3QHZH

Crystal structure of human anti-influenza fab 2d1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
232
structure length
222
Chain Sequence
EVNLRESGPALVKPTQTLTLTCSFSGFSLSTSGMSVSWIRQPPGKALEWLALIDWDDDTYYITYSSSLKTRLTISKDTSKSQVVLTMTNMDPVDTATYYCARTLRVYVRDFDLWGRGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human monoclonal antibody del2D1, Fab Heavy Chain
publication title An insertion mutation that distorts antibody binding site architecture enhances function of a human antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 222
sequence length 232
chains with identical sequence I
ec nomenclature
pdb deposition date 2011-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qhzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qhzH01
4U1IB 1DN2A 5DRNB 1IQDA 4X6CE 2YPLD 2OR7A 3L3KA 3NZ8A 1NBVH 1BF2A 4JPKH 4KMLB 4J3SA 4PBVC 3V6FB 4AM0B 2XIDA 2QSTA 5JW4M 1SHMA 2EDOA 1EGJA 3X14B 4R26H 4Z7WE 3OQ3B 2P7TB 1TNNA 4XAKE 1G9NL 2NXYC 5DZNA 3STBA 5L2JA 5MHSD 1MRCL 3KYAA 4D0BA 5IMMA 3QG7H 4NN7C 1C16A 5HBBA 4FHBD 1J05A 2YPLA 5ICZB 2ATPA 5GS2D 2F54D 4H1LH 4PJEB 4Y5YB 4MJ4A 4HT1H 4NUJB 3O6KH 3QIUB 5FUCE 1ZSDA 4KUCD 3SGDH 3LDBC 1YY8A 2R2BB 4PJ7A 5E6ID 3NBNA 4I48A 1D6EA 2DMBA 3CFJA 3TIDA 4PJFB 1N59B 43CAA 1I1AD 3V7AE 3LSOA 4C4KT 2F54A 3KWWA 3A6BL 3H3PL 4AEIL 2ZKHL 1FGVH 2P5WB 4R4BA 3BPNC 5MI0B 4AIZA 4TPRL 4NZUL 5LGKA 1DQLH 5EUKB 4WWKB 3BO8B 2EDWA 5E6IA 4PJAE 4KXZI 4QGYA 4KDTA 5CKAA 4P49A 4A2MA 5FYLE 3FAWA 1MHPH 2VXSL 4M1DL 1I1AA 3K1KC 4P9HL 1NFDA 2E8YA 2V5RA 2F5BL 3U30B 4S2SA 3ZDYF 1U8QB 1A7RH 3KAAA 1Q94B 3MJ6A 4XP4L 1ZWIA 2LAAA 1S78C 3RGVC 4HUKB 4FZEL 3QHTC 2I9LB 3I75A 4UBDC 4PGDB 2Y6SD 4NN6B 2J6EH 2IBBA 1BZQK 2J88L 4JM2D 4TSAL 3WS3A 3HPJB 1ZHLB 3B2UD 5T3ZL 3I2CH 1PY9A 2FIKA 3CSBA 1OAYL 2IALB 2HFEB 2EDXA 1IEHA 3FN3A 3LKPB 1I9JH 1DBJL 4QRRB 3MGAA 3ULSA 2BVOB 4JM2A 4PP2A 3OKLA 5ALCL 2K7PA 5BMFL 5EBGA 3B5TA 1M7IA 3VG0L 4HULB 1CTOA 3BDYH 2JJSC 5EH1A 2MCPH 1C08B 1SM3H 1I75A 1OP9A 4JREC 4X5WB 4D0DA 1LGVA 3IFPA 3V7AG 5E2VH 2DLTA 3WKMH 4G6JH 4P48A 4R0LB 5GS3A 5H2BB 4I0PC 3CDYA 4X4ME 1BEYH 3VJ6B 3FN0L 4YZFF 2VWEE 3DX6B 4YHNB 1BIHA 1Z2KA 2FO4B 3QHFL 3WIHL 1HHHA 1DBKH 4RWYH 5LWYH 2LV4A 4GKOA 4HPYL 4X6BB 5AYQA 4NQDB 2Z91B 5EZJB 4X9BA 3U7YL 4XI5C 3IXAB 5EN2A 2GCYB 1F90L 1OCWH 1BLNA 3PWUB 3U0PA 4I13B 3PGFH 3PHSA 4QHMA 5F44A 2GUOA 1FVEB 3TVMD 5DEGA 3S35X 3GBMH 5B8CA 4Y2DD 2OCFD 2GYSA 5GS0H 5BRZE 3VU2A 1NGYA 5EUOF 4WHTB 1AH1A 1YNKL 1AGCA 4YBQC 5CCKH 2V7NA 2H3NA 2YMXH 4MLSA 3SKJL 2C7UB 3D2UD 4UT7H 5BV7H 2M8XA 3MRCA 4HLZH 4POZC 4ZOBA 3TVMA 2X1QA 5JR1L 3HI1B 2ZSWB 2D0FA 4Y2DA 3RX8A 1T4KB 25C8L 1MSPA 5D8JH 4I9WD 3QO1A 1CIDA 5C0BB 1AP2A 3V95A 2ZG3A 1FG2A 3U2SB 1QR4A 1QUNA 4YGAB 1A2YA 4NN5C 5IGXL 4J2XA 4WU5B 1TZGL 2DQUL 4QY8A 2GTZB 3D2UA 1A6ZB 5EZIL 3ZL4L 2A74B 5JA9A 4GS7B 3L3GA 4LGRB 5A40E 1KCVL 2HLAA 3MNWA 3QQ3A 4GW4A 3QO0B 2YD1A 3VWJD 3A67H 1UZ6E 3MJ9L 1MJ8L 4HXBH 4JFYA 3VMNA 1TZHB 4ETQB 2E7LC 5FAAA 3KYKH 1RZKL 1XF5B 3BH9B 2MSPA 4Y5VB 5I75B 2DQTH 1GH7A 4WI3A 5C0DB 3FMGL 3AMLA 4AT6A 2Q3ZA 2XRAH 5E70A 4GXUN 3VWJA 1ZE3C 3T4YA 3BEVB 5F9OH 5GGTH 1FYTB 2DIBA 1S7TB 1DR9A 1W72A 4G9FB 1GHFH 1T0NB 2QL1A 3NIGE 4BFIA 4JO1H 3B8YA 2HVJB 4RNRB 1A9EA 2WWMD 1HKLL 1UWXH 2FATL 2OYPA 1KPVB 1A6TA 3D69B 4W4OA 2BNRB 4XC1L 3IJYB 3MRGB 4WTXA 1D6VH 1I8MB 1OSZB 2VLKB 3OB8A 4NO5B 2P48B 4M6NL 4UQ3A 3S37L 4H26B 4ORGB 5SWZD 1XAUA 2WQRA 3CX5K 3BISA 2XXCB 1LNUB 2XTLA 1A14L 3IDGB 1D5ZA 3OBAA 5GGRA 4UU9A 5LGHH 4AENB 3C5ZD 1TPXC 4N0YL 4HDIB 1IBGL 2W9DH 3OKDB 4LASL 1OAXH 5SWZA 1MIEL 4ELMB 4OCWH 3VGFA 5AUMB 3FFCB 4BK4A 1Z9MA 2C4FT 4BA8A 1YEJH 2Z93B 3IXTB 4OKVB 5FM5M 1CD1A 4PJDE 3RUGA 4HS8L 2LABA 3C5ZA 4KKLC 4OZHA 5ITFA 2AJVH 2XZCH 2AJ3A 4G8EB 5JZ7D 1KIPA 1RIHL 2R0ZL 4LLDB 4I5BA 1SJHA 2OP4L 4HWEL 2FLRT 3DYMA 1BZ9B 3SE4A 5KANG 1X6NA 2V2WB 4Z76B 1AJ7L 4HKXA 2EYSA 5F1NA 1DQDH 3KPTA 5C0AD 4JFOA 5J1AB 1A3QA 1SY6H 3I9GH 4S1SL 3ZKMD 3OX8A 5E5MB 1QFUH 4JQIL 5GRXG 4AG4L 5BXFB 2EC9U 4Q9RL 3VFSB 4NQSB 1XIWB 2XPGA 5TFSH 3QG6A 4LFHG 5C0AA 1CICB 32C2B 2VISB 3WSQL 1IARB 2NY2B 4H8WL 5DSCB 2AJSL 3ZKNC 5T3XE 1N64L 3BVNB 3SDDD 1PFCA 4OLUL 2NY7H 4XWOC 2APFA 5D1XB 2J8UF 3HAEG 1LEIA 3VA6A 5LXGL 4L3EE 1T7WA 4AYFA 1J10A 3MLRH 2DAVA 4K3DL 1OAZL 3G5ZB 3WD5L 2CGRH 1A6WL 1C5BL 4D9QE 3RVUD 1JTTA 3SDDA 4HHAA 4OZIE 1KTDA 3N9GL 5C0NC 1TVDA 2AJZB 1HQ4A 5FDWA 5C6PB 2VTFA 3BHBA 4R7NB 4M9PA 5BZDA 3BN9C 4JRYE 1UWEH 1N2RA 5SWSB 4X6CF 3IF1B 2G75A 3ALXA 2NY5H 1WFUA 3NIDE 2DMKA 4AL8L 4MA1C 1MQKL 4JAMA 4Z7WF 2V6HA 1MVUA 2L7UA 4I3SH 3GDBA 3KPQA 1QLRA 2CQVA 3MXVL 2IAMB 1A22B 3S4SA 1RJZB 4ERSH 2QQLH 3GI9H 4ZO6A 3V79C 1A1MB 2B2XL 3T2QA 4P5TD 4F7TB 1SVCP 4P3CH 1P5VA 1FZOB 4Z5RB 4DKAA 5JW3L 2DM7A 4GG6A 3ULVD 2IQAA 4QRPB 3F7YA 1DBAH 5D7IA 4WDIA 3T65A 4GRMB 1ADQH 1YUHB 2AXHA 3MUHL 3EHBD 4H88H 3U36A 2C3VB 3EO9L 2I25N 2FX9H 4NQCE 4FFYH 4GMTH 4C57C 4KROB 4P5TA 4M62L 3REWA 5IHBA 5C0CB 1SJEB 1SJXA 4MA7H 2FBJH 3VXTA 2EZ0D 2XNAB 1T83A 5IBLD 3GSNB 5AEAA 3FO2A 3W0WD 3OZ9L 3SDCC 4RFOH 3U48A 2DQCH 4ZUUB 3VXUE 1EUUA 3O8XD 3OL2A 3U7WH 5DJ2B 4IRZH 5C7XH 1NJ9B 2E5EA 1P6AB 