 3EFDH 4JZNB 2FGZA 1VSCA 3BQUA 1MNUL 1L7TH 3ZDXE 3F58H 1OPGH 3U9UB 4GAGL 4TRPH 1W72H 5MENA 2OZ4L 1HYRC 5AWNH 3QULB 4PS4L 1QG3A 25C8L 1Z5LA 3HNTL 3NIGE 3VXPB 3IJHB 1P69B 1A5FL 1FZJA 1RAMA 3L9RA 4RX4D 3WXVL 1JJUA 4M1GL 3M1BA 3SGDI 3NCEB 3HC0B 3HG1E 3RIAK 2EYRA 5KG9B 4OCWL 3DX9A 2DWDA 5J13B 4HPYL 5GS1A 4PRID 2Z4QA 3PP4L 3G6JF 3W11C 1G7QA 5ABDE 5IFHH 1XIWA 3O11B 3O6FA 4DOHE 3JTSA 1S7TA 5J1TC 3CPLB 1LO4H 5C08E 2D7TL 1NL0L 1QBLL 1AIFB 1A7PH 2K1MA 3LAFA 2J8OA 3EKCA 3VFNB 4PJBB 1JYXA 4WFEE 1WWBX 3IDUA 3QEQB 2A73B 3H9SD 3IDXH 5IEKA 2VL5B 5ICZB 1MCPL 2WNGA 3GSQB 2P1YA 2VSCA 4LLVB 4ONFL 5ERWA 1GZPB 2XWBB 4ZOBA 4R26L 2ERJB 3RGVA 3HI5H 4YDJB 4HIHB 3VU2A 4PV8A 3SO5A 2B4CC 4PJ5D 3U2SA 3FB5A 3HS0B 5DLML 1AQKH 3HTLX 3ZKMD 3ARBA 4WW1B 3MCLL 4HH8A 2HVJB 1BZ7B 1LEKB 4QRPB 2XNAA 5D93C 3TIDA 1HHIA 2VLKB 3VH8G 1EJOL 1S3KH 1UG9A 3AREB 5D1XA 3RUGE 2FR4B 2NY0B 3RVXC 1B4RA 1QBML 5ADOH 5DJAA 3B9AA 4Q2ZB 4KH2A 4ENEC 4RCAA 4H0GA 2GW5A 4ESKA 2CMRL 1N7ML 4GAFB 5IQ9B 4HGKC 1VGKB 4I3SL 4G7YH 5H35A 4WCYL 4BZ2H 4EXKA 1HSAB 2GK0A 1BVLA 5IESH 4JM4L 4JO4H 4YHNB 2GJZA 3PV6B 1H8OA 4D8PB 2PXYD 3F12B 5EBMB 3VFMA 3D39D 2YPVL 4O51B 1I1YB 3I9GH 3MFFA 2NXYB 2CDGA 1R3KB 2HTKC 4Q9QH 2R69H 3IS1X 4EQ2A 4P46D 5CIPB 5EOCL 2YUWA 3BISA 4LEOB 3QCTH 3C8KB 3KPNB 2DQGL 1A3QA 3L7FA 2FBOJ 5D7SL 4LSPL 1A6UH 5IW3A 3UTSD 2YD4A 3FB8A 2E7CA 2EECA 3DVGB 3SBWA 1TZGH 5BZDA 3B9KD 4KKCD 4V1DE 2A77L 3BKYH 1D9KA 5EWIH 3BP4A 3L1OL 1JHTA 1HE7A 2AXFA 4F37K 3VW3H 1JI2A 1KB9J 4MB3A 4N0CC 4FFZL 1MPAL 3G6AB 1WISA 2QHRL 4XXCC 2DWEB 2D7NA 2MKWA 4K71C 4ORGA 4Y4KD 5I9QB 5TGBB 5C0CB 3QCUL 5HY9A 1ZVHA 5IMKB 3RHWK 