3QHZL

Crystal structure of human anti-influenza fab 2d1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
216
structure length
216
Chain Sequence
b'PVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVSWYQQVPGTAPKLLIYGNNERPSGVPDRFSGSKSATSASLAISGLQSEDEADYYCAAWDDSLNGFWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human monoclonal antibody del2D1, Fab Heavy Chain
publication title An insertion mutation that distorts antibody binding site architecture enhances function of a human antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 49
structure length 216
sequence length 216
chains with identical sequence M
ec nomenclature
pdb deposition date 2011-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qhzL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qhzL01
3P73A 1UM6L 3KPOA 4L3ED 4OFYA 3GK8L 2GI7A 4D3CL 5C07A 3BGFC 2PTVA 2A1WL 1S9WB 2HN7A 3ARQA 4HJ0D 2R1WA 3AXLB 1JI1A 1HIML 1WUNT 3A0OA 4LPVA 4I2XB 1CE6A 4N1CA 2FZ3B 5EZJB 3O6KH 2XTJD 4WUKL 4CNIB 1A6UH 1ED3A 3OF6D 4PGEA 1M05B 2IANE 5DHVB 1A3LL 5D8JL 3DJ9A 1J12A 3BDYL 3GRWH 3ARGC 1A1OA 1AQDB 4X9HA 5F8QC 3IDMB 5HHVL 1F11A 1HQRB 1RUAL 3NFSH 4GG8A 4NKDA 4RIRB 1NDMB 5LQBL 1EK3A 2PO6B 3FQNB 5DTFB 4HV8B 2D0HA 4H8WH 1E28B 2GJZA 2KDGA 4GRLB 4IOIB 1RK0B 1R5IA 4LBEB 5TDPB 4NHUB 4J8RA 2Z31D 4PV9B 4LNRA 1ETZB 2IFGA 2X4PA 2R4SL 2DQJH 3RPKA 1MFAL 5GGTL 1BOYA 2IBZX 3GSQA 2HTLC 3C8KA 4YHPB 4A6YB 3MGOA 5HI4D 3IXAB 4JZJC 1F00I 3QDGE 1KG0A 2E8YA 2HA1A 4PFEA 3QA3B 4KKBC 3DUHA 4U4BA 4M7LT 5AAWA 1K85A 1IKNC 4K3HA 1AXSA 3HLAB 5D7IA 4WV1C 3EJYD 1BD2A 5J9PA 4N0UB 3AB0C 3H3BC 3V4UH 3T2NL 3FQWA 1F4YH 4JKPL 2BMKB 5F6IC 3LDBB 4JGMA 5BJTB 4O9HL 1TZIB 3PDGA 4HWBH 5FB8B 3MLWH 2DIAA 1H5BB 2OQJB 1HINH 1P7QA 1H15A 1A5FH 2OTWB 2XXCB 1RY7B 4GAYA 3SKJL 1J1XH 4KK9C 3V9FA 3ULUH 4NKMB 1V7ML 1U8QA 3MJ9A 5JOEA 3ARYA 