1UM4H 1ACYL 3HG1B 3HE7B 5EU6B 5AAWA 3K3QA 3VH8B 1AGFB 3RWJA 1OF2B 4Q6IB 3W0WA 2PNDA 5A1AA 5KG9B 2D7PA 4XRCB 1N6UA 8FABA 4B0MM 3O8XA 1S5HA 3TA3A 4GMSH 3S3PA 4DOHB 2ZSVB 5D5MA 4JY6B 3DBXB 4QXUL 5T33H 5AWNH 1R5WB 3NZHL 3OPZL 4L3CB 4Q9QL 3WE6B 3IU3B 2XI9A 1H3UA 1DN0A 3UO1L 3CFBB 4FS0A 3MLPA 5H35B 3G5VB 3PG2A 4XBPB 2VAAA 4MA8H 4QF1B 3V52H 2EH7L 5IVXF 1HSAB 2ZCHH 5D2NB 4QRSA 4J4PD 4MB5A 5JHLH 4GFTB 4M7ZC 1EAJA 3IDMA 2ATKB 1I7RA 3CH1B 3QWOA 1KXQE 1BIIA 1F11B 3E2HC 1MFEL 4NT6B 4OF8A 4JPIB 5ESQB 3P4MB 1OB1B 2W65B 1UB5A 3VXNA 2D0HA 3WLWD 1JGVH 1JF1B 1RUPH 1MRDL 1AXSA 4L9LB 4N0UE 4LAQL 4J4PA 1RAMA 3RWGB 2AEQL 5JTWA 3HPLA 3WNNA 1IM3A 3HB3C 5DD3H 4FFVD 1ZT7B 1LO4L 3LZFH 3D85D 3CK0H 4AEEA 5D7LD 3UTTE 1DTUA 3M1BB 3LKRB 2C4XA 2AEWA 4U6YA 1YMMB 4LIQE 2KZWA 4OZGB 5MERB 4NQED 4EI6A 5DZOA 1O7SA 3D85A 5DQDL 2NW3A 5D7LA 2FO1A 3CSPA 3DXAB 4FQHB 4F15C 2Y07H 4PGJA 2PYEB 1BAFH 1B2WL 2UWEA 3GKZA 5ID1B 3GJFB 1HYSD 2KQNA 3ZKQD 1LO3L 2VSDA 5JOFA 4NQEA 2YPKB 1A5FL 1JNJA 5TPWH 3TN0B 4OSUH 3QJFA 1YY9C 4PJBB 4Z8FL 1FNGA 1AXIB 4FOMA 4XXDB 1ZOXA 3MC0A 4KKNA 4YH6A 5ALBH 1PLGL 5D9SA 4NNYA 3SHSA 4UUJB 3WL9A 4V1DE 3BP5B 3IFNH 4U6VH 3IDJA 4HH8A 4LGPB 1K4DB 2F19L 3RY6C 4XC3L 3DJ9A 4OCXL 2XA8H 2E6JA 3TO4D 2QQNL 1FNLA 3KYMA 3MLSL 4G6AD 4BSJA 3RZCB 3SE3C 5IW1A 2VLLA 1QSFD 1ROWA 4XPFH 1JNNL 1MJJA 1IGYA 3UPRB 3NIGF 3TO4A 2YEZB 2N7BA 4NKDB 3ULUD 4OGYH 4HX1A 2E8ZA 4O02H 4JHBA 3DV4B 1QSFA 4NM8H 3ECBA 4YHPA 5DVOA 1UH2A 3ARBB 1OQXA 3KGRA 5E6YA 2QEJA 2XQYG 2DQGH 4IRSD 3SGKC 4X8XA 3DMMB 1A7PL 3H9SD 1T20A 2PCPB 1FLTX 3WFCH 4K71C 1D3CA 5C0FA 3C60C 1BVKB 5LQBH 1UXWB 5GRJH 2YRLA 4PFEA 4OJFL 4IRSA 1EO8H 3CDGA 2DQEH 1A6VL 3SE8H 1C12A 5FYJH 1V05A 2HYMA 2J4WL 3MRDB 3H9SA 4IRJB 3KLHD 1X7QA 4YBLC 1Q9LA 4FNLL 3HI6H 5F1KC 5HHMB 2DQFB 3L3DB 4PYHA 4R3SB 4NKQB 1KJ3L 1IEAA 3M8OL 1QFOA 4KKAD 1UACH 1FFNA 4OV5B 4PJDF 4CBPA 4DKDC 3IVKB 1KB5A 1Q0YH 2RIKA 3NGBB 3NCMA 4QGTA 5C6WH 1GPOH 1LO2L 1ZANL 1VEPA 4IDLA 2HLFC 2VDLH 1ULVA 3VXOA 5GSVB 2KL6A 1L9NA 3VFTB 3T0DA 2NY0C 5DMKB 4NJAH 4WV1C 4WFGD 5AAMA 1LO0L 3MLXH 2H8PA 3Q1SH 3EYUL 4NRYB 4OIIH 4D8PB 4J3XA 5I1CL 1AKJB 4P2QB 1W2KT 2H32A 3OJVC 4MWFA 4JDVB 4OLZL 3SE9H 4ELKB 1XFPA 4KZEH 2YA1A 5CWSB 1PAMA 5HHVL 4UI2A 1N6QH 4XXCC 1H5BA 4X7FC 1JPTL 2HJKA 5BQ7B 1MHEA 5CEXB 3VXRB 5HI5C 1X3DA 4Y4FC 4Z7VA 4F57H 1BFOA 1IGFL 3HR6A 4JDTH 2I9TA 2A83A 1S7RA 1RVFL 2JB6A 3QISA 4Y4KC 1KLUB 5FYKE 1FORH 5DUBA 3UBXA 1S5IL 3UAJD 3MBEB 1JRHI 1U8PA 4JO2H 4X6DE 4QHKJ 2BK8A 4CMHB 4F9LC 1I1FB 1JTPA 2B5IB 4Y16D 3TBTA 4EOWL 1BGXH 3SQBA 3DRTB 1E6OH 1T89C 4XNZC 1IC1A 3NA9H 1U93B 4U1JA 2ADIB 5ELIA 4IIQB 3UTPE 1XGRB 1G7PA 4OLVL 3UROR 4P46B 2F9BT 4S1DC 1AR1C 1T6VN 2VR9A 3WS6A 3ARFC 1IC4H 3VD9A 4HKZA 4M61B 5J6GA 4Y16A 4U1IA 5DRNA 1W8OA 3NIDF 1ZLUK 4AM0A 3V6FA 1EFXB 5HVHC 4MD4B 1J87A 4X7SH 3X14A 3QIUD 2V2XB 3JXAA 1BOGB 2P7TA 5B38G 3MJGX 2FH8A 4RMVA 2VWEC 4MNQE 3VFPB 2R23B 4HSQA 4WO4C 1JGLL 1WEJL 5FO7A 1Y0LB 1KYOK 5MEPB 5ICZA 5BS0E 1FL6B 4GAFB 5I15L 5DWUL 1KT2B 2NY1B 3ET9F 4PJEA 4Y5YA 2P5WD 2HRPH 5FK9B 4NUJA 3QIUA 1U58B 4KWUA 4R96B 4WWKD 2R2BA 2HFGH 4ONFH 5EBLB 3SO3C 4PJFA 2PW2B 1N59A 4WFFE 1PVHA 4LP5A 3O2WH 2P5WA 3G6DH 4TVPH 3ZDXE 2CO6B 4M03A 1ZEAL 1CGWA 3MLZL 5EUKA 4WWKA 1RU9H 3BO8A 3RL1B 5HVFB 2OJEB 4OT1L 5JIHA 1F3JB 3GBNH 1C1EH 2B1HH 4R4FH 2BDNH 1UKQA 5D6DA 2DTML 4Y7MA 1U8QA 4YHYC 1Q94A 1QFWI 5E7BA 2QSQA 1MIMH 5E1HB 1NLDH 2I9LA 3QQ9D 4PJ8B 3IT8D 4PGDA 1BZ7B 4QRRD 5CIPB 1T6WA 3S36H 4FQXC 4QTHB 1KULA 5TE6L 3HPJA 1ZHLA 5C0EB 4PLOB 2EE9A 5IP4A 4ETYA 5L9DH 5LVEA 1JV5B 4GQPH 1F4XH 5T3ZE 2IALA 2HFEA 3LKPA 5IB4B 1VSCA 4QRRA 1JI2A 3A6OA 4YX2H 4PJIF 1QFWM 1KC5L 2HH0H 5E99H 4O58L 2JCCE 4KK6D 3WUWG 2BVOA 5E00B 5EC1B 5IFAL 1MAJA 3TEUA 2VLME 2HFTA 1KIRB 4FQCL 4KRNA 4HV8B 1UJ3B 1C08A 3FT2A 4PV9B 4MGXA 1NBVL 4JPKL 1KTKE 5CZVH 2O5XH 4X5WA 4R26L 4NQDD 2PN5A 1UA6H 2AV7B 3DUSB 1DLFH 2Q86B 4R0LA 5H2BA 1KV3A 3QG7L 2P49B 3VJ6A 3BUTA 3DX6A 4MAUH 2APBA 4YHNA 4I2XB 2FB4H 3RWHB 2FO4A 1S7VB 4ZG1A 3U1SH 3RDTC 4X6BA 4HT1L 3O6KL 5HHXH 4NQDA 2Z91A 5EZJA 3IXAA 4P3WA 2GCYA 4D9RD 3LVEA 3MV01 3PWUA 4YK4C 2KQMA 4MXVE 1FVEA 1YC7A 5C09B 2LVCA 1KEGH 4RISH 4NJ9H 1FGVL 2P4AB 3CC5B 4NYLB 2N56A 1EBPA 1S7WB 5C0BD 3RVWC 4R97C 4WHTA 1XF2B 2NZ9C 4DK3A 3S3JA 1DQLL 3WNMA 3GMQB 1ZVSB 2C7UA 1DDHB 1CL7I 2R1YB 1MHPL 4P4KC 5HYFA 3HI1A 3T3PF 2ZSWA 4IMLB 4E41E 1CFNB 1T4KA 2XG5A 2X4PB 5C0BA 1A7RL 3U2SA 5E8NB 3BZDA 5ANMB 4WU5A 2VABB 1OWWA 1A6ZA 2QLVB 3T3MF 2A74A 4LSQH 2J6EL 1AI1H 3T8XB 2J1KA 3QO0A 5GZOC 2C1OB 4D94A 3I2CL 5J4MA 5KZCB 1FYTD 2ITDB 3BPOB 4HUVB 4NFDA 4GRWB 4PGBB 4X80H 4YHIB 3QP3A 5HGGS 1EXUB 1TZHA 4JQXA 1Q8MA 4ETQA 4G9FD 5DXWA 4L8SB 1AD9B 1I9JL 1NFKA 1XF5A 3BH9A 4GKNB 1TENA 4Y5VA 3VWKB 4HAFA 5C0DA 3CLFH 1U3YA 4AZ8A 1HXYB 4NBXB 5DD6B 4DVRH 2OZ4H 4YPGB 5ESAB 2BNRD 3BEVA 43C9B 3BDYL 3QZWG 1FYTA 2MCPL 1S7TA 4NRXB 1F00I 2VLKD 3RVXD 1SM3L 4G9FA 1T0NA 5CJQH 3QCUH 4RQQB 2HVJA 1IGMH 2EDHA 4XBEH 4RNRA 3MRMB 6FABH 5E2VL 3WKML 3ALWA 4G6JL 1KPVA 4QYOB 2JJWA 3D69A 5GZND 2BNRA 2DD8H 5D7JB 3IJYA 3MRGA 1I8MA 1OSZA 2VLKA 4NO5A 2DN7A 3B5HA 5TH2B 2FSEB 3LN4B 1DBKL 2O5YH 4RWYL 3G6JA 