2PYEB 4F7EA 1NDGA 3E6HA 1VERA 4MCZB 4M48H 3VXTB 2JELL 3AM8C 4H20H 4PJ7B 4U6VH 1FCGA 4XNMB 2W60B 1UXSA 3SKJL 2OQJB 3SQOH 4ZNEA 5EUKB 5L2KB 1HXYA 4U1MB 5DA4A 2NYYD 4NM8L 3T0EA 5MP6H 4E42B 2F54B 4X6DE 3OHXB 5D1ZB 2LFGA 2R0WL 4KPHH 4QHLB 4ERSL 4NPYA 2VIRB 3SDDD 5I1GH 1YN7A 1EHAA 3BPLC 1INDL 2AEIT 3JTSB 1LK2A 3MLWH 3KR3H 4CVUA 5BVJB 1ZLWK 3RZCB 2ZUQB 3EW3B 4C55A 4KWUA 5KZCB 2QLVB 2EYTB 1YEDA 1RZ7L 4LGPB 4JM2D 4YNYA 3WXVH 2YC1A 5DGRA 3WIFA 1FYTA 4G43B 2N56A 2C4XA 3IJYB 3WDJA 4GRWH 5F6IC 2EC9T 3FO2B 1FSKB 4KKBC 4M6OL 3DX8A 1JZ5A 5IFHL 1AGDA 4YO0B 1JGLL 5JPMA 4WI6A 1P2CB 3EBAA 3QDJA 5I8KL 4K8RH 3QJHB 2BP3A 2CUHA 4JZOB 3R06A 3QIBD 1ES0B 4ODVH 4O2CB 4DK3A 4KI5E 3VXRB 1OL0A 1E28B 4MJ2A 4KI1A 1ZWIA 1WIPA 5DQDL 4KJPC 3AAZB 4FXKA 1FYTD 1QLFB 2O61B 3I2CL 3C8HA 4NUGL 5IK3B 3LKSA 4DKFL 3PP3K 3TPUB 1WEJH 5DMYA 4KHXH 3MRJA 4HX1B 3UTSA 9CGTA 4CMHB 4MD0B 4K7PY 1BFOA 2CKBB 3NZHH 3N1PC 4GLRH 1AC0A 2QQLH 2DKUA 1SYVB 3IVKB 2VC2L 2P47B 1EK3A 1XGYL 3VJ6A 2X4RA 1MQKL 4MQXC 1CFNA 5SWZD 4RMVA 3QDGD 5DD1H 4LEOA 5DD5L 4HUXA 4JM4H 1ZA3B 5TF1L 5BXFA 4JO4L 1X6LA 4O02L 3DSFL 3SKNA 1P4LA 4MS8C 1IGYB 3TBVB 2P5WD 3DVGA 4DN3L 2VDLL 1U8PA 3U82B 2B1HH 5ICZA 4TUOB 1U93A 3I9GL 1JHTB 3CDCA 4XXDB 5DTFA 3MBEB 1D6EB 1W8OA 3D2UB 2KKQA 4FZEH 2J5LB 3ARED 2FEEL 3HI1A 1K4DA 4LOUC 4PJXF 2W0KA 3CUPB 1WLHA 3BI9X 2YK1H 4FN0A 1LNUA 5C07A 4MA3A 3RFZC 4OUUA 1T2QH 4YBQC 1EUTA 4KJWD 4UUJB 3HI6H 1WFNA 1JPTL 2KQMA 3SDCA 1K6QL 4WENB 5MEOB 4P23A 4FQXB 1TZGL 4OV5A 3IKKA 4PJAF 3TIDB 1TVBA 1WCBA 2G60L 3TEUA 4AIZB 4NDMB 2O5XL 4MWFB 3MV9D 4HKXA 5BO1L 2EIEA 3VFPA 4M3JA 4K7PX 5ISZD 3GIVB 4XP5H 4HWEL 