3OR7B 2C3GA 4ODXA 2IH1A 2W60B 2JJSA 1HHJA 3SGKA 2W0FA 3WNKA 5HHMD 1JYWA 5AYUH 1AQKL 4PJ5E 4M1CC 4BFIB 4ZSOA 5TE6L 3MBXH 2R9HC 2Y23A 1G1CA 3HZYB 2DM2A 1NJ9B 1RMFL 4OGYL 4U1KB 5FV2A 1RULL 1EO8H 1HH9B 4P4RB 5MERA 2Z91B 4LASL 1OAXL 1MCCA 4NM4L 4NRXA 4G6JL 1B6UA 4GG6A 2XNAA 1R3JA 4IMLA 1INDL 4O5LH 5CWSA 3SPVA 1QRNA 1IEAB 1VGKB 3U7WH 5CD5D 1MHEB 3QQ9C 1J11A 3QULB 4FG6C 4FZEL 2DYPD 3SKOB 1VENA 4OF6A 1CT8B 5IJKC 4GS7C 4KAQL 3RVXD 3N50A 4EBQL 1N7MH 4H0IA 2AK4A 3EHBD 4X7TA 3V0AC 4BFEA 4UQ3B 4UT6H 1AY1H 4YHOL 1U8MA 5EZOH 3MRHA 5DR5L 1T5WA 3SBWC 1N0XL 1X5IA 3SDXF 1QFHA 2XXMB 2OJZH 3TA3D 2DLFH 2X4QB 5LCVH 1KJVB 1ZK9A 1MAKA 3MRIA 4YO0B 4PREB 3UC0L 1Y0LB 1XGRB 4JFDA 1SVCP 1WJ3A 4OLVL 3NA9H 2Y06L 3DUSA 4X7CC 1UXWA 2CJUL 2AJSH 1IFHH 1OHQA 4NUGH 4AIOA 4UB0L 1C5BH 4KKNA 3OAYK 1R3KB 4Y19A 4B41A 1F4WL 4GBXA 4JANA 3ARUA 4JKKA 4HH9B 3AY4C 3IJYA 1QLRB 1L6ZA 4R0LB 4OQ1A 2VXUL 3QIBD 5KANG 3G5YA 5I15H 2AI0H 1XGYH 2YUZA 4PRIA 3DIFA 1DL7L 3ULVL 2FB4L 3W81A 3TT1L 2P46B 3VXRA 5GGSA 4Z7WB 3O81A 3WXVL 4XWGL 2GUOB 1DN0A 1BBDH 3OG4B 4ENEC 3L1OH 1PY9A 2FEEL 4XPHL 3A67L 5I0DA 2ADGB 3D18B 5D2LF 4OM1H 3KGRA 3O9WD 1RHHB 5DWUH 4E42A 2ICWJ 3MJ8A 1OQXA 1CFNA 1TXKA 3P77A 2VQTA 2VH5H 1QNZL 1TZGL 25C8L 4QGYA 2ZP0T 2FDBP 4AEIL 1T22B 2XG4A 2VXSL 4IDJL 1S7WA 4FFWD 2UWEF 1FFOA 4K7PX 3QI9B 3KNBA 3PNWB 5BMFL 1RK1B 2YXFA 5D70H 1XF3A 1ZSDA 1B0RA 1JE6A 3MRRA 4BZ1L 1ND0A 3ZZ1A 5IB3B 2SEBA 1MY7A 3MBEC 3CFEA 1KLUA 4O2EB 3QB7C 4R4BA 2A83B 4HCRH 5E6ZA 3U30B 2ICES 4HZAA 5I73C 3V6BR 4MCYB 4CW1B 4NDMA 2YBRA 3S34L 1HYSC 1VADB 1S8DA 1CE1H 1AGEB 4U6VH 5L2KD 4PJDB 1WT5C 3BGMA 4OCRL 4CVUA 5E9DB 3U6RB 1LEGA 2AW2A 3H9SD 5TE7L 5DVNA 3QIWB 2DQEL 4ZXBB 4RSVA 2ERJC 2DWDB 3C09B 1Z3GH 3LEXA 5DQ9A 1DQQA 1F4AA 4UQ2B 3IJSA 5C0NC 5DUBA 1A6VH 2NMSA 2A38A 4XVUD 2O61B 3SCMC 3OJ2C 1GGCH 3LKNA 5FYKE 5ILTL 1ZT4A 3Q0HA 3B5GA 1E4KA 