3QHZH

Crystal structure of human anti-influenza fab 2d1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
232
structure length
222
Chain Sequence
EVNLRESGPALVKPTQTLTLTCSFSGFSLSTSGMSVSWIRQPPGKALEWLALIDWDDDTYYITYSSSLKTRLTISKDTSKSQVVLTMTNMDPVDTATYYCARTLRVYVRDFDLWGRGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human monoclonal antibody del2D1, Fab Heavy Chain
publication title An insertion mutation that distorts antibody binding site architecture enhances function of a human antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 222
sequence length 232
chains with identical sequence I
ec nomenclature
pdb deposition date 2011-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qhzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qhzH01
1KIUA 2E6JA 2X4OB 3DV6A 3PE9A 1N7ML 3C5JB 1OSZA 4M6OH 1GL4B 4ZQKB 1JHLL 2OJZH 4XRCA 3FB6B 5DWUL 5D6DA 1J87A 3FQUA 1QFUL 5FYJH 2HG5A 1RZJH 3MRPA 4X7SL 3OQ3B 3OF6D 3MV01 5BRZA 2PYEB 3TH4T 3MBXH 4ZS6C 5J6HA 2ITCB 5AWNL 4ZUSB 5FO8A 1N64H 2Q3ZA 2Y7QA 1F2XK 2AQ1A 3LKPB 4KK5C 4C57C 3WN5A 4AMKL 4O2FB 5I66A 5DMJB 3WKNA 4JFED 2GITB 1V3JA 2F5AL 2X4UB 3KPOB 3V5KA 4H20L 1MFBL 1UJ3B 1LEKB 1RZIB 4QEGA 5D9SA 3MA7B 1UM5L 3RX8A 2NY0C 5C0ND 2VLRD 4KU1A 1F58H 4YDVA 2EIZB 4PJ7E 1NBVH 1QSFA 3JWDL 4M48H 3BQUD 2VQ1A 4PLNC 4PJ5A 2VLLB 5T3ZD 1UYWH 4EVNA 1SEBB 3GHBH 1TZGH 1QBLH 4ODXB 4LHUG 4X5XB 4MD0B 3S97C 4KQ4H 4JFOB 4NO2B 1BREA 1T6WA 4X4YA 3RFZC 2HRLA 5GISH 3LOWA 3HMXH 4WEUD 5EO1A 4ZUUB 5T1DH 4HPOL 3S4SB 3EDKA 1QD0A 4K94C 1C5DA 1L9NA 4HWEH 3MV8E 3MLWL 1KJMA 1F97A 3CDGB 1M6OA 2MPAL 4TSBL 5GGRA 1OAYL 1KLFA 3O6KH 5DC9B 2FR4A 1YJDL 1CN4A 2JIXA 3KPSE 5FUCE 5I1CL 1PSKL 2M8XA 1K8IB 1WBXB 2E5EA 3B5TA 3CGTA 1SYVB 4O58H 4ZO9A 4CNIA 4D8PB 5BQ7A 2AJVH 3MRQB 5JZ7D 3B5GA 3MJGX 3NABH 3EAKA 1MRCL 3CK0H 1SJEB 4PJGF 2NZ9D 5IHUH 3GUTB 4OD3H 4Y4KC 4WCYH 5FK9A 2X70B 3MYJB 4GBXD 4ELME 1ZLWH 4XP4H 4G42B 2NW3B 5F7YC 4D0CA 3FQWB 5D5MF 4XAKE 4WWKA 4I2XB 4NNYB 3GMMB 2X4NA 4P4RA 5D7IA 3ROOA 3P77B 3SGEH 3O8XA 4OIBA 2ZOLA 4UBDD 4PJFA 1KCSH 2E8YA 3HS0A 5I30L 4PBWD 4RCAA 2X2YA 3FO9B 5GS1C 3BRGC 1T1WA 1G7JB 4KUZH 4RMQA 1DQLH 5ESVA 5GJSH 4HIEA 1CD0A 5JR1H 2OL3L 4S0SD 4XNYH 1IEBB 2YSSB 4NRXA 4U6VH 1BD2A 3B3IA 3PHOA 4PB9H 3HI1A 5J56B 2Y6SC 4HS6B 1DBKH 1X5XA 1VPOH 3VXNB 4ETYA 4OLVL 1BVZA 2BJML 5E6ID 1T22B 1IKFL 4F7CB 5E8PB 4F15C 4TOYH 3OG4B 4JDVA 3WIHL 4DK6A 1II4E 1KUMA 3ULUH 1RIVL 5E70A 1FFNB 5C0BB 5JHLL 1HEZA 7FABH 3IXAA 2E7CA 4NT6B 2DDQL 4ODBD 4PJCA 4TVPD 3CFJB 3TO2B 3RI5K 5DQJB 3QULB 1KBGH 4OJFH 4EOWH 1AGDA 5EO9B 3X13B 4LCWB 2R0LL 3ILQC 5H35B 3RIFF 4MDIB 2ZUWA 1HCVA 4ZMAT 3DVIA 3IJSA 2RR3A 4M02A 2BFVH 1NMAH 1RVFH 3IGAB 1LNUB 1J0HA 1N26A 3V79C 4NM4L 2G60H 4ZFOL 4J6RL 4FP8H 4N9GA 1ZOXA 3DROA 3FFCE 3P4OA 2IFGA 4HGWA 1A8JH 4JREB 3R8BB 4LEOB 1D6EA 4FTVE 4MA1C 5JLZB 4FOMA 4FZ8L 4R4FH 4W6WB 4NUJB 3V52H 4X0KA 1MCOH 4PRPB 5K33A 4YZFF 1KIPB 5HYJD 4Y4HB 2XA3A 4NRZA 3FONB 1U8OA 2MMXA 2OMNA 3DETC 3DVNA 1GGBL 4PJDE 3EO0B 3WS3A 3SKOB 3QDHA 4MQ7B 5HBBA 1HIML 3GI9L 2ZPKH 5MERA 3QDAA 3MREB 1BFVL 5BJTA 2A1WH 2HYMA 4HJ0C 4QT5B 2H26B 1MHEB 1F3JA 2HFGH 2O5YL 4PRIB 4P46C 4XXCC 5F96H 5E2WL 2IPKB 1AHWB 4JJ5B 2DQIL 3FMGL 3V7AE 2BNQD 4FFYH 3PABA 1IGTB 4UNVA 4WV1A 3O4LB 4OUOA 3NZ8A 4HLZG 3UO1H 4NJAH 5ACZA 3KYMA 4P57B 4KDTC 1YEKL 1D7FA 2H32A 4IEFB 5DD6B 3ARFC 5GS0H 3UJJH 5C0AB 1S7UB 2RCSL 2P5WD 1NGWB 1OTSC 1UZ8B 5DVOA 5TQ0L 2YN5A 5KSUB 5LAXB 3EJYD 2VDQH 3OAUH 3NFPA 1ZLSH 3BP6B 2XTJD 1PJ9A 4MJID 5CJXC 1YMMA 3SGDI 4R2GB 4JANA 5C09E 4G7YL 4R7NA 2QR0B 3U36A 3OR6B 2WMPA 1Q1JH 3LQMA 4JKMA 4PGBB 4RGMB 3BT2L 3T2NH 4WI9A 5HJ3A 4P2QD 3BH8B 1TDQA 4MJ2A 4WW1A 3L3IB 4HIJA 1CVSC 1DEEB 4I18C 5CEZE 5E9DD 2HJFA 3FB8B 3QWRA 4OM0L 4TQEL 3JTSB 4GAYA 4UDTA 1AQKH 3WD5H 4FQPA 2EDYA 4P4KD 4UTBH 4YHYB 4L8CA 1ZK9A 2BHUA 3AREB 1EVUA 5J57B 4JM4L 4ISVB 4NN7C 4XP5H 2J2ZA 3OZ9H 4HS8L 4XPAL 4HZLB 4Z7NE 2LVEA 1NFDA 2MNUA 4UU9B 5D2LB 4ZAKB 5C0FB 3WE6A 4P5MB 3ZMRA 2K1MA 1J88A 3T0EC 1Y6MR 2NXZB 4OUUB 1HYSD 4YHIB 2DQHH 3G08B 2NY6B 2EE9A 3N0PB 1SM3L 2OJEB 4HIIB 5DURB 1ONQB 1JNLH 5T5NG 5J9PB 1CFQB 4YAQB 1NAKH 3MV8A 3IDNB 1XIWB 1DBAL 4U1LA 4G9FB 1NBYB 1L9MA 4PJAB 8FABA 1KLGA 1S5HA 4Y5XC 1F4HA 3KPSA 4O5LH 4YBLC 3CFEB 2MQCA 2C3HA 2K7QA 5CEZL 5C0EB 4UIKL 4GG6A 1ZE3C 4Z95L 4ZUWA 5K9KB 5IGXL 4YQXH 4NP4L 3DXAE 2UUDH 2BVPA 3FOMA 3EYVA 1NGZA 4OZ4B 5F7UA 2Y07L 3LQAL 4H88H 3DHMA 3EW3B 5CEXB 3LN4B 4ELMA 3RP1A 3F62A 2G75B 1MY5A 5E1HB 2HJLB 2A2QT 3VWKA 2R2CA 5ISZB 3FZUC 5FYKE 3CXDH 4EXKA 2FWOB 3C2SA 4X4XA 1OARH 4GG8B 4UT9H 5ACLA 3PWUA 3MRJA 4D0DB 2BSED 5I18L 3BD5A 3T0DA 4Q6IB 1H5BB 3MV7D 3LS4L 4L3EE 3NACL 1U8HB 1KB9J 3X12A 1IGJA 3D0VB 4QF1A 1P5VA 3V4VH 1HKLH 6FABH 4PTTB 4XPHH 5I1GL 4XNUL 2XQYG 1CK0H 3K74B 3D39E 5F8QC 3LHPL 4NFBA 4PRIE 4PREA 1TZHB 4FN0A 1I85C 4PFEA 1OAXH 1R3KA 1TJGL 1RD6A 3MLTA 1A6TA 4CU8A 4UOW1 4LSQL 2J5LC 3F5WA 4ETQA 3UTPD 5J8OA 2AP2A 3SGKA 1F90H 4KXZH 3VWJC 1CLYH 5AZEH 1S7WB 3IFNH 1SMAA 1K8DA 3NZHH 5CILH 1HOCB 1JGUL 5K59E 1A4KA 2AV7B 2A6DB 1TCRB 3C5JA 4NQVB 1IT9H 3FFDB 4ZQKA 2Y9RT 3AM8C 3H3PH 3O41A 3QAZB 2EC8A 5I0DA 1ETZB 