3EFFB 3U0WH 4WI7A 2AK4D 5JXAL 5E00B 2X4PA 5DMIH 1MRDH 5IQ9A 3QHFL 3MMEA 4RFOL 2DLFL 3B3IA 5IMLB 3EHBC 2BOCA 2Z93B 1T5WA 3GMNB 4GXUN 2CLZA 5DUBA 4XWOC 4KZDH 4WO4B 3WNOA 4R6UA 2WQRA 3LN9A 3SQOL 3DETC 4XNYL 3BZFB 4BELD 4JM2F 3RKDC 4RQQB 3IS0X 3BZEB 4M7JL 1INQA 4M93B 2SEBA 5JXEC 1LP9E 3AC0A 3IETB 1P1ZA 1QKZH 2R2BB 1ZOXA 3ZKNC 2VZ1A 4OUOA 5BRZD 2ADIB 3ZT6A 3AS0A 1ZLVK 3VG0L 4L9LB 1CXLA 3K3QA 1QO3A 3SGJC 4ZFOB 3UBXA 5E2WL 3QQ9C 4PRNA 3ES6A 3GBNL 1CL7H 1I3RB 35C8H 1DDHB 1EFXB 3P4NB 1H5BA 2IAMC 1I85A 3QA3B 1EHNA 4P5TD 4X9BA 1ZKAA 5HXMA 1B0RA 3ZKXB 2AQ3A 2H1PH 3BP4B 4G80B 1JRHI 1KC5H 1UZ8A 4DTGH 5L7XL 4P2OB 4ONGH 2X4TA 3KVQA 3R1GL 4AJ0A 5KVDH 1CVSC 2QR0A 4R9HA 4FXGA 3MV7E 1HYSC 4UOW1 1DANU 1KPVB 3MRJB 1UM5L 3UTPD 4BH7B 3OR6B 3LEYL 3FTGA 3G6JA 1PFCA 5EG6C 4DFHA 2ARJA 4O2EB 3VWJB 1F4YH 1KULA 5D7IE 4ODSL 5LGHH 2D7MA 1C5BL 5ITBL 3UC0H 4IDLA 2LVCA 1IEBB 3L95A 2LU3A 4QOKA 1OAQL 3VFVA 4ZAKC 2HAZA 3V0VB 4YE4L 3G04A 3CVHL 4XCFH 4OIBA 1QSED 3IRZA 4W70A 2G75B 3KJ4C 3LKOB 2GFBA 4HH9B 2ZG3A 1X5FA 3SJVA 1A3LH 2QTEA 2GK2A 4R4ND 4JQIL 5HYJB 4LEXL 3VXUB 4JHBA 3RI5K 4KAQH 5D7IF 5MI0C 3FOLA 4YDKL 3CH1B 4MA8H 1D5ZA 1QA9B 1QRKA 3KPOB 2BHYA 1SY6L 1FO0L 4FFVD 3UTZB 1CE1H 3MNWA 5KSAB 1LNUB 3WV0A 1G7LB 4UUJA 3SY0B 3QJHA 2F58L 3T3PF 3MOBH 4MB5A 3BIAX 4Z7WF 2XN9B 4Q2ZA 5FK9B 5IB3A 3DJ9A 1KF9B 1J5OL 2OP4H 2YN3A 4XCEA 3D0LB 4Y5VC 4X4YA 4OCRL 3O2DL 3TZVA 3BPNB 1P53A 5JOPE 5FCSH 4OM0H 4PJ9A 2B5IC 4PRPA 4OZIA 3OAYK 1S7XA 3MRDA 4HV8B 3QCVL 4JG1H 3MA7A 1I9EA 1S5HB 3HB3D 3QJFA 3HPLB 1OQXA 2BDNH 4WO4A 3FT4A 1L6XA 3VXMA 3ZE0F 3A6CL 2FO1A 3WUWB 7CGTA 2EIBA 1L9NA 2EIZB 2OL3L 