4H26A 4ORGA 3NPZB 4PGEB 4XNXH 3MV8E 1LNUA 4NC2B 3FFCD 3IDGA 3DETC 1OCWL 3K7UA 3TJEH 3PGFL 5DA4A 3N1FC 1MCJA 3WUZA 4AENA 2BVEA 4U0QB 4HDIA 3OKMB 3OKDA 3GBML 1PZUB 3KG5A 4WI8A 4TSCH 3DUUB 4QXTA 5TE4H 3I6LE 5GS0L 4ELMA 5AUMA 3OXSB 3FFCA 4N90D 4QHUB 3LOWA 1N26A 1CXEA 3IXTA 2Z93A 2YMXL 4OKVA 5CCKL 3HRPA 1L7TH 1CXLA 4PRBB 4U6HB 4UT7L 4Z7QE 5BV7L 5DI8B 5EIQA 1T2XA 1MCFA 5GGUB 2ERJC 4G8EA 4HUMB 4YHKH 3Q2CA 2UZIH 1WZLA 5GGQL 4LLDA 4MCZB 4EDWH 5IW6B 1BZ9A 4Z76A 2H1PH 1JJUA 2V2WA 5EZOH 1REIA 3PWPE 1HSBB 4LCCC 1XIWD 2QQKH 1IKNC 1I85A 1CICD 4NCC2 5J1AA 3QDME 3UDWA 2NY2D 5E5MA 3A67L 3WJJA 5J9PB 5BXFA 4HXBL 3RBGA 3VFSA 5CINH 5D1XD 3KYKL 4FG6D 4NQSA 1XIWA 4DAGH 1CICA 3QXTA 2DQTL 32C2A 1WWAX 2VISA 1V3LA 3RVTD 1Q9WB 1M6OB 5DSCA 5CZXC 2XRAL 1BOYA 3BVNA 3KDMB 1PJ9A 4Y19E 3RTQC 3IU4H 1UH4A 5F9OL 5GGTL 1Z9LA 3TH4T 2DDQL 5LG1A 1D5IH 5D1XA 4ZTOH 5HTSA 1GHFL 1EBAA 4NUGH 4X6DF 1V5JA 4JO1L 1QO3B 1I8IB 5SWSD 3WCYA 3G5ZA 1CXIA 4LVNC 2IFGA 4J8RB 3EKCA 4CN1A 2YPLE 1D6VL 2AJZA 4OFVA 3S7GA 4R7NA 3RAJH 4KKBD 2IAMD 4U7MA 3RX7A 4NDMB 1NMCB 1L9MA 4XVTH 5SWSA 3IF1A 5J11C 2OXHA 1MCIA 4JZJC 5I74C 4CL7A 1U8KB 2UZYB 1R3HB 3D0LB 4O2EB 5LGHL 5IWLA 1ZA6B 2F54E 2ZOKB 3I6GB 2HJFB 4QRPD 2W9DL 3FN9A 1OAXL 2IAMA 4F9PC 3O6FC 5FYLH 4OCWL 1RJZA 4LSVH 1PW3A 2Z31B 2P5EB 2CKBH 4DZ8B 5E2TH 1EDQA 1YEJL 5C0JB 1A1MA 4F7TA 4KROD 1BQHB 4J3VA 2LVEA 1FZOA 1MCLA 1NFDE 4Z5RA 2AJVL 3VGAB 1VACB 2XZCL 4QRPA 2I5YH 3SDXB 3JTSB 5C0CD 3UTSB 4GRMA 1YUHA 1M4KA 3T0XA 2NY6B 2Q3AA 3C87A 4WWID 3X12B 2C3VA 1BQSA 4H0GA 1R3LB 4JFDB 4U05A 3S98A 2APTA 3HR5B 1TZIB 1PGRB 3B9DA 4D0CB 4PJHB 3H9ZA 3H9HB 4WVRA 1SY6L 3I9GL 4M7LH 5C0CA 1SJEA 4KKCD 1MHCB 1QFUL 4HC1A 3HG1D 2VUYA 3HE7D 2XNAA 5EU6D 3ZKXC 3TWCH 3O2DA 3GSNA 4Q58C 3T77B 4HW6A 5TFSL 1IT9H 3MFFB 5E1AB 2WINB 3P73B 4DCQB 2AK1H 4ZUUA 5J3HC 5DJ2A 1NJ9A 2G60H 3UTOA 4PJCB 3HG1A 2NY4C 3HE7A 5EU6A 5GGVY 5KSUB 3VH8A 2NY7L 2NX5E 4TVSa 5L88H 3WJLC 3UMTA 1AGFA 1OF2A 4QTIH 5K33A 4BK5A 4Q6IA 3RU8H 4HK0B 2WWKT 5KG9A 3MLRL 1G9EA 2EYTB 4XRCA 2Q7YB 2BNQB 1QA9B 4M6OH 5C07B 2CGRL 3W5NA 2ZSVA 3O6LH 5HYJB 4JY6A 2JCCF 3NN8B 3O9WB 3DBXA 3DSNA 4AK1A 1R5WA 4DGYH 5CSBA 4L3CA 1UWEL 3WE6A 3IU3A 2SEBB 2OTUB 3JTTB 4JE4B 3CFBA 2DBJA 4U3CA 2NY5L 2VXQH 3C09C 5H35A 3G5VA 4XBPA 1BFSA 1SVZA 5DVLA 4QF1A 1HHKB 4YFDB 2VQTA 1LDPH 1HSAA 4I3SL 5D2NA 2I60H 1N3NB 2IMMA 2AKRB 2ATKA 4Z7UB 3CH1A 4MMXC 3HNSH 4P2OC 4XNMB 4HQQH 1F11A 5DURB 4NT6A 4JPIA 4XAWH 1F6AB 5ESQA 4NO2B 4ERSL 4NZTH 1LE9A 2QQLL 2ICCA 3GI9L 3P4MA 1OB1A 2W65A 2PTTB 1NQBA 4I3GA 5FA4B 1JF1A 4P3CL 3BRFA 4L9LA 1YMMD 3RWGA 1IAKB 2F53B 4FXGB 1DBAL 2WBKA 3JV0A 1ADQL 2BNUB 1ZT7A 4MXVF 4H88L 5F7KC 2F5AH 5IFJB 2XT1B 4M02A 5IMOB 3I02B 2FX9L 4FFYL 4GMTL 4MJ2A 4LCUB 3D3VB 1RFDH 2ZG1A 3DXAD 3LKRA 2CRIA 2PYED 4E5XB 1YMMA 4AIXA 3S88H 1NDMB 1ZKAA 3D18B 2BY3A 5DJXB 4OZGA 1S3KH 5HI3C 2FBJL 5MERA 2X4RB 5DFVD 1M71B 3KLAB 1CGXA 4JQVA 5C6TH 3TN0D 3DXAA 4FQHA 2ZNWA 4MVBD 4P4RB 2WV3A 3ARWA 4HFUH 4RFOL 2PYEA 2DQCL 1OARH 5ID1A 2VQUA 3GJFA 4HMDA 3U7WL 5C7XL 5HHPB 1UM4L 1UVQB 2BMKB 2YPKA 2JKXA 3TN0A 3RZCD 2KDGA 5JXEC 4PJBA 4YDKH 4MHHG 4XXDA 4XHQA 2ZCKH 2G9HB 3LDBB 1U6AH 3BP5A 4NM4H 1K4DA 2D0GA 1Q9KB 1OM3H 3Q6GH 1RIVH 2A6DB 4MQXD 3MSPA 4PB0H 3RZCA 1J5OH 1PG7H 2W9LA 5T33L 5FGBA 5AWNL 3HAEH 1ES0B 3ARBD 4C56B 5ESVB 4ODHH 5F89B 2MNUA 4G42B 3DMMD 1CDUA 1MFDH 3UPRA 5GXBB 3DPBA 1U3HB 4MA8L 2WLYA 3V52L 3TYGH 2YEZA 2ZCHL 5FB8B 3EYQD 3BRGC 4NKDA 5FGRA 2BSTB 5SWZE 5JHLL 1NKOA 1UZ8B 3DV4A 3ARBA 4JFHD 1H3GA 5D93C 4DZBB 1MWAH 4ODTH 4HCRH 4OLWH 3RGVB 3DMMA 3RWIB 2Y7QB 3VGHA 4TRPH 4IRJD 3RUGE 2PCPA 5HHMD 4GAYB 4K9EC 5CBEB 3QIBC 3MOQA 1JGVL 1RUPL 3GK8H 1B0GB 1UADC 5DRWB 1BVKA 1UXWA 4RIRB 5JXAH 4RGOH 5DD3L 3GSWB 3CK0L 2H9GB 3MRDA 4IRJA 5I18H 1VDGA 1MFAH 4PBWD 1UQSB 4NNXB 2DQFA 1A3LH 3GEWB 1NCAH 3L3DA 1H0DB 4R3SA 5IHUH 3LPFA 5D1ZB 1DQQB 2OR8A 3JWOC 3TM6A 4U31A 1WZKA 2FGWH 4OV5A 2IANB 4Z7QF 3IVKA 2DICA 4EVNB 4UTBL 1KCKA 4U6TA 2BSED 4JREB 4QXGH 3WN5C 5T3XH 5GSVA 4AMKH 1AKJD 4P2QD 4MCYB 3TESA 2Y07L 3VFTA 3L3JB 4WUUE 5IKCB 1BAFL 2FX7H 5DMKA 4YFEA 3OGCB 4I0PB 1RZJH 3AROA 3O3UN 4NFBA 4U4BA 4R4NC 3FL7A 5TPWL 3VXRD 4OSUL 4NRYA 2B20A 4DTGH 4D8PA 2EE3A 5J1SC 1AKJA 4P2QA 4K7FB 5ALBL 4JDVA 4ELKA 1OP5K 1J8KA 3IFNL 4U6VL 5CZKA 2XTJB 5CWSA 2F8XC 3MBED 1V3KA 2XA8L 1V7MH 5DJYB 5C08B 5BQ7A 5CEXA 3VXRA 3UZVB 1GGTA 1MF2H 5C86A 2HT3C 3T4AB 1YEKH 2EDJA 3FOLB 1HZHH 5F9DC 4XPFL 2XACC 3BSZH 1MCDA 1KLUA 3P0VH 4P46D 3MQIA 3MBEA 4EQ3A 2QV2A 2ADFH 3V0WH 4PLJC 4PJXE 1F5WA 1I1FA 2PYFB 4OGYL 2YZ8A 3S34H 2DKSA 3DRTA 4O02L 4WHCA 3HN3A 4NM8L 2VDQH 2XG4A 3S36X 1EFXD 2DQGL 1U93A 4U7KA 2ADIA 5HGAB 4IIQA 1XGRA 3B3IB 4X4YB 4P46A 3H9YA 3FB5B 4NHUA 1VFMA 3WFCL 4GG6E 2CXKA 4M61A 3B8SA 3QXDB 4NWTH 1L6ZA 4APQB 4I4WB 2P46B 2FL5B 2BRRH 5D7IE 5DVMA 5LQBL 5GRJL 2VXUH 1EFXA 2NY1D 4JFFB 5ID0B 1EO8L 4MD4A 2DQEL 1OTTC 3SE8L 2V2XA 5FYJL 1BOGA 1FZJB 2HP4A 3ES6B 3HI6L 5FKPB 4KUCF 4BSWB 3VFPA 2R23A 3AS1A 2X05A 3ZSSA 1BFTA 3ULVE 4F7CB 3HHRB 2YD7A 3FQUB 1Y0LA 5MEPA 3L1OH 1FL6A 1UACL 1KT2A 2IWGA 5GRZA 4O2CB 1Q0YL 1OD9A 1Z5LB 5FK9A 3SQOH 1NFDF 1U58A 3GMLA 5HYEA 1GPOL 