1SY6L 5HHPB 4MNHA 5JXED 5FYKL 3C09B 3FFCA 3KG5A 1WCQA 5DZNA 2PYEA 3WLWD 4GRLB 5DGRA 4I9WE 4L8BB 4PP2B 3BGAA 3MLVH 4FTVA 2ITCA 4P23B 2DIJA 4ZUSA 1BAFL 4MB3A 1LQSR 1WBZB 2IG2H 3M45A 4TUKL 2ILLA 3LKPA 2E27H 2HVJB 3IYLW 5DJ0B 4HKXA 2GITA 5LXGL 3ILPA 4BZ2H 4OLXL 2X4UA 2B1HH 4WW2F 3MNVB 3KPOA 1TLKA 3ZE1E 1UJ3A 2RBLA 4PJDA 4GS7C 1UCBL 3MA7A 4RX4D 3IDUA 2I07B 2P48B 1A0QL 3HNSL 4U1NA 1G7LB 1GZPB 5EOCL 4GMSH 3FRPA 1ADQL 3KPQB 5I1EL 4HUXB 1LO3L 2E9IA 4XTRC 1CG9B 4PIRF 2VLLA 5D2LE 1SEBA 2VXSH 1CE1L 4ODXA 4X5XA 4JM2F 4S1DD 4P2RE 3I50H 5FB8A 4JFOA 1HXMB 4NO2A 5B3JE 4HUMB 1DP0A 4DWHA 3VGAB 2KZ1B 3U83A 4J1UB 5KVEL 3F6LA 2V7HA 3FTGA 4Z7VF 4ZS7L 3UDWA 1DLFL 4ODSL 3MZGB 4XP9H 2F54E 1MVUB 3QXWA 1BLNB 4OZGE 1MFEL 2CO7B 1MRDH 3QUXD 1QRNB 3O2VL 1I7ZA 3CDGA 3PGFL 4RNRB 4EN3B 1SJHB 3MLXH 1NEZB 1S78D 4QLRA 1A2YB 3D2UA 4PJHF 4RIRB 1YNLL 2HFEB 1FC1A 1K8IA 1WBXA 1YNTB 4AT6B 1SYVA 4D8PA 3DMMA 4V2CB 1U3HC 3Q2CA 2OTWB 2R4SH 4RZCB 5L2JB 1D3CA 5CHNB 1BZQK 1P4LA 1T4KA 3CXHJ 5HYSB 1CF8L 1HSAB 5FUZH 3KWWB 4Z7QE 4XHJC 4LLWB 1VADB 3DX6A 3GUTA 4YFDB 2JJSA 2X70A 5CEYB 4OZIB 2FJHB 3QIUB 1FZKA 4WO4B 3HB3C 4N0FB 4X6DF 2YZ1A 4X83A 2NW3A 2L0DA 4U1IB 2NY7L 4NNYA 3GMMA 1GGUA 1KN2L 4DKFL 1BEYL 3BVNA 3P77A 2QSCL 1F3DJ 3DVFA 4HMEA 5DUPL 3H7BB 1KSRA 2XWTB 1EMTL 5F88B 4UV4L 5JDJA 3RVTC 4NQED 4XC1H 2VITB 2NW2B 3BZ4B 4NN5C 1ZHKA 4A6YH 4ONOA 4PUBH 2C3GA 5K9OB 1IEBA 4TUJA 1UENA 4PJXB 4NKOB 3QNZA 2BY3A 3OKMA 1I1AD 3MSPA 1YEDB 2XWJB 3ULSB 1I8IB 2DKUA 2RB8A 1FV1B 3DVGB 1D5BB 1WV7T 3IDYB 5DA4A 2GTZB 1Q72H 2FBJH 2MQ3A 2VDPH 1FFNA 2R15A 5C0BA 5IHLB 5IHZB 3F7VB 4JHZA 5F7MC 2ID5A 3OXRB 1VGEH 3QFDB 3CFJA 3AB0C 1J5OL 1JFQL 2Z91B 3VRIA 3QULA 3DRTA 4DW2H 4HC1H 5EO9A 3X13A 3FQNA 5T5NF 3QT2A 4JHAH 2B4CC 4M7LH 5H35A 2P5ED 4MDIA 5E95B 4L9LC 5I19L 3MOBH 4UTAH 4LRIC 1XGTB 3OX8B 3ZHKA 3IGAA 5FAAA 3QRGL 1OY3B 3M17A 3DXAA 3FO2B 1S9YA 4G8GE 4P5TB 2KZWA 5D96C 4PJFF 1IEAB 3LRHA 3NA9L 2CKBA 3VXQA 3LEVL 2X1WL 1WZKA 1FGVH 3NIFE 12E8H 3NCYP 5JLZA 4MCYA 1UB6B 2B5IB 3C8KA 1CFNB 3IJHB 2Z31B 4G8EB 4NUJA 4PY8I 4KRPB 5EFIA 2DKMA 3HG1D 4K23L 1TENA 4F8QA 4Y4HA 1FVDB 3QUYD 5GSVB 4LSPL 3FONA 1DN0A 1EV2E 3PP3K 4YPGB 4O9HH 3RZCB 3HI6L 3HUJE 1GGCH 3EO0A 2IAMA 3IDIB 4RMUA 4DGYH 1C7SA 4L3EA 3QDMD 1INDH 5E6ZA 1G7MB 3U46B 5IFAH 1DE4B 5IOPB 3GGWA 1MRFH 3MREA 4X8XA 4JM2C 3WFBL 4IRZH 5KG9B 3LKRB 4CVWA 5HXMA 3WCYA 1YY8A 3D39A 3QEQB 5HHNB 4QT5A 1FNSL 3WSQL 4WHTA 3LN9A 4PRIA 4GXUN 3TVMB 1EJOH 2JJVA 4OF3A 5IB4B 4U1KA 1K85A 1JHLH 1AHWA 3LS5L 4JJ5A 1I7UB 4HJJL 4JGMA 2H8PA 3SQOL 2IGFL 5JW4R 3NPSC 1MI5B 3QP3A 3L7FB 1HDMB 4XCYA 1P84K 5EOCJ 4ZG1A 4P57A 3MRDA 4JLRA 4MXWH 5AWNH 4NO0D 5C0AA 2CD0A 1GPOL 1N59B 1QRNE 1S7UA 5C0IB 1DVFA 4A6YB 4HUUB 1NGWA 5FGRA 4OGYL 5KSUA 5LAXA 5F9JB 3BZEB 5KS9F 3HA0A 1OAKH 3HRPA 2GYSA 4B7LA 2F5AH 2E6QA 2DM7A 1OP3H 3BP6A 4U6XA 1JWMA 1MFBH 1FFRA 1YC8A 4YHPB 5IEKB 2QR0A 2XV6B 1A7PH 3AROA 3EHBD 2XN9D 4HW6A 4M00A 5CIPH 3GKWH 5GGVL 1DQQA 5HYFA 2ZKHH 4OT1H 4OZIE 2CLVB 3VRLE 1R3LB 3L3IA 5T3ZH 1VGKB 4Z7UE 4YK4B 1C8PA 3QEUB 2IJ0C 1EEZA 3FB8A 4LAJH 3ULVF 4NKMB 3S4SG 3JTSA 3C6SA 1MJUL 3L3JA 1FSKB 1EHNA 2XZAH 4H1LH 1NC4D 3RKDC 1Z0NA 4B5EA 1JF6A 5T1LB 5LWYL 3GSQA 5GZNC 4XBEH 1OAZL 3AREA 4S1SL 3C08L 3MLWH 5TDNB 3MXWL 3VA2C 3DURB 5L0QC 4ZS6D 4BFBD 3OJ2C 4AIXA 2XZCH 4HXBL 1S5IH 1OAYH 1JGLL 5EORL 1YJDH 3O3BB 1IQWH 3ECBA 1MAML 5C0FA 4G3YH 5D2LA 4ZAKA 2CMRL 4KK5D 5I1CH 1PSKH 1OCWL 2VXUL 1K5NB 4P2RA 5DHVA 4U3XA 3MBEB 2HT2D 3G08A 4OFKA 1TJIH 4S1RL 5I15L 3V6OE 1T2XA 3CMOH 3PWNB 5DK2B 3SDXF 1RZGB 5J9PA 1CFQA 1NC2D 3G6AA 2NY0D 4QGYA 4Q9CA 3IU4H 2LE9A 2PXYC 4YAQA 2C7UA 4OZGA 3IDNA 2CDGA 1XIWA 3F6IA 5DC4B 1LO0L 3BP5B 4GKNB 1NDGB 1CGWA 4PJ9C 2Q87A 1MCCA 5FKAB 4UAOC 1BQHB 3GK8L 1RZKC 4KJYB 4XCCL 4EBQL 2QEJA 1N8ZB 2PO6B 3RNQB 3MJ8B 2A9ML 4L4VE 5C0EA 5GZOC 5DR5L 1M7IB 5I30H 2PNDA 3KLAB 5K9KA 2XKNA 2QQNL 1MH5B 2OTPA 1V3MA 4OZ4A 1NCDH 1NMCC 3WJJA 3RWDB 5CEXA 3TZVC 1FH5L 3LN4A 1UWXH 4HPYH 5TE6H 5EBGA 4YXKH 2G75A 2HJLA 1G7PB 5DQDH 4KGLA 2AEPL 1G9ML 4GRWF 3F7PC 4HQQH 4J3SA 5KN5B 4PJEF 1IKFH 4GG8A 1P7KB 2V5TA 3WIHH 3ZDYE 4RGNC 3IFLL 4LSRL 1TPXC 1FO0H 3X3FH 1XGQA 4Q6IA 5FM8A 4JFFB 1K4CB 4Q0XH 5CIPB 1UM6L 4M93C 2CK0L 1U8HA 1P7QD 4Y4KD 3D0VA 1PLGL 3WS6C 2VDMH 2GIYA 3VMNA 3X17A 2VLJE 4WTZA 5CLWA 4OTXL 1TZHA 5ETUB 5F21B 3E1F1 4L29A 4H1LB 4NM4H 1C08B 5DC0A 4X8JB 4J6RH 4FQCL 1Y18B 3G6JF 1OTUC 5F7EH 2WSKA 3SDDA 3E2HC 5KBNC 5I1HL 5KZCD 3W0WD 3RX7A 4LVHC 3RWHB 2M1KA 2BVEA 5SWSD 1HOCA 3LMJL 2AV7A 2XACC 3QNXB 4NQVA 3FFDA 3BPNC 4C56E 3RGVA 5I1JL 1FJ1B 2V9RA 1ETZA 2FRGP 2NX5D 4G8GA 2VZ3A 1L7TL 2LTQC 1HIMH 5FV2A 3MRRB 3GI9H 1F00I 4B41A 2XIDA 4L8BA 4PP2A 1BP3B 5BOPA 4NYLB 1BFVH 1I1CA 1OD9A 3NN8B 1WBZA 5DVMA 2Q7NA 3SDCC 3PDDA 2HVJA 3ILQD 5DJ0A 4ZFZA 3HNVH 2V2WB 3LEYL 4PBXA 4F37F 4OLWH 2BVOB 3MNVA 4U1JB 4ZXBB 3RDTC 4LDEB 3DGGA 4Q58C 2C3XA 2I07A 4IRSC 5F1SA 3WO4B 3PP4L 4TVSa 1DEDA 5C0RH 1BFOB 5DI8B 3CPLB 1A6VL 3W9EB 5BW7C 3A6CH 1Q9KB 1CD9B 1FE8L 3STLB 1CG9A 5I1DB 3N1FC 5GHWL 4YFEA 2ORBL 1HXMA 5E6IB 4ONFL 4M6ML 4J1UA 2JJTA 3BPOC 1TJHH 1NAMH 1QA9B 5LKNA 4G7YH 4NWTL 2KUTA 3DETD 2DQGL 2W65B 5JNYB 