4XNQB 2PYFB 1YPZE 4NQVB 3O0RH 3HUJE 5J1AA 5BZDB 3IETA 5GJSL 4HBCL 5GZNC 1S7UA 3HFMH 3FT3B 3MC0A 4NQCD 2FLRT 4NWUL 1ZA3A 2P4AB 4YHMH 1I8MB 3REVB 4ZFOA 3P11H 3ELAT 1F58L 5FB8A 4G5ZH 5AUMA 4NQTA 1G84A 4PBXA 3B4NA 3RI5F 2PUQT 3LDBC 4PYHA 4OCNC 2HWZL 5HGAB 5CGTA 4KK9D 4UT7H 5DWUH 4NQEB 5DD0L 1TTFA 3A6OA 2R4RL 4WW2B 2W60A 1QKZL 4UIMA 1FAKT 3BKML 1UKTA 3E3QE 4R97B 5F7DA 4J8RA 2CLVA 4CNIA 2M2DA 3DX7B 5ILTH 3CFBA 5B38G 1A21A 1A6TA 5HGBB 5DJZA 2XZAL 1OD9A 1YPZA 1QLRA 3IDGB 4OV5B 5T1LB 5IBLC 3BUTA 3R8BB 3BUYB 4Q6YA 2XA8L 4X99B 1LO5A 4LSQH 1A7BA 1CCZA 1NGPH 4NQSA 1KBGH 4J6RL 3U48A 2XQBL 5DMGD 4WTZG 3VI3E 1RZIB 4JO1H 4WV1B 2P24A 3LV3A 1VCAA 2ZSVA 1IQWL 2APWA 4XVTH 5F7UA 1FNFA 2VDML 4LLWB 3TBTA 1AXIB 4OZHA 2V9TA 4ZUVA 4UOJA 3T09A 1YMHB 4R0LA 5T1MB 8CGTA 1MREH 3QUZA 2ZUSA 1L7TL 4WFGD 5LGHL 4RFNB 2VLLB 2NY6C 4WTXA 1RUAH 4GAGH 5I74B 1ZHKA 4QY8A 2NY5H 2XY1A 1GAFH 4Q6IA 1CYGA 1C1EL 2R29H 4FQHB 4G7VL 4NKIL 2Y5TA 4OQTL 2HT4D 1N64L 4PGEB 1ZA6B 5IW1B 1A7OH 4UNUA 5KN5B 2BVYA 4N0YH 1V3JA 2PTTA 5I74C 3SY0A 1D9KC 5C08A 3PWPD 4AIOA 1DP0A 1S5IL 4OZ4A 3VXMD 3JWDL 1HINL 1H5BB 3QSKB 2L4OA 3D0LA 1NBZA 2BZDA 1HHJA 1R6VA 4YUEL 3CD4A 1KIPB 3LKPB 4RAVA 5B8CA 3DIFA 1KEGL 4L3EA 2CR6A 5DUMH 2FJGB 4N8CL 3IDXL 3MOBL 1TCMA 1NC4B 1X3DA 5TDOB 5C0AB 3OR6A 4APQA 1DBAL 1INEH 2EDDA 3EJYD 4JN1H 5BRZB 1CFNB 1S7SA 4H25A 4NO5B 5GZOC 4KJQC 1XCTA 3ARDA 3SDXE 4LPYA 4OCRH 1KOAA 2BSRB 2WM0A 3L95B 2YUVA 4PRAB 4GW4B 3GSUB 5C8JB 1G6RL 4KK6C 1OF2B 1CWVA 3QUML 1I8IB 1K3ZA 4W68A 1F90H 4OD3L 5IROC 1HNFA 3HZYB 5H2BA 4WWKD 4M7KH 3T4AB 2DQUL 4N5UA 5I16B 4TNVF 1JTPA 1UB6B 3QFDA 1N7MH 3MUY1 2DTSA 