4M6MH 2VDLL 4R96A 2XQBH 1DEEB 1KF9B 3EYOB 2C3HA 3K8KA 5EBLA 3BZFB 5FIEA 1VCAA 2PW2A 3QPQC 3K2UH 3UP1A 4AH2B 2ENYA 1FPTH 4NJAL 1J0KA 2VXVH 3B2VH 3SKMB 1NCBH 5CMAB 2C4FU 3MLXL 3Q1SL 2R8SH 4PRNB 1U8JB 1M1SA 3KPRE 4OIIL 3W0WE 4ZFFA 4PTTB 3VGBA 3RL1A 4U1KB 4B7LA 2HTKD 4PJ8D 5EOCH 2OJEA 3SE9L 3L6FB 1X5GA 3CGTA 1F3JA 1GL4B 1C8PA 1FO0B 5B39G 5D5ME 2QADC 1FV1B 1N6QL 5E8DH 3GHEH 4MD0B 1RUAH 5HI4D 4L9DA 4F57L 1UXSB 4CU8A 3THMH 4JDTL 4OBSA 5KVDH 3FO9B 4PJ8A 4YE4H 3PP3H 1BZ7A 1FIGH 4PJ9B 3HTLX 5CIPA 4P5MB 1FORL 4QTHA 3JUYA 4M9OA 5I71C 4JO2L 4H0HB 3OB0H 4OGZA 5C0EA 4QHKI 3HZMB 1BGXL 2UYLB 1JV5A 1V7NH 1E6OL 5KVEH 3EAKA 3NA9L 3QI9C 5IB4A 2DQJH 3TC9A 1RZKC 4P5KB 2B1AH 5E00A 5EC1A 4LMQI 1UYWH 1U36A 4O51B 3HC3H 1IC4L 1KIRA 4QHLB 3SGJC 4HV8A 1UJ3A 4HFWB 5EA0L 2NR6D 2Z8RA 2QHLA 1KN2H 4PV9A 3W81A 1DQTA 3LRGA 4HK3N 1P4LA 4X7SL 3KYNB 5FDYA 5ERWB 3W82A 4LIQH 1I9IH 2AV7A 3DUSA 2Q86A 4GW1B 1MNUH 1H3PH 4ALAH 2W0PA 1K2DB 1J8HE 3BXNB 4I2XA 5C09D 3RWHA 4ESKA 1KTRL 5JDSB 3IS1X 4QEGA 4GRLB 3QUZC 2HRPL 1K5NB 4PRIB 2Y72A 2ITCB 1FFOB 2NMSA 3HCVB 2HFGL 3JV6A 4ONFL 2IH3B 1CXKA 1QG3A 5CBAB 1HE7A 3NCEB 3QCVH 5C09A 3QIWC 5IOPB 4D3CH 2EH8H 3O2WL 4C54A 3G6DL 4TVPL 5E4EB 3CC5A 4NYLA 1S7WA 4I77H 3H0TB 5F8RC 1XF2A 3L3HB 1RU9L 1ODAA 4HGWB 3GMQA 3KXFB 4ISVB 1WBYB 1ZVSA 4Z78B 5F96H 1DDHA 2DS4A 1XGYH 2R1YA 3SKNA 5BCAA 3GBNL 4IMLA 5FUZH 1C1EL 2B1HL 4R4FL 5HPOA 4MA1B 2BDNL 4BQ9A 1CFNA 4XVUD 4LOUD 2X4PA 5J06A 4F8QA 4NQXB 2HG5B 2JB5H 3S5LB 1CD8A 5KZCD 2FHFA 4HEPG 1Y18B 1MIML 3MYZA 5E8NA 1HOCB 5ANMA 2VABA 1NLDL 3UTZB 3S36L 1WAAA 3VWKD 3TYFB 1NANI 4M93C 3T8XA 4XCFH 2C1OA 3CVIH 4OM1H 5DHXB 1GYAA 4XB8A 4O00A 5TQ2H 4LSPH 5L9DL 2ITDA 5H94B 4HUVA 3BUYB 4PGBA 4YHIA 2EEDA 5CSGA 1F4XL 1EXUA 3W9DB 1WCBB 4KK9C 4OGAC 4L8SA 1AD9A 4GKNA 4I8DA 4YX2L 1NKRA 2HH0L 3VWKA 1ED3B 5E99L 1CBVH 3D0VB 1HXYA 5SX4I 5DD6A 1ZT4B 3TFKD 4YPGA 5ESAA 5IVNA 43C9A 5D7JD 1JVKA 2R39A 4OAWB 1T7ZA 1NC4B 4NRXA 3OG6B 3KVQA 2HT2C 5CZVL 1RK0B 4RQQA 1U42A 3QUMH 1ZLUH 4JZNB 4LQ1A 3MRMA 5DJ8B 1UA6L 3QAZC 1DLFL 1CR9H 4QYOA 5K93A 4M4PA 1RQ5A 4RFEB 4ZS7H 4LCWE 5D7JA 4LSTH 2F74B 2UVEA 3EFFB 4MAUL 3I84A 5EBMB 1JPSH 2FB4L 4WFHE 2VDNH 3ZE2E 5TH2A 2FSEA 3LN4A 3U1SL 5A2FA 1NCDH 5HHXL 4JB9H 5D2LE 4PGEA 2BHZA 5ISZB 3U79A 3ESVF 2YD2A 2EC9T 4P59H 3U9UB 4PLKD 1XH3B 3WFZA 2Y25A 4GT7A 1KEGL 4RISL 3HNVH 3OKMA 3FRUB 3DUUA 3HUJE 4GJTB 4X7DC 2DM3A 3OXSA 4Q97A 4QHUA 3T0EB 1I1AC 3ZDZF 3PWNB 4PRBA 4U6HA 3LEVH 1JHLH 5DI8A 4WFGE 5GGUA 3W11C 5DJAB 4MCZA 4W68A 5IW6A 3E1F1 2PR4H 5FYKH 4M7ZB 2ED9A 1HSBA 3E2HB 1KJ2H 3KHQA 4FQ2H 3H3BC 4LSQL 3EYVB 1AI1L 1HHIB 4B5EA 1W0WB 4M5ZH 3TJHC 4WNQB 1J18A 2VLJB 2EDNA 5J9PA 5K9OB 4X80L 5I1IH 5JA8B 5GGTA 2EDYA 4PG2C 4K9EH 5ECJE 2VDRH 3CLFL 4JY5L 1Q9WA 1M6OA 1SMAA 1P7HL 4DVRL 2OZ4L 3KDMA 4K94C 4HKBB 5DMJB 4KDVA 4JKPH 3SGDI 3ZT6A 3VXMB 5CJQL 4XHJC 3QCUL 2OL3H 4PJXF 1QO3A 1I8IA 1IGML 4XBEL 4HWNA 3KR3H 2OLDA 1VFBB 6FABL 3MV7B 3FO0H 4FQQB 4PRAB 4J8RA 3WDHA 4FN0A 2BJMH 3JWOH 3MO1B 4G7VH 2DD8L 2M26A 4NHCH 4RFNB 4JG1H 3IS0X 4IS6B 4O2FB 2ZUQC 2O5YL 1LEKB 4NDMA 3N1QC 4N1HB 3HNTH 4JFXB 4RMSA 3RP1A 4RBPH 4XNXL 4YHZH 1DLHA 5D7IF 4C55A 1CGYA 2Z31D 2P5ED 3TJEL 1R3JB 5B8CC 2GFBB 2L7JA 4G8GB 3MLVH 1U8KA 3LKSB 1R3HA 3D0LA 4O2EA 4LNVA 4UOW0 1JMXA 1ZA6A 3IKCA 3PGCB 2ZOKA 3I6GA 4AEIH 2HJFA 3HMXA 4A6YB 4TSCL 2XZZA 4KH2A 2V9QA 5TE4L 1ZGLA 3UTSD 1LP9F 5KSAC 3SBWC 2XKUA 3UBXG 3MCKB 1YC8A 3V6OE 2NY6D 4NQTA 2Z31A 1UT9A 2P5EA 1RMFH 4DZ8A 3GMRB 5GS1C 4WHYG 4X0KB 2VDOL 1L7TL 4JFDD 4ZD3H 5C0JA 1J1XL 1H8NA 1BQHA 1QSEB 2J8UB 2R29H 1LMKA 2Z8SA 3ORJA 3BIBX 5CJOL 4NQUA 3HRZB 4PBXA 2PTVA 5DD5H 1VACA 2A6JA 2D7NA 1E6JH 2GT9B 3SDXA 3JTSA 2GITB 4YHKL 2UZIL 3D48R 4QO1A 4MS8D 3UTSA 1SY6A 5IBUG 1JCKA 4EDWL 3X12A 4RRPA 2H1PL 5EZOL 3SDYL 3BIKB 3QB7C 1IZJA 1R3LA 2V17L 4JFDA 1ZHNB 2QQKL 3D25B 1TZIA 4D0CA 3DI2B 4PJHA 4U33A 3H9HA 1UENA 5T3ZH 4K71B 5GJTH 4X6CB 4HWUA 1UCTA 1MHCA 3PGDA 3C60B 1S8DB 4WW2F 5D5MF 3T77A 1KELH 1A64A 3WNLA 4YPJA 4DAGL 3VWJC 3MFFA 5E1AA 2WINA 3P73A 4DCQA 3S3SA 5BMFH 2RGSA 2BNQD 1T80A 5C07D 2AQ2A 4POUB 4W70A 1N6VA 3ARGC 2EDBA 4K8RD 3IU4L 3SDAC 4LNRB 4PJCA 5HYJD 5KSUA 3UJTH 1F2XK 1D5IL 1EX0A 3O9WD 4ZTOL 1UWXK 2BVTA 2PXYC 4NUGL 4HK0A 3FOMA 1TTFA 2EYTA 2Q7YA 5AG9A 2BNQA 1QA9A 5C07A 3VFWB 1XGTB 4G8IB 5CLTA 3FN0H 2X7LB 4EEEA 1VEMA 5HYJA 3NN8A 2XICA 3QUKB 3O9WA 1HWGB 5TE7H 1A6PA 1UKTA 3RAJL 4NQDE 5F7YC 2SEBA 2OTUA 4XVTL 1MELA 5DURD 4NRZB 3JTTA 5K9JH 1CYGA 4HIEB 2IBZY 1X9QA 4RAVB 3JWDC 4JHWH 3V0AC 1HHKA 5DO2C 1PG7X 5KVGH 3BYTA 5FV2A 1Z6JT 4P9MH 1N3NA 3V7MA 2VN4A 2F53D 4X5LA 4CN4A 2AKRA 5C3TA 5D7KE 4Z7UA 4XNMA 5FYLL 4HKJB 1G6RB 4LSVL 2GAZB 3C5ZC 1F6AA 1K8DB 2CKBL 4NO2A 3CX2A 1DANU 5E2TL 3D3VD 2PTTA 2A9NH 5FA4A 4Y4KB 4OCYL 3H7BB 2VZUA 2VC2H 1IAKA 2F53A 1HINH 2I5YL 4FXGA 5C0BE 1IAMA 3K74B 5C0GB 2BNUA 5IFJA 5DK2B 5IMOA 3I02A 3SOBH 4IOIB 4LCUA 2YA0A 3D3VA 3BMWA 3OWEA 1PKOA 2EEAA 2M1KA 4E5XA 3AC0A 1R0AH 1NDMA 3D18A 3ARFB 1RULH 5DJXA 4M7LL 2P44B 4LAJH 4LVHB 2X4RA 1YEIL 1TLKA 1M71A 3KLAA 1AGEB 3TWCL 5IVXB 5HVHB 1O5DT 3EJJX 3GIZH 4P4RA 1IT9L 2NY3B 4YQXH 2A77H 2AK1L 2XY1A 2X89D 4U2YA 2R56H 