1FO0B 4POYA 4LCIL 5LGJB 1RUQL 1MVUA 1BLNA 5H37H 2DTMH 4MNQE 1V5JA 4Y5YC 3MRBB 1QRNA 3STZB 4EI5C 2FL5A 3FJTA 1YEIL 2ZSVA 4RNRA 1TVHA 4KKCC 1SJHA 1ZHNB 3SE8L 4XPGH 1LWRA 1U92A 1JPSL 1A2YA 4LCCC 4HJ0D 4OM0H 1RMFL 4RIRA 4P46D 2EC9U 1IEHA 1YNTA 4AT6A 1HHIA 3KHQA 3HE7C 3BI9X 4RZCA 5L2JA 4U7MA 3W5NA 3OKNA 5CHNA 3PIQA 4LLAA 4ZFOB 5GQBA 3WBDA 3D6GA 5HYSA 3DUSB 3KWWA 3BRFA 1BFSA 3QPXL 3ARFD 3VI4E 1U41A 2ICES 5CEYA 2VXTL 4OZIA 2AEQL 3QIUA 4WO4A 4N0FA 4QHMB 4Z7UA 3WDJA 1OTSD 1QR1B 4U1IA 4LSUL 5HYJB 4IIQA 5GRZA 4JFEE 4XNMB 2FEEL 3V95A 2YD9A 4Y1AD 2X89D 4G80B 1NBZB 1G7IA 4F58H 2BOCA 3QWOA 3WFDL 4HCRH 2VLRE 4M7KL 3C5ZA 4YLQT 2VITA 4JCLA 5K9OA 4JJHA 5EZJA 4PJXA 3TYFA 4NKOA 3RUGE 2XWJA 1Z9OA 1I8IA 5I1KL 4X5WB 1V8HA 4L8SC 4UIKH 4CGTA 5E8DH 2VC2L 4ODVL 4PY8J 1FL6A 9CGTA 2X09A 4Y7MA 1F3DH 2GTZA 2L7UA 3M1BB 4P3CL 5GIRB 3DBXB 2VJXA 4UUJB 5IHZA 4ZO8A 1WWWX 1UH3A 1W0WB 4WUKH 4I8DA 5F9AC 3QFDA 2Z91A 5HYEA 4WUUB 3JSSA 3T0ED 2EIEA 5FHBL 5I8EB 4MJIB 4YO0A 3OX8A 4L4VA 4U3CA 2EICA 5E5RB 5I18H 1NAMB 4KJPC 3FO2A 2NY1D 1HI6B 2X1XR 5D7SL 4P5TA 3ARYA 5EZLA 3I9GL 2NNAB 2DS4A 2J8UB 3FO1A 4LSSL 5D7JB 5ANMB 1MY7A 5E7BA 5E2TL 2B0SH 5I1GH 5E9DB 3C60A 4NNPL 5IMMB 1GH7A 3IJHA 1WBYB 2Z31A 4CN1A 5D2NE 5A2KH 1L4IA 1CFSB 5B8CB 1C16B 5HGBA 4HF5H 1FVDA 1ZLWK 1NH6A 4XI5C 4N8PA 4H8WL 4X6FB 1MCPL 4CN4A 5JPMB 4LSVH 2I5YL 4LSQH 3IU3B 4YPGA 4TNWK 1FIGH 2N7AA 3IDIA 2UVEA 1CR9L 4KK9C 3RVXC 3U4BH 5E99L 5GXBB 1TETH 1G7MA 1DE4A 4JZJB 5T33H 5C9KA 1JBJA 4YDLC 5KG9A 3LKRA 5GS3A 1A4JA 2WUCL 3OAZK 4Z7OF 1QNZH 3QEQA 5HHNA 3QBTB 1MCKA 4R90L 4OCSH 3FZUD 3LQZB 5IB4A 1BGXH 2ATPB 4U6YB 2NQCA 5DF0A 4FQ2L 1B6UA 1HXYB 4RFEB 1XFPA 4EQ3A 5I8CA 1HDMA 5F6IB 3VE0B 1INQB 2BDNH 4Q9QL 4TVPE 4PS4L 5CJBA 3SGDH 1ZVSB 4RQQB 5C0IA 4A6YA 4HUUA 2DQUH 1LP9E 3QHFL 5TJWK 5C07B 3BZEA 1LEIB 5HY9B 3VFMB 3KS0H 3QQ3B 5F3HA 4LU5L 5E08L 5J11B 4NO5B 4C56A 4GAJH 3GO1L 5ICYB 3RX5A 3DUUA 3DRQA 4YHPA 2VISA 5IEKA 5F1IA 1I1RA 3ZTNL 4X6BB 4E41D 2X7LB 4J3XA 5I1IL 2IBZY 1YEEH 3VWJD 1ED3B 1KNOB 1EBAA 2CLVA 1QQDB 1R3LA 3FAWA 1VGKA 4JB9L 3FT3A 5BVJB 3QEUA 4LPVA 3CZJA 1JGVL 2DQDH 2AAVA 5HYJE 1T5WA 4C58B 2YR3A 2BNRD 4JGUA 1H8OA 4OKVB 5GGTL 4OI9A 5DHXB 3BUYB 1DBBL 1G84A 2F8VA 5T1LA 3KR3H 3MV7B 1PD6A 3OKYA 4KKLC 1NEZG 4UZGA 5TDNA 3L6FA 3A67L 1XAUA 1GGIL 3DURA 2APVA 4Q9BA 3MGOB 4HXAH 3PGFH 3EYQC 1WFUA 1J1PH 4DCQB 5KVFH 3S37H 3O3BA 1LK2B 3LIZH 5F9WB 4OKDA 5SX4I 2BY0A 1GOFA 3REWA 3D9AL 2VH5H 3QG6B 1BZ9B 4U1MA 1K5NA 3MBEA 4N5UA 2BNQE 5FGCB 1S7SA 4RDQG 2Z4QB 3RVVC 3U7YH 3QIBB 5ENWB 4X4MA 4XVJL 4XPTH 4LCUA 3NIDE 4KKAC 5FDYA 5DK2A 4TRPH 3VFWB 5C8JA 1RZGA 3WNKA 5EG6C 1CS6A 4MNQA 5DJCA 1XZ0B 1JPST 4NWUL 5HHMD 3IVKB 3ULUF 2P5WE 4GKNA 1NDGA 3CSPA 1CFTA 5LJYH 4QGTA 1BQHA 2NY7H 2WBKA 4KJYA 3KJ6H 1BEYH 1FG2B 3BP4B 1N6UA 4ZD3L 4LASL 2XTJE 3RNQA 3IAPA 4HSQA 3RAJH 5FOBB 1M7IA 1TVBA 1ZANL 3BJ91 3KLAA 4UV4H 3OF6A 3GEWB 2X05A 4I1NB 3RWEB 4ZODA 5HI3C 1NL0L 4P2QE 1JRHH 3B2UD 3ESUF 3N9GL 2HFFB 3RWDA 4G6KL 5I16B 3RA7L 1MJ7L 2ZJSH 3LZFL 1G7PA 3DTXB 2PTUA 3WUWB 3V8OA 1QYGL 3U0WH 1X7QB 5HHXL 4JFEA 5KN5A 2Z8VC 2OS7A 5ADPL 4UQ2B 4JY6B 5HDQL 5IB2B 1Z9SA 1AGBA 3PGCA 4GSDH 4PGEB 1FZJB 3ZZ1A 2EH7L 2IQ9L 3CFCL 3CSGA 5CIPA 1MLBB 2VLRA 2HLAB 4N8VG 3BQUA 5BVPH 5E1AB 1E4WH 4JN1H 2VLMD 1RV6X 2BY1A 4JRYB 4PJAF 2VXQH 1JZ5A 5D72L 2I9TA 5KSBF 4W4OC 5HI4C 4X9HA 4H1LA 3NVQA 1C08A 4X8JA 2WZPD 3OPZL 2JB5L 1RSFA 5E2UL 5EBWA 3RVTD 3NA9H 4OSUH 2W0FB 3VXMD 3ZE0F 3QUXB 3OXSB 5EU7C 3MGTB 3RWHA 3T77B 4WI7A 2J4WH 1IC4L 5DLMH 4F2MB 5C92A 2HLFC 4LSPH 3UZQA 4YH6A 3SKJL 1RK1A 4GW5B 3TBYB 4MCZB 1U95A 3NIGF 1X5KA 4MA3B 1FJ1A 1A1NA 4HX1B 4OZFB 3NOIA 3UZEA 1XCQB 3GBML 4TN9A 3T04D 4BSWA 2OR9H 4OZHE 2HA1A 3CD4A 3QQNA 4GBXA 3RWIB 3TNMB 4JPKH 2UWEB 5DVKA 3NN8A 4UINL 5D2NA 5DVNA 5HHVH 5DQ9B 4J7RA 5H94B 2V2WA 4HJJH 3MFGB 1JPTH 2IGFH 35C8H 2BVOA 3EFFB 2XZQH 3IAGC 1Q9OB 2ZZUT 1FL3B 5DFVC 2IANE 1DBML 1AR1D 5IT2H 2J88L 5EBLB 3W9EA 1S7TB 2HFTA 2YPLE 2BVQB 4OGYH 5AYUL 1UVQB 2BRRL 3VD9A 1I1AB 3H7LA 3W2DH 2OI9C 3JZ7A 3GSNL 4WEBH 1X5LA 4R2GC 4JG0H 5C2BL 2R69H 5JW5B 1BX2B 1FPTL 1TITA 1FO0A 5JNYA 5GGVH 5LGJA 5DUMH 5FECA 1N0XL 1A22B 5MHSD 3MRBA 4R0LC 4LIQE 1GC1H 5IR1B 4LSTL 3T08A 3BN3B 4JM2D 5DK0A 1F6AB 1LP9A 2OMBA 4N0UE 2P5EB 4Y0GA 3G04A 2J6EA 3T4YA 3MRNB 1AJ7L 3GRWH 4LGSB 2NXYC 4FQQB 4M5ZL 4YHYC 4U1GC 1YN6A 2W1NA 4S1SH 3T3ME 1E28B 3MMEA 3U7WL 1HHJA 4HXBH 3AY4C 4M61A 3MA9L 1JGLH 5EORH 1MAMH 4QHMA 3EBAA 3I3BA 2HTKC 1OCWH 3ZYIA 3C87A 3HG1B 4P9MH 2OZ4A 5HYJA 4YHZL 3EZJB 3QUYB 4XNMA 1LO4L 1RZ7H 5MEPB 1NCWL 4U0RB 5HGAB 1B4JH 1NUNB 3T3PE 1G0YR 4QTIL 4L5FH 2YC1B 4WGVB 4FRWA 3UTQB 3QDMB 2PR4L 5F8RC 1KJVA 3CZFB 3V4PL 3Q5YA 3ISWA 2XY1A 1S7XA 43CAA 4G7VH 4GH7B 4FABH 2ENSA 2GSIA 5HHOB 1FVEB 3GK8H 4NUGH 4XCCH 4GAGL 4EBQH 1WUNT 2K7PA 2YRLA 4F3FB 3CVHH 4K8RC 2A77H 2BK8A 2BNQA 3B9DA 4LIQL 4X5WA 2A9MH 4M8VA 2YXFA 3RKDD 3RNKB 5IEHA 1EFQA 2QQNH 5EOTA 1F13A 4K94H 3QCVH 4K71C 3M1BA 4YDIL 4XZUA 4UUJA 3O2DL 3TFKC 4NO0B 2V5SA 1W0WA 5GRWA 2MCG1 3JXAA 5DHYB 1YZZA 2P5WA 4RDQF 4NCC2 2VZUA 5MEQA 2HRPH 3PDOA 4N90D 5BV7L 4ODWB 4DKEL 5HVFB 1LK3H 3O3DA 3L5XH 2EDFA 1YDPB 