1HHGA 4ENED 4U1NA 2OK0L 3SDCB 3BVNB 5LCVH 1D5ZB 1QA9A 2R39A 4OSUL 4ZPVA 4MXVF 3DVFA 5GRVL 4Y4HC 3QIUC 5FYJD 3WE6A 4KY1H 3LRHA 4GS7C 2IPKB 1MCKA 1F58H 5JZ7C 5DJZB 3PGFL 1EVTC 2AEPL 3E8UL 5FHAL 4NQXA 1MLCA 3FJTA 5I8EB 4Q9QL 5D5MB 4NNXA 5A43C 2AV7A 4KRPD 3WFBL 3E6FB 2R2HB 4JM2C 3MREB 1T5WB 3GMNA 5D2LE 3JSSA 4JRYA 1FPTL 4XH2B 4YFLI 4KKBD 4GKZA 4LSTH 3ARGC 2LU4A 4M5ZH 2QJDA 4PJ8C 3U7YH 3DETD 3OGOE 1ED3A 4J3VA 2FH6A 5D7LE 1RZGA 1U3HA 4HWZB 4P3CL 4HGMA 1D5BA 2BVOB 1QRNB 4XCCH 4LCCA 1UH2A 2NX5D 4ODUB 1A9EA 4MQ7A 4FQ2H 2D31A 1DL7H 4JO1L 4QRRD 5IKCB 1WZMA 6CGTA 4XNQA 4PFEA 4H8WL 1MFCH 1Q0YL 1JZ7A 3JV6A 4X80L 3GSNH 2EO9A 4PJCA 4JJHA 4DK6A 2UWEF 2QSCH 5GRZA 2Z31A 3REVA 4LCIH 4JRYE 5FFLA 4ZD3L 5I17A 2BC4A 4GW5B 4ERSH 3Q3GB 4BH7A 5DRNB 2CUIA 4O2FA 3MLWL 3RNQA 3U30C 5F9OH 3EZ8A 3VXPA 3VWJA 1RURH 4PJIB 4NHUB 4XP9H 1BBJB 2BNQB 2AJUH 4PP2B 4NJAL 3EYFB 5LBSL 1SHMA 3C6LA 4TVPD 3ZYOA 1XCQA 4YDVB 1JE6A 3F7YB 4M6OH 4ZTOL 3IJSB 1FG9C 2JKXA 1IC5L 2FEEI 3QUXB 1JUFB 3ULSA 1JCKA 1EO8H 4RA3A 3ZE0E 2FJHB 4G8GD 5KS9B 5D5MF 3H42H 4FFWD 3ULUH 3AUVA 4U6XA 1HOCB 3TT1H 2UY7A 1RZ8A 4WJ5A 2DWDB 1HDMA 1P6AB 2VLKE 4TULH 4ODVL 4KMTL 5IROA 5KVMC 4WWKB 2OXGA 1DQDH 1MFAH 1O5DT 3O3EB 4CW1A 2ZPKH 4D3CL 4ZAKB 4GAYA 4NO0A 5F7LB 3L3HA 3TVMB 1HZHL 4Y19E 4NRXA 5I1EL 3QUZB 3I2CH 3FQTB 1JPSH 1MY5A 1AXTL 3V6OA 2D0FA 4JO2H 3WKNA 3GK8H 4PJFB 5DMGC 3JBG7 4LSUL 4MJ6A 4QYOA 1CIDA 2MHAA 3LPFA 2HVJA 3GSRB 5DQJA 5HHPA 5J56B 1T7ZA 1MH5A 4G9FB 4F33A 3QUMH 4YXLL 1ETZB 3UTQB 1U8KA 4WDIA 4JFOB 2KL6A 4XBEH 3P4LA 5C08B 3QXAA 4RDQG 4I0PB 4GXUM 3QDGB 5DJ8B 4OFKA 2XNAB 4HPOL 3QRGL 3MRDB 3LEXA 3H9HA 