3QUXC 1FFRA 4WO4B 1FYTE 5HHPA 3BESR 2G60L 1UVQA 2BMKA 3MRQB 3L5HA 1FBIH 3MZTA 4G9FE 5L88L 2G2RB 2ZG2A 3VW3H 3RU8L 1TTUA 3QUYC 4BQBA 2MQCA 3SDDC 4C56D 2G9HA 1FRGH 2X89A 2AJXH 2BNRE 5FYKU 1RUKH 2DQHH 3OAYK 3VDAA 3SO3B 4MXQC 1Q9KA 1U3HD 2BHYA 2VLKE 3O6LL 4Q6YA 4S11A 2A6DA 5BRZB 1YEGH 3OG4B 1HI6B 1GAFH 2CPCA 1ES0A 3CXHJ 4DGYL 2QSCH 2E7BA 4C56A 1JE6A 5ESVA 4F33B 2LQRA 2ICWJ 3OXRB 2VJXA 5F89A 2FHCA 4G42A 1S78D 5GPRA 3IJHB 3RGVD 1BD2B 2VXQL 4M3JA 4RGNE 3NCFB 4XTRD 4AQOA 1U3HA 3EJZD 3MPCA 1LDPL 4I18C 4LSSH 3UPAA 5FB8A 3WLBB 4EUPB 2I60L 2BSTA 4XPTH 1UZ8A 2BZDA 4DZBA 2DL9A 4YHYB 1NCUA 2UUDH 3FFCE 4HQQL 3RGVA 4XAWL 3RWIA 4NZTL 1TMCB 3ZE2F 2VE6B 3EDFA 4Y5XB 4HS8H 1FC2D 4GAYA 5CBEA 3WMSA 1UM5H 5D2LF 1ZGLM 5GRYA 5D1ZD 3WO4B 1B0GA 2YS4A 2ZUWA 5DRWA 2CMRL 5CD3B 1EPFA 2IAND 4RIRA 1X5HA 4FMKA 2EXWD 5EC2B 1U0QA 3GSWA 4PRDA 2H9GA 4H20H 2XKNB 4KRMB 3ULVC 2AK4B 4P0DA 1RFDL 4LPUA 1UQSA 1BVZA 3GRWA 3K81A 3HUJF 4NNXA 5CILH 5K9QI 1H0DA 4OD3H 4MQSB 1MY5A 3S88L 4S1SH 5D1ZA 1DQQA 1MOEA 1T83C 5HYQB 4ZAKC 4I0PD 3DV6B 2IANA 2JJSA 1S3KL 2D03H 1J0HA 1P9MA 4KGJA 4EVNA 4Q9RH 1Q9OB 4P57B 5C6TL 2YN5A 2HMID 3IDNB 4BFEA 4MCYA 4NOBA 1W0VB 3L3JA 4HFUL 5IKCA 4XI5D 5KTEH 4JFQB 2EZ0C 1FVDB 1X5AA 4M8QB 1EGJH 2LTQB 2XTJD 3OGCA 4I0PA 2CR3A 1CK0H 1K3ZA 2YC1B 2NLJB 5C08D 2YD4A 3RDTB 5LXGH 2BOCB 3TLRA 4YDKL 4K7FA 4WW2C 1OLZA 2ZCKL 3TA3C 4NPYB 1U6AL 3GZKA 3OJ2C 4YBQD 4YK4B 4NM4L 2EC8A 4POZD 1OM3L 2YK1H 5ICYB 3MRNB 2YXMA 1RIVL 3Q6GL 2DBLH 5DJYA 5C08A 5CSZB 5MP6H 4PB0L 2HJLB 1J5OL 3T4AA 1PG7L 5CD5D 4YR6B 3FOLA 4U49A 4R97B 5GS2H 1WGOA 4PJDB 4W81A 4LPYA 4ODHL 2W0LA 2OMBA 1MFDL 3UX9B 4P4KB 1OWRM 4LHQB 3TYGL 3FT3B 2PYFA 1U92B 4APQD 5TDNB 1PD6A 5HSFA 2CJUH 3S96B 5I6XC 5JIIA 4JFFD 1MWAL 3TBYB 5HGAA 5SV3A 3RKDC 4ODTL 1I3GH 4HCRL 4OLWL 3B3IA 4TRPL 4X4YA 3FB5A 3CU1A 2IPKB 3QXDA 4APQA 5DA0B 3PDDA 4I4WA 4QRPE 4CJ1A 3IAPA 1NBQA 2FL5A 3WXVH 3CFCH 2P8PB 1T2QH 3ZO0A 4OZFB 5KSBE 1LK3H 4JFFA 5ID0A 1YQ2A 5JXAL 1RZFH 4RGOL 3WLWC 2E9JA 4RAUB 3WEXB 1FZJA 4OTXH 2E7LA 2EE2A 3X3GH 5I18L 3ES6A 1MFAL 5FKPA 4BSWA 1A3LL 1NCAL 2NQCA 3L95B 4JVWA 5DGRA 5IHUL 2ZUXA 4F7CA 3KJ4B 4FFVC 3FQUA 3BKMH 1B4JH 3PV7A 1DP0A 2FGWL 3BD5A 3RI5K 4O2CA 1Z5LA 3CSYB 4HD9A 4L3EB 5T3XL 1DEEA 4AMKL 3EYOA 3W5MA 3BZFA 2FX7L 2XXMB 4K94H 4AH2A 1PX3A 1RZJL 2YBRB 4LHJB 1CI5A 3HG1E 5IHZB 1QKZH 4F7PB 5CMAA 3OKYA 5DJCB 1P4IH 4NO3B 5JHDE 3CAFA 4XP5H 4PRNA 1U8JA 4UV7L 3FZUC 4DTGL 3O3BB 4PTTA 1T0PB 4U1KA 3P0YH 4PJ9D 4YDVB 1YYML 1JWSB 3L6FA 1TQCB 4Y1AE 1FO0A 2VRAA 4WW1B 1VENA 1FV1A 4KKLD 1V7ML 1U2HA 4MD0A 4G80B 3NPSC 1GOGA 1ZA3B 1YEKL 1TDQA 3OMZA 4LLQB 1UXSA 1HZHL 2AVGA 3FO9A 4PJ9A 1VESA 3TO4C 1BFVH 1D5MB 3BSZL 3IFLH 4P5MA 2EO1A 3P0VL 4G6AC 3MFGB 4JGMA 3O41B 1OW0C 1YEEH 3C6LC 2ADFL 3V0WL 5D2NE 1LE5B 4KJWC 1JNHB 3VFNB 3HZMA 3S34L 1WK0A 4XVJH 2UYLA 4MA3B 3BDBA 4NQCB 4GLRH 2VZOA 5F6IC 2Z8VC 2WBJB 2MPAH 4P5KA 4LGSB 4LCCB 2IQ9H 2R4RH 4O51A 1WJ3A 4LAQH 1B88A 4QHLA 1YECH 4HFWA 5I17B 1R5VB 2BRRL 1OT1A 3AM8A 3ZKND 4KDWA 2VXUL 2E7HA 5E94B 1JZ3A 3QDJE 4GRLD 5C0RH 1D7FA 4OCNC 3KYNA 3NCYS 4PRID 5ERWA 1XF4B 4MAYC 3VXUB 5ITBH 2MWCA 1H3VA 5HVGB 3VH8G 5TGBB 4QCIB 4GW1A 4XP6H 5CEYB 4YO0B 5H37G 1F02I 1K2DA 2H6PB 4OZGE 2XY2A 4OF3A 3BXNA 3L1OL 4I0CC 3C2AH 5F1SA 2AW2A 3RTQB 5JDSA 4GRLA 1K5NA 5C0ND 3SQOL 4PRIA 5DQDH 2JTDA 2ITCA 1FFOA 5C1MB 4M6ML 3F8UB 3DXAE 1KEMH 3HCVA 2XQBL 5HGDB 3KXFD 3WDJA 3SEPA 2EDEA 3BN9D 3D9AH 2IH3A 5CBAA 1JWUB 4LVNB 1W72H 3K2UL 2YD3A 2ZUVA 4PJIB 3WHE1 5IOPA 5IESH 1FPTL 2VXVL 3B2VL 3DROB 3QSKB 2R8SL 4KI5E 3VD4A 2X9XA 3NCYP 3H0TA 5F93C 1WBXB 3L3HA 4HGWA 3KXFA 4ISVA 1WBYA 5E0QA 4Z78A 3VXSB 5EOCL 1N7MH 4WJ5B 5J11B 1H5BC 5BV7C 5IEHB 1JL8A 4JZJB 5I74B 3DNKA 3A0OA 4GAGH 1OP5H 3ZT7A 1JIBA 2BOBB 4U2ZA 1G0YR 5DC0A 5MEOB 5E8DL 2F8VA 3KPSE 4NQXA 3GHEL 2HG5A 1RUAL 3S5LA 1Y18A 2OQJB 1J1OH 3O6FB 1HOCA 4IMKC 3THML 3ARRA 4OKDA 3UTZA 4KK8C 1S9KC 2H45A 4YE4L 3JWDH 1FIGL 4KAQH 1IVLA 9CGTA 3VGDA 3TYFA 3MJ7B 3GM0A 3EFDH 7CGTA 2VAAB 1IGIH 2Z35B 4OI9A 5H94A 3OKNB 1NC4D 3BUYA 3HLAB 1AC0A 1LK2B 2X4TB 5AZEH 3W9DA 1WCBA 5KVEL 3V5HB 5F7HA 4DKFH 2F58H 4J6RH 3UAJC 3UTTB 5T5NF 3WS6C 1A7PH 1GCFA 5KJRH 1ED3A 2B1AL 5ETUB 4QLRA 4LLWB 3MRBB 3D0VA 3N1MC 4DEPC 2ILLA 5DHVH 1ZT4A 3FTGB 3HC3L 4R6UA 4OAWA 1NC4A 5EPMB 4UAOB 1KN2L 4M48H 1NEZG 4EBQH 1QZ1A 1RK0A 4JZNA 1P5UA 3AS3A 3BJLA 1OLLA 1SBBA 5DJ8A 5ISZD 4LIQL 1I9IL 3TO2B 3AY4C 1JK8B 4WHDA 3GSQB 3FQRB 2WQ8A 5IFHH 2DM4A 4RFEA 3I3BA 1MNUL 4D2NA 4Y5YC 3EFFA 1H3PL 4NOFA 4ALAL 3QIUC 5EBMA 3H7LA 3QQ4B 3FRPG 1WZ1H 5TDOB 2JLLA 5EOCJ 2NY4B 1I8LC 4PLNC 3MACH 1BPVA 5ISZA 1A7OH 3GKWL 3T0ED 3U9UA 1PSKH 1XH3A 4J12A 3QCVL 4HPOH 3TV3H 3RWDB 2IF7A 3FRUA 4D3CL 1JBJA 2GTWB 3V6OC 2EH8L 2VZSA 4Z6AT 2ESVE 4JLRB 4DFIA 4I77L 1ZHBB 5I1CH 3T0EA 2Q20A 4NNPH 3Q48A 2MCG1 2NTFB 3LQAH 3PWNA 1NCWH 5F96L 5D6DC 1D9KB 1XGYL 3WYRA 3TZVB 3TPUA 3C09B 4JFEE 5FUZL 5KAQG 2VDKH 1A8JH 1KG0B 3VXRE 5DJAA 3UEZA 4ZOCA 2JB5L 1RJLA 2VLJD 4NN6C 3RI5F 5DJZB 2O26U 4X6FB 4TSBH 1QFPA 2WUBH 2Y06H 2P24B 1C5DB 1HHIA 3EYVA 4XCFL 1W0WA 5E2UH 2RFXB 2BCKB 3CVIL 4OM1L 4WNQA 2GJZB 3QQ9C 3AAZB 5TQ2L 2VLJA 4LSPL 5K9OA 1NUGA 