4NQDD 5I8EA 4MJIA 5TDOB 3GSRB 3IFLH 4JZOB 1NAMA 4V1DD 2ZG3A 1HI6A 5IESH 2I9LB 2CK0H 2NNAA 1JZ4A 4P2QA 1BQLH 2CDEA 2PXYD 2YUXA 2J8UA 5C08D 5ANMA 4FQHB 4MYWB 2UWEE 5KVDH 5E9DA 3SJVD 5L6YH 4PJ9D 1VERA 2FHCA 4IM8A 1FIEA 2FEDC 3PWPD 4DGIL 1C16A 3WDIA 4D9LH 4KY1L 1NC4B 1YEGH 2XA8H 2ZUXA 5AZ2L 1D5MB 1XH3B 3MNZB 4ODHL 4P4KA 4PRHD 4X6FA 4A2MA 5IVXE 4MXVF 3GHEH 2IH3B 2Z8RA 5GZOD 5JPMA 2N1KA 5D8JH 4ZDHB 5KVGH 3IU3A 1GYAA 3HRZB 1XT5A 4QNPE 4QRRD 4XX1G 1DDHB 5HVGB 1RUAH 4ZUTB 1J8HD 4NQEE 4J23A 1VEPA 1KTKE 3AC0A 2QQKH 3X14A 3TZVD 1MWAA 4L4TD 3QDGD 4KTYA 3LSOA 1RJYA 3RPIB 1KJ2A 3S98A 3BX7C 1QO3B 1QBMH 1WJ3A 2CR6A 4BFGA 5FO9B 2IFFH 5IKCA 1R0AL 4KPHH 1HXYA 2YWZA 3BDYL 1NCCL 1NC2B 2NY0B 2GSGB 3UPRB 3VE0A 4ELKB 1E4KC 3U0PB 2GCYB 4HCRA 3UTZA 4P23C 3BPCA 4RBPH 1ZVSA 4RQQA 3SE4C 1CDIA 2E7BA 2F5BH 1LEIA 5HY9A 3VFMA 4KRLB 2P5EE 1UH2A 2E3VA 3QQ3A 1BPVA 5HPMB 3LEYH 4B7IA 3CVHB 2W9EL 4I5BB 4XHQA 1ZS8B 2VDKH 3GSWB 4N68A 5ICYA 1JGDB 2BX5A 2CIKB 1OTUD 3PP4H 4X6BA 5J3HC 2X7LA 2D0GA 2IALA 3JV4B 2VL5A 4N0CD 3UTTD 1YEFL 2EDXA 1KB5H 1ED3A 2AABH 1KNOA 1QFWL 1FE8H 5KTEL 3OB0H 4LF3B 3VG0L 2EH8H 8CGTA 3HG1E 5D71L 4GT7A 4ONFH 5EU6D 3O81A 3VGAC 5GRYA 2F53E 4OKVA 4NWTH 1MIMH 2FIKB 3VXUD 4F7PB 3MV7A 2W9DL 2FH8A 2DM4A 1KCUL 2EDTA 4Y4KB 1U58B 3MGOA 2R56L 3MLYL 3ULVD 2A9NL 2NLJB 1FDLH 2PCPA 1LK2A 1I8LA 1JPSH 2F58H 3OJMB 4BZ1L 5ESAB 4JRXD 4NFDA 5DMIH 1RMFH 4M62L 4LPXA 3QG6A 1BZ9A 3KYAA 4F8TA 3D18B 2A6JA 1URLA 1GHFH 3VDCA 4KKBC 2EYSB 1A6WL 4TULL 1R24A 3H9SD 2E7MA 5GS1B 4CVZB 2ZOKB 1MHHA 3RDTD 3GIZH 1QVOA 4LL9A 2VAAB 3ZDZF 1HHKB 3EDFA 4IRSD 3FHAA 2ADGB 2L7JA 1YMHB 2E7LC 2DTSA 2AEQH 4OLUH 5KZCB 1XZ0A 4NZUL 3GDBA 4PJIF 5DZLA 5SWSB 1Q9LB 2UV3A 1U8NA 4MS8C 1RZFL 1Z9LA 3RL2B 3PWLB 4LSUH 4OD2B 4N0UA 1R3JB 1EPFA 3UTSD 4MVBC 1FCCA 5EIQA 5TQ2H 4M9OA 1N5YL 3BP4A 2P8MB 4AEHH 2VZ1A 3HZMB 4F15B 3HI5L 5TFSH 5FOBA 5EUOE 2ZUSA 5JXEA 1A7RH 1INEL 2XN9E 2NX5B 5B39G 5F1NB 1VB9A 1SMOA 3RWEA 3SY0B 3VXPB 1OP3K 1IVLA 2WLYA 3KGRA 3MV9D 4XVUD 3IJYB 2HFFA 4G5ZL 2QLVB 3VFPB 3ZDXE 3L3KB 5I16A 3CCHB 1CD8A 5DJYB 1CBVH 4EI5D 4J3UA 3T65B 1MIEH 1MLCB 4KKCD 4U1HB 3CIQA 4HKBA 4QO1A 2AJYL 2EKJA 1X7QA 5I71C 5IG7A 3MJ9L 3K46A 4Y4FC 1HSBB 4ODVH 2VWEE 2YBRA 4JY6A 5IB2A 2FCBA 3CFBB 1AO7B 3HE7D 1OP5H 4OV5A 4PGEA 3UX9B 1MCQA 1FZJA 3OGCB 4RX4A 1JN6B 4OQTA 1PX3A 2ZG1A 3HR5B 3HLAA 3OKOA 2HLAA 5D6DC 4ORGB 1OF2B 3U6RA 5JORB 1KB5B 4MA1B 1XGPB 4HLJA 3IDGB 4DVRH 2D7MA 5F7DB 3LN5B 3TWCL 1YPZE 5DS8B 4HH9A 5DJ2B 4NQXA 3MLRL 5CJ5A 4JDTL 1H3XA 2VZVA 2YEZB 1VEMA 2KBGA 4JQXA 3CFIC 4MNGE 1BVKB 2DB8A 2W0FA 4N1CA 3DHJA 3QUXA 4KZEH 4JN2B 4R3SB 4F33A 3OXSA 2B5IC 3MGTA 3RIAF 2IPUK 15C8H 3BKCH 1GOHA 3VFVB 3T77A 2AXFB 1CU4H 2D7OA 1SBBA 3LPFA 2WANA 1JNNL 3AS0A 4UOW0 4FXGA 4KROC 1KELL 3V7AG 1MCPH 2FGWH 5D7KD 4HEME 4GW5A 4MCZA 5L8JB 3RZCC 4HX1A 5CUSL 1MFCL 2EKSB 2VDOL 4RMWA 2APFA 1CR9H 3RRQA 1UB5B 2BC4A 5E99H 3ARFB 2FX7H 5F1KC 3THML 5GRUH 4OD1H 3RWIA 3DYPA 2UWEA 3U4EB 3PXJA 2IF7A 3MACL 3FT2A 4OBRA 3LH2L 5JO5B 1T0NB 5IBUB 2F74B 5DQ9A 2UZIH 1CZ8L 5H94A 1UWXK 4Y1AB 5IMKB 4PJGB 1VACA 5B21A 5FF6A 1FVCA 1A9EA 3EFFA 1OAUL 4WU5A 1QSED 4PB0H 1Q9OA 1WZMA 2VDNH 3NCJH 1XR8B 4NQEA 1DANT 4MQTB 4Q9QH 4MJ6B 4JO2H 4PS4H 1S7TA 2BVQA 4I18B 2VQTA 3GMLB 3S6CA 4K7PL 1I1AA 3TV3H 5GGQL 3MPCA 1TMCB 3P4MA 4ZSOE 4DVBA 2XFXA 4XI5D 2R8SH 4UILH 3ZTNH 1EH9A 1X5IA 4JFXA 1QFHA 3LD8C 5I1IH 4NN7B 4KK9D 2R2HA 4JPWL 4K7PY 4LLQB 3W0WE 5IR1A 2AK1L 4R4NC 4MB5A 1F6AA 2ESVB 2ED9A 1CD1B 2R1YB 3SBWA 2P5EA 3T0EB 5KW9H 4HH8A 1FSKC 1KB9K 1P4BL 1BBJA 1OPGH 5CJOL 4PV9A 4PJ7F 3B43A 4I0KA 3ZTJG 1E28A 1W72L 1GGIH 3EJJX 2ZWLT 1WITA 4LLDA 4I4WA 4NKDB 4K07A 2ZUUA 4Y5XB 3T0VA 5BS0B 4FFZL 1NGPH 5T1KD 3HG1A 4YBLB 4M6NL 4X5LA 1GAFL 3RWCA 2HWZL 1MCJA 3HPJB 3QUYA 2IC2A 3SHSA 2DLHA 2QHRL 5A2IH 2R1WA 5MEPA 4AEFA 4PP1C 5DGQA 5HGAA 5L2KE 5DDHB 2M2DA 2YXMA 1MREL 2XRAL 5C7XL 1MNUH 2YC1A 1EUTA 4LKXB 3RY6C 3QJFB 3QDMA 3CZFA 4WHCA 3SKMA 1ZA3B 2ED8A 3SPVB 2CLRA 1J9CT 5CZKA 5SV4A 5K9QG 2G5BA 1QLEL 3QZWB 4P0DA 3V0AC 4B50A 4YGVB 1PG7W 4Z0XA 3CFDB 1MFNA 3HAEA 4ZD3H 3O3AA 1EUUA 4LASH 3WV0A 2PO6C 4ALAL 3QI9C 5E8EA 4Z8FH 4F7MB 4KH2A 4JRWA 5C0CE 3EYOB 3N1GC 2XQBH 3AS2A 3UBXG 1VFAB 4KKLD 5FO7B 3N9GH 4JR9L 4P59L 1IAMA 3WUWG 1JE6A 4NO0A 4G6KH 3NPZB 4BFIB 4ODTH 2BSTB 2DYPD 3LKOB 1T1YB 3JUYA 4DK3A 1W0YT 4Z0BH 3QSKB 4ODWA 3B5HA 5HHXH 2DJ4A 2NR6C 3RGHA 4KMQA 3CX5J 4FQJL 3DIFB 3BISA 2BNUA 5TDOA 1ZWIB 4OGZA 4BSVB 5EUOA 1WIPA 3PQYD 5E94B 1KEML 2J5LB 2XN9A 3E3QC 4E41B 2DQFB 1FAIL 5IJKA 3EYUL 1DBJL 4RFOL 3VWJB 4AEIL 2P8PB 3JWDC 4FQHA 3G6DL 4XMLH 3S88H 2DJUA 1A6ZB 3L95B 2DWEB 1IAII 1HHGB 4ZPTB 1NJ9B 1EZVY 2XXCB 1NC4A 1D5MA 1T21A 1XH3A 3GRWA 4JE4B 2DQCH 4PJGE 1MFDL 2IH3A 3P0VL 3FN0L 3HRZA 1RU9H 1X4YA 5B38A 5E2UH 1DDHA 2DOCA 1IL1A 2ZCHL 3U30B 2D0FA 3KNBB 5HI3D 1I1FB 4KDVA 1E27B 5D5ME 3WNMA 2DQJL 3NAAL 1XF2A 4LKCB 1G1CA 5KVMC 4JFZH 5MP6L 3PWVB 4JEGB 4OZFG 1Z3GL 5SV3A 4WI3A 1DTUA 1QO3A 1VFUA 5HGHA 4NZTH 2DI9A 2B8OT 4WJ5B 3KXFB 3FB7A 3HMWH 2WP3O 4F9LC 1FORL 5EU5B 4GS7B 2FLRT 3OSKA 3QJHB 3GBMH 3GIVB 1NC2A 4MNGA 3UXFA 2GSGA 1RJCA 5C0DA 4ELKA 4ZTOL 2WK2A 2HT3C 5HHMB 