1I1AA 3B5HA 1IEHA 5E4IA 3FRUB 5KS9E 1QRND 1T0MA 3MGOB 3CX2A 4JPKH 5LCVL 4S1RL 4YPJA 1IGJA 3GI9L 1KIPA 1WGOA 4PLJC 4X8XA 4KROB 1ZT7B 3HNSL 1I9IL 3M1BB 2VISB 3MBEC 3JV4A 3OKLA 4M62L 5GGQH 3OMZA 2D0GA 2VXTH 4L8BB 2R23B 1D5IH 2HLFD 3ZKND 5DVMA 1CXKA 2AEQL 2GJ6A 1J8HD 1J0HA 1X7QA 2UVEA 4PJHA 3FQXB 5FV2A 3FT3A 4ETYA 4JY4A 2C7UA 1IZJA 3A6BH 4OCMC 4D9RD 1V7NH 3TFKC 2ATPA 1U6AL 5F6HJ 2GSIB 2XN9E 3IFLH 2BCKB 3I6LD 4XP1L 2N7AA 1XGQA 4ZFOL 4Z95H 4P46A 2G60H 1NFDB 3CSGA 3C8KA 5DHXB 3KJ4B 3G6AA 2P45B 3HRPA 4Z0BL 5GZOD 4JDTL 2XWBA 2QBWA 3LHPL 1RUKH 4PV9B 2OL3A 2OJZH 4FQ2L 1JF1B 2VITA 2Z9TA 5CJXA 3OAZH 5B21A 1HHGB 5F9AC 2DQDH 2FCBA 3FFCA 3VGFA 1O7SA 2IPUK 5HHOA 2GJ6E 2DWEA 5D6DC 1DZBA 1IAII 3T0EB 7FABL 1WFTA 3BN3B 3DRQA 1LD9A 1CXEA 1AGEA 2IQAA 1AH1A 3KXFB 4JFFD 1UGNA 5HTSA 3PL6C 1P7HL 3ILPB 3RZCA 4KROC 4J3UA 1YMMD 2OR9H 5F9OL 5FYLH 2W9EL 1I8KA 3G5ZB 4OT1H 1BVLB 5FYKE 3VG0H 4P2QB 1WT5C 5TE4H 5D1ZA 4EUPG 2NY4C 1DTUA 3S34H 2C1OA 4FXLA 4U7SA 3GBNH 4UAOC 4PRHA 1T1XB 3WJLA 1BWWA 3GHEL 3HNVL 2I60L 5DSCA 5EPMA 3W39B 2CDGB 5B3NA 4K8RD 1F8TL 4Z18A 3HR6A 5BV7B 4I3RH 4JZNA 4Z7VF 2E3VA 4EI5D 2VKWA 2FSEB 3MJ9H 2C9AA 3QDHA 2MHAB 1IVLA 4FOMA 2X9YA 5B39G 1MJ7H 3ARGD 3ZE2E 3QWOA 4XNXL 4KMTH 1PQZB 4JHAL 1RZJC 3LVEA 3ZHLA 5E03A 1SEBB 4EUPA 4Y5YC 2C4FT 2V5YA 4H1LG 5E4EC 1V3MA 3NVQA 3V0WH 4F7CA 2EH7L 1H9VA 2A6KB 2A6DB 3L9RB 4YE4H 1DEDA 3CVHH 3I50L 3IF1B 2VH5H 4GG6A 4UT6L 1BEYL 1KPUB 5HY9B 3P9MA 5DRNA 5IJKA 5DZOA 4ZUWB 4OGYL 1JPFB 3E6HB 5ALCL 2DM7A 3F7QA 5HHME 1UWGH 1HKLH 3ZKQD 2O61A 5CWSB 3ULUF 1AY1H 1UWXK 1XIWB 5BRZE 1S7TB 1JTTA 3CC5A 4X9FA 1G7JB 4K94C 3W11D 2FB4L 4NQDB 