1AR2A 4LCIH 4YJZL 4WCYH 3VXMD 4BH7B 2H2PD 3ME0A 5I8CB 1SYSB 1W0YT 1CVRA 3QUMB 1UEMA 1FCCA 3MV7D 1DJSA 1JZ5A 4U0RB 3EZ8A 5KVMC 4XNQB 3NCCB 4HKBA 4MSWB 3VXMA 1EFQA 2DJUA 2CUIA 4R0LC 4H25B 3OR6B 3QUML 2NXZB 3ULVH 2ZUYA 2DLFH 1VFBA 3MV7A 3WDIA 4FQQA 4PRAA 1CR9L 1KGCD 3L7EB 5B38B 1YEHH 3MO1A 4ZS7L 3O11B 4G8GD 3AREB 4X6EB 4LSTL 1EHNA 2WMPA 4IS6A 2CK0H 4Z95H 2C5DC 4O2FA 1PX4A 3QDGB 1SBSH 5FF6B 1AO7B 5CP7A 1LEKA 2EEBA 5IF0B 4JFXA 4JB9L 2EXYC 5KSBF 4TNWK 4P59L 1X6LA 3VFRB 2NY5C 1R3JA 2GFBA 3IETB 4G8GA 4J23A 5IVZB 3LKSA 1QSED 3Q5YA 4HMEA 2FJHB 1MCHA 1CDYA 3RY6A 3HNVL 2IBZX 1RIUH 4A6YA 3MOBH 3MCKA 1HXMB 3SE3A 4ONHB 3F6LA 3GMRA 1R24B 4X0KA 3LEVL 1QSEA 2J8UA 2X4OB 1JHLL 2I27N 3HRZA 1SYVB 2YD8A 5IR1B 4XCYB 4HJGB 2GT9A 1WITA 2GITA 2VL4A 2PR4L 1MH5B 3C60D 2UY6A 5FYKL 1IMHC 5D93B 4GS7C 3RY5A 3BIKA 3PQYB 5DJDB 3SGKA 1KJ2L 1ZHNA 3D25A 4XAKD 4FQ2L 1XCQB 1S7XB 4X6CA 2AEPH 5GRVL 4M5ZL 4JQXC 2EDKA 4GXUM 1JTOA 3C60A 1S8DA 1MQ8A 4XBGB 1CGSL 5I75C 1EEUA 4P3DB 5I1IL 1GIGH 4ONGH 1ZHKB 3CIQA 4DN4H 1BREA 1KFAH 4MNQB 4K9EL 3GBLA 2VDRL 2HLFD 4YXKL 1Y6MR 5BS0B 4Y16B 3WUWB 1F58H 2DMCA 1A6UH 2BSSB 4LNRA 4PJ5E 4JKPL 4ODXB 1KTLB 2FR4B 3V8OA 4L3AA 4G6MH 3EJYC 1DZBA 1MLBB 2OL3L 4FABH 4J1UB 1QVOB 5EWIH 3KR3L 4UT9H 4DK6A 3FO0L 3VFWA 2CKNA 1XGTA 4G8IA 2BJML 3JWOL 3V9FA 5FO7B 5HHOE 2UZXB 2X7LA 1VFUA 3KPLB 4G7VL 3UJJH 1T2JA 4I2XE 4NHCL 4JG1L 4WV1A 3QUKA 3SGEH 3LB6C 2A2QT 5FXCH 3HNTL 4HIXH 1CXHA 4LVOC 3U7AA 4XPHH 4RGNC 4YHZL 4NRZA 1TIUA 4HIEA 4RAVA 3QT2A 3BEWB 2YRPA 1UC6A 3MLVL 2MJWA 2HTLC 4Y4KD 5C09E 3S37X 2GQHA 3T1WA 1NAKH 1Q72H 2KPNA 4K3JH 3FB6A 4XXCA 3VG9C 2YUWA 1K9TA 4ZFZB 4HKJA 1G6RA 4NKOB 2GAZA 2E9IA 2EYRB 1K8DA 4NGHH 1RMFL 5DF0A 4ZD3L 2ICES 4YDLB 4Y4KA 2R29L 3H7BA 3ZTJG 4OLYH 4S1DD 4N5UA 1AR1D 3I3EA 5DD5L 1E6JL 2VLRB 3ARFD 4U3XA 4MJ5B 5C0GA 3CU7A 2YUXA 4CKVX 5DK2A 1I85C 5ANME 3CLEH 3DX9B 2JCCB 5FHBH 4IOIA 3P4NB 1X44A 5H8DA 3UDWC 1WAAE 1EO7A 4KI5F 3WJJC 3HA0A 2NY3D 3LCYA 4PRPE 5J57B 5GJTL 1DBMH 3ARFA 2E7MA 3VDCA 1LD9B 3LN5B 4WO4D 3O4LE 1XIWC 3SN6N 4GRWE 2RAMA 5IMKB 1H3WM 1AGEA 1CICC 4OI8A 5IVXA 4YAQB 1KELL 2NY2C 2J2ZA 4LLYB 1VHPA 4WI4A 5DS8B 5IV2B 3ZHDA 1EUTA 1WBZB 4ZFOL 2D4DA 1N8ZB 5BOZG 5D1XC 4WO4A 3L7FB 3VI4E 2XN9E 3MRQA 3DVFA 3FT2B 3UJTL 4OFPA 5BRZD 2G2RA 2AGJH 3RVTC 1A7QH 4ZNCD 1GOFA 1S7QB 1YA5A 4LSUH 3ARDB 1F3RB 3QEHB 4HJ0C 1BD2D 5KAQF 2YZ1A 2R4SH 5T1MB 5HDBE 5JW5B 4ZSOB 1AHWB 5DZLA 1CLYH 5BRZA 1HI6A 5TE7L 2VZ3A 2VL5B 2V5YA 2WZPD 4OCMC 4F33A 3OXRA 3FB7B 3LEYH 3PL6C 4MJIE 5K9JL 2DQIH 3IJHA 3KPNB 5B3JF 5IWLC 4OFYD 1BD2A 3WV0A 2COQA 3R06B 4JHWL 4E41B 3ARXA 4LLMA 4FQXD 5KVGL 3WLBA 4EUPA 4P9ML 2H32H 2QADB 2IGFH 1CFBA 4KV5E 5FOJA 4LEXH 4Z0XB 3CXHK 3FHQA 4OFYA 5GIRB 2BP3A 2VE6A 4Y5XA 2AK4D 3NAAL 4F7EB 2A9NL 4OCRH 4Q0XH 4FQXA 2VC2L 5I71B 1HINL 5GGQH 3QNZB 5CD3A 1WIPA 3P3YA 3FT4B 5HYSB 1PQZB 1U3ZA 1U3JA 5EC2A 2R2EB 4YXLH 3SOBL 1ORSB 2XKNA 2YSSB 2AK4A 4WHYH 4TNWF 3ARPA 3AGVA 1R0AL 1AC6A 4M7LT 5HYQA 1RULL 1WFNA 4RDQG 3PHOB 3W9EB 3DV6A 5E8PB 4N0RA 3RNKB 1Q9OA 4P57A 2X40A 3B9AA 4ZYKB 4YIQB 1E28B 3IDNA 3MTRA 3RDTD 1LHZA 3GIZL 1W0VA 5DC9B 2WP3O 3VRIB 4YQXL 2A77L 4JFQA 4PB9L 1FVDA 3HE7C 4M8QA 2R56L 2ZZUT 1TNMA 3LN9A 1W8NA 2DDQH 2EO9A 2YC1A 2NLJA 1H8OA 1FBIL 4N1EA 5IB1B 2A9MH 3RDTA 4MNGE 3VW3L 2BOCA 5AG8A 3AMKA 2XFXB 5I8KH 4C59B 3RVWD 4NPYA 5L6YH 1FRGL 2NZ9D 4NBZB 1IZKA 2AJXL 4HWBA 2ZUTA 1RUKL 2DQHL 3VD7A 1OGTB 1ZVHA 1FZMB 4P4KD 5ICYA 3MRNA 1HHJB 5CSZA 1YEGL 1NBZB 2ADGB 2HJLA 1F4WH 2X09A 3G6JB 4YR6A 4ONOA 1GAFL 4XNYH 5D72H 5DLMH 3ROOB 2QSCL 4PJDA 1WF5A 3NFNB 4R9HA 5D2NC 4HCRA 5C8JB 1CVSC 5FOBA 4P4KA 3VMOA 2DI8A 3FT3A 4LSSL 1G7JB 1U92A 5FHAH 2X1OA 5TDNA 4XPTL 3S96A 4QXTB 1JNLH 3ILPB 4Z7OF 3PWPB 2OSLB 3MLYH 1T1XB 5D1QC 3TBYA 4PRHE 3TPKA 2ZOLB 2D31B 5DK3A 4WFED 1UM5L 2IPKA 5T3XD 1QQDB 4M93B 3SDXE 3ETBF 3GJEB 1QSZA 5J12C 2P8PA 4ENED 4M43H 1OTSC 4OZFA 5IJKC 5E7FA 3VCLB 4HIHB 2FIRT 4N8CH 4RAUA 5F9WB 4L3ED 4UT6H 3WEXA 1EVUA 2VMFA 4H20L 1IAIH 4JKMA 2VKXA 4PJHE 4D9QD 5CILL 1U41A 3L95A 4OD3L 1P69B 4Y19B 5E6ZA 2NPLX 4OUUB 5T1DH 4QXWA 3RWCB 4KK5C 1F8TH 1KIQB 2MQ0A 3R0NA 1H3XA 3UCRA 2D03L 5TDPB 5JDJA 1PZ5B 4HS6B 4LDLB 3CSYA 4L3EA 3KS0H 4JRYD 3G04B 2YUVA 1G7QB 5F6HI 5LAXB 3CXDH 3DYPA 3QAZB 2K7QA 1J12A 5KTEL 3EDEA 5DFVC 1EGJL 3TN0C 1FHGA 2YBRA 2GW5A 4KI5C 4PJCE 5IHZA 4F7PA 1CK0L 5DJCA 1IM9B 4MVBC 4NO3A 4JRYA 3O3BA 2WSKA 4GXVH 2C3GA 3DTXB 2BNQE 3IRZA 4OIAA 4YDVA 1JWSA 1P7KB 2FZ3B 3TH3T 2XWBB 4C4KO 2IC2A 4WW1A 5FGBC 2YK1L 2Z9TA 2DBLL 4G80A 2DQDH 3OAYH 4LPTA 3CVHH 5MP6L 3GMOB 1ZA3A 4LU5H 1BQHG 5ICXB 4LLQA 4NQCD 4TNVK 2B7DT 4OCSH 4FA8A 2WBJD 35C8H 1D5MA 5HHNB 4MQXC 5K59E 1KCSH 1J1PH 3O41A 1FSKC 2ZUSA 5FECB 4RRPG 2OMNA 4J3UA 3DHMA 15C8H 2IFFH 4WU7B 1LE5A 1EEQA 1JNHA 3VFNA 3ABZA 2CJUL 4MA3A 2D9CA 3DMMC 4NZDA 3LY6A 1WSST 4NQCA 1YQVH 4XMPH 2ADJB 2WBJA 1I3GL 4K55A 3EYQC 4LCCA 1QRKA 1IKNA 3IKKA 3VXUD 1VGEH 5IB5B 2W59A 2F53E 3WHXB 3GMPB 1GVIA 5I17A 1R5VA 3T0WA 3WXVL 5F7WC 5KANI 3CFCL 1T2QL 4GSDH 5CZXD 3G9VA 4IRJC 1LK3L 3RTQD 5E94A 4Z7NE 1RZFL 1X5IA 7FABH 4LARH 3KYOB 3D3VE 1XF4A 4OTXL 4OZ4B 3X3GL 3Q5TA 3VXUA 2R2HB 5TGBA 