3EO1B 4YEFA 3KPLB 4YR6A 4X7DC 4IOIB 1L0YA 4FFVC 1XGYH 4LCWD 2B4CH 4X99B 3WXVL 4XCFL 3T0EE 5HPMA 5E24E 1WCBA 3CVHA 4FFWC 4QRPD 1T1XB 3BEVA 3CUPB 4JVUA 5CBAB 1KIRA 5HI4D 4YEEA 2NTSP 1JGDA 2FD6H 1IC7H 5ADOH 3B9EA 1TCMA 1LDPH 2CIKA 4CDGC 1DBMH 3VXSB 2P4AB 3JV4A 4IBLT 3S3SA 3P4NB 4QKXB 2J88H 2DLFL 4LF3A 4M5YL 1YYLH 2R23B 4JY4A 2QADC 4PRPD 4U6HA 1KGCE 3ZYZA 5DMKB 3CDFA 4EJ1C 2YD3A 4WI4A 1U3HB 3V4UL 1DZBA 2DF3A 1HCFX 4LARL 2AJXL 4NKQB 1FPTH 1U8IB 2EYRB 3WIIH 3TIEB 5ABDE 4YX2H 1P7QA 4NPYB 2KH2B 5FM5O 4Y4KA 4YZFE 4EI6B 1UWEL 2H45A 3ZL4L 2HKHL 3U2SA 4OGXL 5L7XL 4PYHA 1T3FA 1UQSB 5J7CC 5BZDB 3D18A 2WQRA 4AL8L 3QCTL 4RAUB 2P7TA 1J10A 3EYFB 3ZHDA 5D1QC 2EYSA 3VWKC 3P9LB 3GSVB 1MJ8H 4R96B 1LMKA 1BQSA 4QTHB 1FN4B 1G6RL 5GS1A 1UWGH 2IPTH 3BIAX 2QKIB 4K9EL 3VXMB 1IFHL 1KEGH 2G9HB 4LMQE 5DFVD 3DI3B 4HLZH 2ADGA 1YMHA 4NN5B 1B3JA 4ZFGH 3W0WA 4OFVA 3BAEH 4OLZL 4CADB 5E00A 4QXUL 5SWSA 1Q9LA 3OKEB 5JA8B 1A64A 2XTLA 1CXFA 3RL2A 3QHTC 4LVNC 4OD2A 3R1GL 4PJ8C 1A14L 3QH3A 1O5DT 1KPVB 5M95B 4JKPH 5FA3A 4MD4B 1I3RA 5H2BB 1IAOB 3F65A 4R2GD 3RL1B 1NGQL 1LO2L 4NQCB 2NX5A 5F1NA 3GM0A 2PR4H 3V4PH 2RHEA 3ULUD 3VXPA 4CJ1A 5GRXG 2P43B 5C3TA 3AB0B 4HWBA 25C8L 4YHKL 2ICWA 4W6YB 1SBSL 3QXDB 3T65A 3SGKC 1EEYB 1RFDL 4XMKL 3WL9B 3WXWL 4L9LB 2MCPH 2BNRE 5F3BB 1JUFA 3LRSB 1PQZA 3I2CH 3QFJD 1G9NL 1KPRA 2NXYD 5L2KA 4JQVA 3T4AB 5JQ6H 2EDDA 4IDJH 3JV0A 7CGTA 1OAQL 4L9DA 3REVA 3EOBB 3HR5A 2MJWA 4XXDB 2AJ3B 3Q1SH 4ORGA 1OF2A 4OCWL 3T0WA 5JORA 2DBLH 2W92A 1T7XA 4L1HA 2EEDA 1EHAA 3KLHC 4DKEH 1AFVH 3IDGA 2HTKD 3LN5A 4QHLA 1TVDA 4FQLL 2FHBA 3GI8H 5DJ2A 3K0WA 1YYML 3AMLA 2NY6D 3RU8H 4GKZB 3BKYL 5IW1A 3CH1A 3QIWC 1I8MA 4NRYB 3O6ML 4HV8B 5HDOA 1HZHL 1RUML 4LRNH 3S5LB 2R29L 1R5VA 1N3NB 4G9FD 3ARXA 2XNAB 4R3SA 4JM2B 1UH4A 2E9BA 1RZKH 2O5ZL 2YKLH 2AXFA 1BF8A 3VDAA 4P46A 4XXCA 3V5DB 4KY1H 5ITFB 4K8RD 4YPJA 3BSZL 1QHOA 3NPSB 5T3XL 4UV7H 1VA9A 2EKSA 1NGYA 2ATKB 4KDTA 3TJHC 4C59B 2LAAA 3MLSL 3FQXB 3ARFA 3FO0L 2BCKB 3S35L 4PJHB 2DIAA 1DJSA 3U4EA 1F4YL 1B0WA 5JO5A 5ISZD 1T0NA 5SWZD 3IB4A 2F74A 5DJ8B 1L7IH 5DD1H 5FDWB 2EDNA 1AIFB 5CJXA 4Y1AA 1U6AH 1WT5A 3CH8A 5IMKA 2X89A 3BDYH 4PJGA 1VHPA 4XPBL 3PXHA 5GJTL 5I8OL 4MDJB 2C5DC 3DSFL 4FMKA 1R5IB 2P42B 1S7QB 3L5JA 5K59F 4MJ6A 5ILTL 5KJRL 1B2WL 2HH0H 5D5MA 4ZO7A 4OF6A 2DWDA 4FQ1L 2VLME 4I18A 3A6BH 4G6FD 1AC6A 2EO9A 2X9YA 1A02N 5D7LD 2JJSC 2W9EH 5IFHL 1Q38A 4DN3L 1MPAL 2J3SA 4X6CB 2W38A 4HT1L 5HD8C 4NOFA 1MJJA 3LQAC 5J1AA 3UYOD 1KFAL 1EERB 5HI5D 5DJAB 1H0DB 4JO4H 1XR9B 1E4XL 5L0QB 3P11L 4PG9B 3LPWA 3N85H 1CL7I 4LLQA 5CJQL 3TBWA 3FCTA 4LQFL 5MENE 1EHLH 5IBLC 5D71H 2JB6B 1CD1A 2R1YA 4DGVH 1AP2A 5CP7B 2HN7B 3T0EA 5E8NB 1LEGA 1NCAH 2R0ZL 4K3HA 2BY2A 4P48A 3VW3L 4LLVA 4V1DB 3WFCH 1UM4L 3ARUA 1CGUA 4NBXB 2W9DH 4WTXA 3IXTB 1NANI 4E5XB 1OGAB 4GRLD 5B4MC 1HQ4B 4JO3H 4RMVA 5B3JF 3RWGA 4P23D 5A40E 5JW3L 5JXAL 1WAAE 3IETB 4DN4L 3HPLB 4PJ9B 1BOGA 1FZMA 3EGSA 4NJ9L 5C0GA 1J0KA 5TPWL 4C83B 3WEXB 3B9AA 4R26H 4PRHB 2HAZA 3QIBC 1X5JA 5DDHA 1N5AB 5GGUB 3I3EA 3BYTA 4WHYG 1CGSH 2IMNA 1ZLVH 5J3HD 1EO8L 4ZOBA 4MHHI 4YC2C 2M26A 3TZVB 4CBPA 3UJTH 1RJLB 1V7NL 2FX8H 4L4TB 1A7OH 1RZFH 2FECI 3QZWA 1I9IL 4U3HA 4YGVA 4WY7L 5EPMB 3QCUH 3UJIL 3F8UB 3HI5H 4DOHB 4RGNB 1BZ7B 1F4XL 1TPXB 1BIIB 3EDDA 5KSAA 1VFAA 1Z2KA 4M93B 2O93L 5EZIH 1BFTA 1KXTB 1W0VB 4YE4H 5LQBL 1NUGA 1JZ3A 3UAJC 1YEJH 2LFGA 4U7SA 3B2VL 2BSTA 1PVHA 4EN3D 2IAMC 4PBVC 3SE3C 1MQKL 3MJ9H 4OLYH 3WNPA 3C9NB 1I85A 3UYRL 1Z5LA 2C4FU 4Z7VE 1C7TA 3AXLB 4G8FB 3OR7B 2P46B 1ZWIA 2RQ8A 3KYKL 4NCDA 4BFEA 5E94A 4E41A 5BRZE 2DQFA 5DMYA 4W81A 2N56A 3T2PA 1H9VA 2YPVL 4GRWH 3E2HB 3UTTB 1TQCC 2P8PA 4WTWA 1KTDB 1SJVA 3OAYH 2BSRB 4LVHB 3GSOA 2GFBB 4DZ8A 4MS8D 1NFIB 5DO2D 5F7HA 1CLCA 1JZ7A 2DWEA 3BPNB 2BNRA 5HDBE 1NJ9A 1DVFC 3SGJC 4Z7WB 4NC2B 5EH1A 3AM8A 2PW2A 3VXUB 1S7VA 2OP4L 1BVLB 4QOKD 1R3IH 4LNRB 4X9IA 3X3GL 3L3DB 3BXNB 4X6DE 4N0RA 4JFHE 3QPQC 1EK3A 1DL7L 2WIIA 5EA0L 1FFOA 1I1FA 1E27A 3HNTL 3TNNA 4PG2A 2H9GB 3VG9C 4PJ5E 3C2AH 3IDJA 3WMSA 4HKZB 4LKCA 5L88H 4JRXB 5FYLE 3NBNA 4I77L 4LPWA 4YHLL 3SDCB 4OAWB 3BZFB 4J2XA 3EFDL 2G5RA 1I3GL 3CFKA 4Y4FD 3VA6A 2D9CA 3V8CA 4D3CL 2PW1B 3H9SB 3QUKB 5CUSH 1MFCH 5EU5A 3RDTB 3GNMH 4ZUVB 4RSVA 4ZPVB 5HVHC 3GIVA 4IRSB 4AH2A 1JPGA 2IADA 4MAYB 1XGRB 2APWA 1KIQA 3K4AA 3EO1A 1ZV5A 3TC9A 2CJUH 3KPLA 1CT8A 5FV1L 3SN6N 3O3EB 3O4OC 5TE7H 3BW9A 5E4EC 4PRBB 3VRJA 5DD0H 4X99A 4G9DA 1PEWA 3HUJF 4P9HL 5FYJU 5LBSL 4YXHH 4M1GH 4HIXL 4NQDE 4TSAH 3SCMC 1CXKA 3SDXB 4BQ9A 1T1XA 1CE6B 1QHPA 5CBAA 1CL7L 5CSGA 3VH8G 1IM3A 4WIQA 4BKLB 3GBNH 1DUYB 4AENA 1J1OH 2O5XH 2UY6A 4MJ5A 5C08E 1YNKH 4Y5YB 3BDBA 3P4NA 4EI5B 3MCG1 1JHTB 3SJVE 3QA3A 1S8DB 1CQYA 3AMKA 1DSFH 2R23A 1MUJA 4KRPD 3AVEA 4LCCB 3PWPE 2HT4C 5DMKA 3H9HB 3C6LC 3CC5A 1JNHB 4PRHE 4YHML 4H0IA 5IK3A 3HE7B 2D7TL 3K1DA 4PJFE 5INDA 4HWNA 4YUEH 5FYLL 1QBBA 3RZCD 4QRRE 1U8IA 4ESKA 3TIEA 4R4BA 1J8HE 3MXVH 4X7CC 2KPNA 5I75C 1FHGA 2ARWA 3MRFA 4Y16C 1ORQB 3D25B 4GRWB 2R0KH 5DEGB 2AK1H 3QXVA 4Y2DB 1YQVH 4EUPB 1BD2E 3QDGE 4PJEB 1FL5B 1IGFL 1Q94B 1AQDB 4JDZB 5DUBB 5MEOB 3TVMD 2QQLH 3I02B 4ZOCA 5BZDA 2EDEA 5CJOH 