5E8DL 3MLUH 2IJ0C 2AJVL 2QQNH 4U0QB 3G6DL 3GHBL 3QUMA 1P4BL 2AJYH 1AI1H 2X1OA 2PYEE 3MRCB 5IVXF 3H2WA 5DMKA 3MLVH 4IS6B 2F19L 5D7KE 1P5UA 3BQUC 5BS0B 1ZGLM 3WFEL 4HIHA 1UB6A 1U8NA 2AJSL 1C08B 2E9WA 4U3XA 5JLZB 1ONQB 1U8JB 1YYLH 3MUJA 3V4UH 4H8WC 3IJYA 5CS7A 4Y5XA 3C60D 4ZAKA 4KRMB 1KTLB 4LDOB 1AKJB 4U1GB 3RIFK 1AGCB 4M1GH 3GEWB 1V7NL 3K8KA 4KI5F 1PZUB 3QCVH 1U93B 5JW4Q 3GSXB 4L8SB 4ZNCD 4JKPL 3L3IA 3DXAD 4QNPF 4UTBL 3MV11 1M7IB 2NR6D 1JZ3A 3WN5A 1QFUH 4AL8L 12E8L 2MNUA 4Y4FD 1LO4L 1B0GA 1A6UL 3LHPH 2HJLB 2PCPA 4Y4HB 3NCBB 1MCSA 4NGHH 5FCUL 3O0RL 3OKDB 4NQCB 1X5LA 3GJEB 3EGSA 3BZ4B 5GISL 1MJUL 1I1YA 3MFFB 4LOUD 3V8CA 1FL3B 1I7TB 2WP3O 4KZEH 1MPAH 4FFZH 3TBWB 4Y2OA 4LCYB 1Z9SA 2XZQH 5DXWA 4UB0L 4FTVE 1IL1A 1F3RB 1OGAE 1AXSB 1QSFB 3BX7C 4ODTH 3NTCL 5HYQA 3AM8A 2C3WA 1AE6L 2ZCLL 3THMH 3CXDH 5K9QG 1ZTXL 2D3VA 4O9HL 1TJGH 1FQ9C 2R1YA 5DD0H 1VADA 5FEBA 3C60C 5DUBB 1UYWH 4NFDA 3SKJH 5I1HH 3VXRE 4Z7UE 1I9RH 5TE4L 3FO1B 2VAAA 3SKNB 4M02A 4KTEH 1SJEB 5E8EA 2NNAA 4XPGL 2FL5A 5CSGA 5HI3C 3UJJH 5T3XH 2ED7A 3B2UC 5DHYA 4WI3A 2ZKHH 1QP1A 3EOAB 2BX5A 4AEIL 2EE9A 4Q9RL 4LGRB 1NFDA 4JDZB 2X4TB 5I8CA 4KUZH 2LAAA 5F1OB 4G8GB 2GAZA 3H3KA 2MJWA 2F8VA 1F4XH 3T8XA 1I7ZB 2V5MA 4QXGL 5D93B 3S36L 3W82A 3CNKA 4JFXA 1RZKL 3LD8C 3QXVA 2BERA 3DYOA 1AHWA 4PGDB 1NBYA 3ILQC 4NKMB 1RVFH 1T83A 1YNLH 4JHAH 1UM6L 4GBXD 2R69L 4FQXA 4YZFE 4TOYH 5EOCH 4HK3J 4AIZA 4NQCE 4JRXA 3ULUE 4G3YL 1GAFL 5JHDD 3H9SB 5CHNB 4X6DB 5GS0L 3IDMB 1N4XL 3Q6FB 3DRTB 4JFDD 1R24B 3UROR 2E9JA 5E00A 3RWEA 4JVUA 5E94A 3N50A 4PJIF 1T3FB 2QQKH 2F74B 3W5MA 4DZ8A 3QISA 4WO4D 3C5ZC 3M45A 1U91A 3RKDD 