4QCIA 1TQBC 4GAJH 5CEYA 3BRDA 4YO0A 2H6PA 3BKML 1B4JL 4PJAF 4I1NB 2NX5B 4KJQC 1U9KA 5M94B 3LS5H 1I7ZB 3FFDB 3RTQA 1R3IH 2GJ6B 3OF6D 4F3FB 3NACH 2DIJA 2V9RA 4F80A 4IOFD 4TULH 1G1YA 3D39B 1JN6B 5HGDA 3VXSD 1JWUA 1ITBB 4KRPC 4K94L 4PJIA 4AQ1B 1KCRH 3NFSH 2DJ4A 1QKZL 3DROA 1T66D 5F7NC 3OF6A 1P4IL 4XP5L 1A3RH 4QRUB 3DX7B 3MLWH 1NCCH 5EIVA 1WBXA 2HKFH 2OJZL 3O6FD 3P0YL 3ZYZA 3VXSA 5DJ0B 5E9DB 4WJ5A 1F13A 5IEHA 2VOTA 4JZJA 2B39A 1T7VA 2Q1EA 2QR0B 1S9VB 1KXTB 2BOBA 5MEOA 4HK3J 4RGMC 1QP1A 2FYYB 3FQTB 4EN3C 2OQJA 2RJMA 4F9PA 3O6FA 5FM5O 4C56E 3QEQE 5KSAB 2Z92B 3GMNB 3VI4F 1EO5A 3UTTD 3MBEC 3BP6B 2O93L 1BFVL 5ACZB 3IFLL 3QXUA 1SMOA 4CMHC 3MJ7A 5GS1B 2YD9A 4JM4H 3P2TA 5D96C 2CUMA 3IYLW 1YEEL 3BGFC 3L3OB 2Z35A 1R3KB 1U8LB 5L2KE 4L29B 4RMWA 3OKNA 1JHKL 3HLAA 4IIQC 4XVJL 1LK2A 2X4TA 4BM7A 4PJGB 1CT8B 3V5HA 3UTTA 5HDBF 1LE9B 2MPAL 1FNHA 5ETUA 4XNUH 4LLWA 3MRBA 3EO1B 1A02N 2IQ9L 1CLCA 2R4RL 4YC2C 3JUZA 3FTGA 3C9NB 5F21B 3AS0A 1YECL 2R2CA 5EPMA 4JHZA 2R9HC 2OI9C 2G5BB 2P43B 4PREB 2NY4D 3EDDA 5C0RL 1DL7H 2YR3A 4LK4A 3TCLB 1B0RB 3TO2A 5ITBL 1JK8A 3GSQA 3FQRA 4KV5F 3CNKA 4XP6L 2NY1C 5CEZD 3LRSA 3V5DB 4HEME 1MCWM 4X9GA 2PUQT 4LHUG 5J8OA 3ARGB 5CUSH 3QQ4A 5TDOA 3C2AL 3MNZB 1YN6B 3T09A 3V0VB 3SDAB 4UTBH 3DUHA 1AY1H 3WJLA 4DWHA 3P77B 2PXYB 3X13B 1KEML 3UXFA 3D9AL 3TCXA 1D9KD 1W72L 1T22B 3TZVD 2MKLC 3RWDA 3O3EB 5IESL 4K7PH 1H3TA 2GTWA 1S7UB 3C8DA 3S35H 2FJGB 4FXKB 4MDJB 4JLRA 4GBXB 4FMFA 4K3HA 1ZHBA 3JVGA 2QKIB 3VFOB 1UZ6F 3L9RB 5EB9A 4M3KB 2CIIA 5J13B 2NTFA 1D9KA 1N7ML 2XTJE 3TZVA 3QRGH 2XA3A 4ODSH 1PYWB 4GAGL 1LWRA 1QD0A 4KVNH 4U3HA 1KG0A 2HTKC 4AY0A 3PP3K 2X70B 1E4XH 5DJZA 1J1OL 4X6FA 5IUSA 2X10A 1N0XH 3JWDL 4KAQL 2BXZA 3OB0K 2P24A 4MNHB 5E8OB 2VZTA 1C5DA 3QR2A 3EFDL 3KPMB 5JUEH 1IGIL 1KCLA 1NDGB 3T04D 1OPGH 2EIDA 2RFXA 2BCKA 2GJZA 3TBWB 3AAZA 5DHVB 1T5XB 1KJVB 2LU3A 5AZEL 2BFVH 3PABB 4BH7A 4DKFL 1JF6A 2F58L 2YUZA 4J6RL 3OV6A 3GUTB 2NXZD 5I8CA 1SYSA 5KJRL 3QUMA 1UJ3C 4IOSD 5C9JB 1CDGA 4GG8B 2W0KA 3REVB 2XQYK 4XNQA 3ARED 1JPFB 5C92A 4KU1A 3O0RH 4MSWA 4JFFE 4M48L 3TT3H 1VADB 1JGDB 3QDGD 4H25A 3OR6A 5F97E 4EBQL 1AO7D 3CZJA 4WUUB 4TNVF 5JXED 4F7MB 5J0BA 1NH6A 3QDAA 1A47A 4HC1H 3HC4H 2MKWA 5B38A 3L7EA 5CLWA 5IFHL 2EECA 3O2DH 4WEBH 3GSNH 3O11A 3AREA 4X6EA 3FQXB 4M8VA 3QUXB 5FUCC 2X44D 1WZ1L 5I8OL 3C6SB 4ODBD 3O3DB 1NMAH 3QDGA 5FF6A 1AO7A 2HT4D 4XPGH 5IF0A 5M95B 2EDTA 3BYYA 5B21A 3MACL 3ZHKA 3SDXF 5JXEA 2FNBA 1A7OL 4MB4A 4JG0H 2EE6A 3QUYB 4JVPA 5FYKD 4ZNEE 3VFRA 1PSKL 2AXJA 3IETA 3GNMH 5IVZA 5I1KH 2X9YA 1X5LA 5H37H 2FJHA 4HPOL 3TV3L 3QFJB 3ZMRA 3QHZH 1RZGB 1T03H 1EMTH 4PJHF 2EDLA 1HXMA 1KLFA 4ONHA 2PF6A 3UTPD 4YWGH 4NNPL 1R24A 3LQAL 3PQYD 1NCWL 3O4OB 1QPPA 2X4OA 4ZUVA 4PJXB 1SYVA 5IR1A 4XCYA 5C2BH 4HJGA 5I1AB 2MQ3A 4JRXB 2VDKL 4I18B 5B39B 2CDEA 4FQJH 1MAKA 3JZ7A 1MH5A 5I1HH 2Y9RT 4PJCF 3PQYA 5DJDA 3H2WA 2EICA 4TSBL 1I7TB 1K6QH 4LOUC 2WUBL 4MNQD 2Y06L 3LD8C 3CD4A 1XCQA 3MJ8B 1S7XA 3LH2H 5E2UL 2X4QB 5BS0D 1OOAA 3ARVA 4XBGA 3U0TB 3VWKC 4P3DA 4LCIL 4OZIF 4WCYL 1ZHKA 2IADB 3EYSH 4LPXA 3P9WB 4JFPB 1JHTB 4AEFA 3BWUC 4MNQA 5DC4B 4KC3B 5J56B 4NKIH 1LP9B 4NHUB 1E4KC 4ZDHB 5BS0A 2OBGA 3PXJA 3WUWA 1DANT 5EA0H 1Z0MA 4FTVB 1XF3B 4WFFD 2BSSA 1LDSA 5K59F 4ZAKB 4ODXA 1KTLA 2FR4A 5C9KA 5I19H 1MLBA 4NO0D 3ULVL 2YRZA 2DLFL 3TFKC 4J1UA 3HZYA 3C5SB 1QVOA 2FCBA 3WN5A 4TYUA 2A0LD 1YEHL 4WGVB 3KPLA 1JPST 1GGCH 1M7DB 3BGAA 2BC4B 2CK0L 4Z95L 3KPRB 2HFFB 4OQ1A 1QBAA 1SBSL 4PRIE 3K46A 3GMLB 4L4VE 1M05B 2D4FA 2Z0BA 1WICA 1N5YH 1DEDA 1KB9J 4N0CD 4Q74A 4UILH 4WW2B 2DM2A 3BEWA 4Z7NF 1PKQB 1MJ7H 1BJ1J 5I66B 2J8OA 3GB7A 2VLRD 1RIUL 4PLJD 3IDYB 2AERT 4OB5H 5T3ZD 3MOBL 4ZFZA 4PLKC 4NKOA 4ZFFB 1MHHB 2EYRA 5GISH 5A16B 4PV8B 1R6VA 4FFZH 1KPUB 3KJ6H 2VLMD 3OSKA 2QJDA 1LO5B 2VLRA 4HH9B 4F58H 2NW2B 4MXWH 4MJ6B 4MJ5A 4CMMB 1A1NB 4NKMB 4Q7DA 1TCMA 4YZFE 5I6XB 2GSGB 3OKOA 3DX9A 2JCCA 2P45B 3P4NA 3R4DA 3AVEA 4LF3B 5GRVK 2AJYH 3P11H 3MUZ1 1UG9A 5HGHB 3CFEB 2AEPL 1CQKA 1LD9A 1ZT1B 3LN5A 4DGVH 1OTUD 3K0WA 3LKOB 4UMGA 3AB0C 1MCSA 5IMKA 1VPOL 5FM4A 5ADPH 4V2BA 1GIGL 4ONGL 4YAQA 3DVIA 4DN4L 1KFAL 4LLYA 5DEFB 5DS8A 5IV2A 2HKHH 1WBZA 2D3VA 3IDIB 3ARDD 3GSRA 2VYRE 1TETH 3EYFB 1J8HB 1N8ZA 3L7FA 1XZ0B 1F58L 1A6UL 4MLIA 3B5GA 1P4LB 4R7DB 1YPZE 4G6ML 3WIHA 4H1LB 5EO0B 4FABL 2VO5A 1NC2B 5EWIL 1S7QA 4UT9L 3ARDA 3QEHA 1OGAE 2XZQH 1NSNH 5JMOC 5IW3A 4QWWD 2W91A 5J1TC 3WFHB 5DUPH 3UJJL 4E41D 1EHXA 5T1MA 5JW5A 3BZEB 3AU1B 3C8KB 3EZJB 1AHWA 3QEGH 4LRNH 4ZSOA 1B3JA 4RBPK 1CFSB 1QPXA 2QADD 2VL5A 4RAHA 2FEDC 3X17A 3V6ZB 2HWZH 5C0IB 4HIXL 2VAJA 3FB7A 4XPHL 5I1LA 3KPNA 3JV6B 2IMNA 2UY7A 3KHOA 3R06A 1P6FA 4E41A 1GZQB 1NAKL 1Q72L 4K3JL 3MRIB 4Y88A 5KS9E 4YNYA 4S1QH 4QOKE 5JQHC 4Z0XA 3T0EE 3B4NA 2PO6B 3VGAC 4YDIH 4NGHL 5GIRA 1CDJA 1VGKB 1I4FB 3QI9D 4F7EA 1X5YA 3SKNB 2VH5H 1CGTA 1MCKA 1CFVH 3KPOB 1RK1B 4OLYL 2NY6C 5FYJU 5INCB 3C6LB 3QNZA 1K8IB 4NCDA 4N8VB 4XP9H 3B9KC 3FT4A 5HYSA 1QBLH 1PQZA 1EHLH 2BY1A 5F7LB 3T2OA 3MJ9A 2R2EA 1P1ZB 1SQ2N 3CLEL 3FONB 4P2CG 1ORSA 5FHBL 2YSSA 5F6IB 3V4UH 3QI9A 3SCMB 2KZ1B 2Q8AH 1I1YB 2LU4A 3GO1H 3DGGB 2ICEB 1DBML 4P23C 3PHOA 