4D0BB 4GXVH 4C54A 5IWLC 3MCKB 3GSVA 4R96A 1MI5D 1RURL 4QTHA 3OHXB 1FN4A 2QKIA 4I3RL 3VXMA 2G9HA 1MAJA 1HH9B 5BMFL 2JELL 3HC4H 1QLFB 1LD9B 1ZA6B 5J4MA 1J0IA 1VFBB 3VXRB 2X4RB 1IAKB 2GK0B 1B4RA 1NCUA 3WHE1 4RBPK 1ACYH 4OV6F 4YNYB 1KPVA 4L8SB 1EGJH 4U0RC 1MREH 5H2BA 2D03H 1IAOA 5E5MB 1FRGH 1HNFA 3A0OA 3QXTA 4XAWH 4XP6L 5DJXA 1TNNA 4XC3H 2G2RB 3ARDC 1B0RB 3DOSA 5LCVH 4N8CL 3Q6GL 3UTTE 2BERA 2EO1A 4RWYH 4JQIL 3SKNB 5KS9E 2XICA 4R4ND 4YWGH 3V5HB 3QXDA 5TDPB 3E6HA 3MRHA 1EEYA 1JF1B 3RWJB 5JHDD 3GMRB 2ADFL 3WL9A 1I9JH 3L9RA 3IF1B 5EU6E 4NHCL 1P1ZB 4ALAH 5DTFB 5FHAL 2N7BA 5A2JH 5DRWA 1JZ2A 1Q0YL 3LRSA 4LRIA 4NNXB 1NQBA 4K2UH 3FRUB 3RVWC 1QSEB 1F4WH 3KJ4C 3EO9H 3B4NA 5F9OL 3MRMA 3RGVC 3B8SA 3WNNA 2IBGA 2AJ3A 2C1PB 2AS5M 3ULVE 5J1TC 2ZNXA 4AJ0A 3LCYA 1SEQH 1EEUA 4GW4A 2QL1A 4WW2A 2AI0L 1AGFB 4WENB 3U1SL 2I27N 2X4PA 3UPAA 3U0TA 3AS3A 4XWGH 1BQUA 1FAIH 2Q86B 3TYGL 2VDRL 1NCTA 4DQOH 3PJSB 2F19H 4NRYA 4HV8A 1MHCA 4PRDA 4RFOH 4AEIH 5C6TL 4U33A 4PY7B 3MRKB 1A3QA 1A6AA 2CRMA 4YHOL 2XNAA 4YDLB 1KN4H 4J3WA 4JM2A 2ZUTA 1KENL 4LLMA 1J11A 3SO5A 3ABZA 1NSNH 3UTSE 3MJ7B 4XVTL 2YD8A 5C71A 5ITFA 2ZCLL 1IC5H 4Z7VA 2PO6D 1YMME 3QI9D 2HKFL 3FN0H 3LEXB 4QHNB 2VE6B 4PLKC 2C1OA 1CDCA 2D7PA 3MV9E 2ZUYA 3NAAH 2D4FA 1DQDL 2BCKA 4PJHA 2W59A 1R5WA 4HS3B 2A6IA 1V7ML 4AM0B 5IHBA 5T1KB 3GSXB 4OCXL 1KPUB 4MMZC 3MR9B 1Z3GH 3K81A 3BDXA 5FDWA 5INCB 4CUCA 3D3VD 4PYGA 4FZEL 4BELD 1KCVL 4MDJA 1PKQB 1A1OB 2GUOB 3SDAC 4JFFD 1R5IA 1CXEA 1S7QA 5MI0C 1MCWM 4X6DA 3WFEH 4CN6A 5LVEA 3MRLB 4YDKL 1OP5K 5DJDA 2VYRE 1NFDE 3V6ZB 4PJEE 3WXVH 4XCFH 2XKSA 4NC1C 3SDYL 3S36X 2Y36L 3QG7L 3CLEH 3SOBL 5IMLA 2XYCA 5EUKA 5EN2B 5FUOH 3P0GB 3VFSB 1NLBL 3DO3A 1U2CA 5IW3A 2V17L 4FXLA 4PGDB 4L8DB 5DJAA 1H0DA 1KTLA 1QFOA 4PG9A 2DYPB 3MODL 2YMXH 4P2OC 1KC5H 2FDBP 1G9MC 3EOAA 2OK0L 4KTDH 3RIFK 3BGMB 1OSPL 3CDYA 4NQDA 4DTGH 3G6JE 4GG6E 5J12C 4LARH 5CSZB 4YXLL 3PQYB 3OBAA 4V1DA 5TF1L 1OP9A 4DAGL 1BWWA 3IXTA 1AD9B 2JCCF 4XB8A 3ARSA 4E5XA 2RJMA 2PXYA 5C08A 2F8XC 1A5FL 5K9JL 3MCLH 1UG9A 3WNLA 3V6OC 1WTGT 3ARBC 4H26B 3IETA 3SJVA 1RJZB 4N1HB 5F89B 4XBGB 2HKHH 1Y0LB 3HPLA 3PDGA 4NGHH 4PJ9A 4PGJA 4FFVD 5ALCL 3VFRA 4BA8A 3O11B 1DFBL 5I76B 3PWPA 4C83A 5A43C 2FH6A 5D6CB 4KHXL 3SE9L 4FFWD 3GMQB 4PRHA 4ZXBD 2Q7YB 2CK2A 1G6RH 3DX7B 5GGUA 4QRRA 5A2FA 3U79A 1QSEE 5CJ8A 2FO1A 1J8HA 2R2EB 3P30L 4MAUL 3CU7A 3IDMB 4HAFA 1OOAA 4JG1L 3TZVA 4L4TA 3QDGA 3U9PH 4R7DB 4TUOA 4MGXA 3PL6C 2QADD 1U8QA 3H8NA 5EPMA 4KI5E 5C9JB 3V9FA 4U2ZA 3AAZB 3C60C 1OTTC 2VMFA 3VI4F 3BUTA 4GLRI 5E03A 1MHPL 2DD8H 1UZ6E 1E6OH 1BIIA 3JVGA 3W39B 5KANG 1H3WM 5CCKH 1JGEA 1HE7A 2IQAB 1CXHA 1GIGL 25C8H 4YBQC 4YHKH 5HHQB 3VXOB 1C5CH 4WU7B 4KHTH 4J3VA 3P9WB 1IQDA 3C5SB 1RFDH 4QXTA 2GW5A 5I74B 3S96B 1A7QL 1MEXH 3C9NA 5IBTL 4KJQC 4QRPB 5JOPD 2A6KB 1YA5A 3NCMA 4G8FA 2RAMA 2ZSWA 4KMTH 3OR7A 3TBTB 5D1QD 3QO0B 2AKRB 2PYEE 4RFNC 3BPLC 2JKXA 1IAIH 3WJLC 3RUGF 3UTTA 4FQIL 4JY5L 3TA3C 3DX9B 4O02L 4OCWH 4QY8B 4UMGA 5KS9A 3MRIB 2BSRA 5F93C 3BD4A 1NFIA 1PW3A 4X98A 4PJ8D 4I0PC 5EU6A 2R4RH 3ES6A 3EOTL 3H3KA 5JIHA 2ARJB 1YYMH 3QXAA 4RMSA 1T2QL 4RGOL 3S5LG 1EJ6A 3OKLB 3NH7H 1RULL 3ARZA 3K8MA 1BVLA 1JMZA 3BXNA 1ZLUH 3D69B 1RUKL 5EOQL 1C1EL 2H9GA 2O5ZH 3OWEA 4HKZA 1S9VB 3PNWB 1JPFA 4JRXA 3V6BR 4LP5A 5ID1B 4CL7A 4XNQB 1UC6A 4PJBB 3U9UA 3LB6C 4K8RH 1BJ1J 3DO7B 2P24B 3BSZH 1ZT4B 3MLZH 5EZOL 3H9SA 3RDTA 1G6RB 3TO4C 1DR9A 2ICEB 2BZDA 4ZPVA 4HKJB 4IRSA 5K9QI 3LKNB 2NY5L 1OM3L 4LP4A 1XGRA 3CJJA 2MWCA 2PF6A 4OCYL 5CZVL 2EZ0C 4XVSH 5BW7A 3IT8D 1F4YH 4P2YA 4HULB 3PWJB 2D7NA 5GGSB 3O9WC 4WUUD 4PRBA 3KLHD 2OI9B 4JPVH 4LLYA 4UOJA 3UTSA 5IW6B 2MOVA 1RIUL 4UQ3B 3UBXI 1RIHH 3SDXA 3S34H 3DSFH 2YOCA 4G6ML 1H3UA 3K2UH 3QIWD 4ODUB 1NLDH 1W8OA 5KJRH 5KSVB 1WQVT 5ILTH 1JI2A 3MV9A 4JZNA 5D7JD 4O4YL 4Y5YA 3CLFH 4R0LB 4EI5A 2DQTH 1JHTA 1YEHH 2Q1EA 5CMAA 3OL2A 2RFXA 4HIHB 5T5FH 4LCCA 4I2XE 3RVUC 1UA6H 5CWSB 1GRWA 2CDFB 3QFJB 4POUB 1JNHA 2NXYB 3HE7A 2VIRB 4U1GB 3ZHLA 1WC7B 4S2SB 1CCZA 5FYJE 1ROWA 2P8LB 3TJHD 5DMGC 3E8UH 4HWZA 4Z5RA 3P11H 5KOMC 5DRNA 3UC0H 5CJQH 4BZYA 4XPFH 1NMBL 4ENEC 2QJDA 4PJEA 1FL5A 4LDLB 3VI3F 4D9RD 2AQ2A 3ARRA 1Q0XL 3QUZC 4XBPB 1AQDA 5DUBA 5MEOA 1D5IL 1RK0B 3NFSL 1K3IA 2R0WH 2ERJB 1AI1H 2YK1L 3VCLA 4J4PD 4TTDC 2V2XB 4XCEA 1U8JB 2DQEL 4N0YL 2VR9A 3F58L 5C0BE 1FNEB 3QQ9C 4NKIL 1QLFA 1ZA6A 1T7VA 4DN4H 4M7ZC 3QDJB 5ALBH 4Y89A 5C09D 1AGCB 1RUPH 1ZSDB 3VFUA 2X4RA 1IAKA 4LCWE 4ONGL 1CDUA 2GK0A 1CLOL 5C07D 5KSBB 4BH8B 2PYFB 4KZDL 1TQBC 1AXTL 2GT9B 5L8LB 2FO4A 4QRPE 1A3LH 1O7SA 4YNYA 5TH2B 1HINL 3G6JA 3H0TB 4H8WC 4L8SA 4U49A 4XNZC 1JCKA 5CEZD 4E0RA 3WKML 4PRNB 3O0RL 4K71B 4MX7B 2W60B 5HD8D 1A1MB 3CAFA 1UKSA 3U82B 2AK4B 3QWQB 3LKQA 2OJZL 3QEHB 4M43H 1IGCH 4FXKB 1I8KB 5FYJL 2ENYA 2Q3AA 3V5HA 4CW1B 5LGHH 4G6JH 5SWZB 3B83A 3RWJA 1JF1A 4PRPE 5IBLD 3NIDF 3MBXL 3UJIH 1FZOB 3QEGH 1WWBX 1N64L 4IRJA 4NNXA 3WFHA 1H3PH 5FXCH 2H6PB 5CGTA 3FRUA 1QSEA 2Q8AH 3Q3GA 1B6DA 2D31A 5IVZA 4OFPA 4BK4A 4LFHG 4P49A 5CLTA 5B4MD 1FLTX 4C4KT 2GTWA 3RJQB 4M1DL 3JV5A 5CKAA 1MCDA 2D7QA 4G6FB 5D7LB 1F58L 4X80L 1NBVL 4Y19B 4M48L 3O4LE 3QIBD 1UYWL 