3VGHA 1EHXA 4C58B 3MRHB 1J11A 1N6QL 3RDTC 5E8DH 5MEQA 4JQXA 4MD5A 3TBSB 2G75A 4AH2B 2LVEA 3L6FB 5DEGA 2AJYL 2JJSC 2ESVE 5TQ2L 1KEGH 4IHOB 5KSVB 3QEUB 4MLIA 3H0TA 5INCA 2NY7L 1CD1A 3AAZA 2KDGA 3FO0H 3O2DA 4GUPB 2C1PB 1EEQA 4DGYL 4LNRB 4DW2H 1DBAH 3OKEA 5I1AB 3BH8B 3W2DL 4WNQB 5HGDB 3MNWB 1TQBB 2ZOKB 4H0IA 3TO4C 1B0RB 5D1QD 2Q8AL 4K8RC 1NCCH 3S88L 3VD9A 5HI4D 3D25A 4X6EA 4WFGE 4UU9A 2EE2A 3P30L 5GGRA 4PJ9B 2Y07H 3UJTH 2VISA 3WKMH 2B1HL 1A22B 2Q3AA 2HLAA 4KK6D 2H6PA 4PJCE 4CADA 2R23A 3BGMB 1BPVA 5I8OL 4UTBH 5HDOA 3ARPA 4X9GA 3J8F7 1T7YA 3INUH 5EZIH 1GOFA 3BDYH 1CIUA 1G7JA 2DD8H 1DQTA 3GRWH 3T1FB 1A14L 3G08B 4PJBF 4UTAL 2X4OB 1BZ9B 3MRBA 5CJBA 5FO7B 1RV6X 4NQVA 1AQDA 4HUWB 1JWSA 4A6YH 5HDLA 3V7AE 1G9MH 3ZO0A 1MJUH 3F7PC 5BQ7A 3RUGB 5IVXA 3TN0A 3ZL4H 3P4OB 1KJMA 4WGVB 4MVBC 1VEOA 4FQXD 5T5NG 5JOEA 2FATL 1J87A 3V79C 2F5BH 4DKFH 1G6VK 4ZYKA 2VUOA 3EOAA 3GMMA 1D5XA 4UI2A 5JORA 1U8JA 5DC4B 3ZT7A 5FKAB 4OI7A 1I9JH 2HA1A 4F3FB 4OLEA 3W5NA 4U3HA 1UYWL 3TO4D 1ZMYA 4AENB 5I1DB 3QIWA 3C5JB 3F8UB 4XNYH 1OLZA 3MRIA 3CIQA 2AS5M 1WBXA 3VFPB 1U41A 4X4ME 4DKEH 3FT2A 1XR9B 3IYLW 4F7TB 4EI5B 1IZKA 2M26A 4P2QE 4DCQB 2D9QB 2RQ8A 3OXRB 4HG4J 1CD0A 4Z7QE 2ZKHL 3MMEB 3F7VB 4DOHB 1IC7L 4PRBB 5TF1H 2UZXB 2Y25A 3WFDH 4RMWA 1N59A 2NY0C 5EOCJ 3VGAB 4I9WD 2AABH 3ULVD 1NCTA 3TNNB 4NZUL 4MX7A 5JO5A 1QLRB 4RDQF 2XV6B 5FYJL 2YPKA 3UTTA 3GJEA 2WBKA 1MCIA 4HJ0D 5E94B 3C5ZD 5I1KL 3PGDB 3O3DA 1RVFL 4EIGB 1CTOA 4LHJB 2NX5B 1Q9OB 4ZD3H 4HS8L 3ZYJA 5D1QA 1C16B 3MXVH 1I7UB 1Q9WA 4Q6IC 4HFUL 1QSEA 2NZ9D 3D3VB 4G8FA 4L4TE 1J05B 5GS0H 3FN0L 5E4EB 2Q7YA 4CVWA 5CGMA 3O6LL 1QHOA