3W9EA 3WFBL 5E8PA 4CVXB 1G7IB 3RNKA 1OP3K 2OK0H 4X9FA 3RJDA 4IJ3C 4ZYKA 4X99B 4YIQA 1E28A 5E8EB 2YOCA 3F6IA 1JYNA 4JY5H 1IRAY 3VRIA 4LCWB 4MAYB 3UPCA 1KSRA 2CIKB 4U1MB 1RZJC 2NYYC 2LAGB 4HGKC 3VXME 3I6LD 2AGJL 5D2LB 5IB1A 5EG6C 2XV6B 3DGCR 2XFXA 1A7QL 3HMWH 5E95B 3MV7E 4LSUL 1CZ8H 2LFGA 4XH2B 3O9WC 1OGTA 2R4SL 1DVFB 1FZMA 3HE6B 3HUJB 1HHJA 3BI9X 3RQ3A 4J7RA 1CLYL 1NBZA 2ADGA 1KNOB 1TCRB 3FJTA 3ROOA 5AZ2L 2X2YA 3Q3GB 3O6MH 3PWPD 1TXKA 3W39B 1CFTB 1IFHL 3M45A 5ABDE 3LEYL 2DQIL 3NFNA 1SJVA 1XR9B 5C8JA 3RHWK 4X9IA 3FQNB 1FL5B 5BV7B 1QNZH 4V2CB 1T04B 1G7JA 4PD4J 1Y6NR 2IGFL 5DVKA 3ILPA 2EDFA 2OSLA 3PWPA 1T1XA 4LEXL 4QRTB 2DKMA 2R0KH 4ZTPH 4K2UH 3BKJH 4KK9D 2VDOH 4OGAD 2W9EH 1J1XH 1QSEE 1VFAB 2ZOLA 2D31A 3G08B 5CJOH 4ORZC 3WNKA 1CE1H 4OCRL 1UKSA 4Q0XL 1QQDA 4Y19D 5E5UB 3GJEA 3S6CA 5CAYB 3TP4A 5CIPH 5EU7E 2FD6H 5D70L 4HBCH 4N5EC 4PR5B 3MRKB 4HIHA 3VCLA 2BX5A 3SDYH 5GGVH 3H3KA 4YXLL 4N68A 5GRWA 1U91B 2V17H 5HD8D 1FNAA 4KI1A 3P9MB 3ZTJH 4Y19A 4OUUA 4DEPB 4I0KA 3IRPX 3RWCA 4JVUA 1KIQA 3MGTB 5TDPA 1PZ5A 1CU4H 4HS6A 4WUKH 4A2LA 1IM9D 4OQTH 5DK0B 3O3AB 1ZLVH 1T1YB 3G04A 3OJDB 1G0DA 3MA7B 4EI5B 1G7QA 3L5WB 3O81A 1JZ8A 4XP1H 5EU5B 5LAXA 1BMGA 1ZMYA 5HJ3B 1A4KB 1GGYA 3GMMB 1YDPB 4ZS6C 3BW9B 4M6AA 2ZJSH 4HG4J 4DQOH 1A0QH 1IM9A 1WCQA 2B4CC 3FQWB 4CW1A 1QACA 2A9ML 3DTXA 1WZMA 5JPMB 5MENB 3BQUB 5I8KL 5I0DA 2GY7B 2IJ0C 5L6YL 1P7KA 2FZ3A 1INDH 5CGTA 1MREH 2XWBA 3MX0A 3RA7H 3BE1H 3QH3B 1KOAA 2WW8A 3GMOA 4FQ1L 1F4WL 5DLML 4XNYL 5D72L 3GM8A 5ICXA 3W11D 1NUDA 1DLHB 1FQ9C 1U3HC 4PJ7E 5MHSE 5HHNA 2VITB 4U1LB 1HILB 5FECA 5B3NA 3IKCB 2W1NA 1HIMH 4UDTB 4WU7A 5FHAL 2APXA 5I30H 2UUDK 1ZGLB 3TJHD 5DHYB 1JNLL 4XX1E 3BP4B 4XTRC 3MLYL 2ADJA 1ONQB 3EJZC 2VR4A 4UINH 4X7TB 2V7HB 4OCYH 5I1JH 4XT1C 5IB5A 2A6JB 5F3BB 3WHXA 3GMPA 5CP3A 2Q7NA 4M43L 2NX5D 1DFBH 2GJ6D 2X42A 4N8CL 3KYOA 3QULB 5E56A 3UJIH 3NCJL 4UT6L 4OZ4A 4XHJD 1IAIL 5D1ZC 3VI3E 1CFQB 2R2HA 3ZDXF 3D39D 4PG2A 1L0YA 4GRWH 4L4JA 3MR9B 1FIEA 2EXWC 1P9MC 2V9TA 4OLXH 5T1DL 4HJJH 1F8TL 1ORQB 2NX5A 3PGDB 1HNFA 1I7ZA 1L7IH 1YEIH 1FH5H 2P1YA 3FFDA 1WISA 2AQ1A 2GJ6A 3PWJB 1XGPB 5EO1B 1UB6B 5IVXE 4F3FA 4HS3B 2X5PA 3D39A 1JN6A 5DMGC 4QRQB 3CXDL 1XCTB 5E9DD 1D5XB 1NLBH 4UV4H 4PYGA 1CDCA 2ARWA 5I8EB 5IG7B 2HMIC 4KTDH 5LBSH 1DE4B 4QRUA 3DX7A 1TJIH 3QEUB 3FOMB 4GXVL 4LQFH 3CVHB 2XTJC 5KSAD 3V8CA 5DJ0A 5E9DA 1OAUH 4K7PX 1NGQH 5FGCE 3UZQA 3MMEB 1E27B 2RB8A 4XX1G 2QR0A 2B0SH 1S9VA 1EK3A 3QA3B 1I1RA 1XMWA 2FYYA 2CK2A 2DQDL 3FQTA 3CVHL 2XWTB 4JCLA 4LU5L 2X4NB 3I50H 5KSAA 3SBWA 1EV2E 2Z92A 3GMNA 5HDOA 4YGVB 2A38A 4OCSL 1QFHA 3BP6A 1H15B 1BD2E 35C8L 3MRPB 4TUOB 5ACZA 5GS1A 1KCSL 1J1PL 1YPZF 5CD5C 3TBSA 15C8L 2IFFL 3L3OA 3OKEB 1R3KA 1U8LA 4L29A 2EKJA 4PJGA 3LPGA 1CT8A 5D71H 4FZ8H 1YQVL 2BVPB 1IE5A 4XMPL 3PHQB 1BBDH 4APQC 3MYJB 3EO1A 4BQCA 3DO3A 5INDB 5E08H 1MFCL 5I9QC 2AABH 1VGEL 3S9DB 3C9NA 3KS0J 1IL1B 4LPCA 4U1HB 3MROB 2CMRH 3NH7H 3ARGD 1EZVY 3K1DA 3PUCA 4GSDL 2G5BA 4PREA 5IQ9B 4NSKB 2O5ZL 3SDAD 5I76B 7FABL 4LARL 2AK4E 3T2NH 3TCLA 1B0RA 1H8SA 2PXYD 5IK3B 5KS9F 1GXEA 3CFKB 4GAJL 3VRLE 1BF8A 2OXGA 3V5DA 3RHWF 1B6UA 4X98B 4I9WE 3ARGA 2AI0H 3LIZH 2ED7A 3LS5L 3MNZA 1YN6A 3V0VA 3SDAA 5LJYH 3MCLH 1R3IL 3N85H 1DQMH 3NACL 3LMJH 4GBXD 4JJ5B 3P77A 2PXYA 4TULL 3X13A 1F4HA 3I6KB 4JPVH 4YHLH 4KQ4H 2NXYB 1T22A 5JW4N 4NN7B 3O3EA 1KCRL 3F12B 3NFSL 1UM6H 1S7UA 5DO2D 2FJGA 4FXKA 4MDJA 4YXHH 1ZS8B 2EIBA 4BELD 5EIIB 4GBXA 4YUEH 1A3RL 4OGXH 2EIZB 3MLWL 1NCCL 3ESUF 2QKIA 3MXWH 3VFOA 3L9RA 5A43C 2HKFL 4N0FB 4LVOB 1MEXH 4EUPG 4JHAH 4RGNB 1VERA 5HVWA 4P2RB 1PYWA 4NZRH 2FDBP 4MQTB 5I0ZA 3EBAA 2HVKB 4PJ9C 2X70A 3BPNB 3VG9B 1P7QB 3G6AB 3STLB 4JKWA 3HMXH 4MNHA 1FAKT 4TUJB 5E8OA 4F37K 4G5ZH 3KPMA 2XZAH 4JM4L 3ZT5A 1NDGA 1G7MB 5I16B 3PIQB 3DO7B 1EVTC 3ZTNH 3BKYH 3TBWA 5DHVA 4ZXBC 1MUJB 2EKSB 1T5XA 1KJVA 1KN4H 4M1CC 1UJTA 2X4UB 4Y4HC 3PABA 5TF0A 1CF8H 3RVVD 3GUTA 2FH6A 4XMLL 3J8F7 1MVFA 4WUUD 4ZOAA 4XNUL 5C9JA 4OZHE 4DUWA 3AM8C 1CE6B 4FQLL 4GG8A 3REVA 3MLUH 1JPFA 3QUXD 1YMHB 1BBJB 1VADA 3HKFA 4GOSA 4PY8J 1JGDA 4R2GC 3TNMB 4PRDB 1DL7L 4WUUA 4F7MA 4WFEE 3F62A 3QUYD 1UGNA 2CLVB 1TJHH 4GRLC 3FQXA 2Y36H 3QUXA 3QFJD 5CUSL 5E5RB 3OKKB 5EOQH 3C6SA 4MXQD 1HH6B 5IB3B 3O3DA 2D7TH 2JJVA 1AY1L 4OD1H 5C0AE 4YHMH 3QUYA 4Y89A 5JIKA 1T1ZB 5E4EC 1S9YB 3QFJA 3J7HA 1RZGA 2AV1B 4K7PL 4MHHI 4IHOB 3S35L 5AD0B 4JRXD 2GSIB 4UV7H 4HXAH 3ZKSD 2YPVH 1G9MC 4K8RH 3EUUA 3SKUD 1YYMH 1YNTB 3PL6B 3R1GH 5DQJB 2CRMA 3MNVB 1E4JA 3MA9H 4PJXA 1TVHB 3QRGL 3UTQB 4ODSL 5I1AA 4ZQKB 5IM7B 2V5MA 4BZ1H 1NCTA 4GLRI 4JRXA 4I18A 5B39A 4KVNL 2BHUA 1LQSR 5B4MD 1E4XL 3OR7B 1ERNA 3K2MC 2FJFB 1F45A 1N0XL 1I7TA 2YXFA 3ARUA 4OZFG 4FP8H 3MJ8A 5JUEL 3E8UH 1OPGL 2X4QA 5KSBB 2DKUA 4FTVD 5JPNB 1RUQH 4JKKA 5HXMA 3U0TA 4ZAKD 4PIRF 2BFVL 2IADA 4M7KH 1G1CA 4JFPA 4NN5B 1JHTA 3QWQB 2Q87A 1LP9A 1MPAH 4ZDHA 1FN4B 4B41A 3RPIB 1IGJB 4FTVA 1XF3A 1ND0B 3T0BA 4PJ7F 5CGYC 1KBGH 4ZAKA 3O0RL 1S9WB 3W2DH 3TT3L 4LKCB 3KPRD 2OX5A 3DHJA 2KH2B 3C5SA 3EOBB 4IEFB 4HC1L 3SKOB 1BJ8A 3HC4L 3PWVB 4MZ3A 4LSRH 2ZPKH 3MGOB 3TA3D 3JSSA 3O2DL 4WEBL 3GSNL 4L8DB 4Q9CA 5JHDB 1M7DA