5D2NC 3T0BA 2FYYA 3TT3H 1TZGL 2Q86A 1QBLL 4KQ4L 1LHZA 5JDSB 3PJSA 2EE6A 5IM7B 5C0AE 3MRKA 5GISL 3QHZH 3IDXH 5J0BA 4WEMB 5E6YA 5T1DL 2X4OA 4HWEL 2CKBL 1XCTB 1A7NH 1MCBA 5ICXB 2NY2C 3FB6A 1WZ1H 5E56A 3O6KL 4M7JH 3LEXA 2GKIA 5FYKD 4KTEH 3BHBB 3U30C 4LCYB 3ULUE 3G9VA 5ITBH 3B9KC 1DL7H 4NBZB 4O58L 5EA0H 3T8XB 2XI9A 2AJVL 4L3CB 1J7VR 3QR2A 3FAXA 3TM6A 3DECA 4AM0A 4LEXH 5T1KA 2VOTA 3GSXA 4O2FA 3EFDH 4MWFB 5IHUL 4OD3L 5D93B 1H3VA 4WCYL 2CO6B 1J86A 3QFJE 1MCLA 2GJ6B 4XP4L 5CFHA 2YD7A 1EGJA 3D39D 1LEKA 1RZIA 4XMPH 1PKQA 1A1OA 1W8NA 2GUOA 1ZT7B 2JLLA 3AUVA 4AIZB 1A6UH 3L1OL 1QRKA 2EIZA 1JZ8A 2YRPA 3INUH 3VGEA 1KCSL 3VJ6B 1P2CB 1X44A 5J89A 4FMFA 4JRYD 4MD0A 1F42A 3OKKB 1DQLL 5GJSL 1QBAA 4H0GA 5EB9A 2VAJA 5EN2A 1CL7H 5JR1L 4XNYL 4OZHF 1IGYB 4ZUUA 4S1QH 3TESA 4PB9L 1K6QL 1F6LL 5EDXA 3S4SA 3O6LL 4R8WL 4POZC 4P99A 4K7FB 4BUHA 4PGDA 4TOYL 2UVFA 3QPQD 4G9FE 1RHFA 2DYPA 3HFML 4PJAE 2CGRH 5KSBE 2DI8A 1WK0A 3KDMB 4LGPB 3PV7A 4YHMH 3MRQA 1JYWA 1AR2A 1KBGL 2Z9TA 4OJFL 4EOWL 5CSZA 3PQYA 3VXTB 2YHGA 4EUPG 1SJEA 4MLIA 1AD9A 2EDJA 5C70A 3MYJA 4G6AC 4H26A 4AY0A 4LPCA 4G42A 2G60L 1IGFH 1RJZA 3CU1A 1Y0LA 4FP8L 3FQWA 2JK5B 2VQUA 1UACH 5ISZE 4I2XA 3O11A 3NIGE 2Q6WB 3VGFA 4PGCB 4HD9A 3MOAH 3X11B 2FGZA 4HBCH 5D6CA 3P0YH 3SCMD 3TJEH 1VCAA 3DX7A 3FO9A 4F9PC 1MCOL 4QOKB 4P2RD 1L0XA 1M05B 4X6CF 1A3RH 1N0LA 2P45B 2R2EA 2XTJC 1G7JA 4KV5F 1CYGA 4MA7H 3DV4B 1FBIL 1HILB 3MUGB 3GSUB 2YSSA 1T7WA 4NZRH 1T20B 2F54D 3QUMH 5EIIB 5IJVB 4HS6A 4R7DA 3ZKMC 3VXNA 5D7LE 5TE4L 3UEZA 5I71B 5AUMB 2ZPKL 4KAQL 5IQ9B 4Y4FB 1T22A 4F7CA 3C6LD 2GY7B 1HQRB 4IMKC 3AAZA 3GKZA 5E8PA 2A1WL 3ESVF 5JA9A 3S7GA 3DV6B 1IGIL 4XP6H 1QPXA 1QFPA 2D3VA 3BFOA 2HFGL 3NTCH 2XQYK 5F96L 2FB4H 4NT6A 4XRCB 4P4KC 4FFYL 4Y16D 2OXHA 3TO2A 5DQJA 2HG5B 5EU3B 3VXOA 5HHQA 4WU7A 1CXIA 1U93B 5F7FA 2XY2A 2OX5A 3C5SA 4LCWA 1DLHB 2ADFH 2WBWB 4N8VB 3MNWB 5GS0L 3S96A 4OFYD 5CINH 5FO8B 4QRPA 1EA9C 4KMLB 4QCIB 2Y7QB 4W4OA 2A6KA 3OB8A 5CD3B 1LNUA 3TBTA 3HMXA 3QO0A 1VESA 4LQ1A 5I66B 2EE3A 2VDQL 1F11B 1ODAA 1HYSC 3QNYB 3OAUL 3V5KB 4LEOA 1ZLSL 2NY4C 5FCUL 3DX9A 5IFJB 1WZLA 1EFXD 4QY8A 5D9SB 1YQ2A 5HSFA 1ZEAH 4OBSA 1Q1JL 2AI0H 4PRPA 3T2NL 1KIPA 1NCBH 4KROB 2VQ1B 1YECH 4UDUB 2ARJA 3HE6C 3OKLA 4QRQB 4KQ3H 3SKOA 3TH2T 4MQ7A 1F02I 4F80A 1AQKL 3ARDD 3WD5L 3H42H 5EO1B 3RHWF 5HHOD 1C5DB 1N7MH 1S9VA 3U48A 2H26A 1MHEA 2FJFB 4XNQA 1EEQA 4XP5L 3CMGA 5IP4A 2IPKA 3DO7A 1UFUA 4RA3A 5FM5M 2B7DT 5DWUH 5GGRB 1IGTA 3WFZA 3ARGC 4HG4K 1QFUH 3O4LA 1KCKA 2JIXB 4X7SH 3RVWD 1XEDA 1KXVC 2ICEA 5DD6A 4FHBD 4YGAB 5BQ7B 2VKXA 4HGKC 4M9PA 3ZKSD 4O51B 4WFHE 3S36L 1UZ8A 2R2BB 3T09A 1T66C 3PWJA 4OCXH 4UI2A 4AMKH 4G8GD 5IVXF 4K3EL 2Y25A 3QUMB 1PKOA 3NCBB 2UZYB 4FG6D 4H20H 4UQ3A 1BJ1H 4D0CB 5E0QA 4PV8B 4L1DA 5DA0B 3KLSA 1UM5H 3OR6A 1UEYA 4Z7WF 3LD8B 4PGBA 4P4RB 3ROOB 4ODUA 5KSVA 3O8XB 3BH8A 3JWDH 4PJIB 3HS0B 2EXYC 4R0LA 1DEEA 4YQXL 1T1WB 5JHDB 4HIHA 4H88L 5ESVB 5FCSH 4HIEB 5BOZG 5CWSA 1IC1A 2CDFA 3OAYK 4NRXB 3QFJA 1CVRA 3B3IB 3PHOB 1BJMA 3HI1B 4H5SB 1ZVYA 1GOGA 2VIRA 4HFUL 4HPOH 4L4JA 1J0ZA 1WC7A 4QOKE 3CXDL 4PLKD 4ISVA 3KPMB 2P8LA 4HMCA 4UT9L 1IKNC 2MPAH 3AY4A 3N50A 4TSBH 4HZLA 1A21A 4RRPG 4UU9A 1HEZB 4M4PA 4PJXE 3OJVC 3WLWC 5BV7C 4P5MA 2YA0A 4XBPA 4P2CG 4PJCB 4MXVE 1RK0A 1CDGA 4OUUA 4CMHC 4YHIA 2C26A 3V4VL 1HKLL 3IFOB 1MELA 1MF2L 1U91B 2X5PA 2K3TA 4XPHL 1MRCH 1U8JA 2OJEA 4HIIA 1CK0L 1ONQA 3SDAD 3IJSB 1OAXL 1FNEA 5K9JH 4S11A 4G9FA 1NBYA 1TTFA 1CGTA 4PJAA 4MQXC 1ZSDA 5KSBA 3CFEA 4APQC 2PYFA 2VXVL 4IOSD 2GT9A 1CLYL 3SE9H 1DQTA 3QI9B 3H0TA 5AZEL 3IFNL 5CILL 3V6FB 4MX7A 3MUJA 4DUWA 1IT9L 2FEEI 4JG1H 3ZKNC 1K3ZA 3QEHA 2OL3H 3DVNB 1I8KA 4JQXC 4ZNEA 3EJZC 2CSPA 4P2OD 3K8KA 2YS4A 4AIOA 5ISZA 4IS6B 5SWZA 4OLVH 1RAMA 2FWOA 2QV2A 2BJMH 3VGHA 1CLZL 4JVPA 3MLVL 4XT1C 1FZOA 1PG7X 5BJTB 1WF5A 4F37K 2B2XL 4D0DA 3D3VB 5J6GB 2O61B 3MUY1 1BWMA 1RIVH 5JHLH 2E27L 1H5BA 3GJFH 4OGAC 4PPTA 2APTA 2DDQH 3PABB 1JHKL 1HYRC 4BZ2L 1VENA 2B1HL 3ARBD 4PTTA 3OGOE 4KVCL 1T04B 2R0LH 3QEQE 5JW4M 5D7LA 4F57L 1SVZA 4OF5A 4GMSL 5IV2B 3PV6B 4KK6C 2Y5EA 4BK5A 1J8KA 1MI5E 2OTUB 3ZDXF 1F8TL 2VXSL 3NFPB 5IM7A 4O02H 1FNLA 3NGBC 5ESQB 1U36A 4JANB 4FZ8H 4RWHA 3U36B 1FYTD 1OLZA 1S7WA 1PX4A 4BUGA 4KDWA 4XP9L 3IRPX 2Y6SD 2A6DA 1GGYA 1TCRA 4X7FC 3PL6D 1MRDL 1CXLA 1T2QH 5I9QB 5ICXA 5DFTA 1OTTD 1GGBH 2HJFB 3ZDZE 3MLXL 1RULH 5HHPA 2C9AA 2EDWA 4JGJA 4GAYB 4UDTB 2FHFA 4UT7L 5SX5H 4LCYA 4GRLA 4LOUC 1E4KA 3MOQA 3T8XA 4L8CB 4P23A 4GRMB 1TNMA 2R4SL 2EDOA 2EYTB 4YBQD 5CBEB 2VO5A 3DARA 2O5YH 2DLEA 1A7BA 5E2WH 3ZSTA 2DQIH 3FMGH 4PJ7B 3OTTA 1QTYT 4KJQD 3ARQA 4X9GA 2FSEB 3RTQC 1AO7D 2VLJD 3SBWC 2CR3A 2ED7A 2VR5A 1YEKH 3P9MB 3I6LD 4MAYC 2QTEA 2YD1A 1G7LA 1GZPA 2RCSH 2YUZA 4LAQL 3KPQA 3BKML 3LDBC 3TA3D 5FKPB 2OL3B 5TQ0H 4HUXA 1P2CA 3MV8B 2QADB 3GBLA 1XF3B 3OKKA 3IKKA 4I0PD 4A6YL 4PUBL 5FGSA 4TYUA 2OXGA 5GRVK 2FJGB 4X4ME 1S5HB 3KPSB 3KYOB 3BT2H 4G8IB 1FG9C 4K7FA 3GJFB 1KULA 4C56D 3H6JA 1I9RL 4I3SL 4EN3A 2BVPB 1OW0C 1Q72L 2FBJL 3EYVB 4NBYB 3TPKA 1NEZA 2VDPL 4TQEH 3ZE2E 2HFEA 3KDMA 3LB6D 4ELMB 1VGEL 2HVKB 4MB4A 5D1QB 1OB1B 2OTWA 3VWKB 4DW2L 3VXTA 1H3GA 3BYYA 4JHAL 2MKWA 4JM4H 4Y5VC 4M7LL 1HSAA 1AGEB 3TO4D 4LLWA 3PWUB 4HS8H 1VADA 4XPAH 3MRJB 3MUZ1 4UTAL 2FJHA 1NMBH 4Y2DC 1D5XB 2EZ0D 4JAMB 1CGXA 4HZAA 1WFNA 1CTOA 2JK5A 3O9WD 4LVNB 3P2TA 4PJ8B 3I6KB 4PGCA 3X11A 2X1OA 1IZJA 1FGVL 12E8L 4NN6C 1SM3H 2DQEH 2X9WA 3H7BA 2XWTA 5F88A 3F58H 4JFFE 4QOKA 1T89C 1M05A 1DBAH 4Z6AT 3DV4A 2NW2A 3BZ4A 3GSUA 1J05B 4GLRH 3EHBC 4O9HL 5B39B 3F5WB 5T3ZE 5IJKC 5HDLA 5EIIA 1AXTH 4DGYL 1J12A 1FNGB 1FNAA 1YEDA 5A16B 4MNQD 3RVUD 3ULSA 5IIEB 5AUMA 5IFAL 5CEZH 1MRFL 5IQ9A 4Y4FA 1FV1A 1HQRA 3DVGA 1D5BA 4Z95H 4IRZL 5CGYC 1K8DB 5IGXH 4NP4H 1A4KB 3O0RH 2Y07H 3EKCA 1ZGLP 3LQAH 2GEEA 1EJOL 1VDGA 3F7VA 5DMGD 2VWEC 3O41B 3OXRA 4KK8C 1HHHB 1ZGLB 4XX1E 4MNHB 5IF0B 5EU3A 4ENED 3FFCB 2V7NB 1U93A 1MCEA 3G5ZB 2XXMB 2DRUA 2PTVA 4WI8A 1DLHA 2ESVD 3FB5B 4N8VA 3MNWA 3GZKA 2CPCA 3QUZD 4NQUA 4FTVB 4MXWL 2DLTA 5CKGA 1JMXA 1BJ8A 4QCIA 1XGTA 1AE6L 5CD3A 4TTDD 3DJ9A 3GJEB 4PLJC 2YN3A 4HKXB 1F11A 3LS4H 3QIWB 3NACH 2HT2C 1IEAA 1OAKL 3QNYA 3ILPB 3I75B 2QSVA 3QQ9D 3ZTJH 5IFJA 4PJDB 4XNUH 4M1DH 4WI5A 1UB6A 2J8HA 1CFNA 1A7PL 3LHPH 3BIKB 4G8EA 5BS0D 4U1NB 1T2JA 4U2YA 3GKWL 1X5GA 1TJGH 4X80H 2ZKHL 4OT1L 5GSVA 4UDUA 5T3ZL 4LPYA 3V7MA 4NC0B 3KYNB 3RZCA 4QRQA 5FM4A 5FB8B 3B9VA 2XZAL 3D85D 3U46A 3VD5A 3PUCA 5IOPA 4U31A 2CUHA 2V7HB 3FTGB 1EO5A 1JGUH 4XBEL 2CKBH 1K4DB 2Z92B 1OWRM 2FJFA 4JFPB 3TVMA 1U8PB 4L3AA 4EEEA 1I7ZB 2XZCL 1I7UA 1S5IL 2X1PA 1P6AB 3T0AA 1SY6H 1IQWL 1MI5A 5FYKH 3D2UB 4G3YL 3L7FA 2Q8BL 1NUDA 1OGTB 2BHZA 4FNLL 3DMMB 4GUPB 3VFNB 1BAFH 1TJIL 4O51A 1N59A 4HMDA 1P4LB 5C09B 1T4KB 4TUKH 3CMOL 3O2WL 2A74B 2DKSA 2R2BA 5F9JA 2CXGA 3DX6B 3IU4L 3QUMA 5LXGH 4OLXH 1FZKB 3OMZA 4G43B 5JOPE 4U7KA 5KANI 4PV8A 1UCBH 1A0QH 3HNSH 3DSNA 2W9LA 3BVNB 5EOCH 3L1OH 1ADQH 4PJIA 5I1EH 2VLKD 1I3UA 1CGYA 5JPNB 1LO3H 2VDLL 1CE1H 3M07A 1J18A 1FQ9C 3N06B 3OAZH 4HC1A 5AD0B 5JHDA 1NCDL 3S3JA 1F5WA 4NKMA 2D9QB 5F72S 4Z78B 1I9EA 1ZHKB 3TEUA 5I17B 5KVEH 2FX9L 2ZG2A 4TUJB 4K7PX 4HPYL 2KQNA 4PJBF 4YXKL 1CIDA 3HZVB 2NY2D 5TE6L 3K2MC 5DQDL 3QNZB 4ZS7H 4H5SA 1K6QH 1DLFH 4ODSH 3OKMB 3O6LH 4R8WH 4LK4A 1G6VK 4UB0L 4HQQL 1MFEH 1S9XB 2YUVA 3KPMA 3O2VH 3B9KD 3HFMH 3X3FL 1FO0L 3LAFA 1YNLH 4Q0XL 1ZLUK 3ETBF 3R4DA 1CQKA 4TVPL 4C55A 4D9QD 3VRIB 3KPNB 3DRTB 3IFOA 1U91A 5DEFB 2VDML 3KXFD 4OZFH 3T1FB 3FQNB 4BSJA 3ARVA 1CF8H 3TPUB 3PWNA 2J6EL 2IMMA 4QRUB 4XP1L 3RY6A 1N6QL 3QB7C 3VGGA 4YC2B 4JCMA 4JQVC 1KTRL 3BP5A 3M17B 3DXAB 3MZTA 1S9YB 4UNUA 4XTRD 5FKAA 1ACZA 4WUUE 1CI5A 5F7EL 2CKBB 3VXQB 1TZIB 1KN2H 3TBSB 4DKFH 1N8ZA 2QSCH 2PO6A 3D5OF 4MJIE 4MCYB 3KHOA 3MJ8A 3C8KB 3QI9A 4M7LT 4P3DB 2V6HA 5DUPH 3VD3A 2YRZA 1EMTH 5EFIB 5DHVH 3V6FA 2OZ4L 2J12B 1MH5A 3SO3C 5D1XC 4POZD 1OVZA 3VXSD 1FBIH 2J8UE 1DN0B 5ANME 1SVCP 2Y1VA 5EWIL 3UBXB 3WHE0 5E9DE 2IAMB 1X6NA 3MLUL 4L3EB 1MCSA 4LVOC 4IS6A 5TE4H 2OYPA 4RMRA 4KAQH 3GGWB 1V3KA 1JV5B 3JTTB 4WFED 1DUZB 1P7KA 3S3PA 1IGIH 1U3HD 1YY8B 3D3VA 3D39B 5J6GA 4FQXC 2O61A 4HJGB 4WHTB 3MFFB 5DXWA 4JFFA 4U1KB 1K4CA 4XHJD 3HNVL 5C86A 4CVXB 2H8PB 3RWFB 1OHQA 1TQCB 4W6XB 4OLWL 1JFQH 3VFTB 1J5OH 3P40A 5L8KB 4G6AD 3HB3D 4XCYB 3JWNC 4PR5B 1S3KL 4A2LA 1T04A 3MV11 4D9RE 2VUOA 3JV6B 3MRDB 4JLRB 5I74C 5I19H 3RI5F 5C0RL 5ETUA 1DVFB 4ZTPL 5IV2A 3QRGH 3PV6A 3A6CL 3TT1L 2OTUA 1Y18A 2H2SC 1X3DA 2VN4A 2WAHA 3LEVH 1EZVX 1WEJL 4U6XB 1JWMB 1WT5C 2XOTA 3DWTA 5FCUH 5ESQA 1TJHL 1NAML 3VG9B 2FZ3B 4K23H 2BHYA 5C07E 1DQQB 3ZKMD 2DTML 3QNXA 1G9EA 1F4AA 3HI6H 4F9LA 4XPGL 1EEZB 1JZ6A 3K80A 1WLHA 4NQCD 4QRSB 3C6SB 1IAIM 3L3JB 3W11C 5HVHB 3MRRA 3P73B 2AJUL 3K7UA 2GY5A 4NYLA 3WFBH 4GRMA 2UUDK 3GSQB 2EYTA 4MHHG 5CBEA 3O4OB 1FNSH 3WSQH 5E4EB 3OV6A 3ARTA 3LS5H 1K2DB 4PJ7A 1IGML 2MTPA 1J0YA 1MWAL 4PD4K 3SQOH 3SCMB 1WIOA 3ECBB 2FSEA 4U1JA 4ZXBA 2GHWB 1KJ2L 4HHAB 4P2RB 5DHVB 3MV7E 4K9EC 5F7LB 4ACPA 3P9MA 5H8DA 2WBJC 4V2BA 1GPOH 1BFOA 5DI8A 3S36H 3CPLA 2NY4D 5FKPA 1U8MB 2OL3A 2NY1C 2DIBA 1Q9KA 3STLA 5I1DA 4K3EH 1P9MC 1UXSB 2F54B 3G6AB 4F58L 2C7UB 1I3VA 4OZGB 3F7QA 2CDGB 4HCRL 1D9KC 5E6IA 1XF3A 5FGCE 3C6LB 5AAMA 1QA9A 2FJGA 3WIHA 5JW4Q 3T0XA 3ARWA 3HE6D 1H8NA 3KYOA 2W65A 3UTPE 1BOYA 4Q9RL 4G8IA 3GJFA 5I75B 1KF9B 2NZIA 4Y16B 1RZ8B 2ADIB 1F45A 5E8DL 5GS2D 3STZA 2XKNB 1X5FA 1ZHNA 4X4ZA 2V9QA 1M7DB 1MJUH 4QWWC 1HWGB 4WUKL 3Q0HA 1QFWI 1G9NC 2HVKA 3ARGD 5D1QA 1OB1A 5LWYH 1WIUA 4HFUH 2XZZA 1OAZH 4ZFOA 2CLZB 3C08H 2BXZA 5DYOB 3DUSA 1AGEA 1BHGA 1JRHI 3MXWH 1RHHB 5I0ZA 3NA4A 1EFXB 3IS0X 1XGQB 1D5XA 4JAMA 2CMRH 4NDMB 5KSAC 1T66D 1QR1A 2VXUH 2IAND 3P3YA 3L7EB 3DX8B 4PJ8A 1RI8A 3I6KA 2ERJC 1T0PB 5E5UB 4URTB 4S1RH 5I15H 1MF2H 3D48R 2YPLD 2B0SL 4G80A 1NBZA 1TTUA 3UMTA 3ARDB 5JQHC 1IARB 4HF5L 4L29B 3K1KC 4D94A 1LO0H 4LSVL 1S9KC 2EXYD 3AFLA 1J05A 5B39A 1PG7L 4MQSB 1MCNA 4RISL 1FIGL 3SDDB 2VXVH 4JRYE 3U4BL 1FNGA 5A16A 5IIEA 1TETL 1MFAL 1QKZL 5T33L 3TCLB 2IH1B 5DR5H 3V0WL 2E8ZA 1QNZL 1WAAF 5GZND 1M71B 4OCSL 3UROR 5GIRA 3KJ4B 4J3TA 1JTTA 3DBXA 5LGKA 1BGXL 3RGVB 5DRXB 5EU4B 1FH5H 2V5RA 2J1KA 1HHHA 1ZGLA 5IF0A 2AEPH 1AY1L 1G9MH 4G8GB 2V7NA 3G5ZA 4ZFFB 4WUUA 2VRAA 3VGDA 3FB5A 43C9B 2BDNL 1CLZH 2CH8A 4PG2C 2B2XH 3D87B 1ZXQA 4LSRH 2DQUL 2LU4A 3GJEA 4NFCA