1OB1A 3WJLC 1CQKA 4L8SC 3I50L 3E6FA 4MXWL 3JTTA 1KLGB 3TVMC 1RUKL 3S96A 1U8IA 2IG2L 4XZUB 1U58B 2DLTA 3PP3H 1N6UA 1OAQH 4G6AC 3RU8L 3VI3E 5IEHB 3FCTB 5T3ZL 4OI7A 4HSQA 5J3HC 3DYPA 1WCQA 1LP9E 1BX2A 3D85B 3MFFA 1CXFA 1I9JL 1EEZA 1TMCB 1UC6A 4EUPH 5GS1A 5MHSD 4L8CA 5DJYA 3L5XH 2HJLA 4NNYB 4G8FB 3SGDH 3BX7C 4JDZB 5C08E 4Z5RB 5HYJA 4JREB 1S9KC 2HT2C 2F8XC 1A3RL 1X5ZA 5L88H 2R8SH 1UM4L 3HAEB 2R2HB 4YK4B 5IGXL 5IT2L 4NC2B 1ACYL 2VC2L 3BPNC 5JO5A 1ULVA 1Z5LA 4PJXB 1SEBA 1BZ7A 5D1ZA 4MNGB 4M4RA 4JQXA 5E6IB 4MQ7A 2E7BA 5DJ8A 1I7UB 2LVCA 1Q9KB 1V5JA 4RDQF 5JR1L 1QFPA 3RGVB 3DVIA 3TNMB 1BFVH 3MRKA 1NGYA 1FH5H 1FORL 2NY4B 1CICD 3BUYA 3WFCL 2FEDD 3CFCL 1GPOL 1TJHH 2F58H 3T0EE 4PJEB 1VERA 1WZMA 2CQVA 1G9MC 3ZSSA 1HCFX 3Q5OA 1H3VA 5GZOD 4O02L 2XWTB 3IDUA 4DZBA 5JXAH 4X6CB 3LHPL 4PS4L 3S3PA 3PXJA 3BSZL 5MENE 4WEBH 3V5DB 1MVFA 3H42H 2Z92B 4KDTC 4XHJD 3SKMB 1X5KA 4F37K 1HH6A 3MOBL 3OR6A 4NYLA 3CGTA 5E2WL 4PTUA 2ITCB 3CC5B 3QFDB 1QHOA 4YDLC 5CEZL 4MAYD 5HXMA 1OCWH 4MVBC 1YMHA 1T66D 1PDKA 1P2CA 1MIEL 4I0PD 1CFSA 3QIUA 3RWJB 2EIZB 3GSNL 3QUML 1FZKA 4LEXL 4YXHL 2QL1A 4WI9A 5A2IH 3FQUA 2DTSA 4QRTB 3BT2L 1VFAA 2QR0A 2OR9H 4KMQA 5TF0A 4DEPB 2HJFA 5JDSB 3F58L 2XN9E 4X7FC 3WEXB 2OTPA 4HIXH 1T04B 1P4IL 1YN6A 4XPGL 4N1EA 4NQDE 1QSFD 4UT7L 3N85H 3QDJB 3SY0A 1MCLA 5IESL 4CKVX 4FQ2L 2Y72A 3V6ZB 1E6OH 1U3HC 5ETUA 3REVB 4U1IA 4NQED 4X6DB 2AJXL 1TCRA 3NCFB 4XNUL 2R0LH 2BOCA 1W72H 4LSTH 4KTDL 2CMRL 5B39A 1W0WB 5HHXH 2H3NA 3FN0H 1KJMA 4DGYH 4UIMB 1SYSA 1CFBA 4P2OC 3ZL4H 2Q1EA 2EECA 4PGCA 1OAZL 1TLKA 3QCTL 1DVFB 4U6YA 4L4TD 2YMXL 1JWUB 3Q6GH 5ADOL 4HJGA 4AL8L 2R2BA 4TOYH 5JW4M 1Q0XH 4AJ0A 4CVZB 4YBQD 4WW2F 2NY3B 2F9BT 4H1LG 5IF0A 2XZCH 1S5HA 3Q1SH 4PJ9B 4POUB 4GUPB 2ARJB 4NZUH 1BZ9A 1JK8A 4OI9A 4OFYD 2YWZA 3O3AA 4UNVA 5C07D 4HZLA 1YDPA 3QYCA 3ILQC 4FTVE 5ICZB 3K3QA 4KHTL 1Q94A 1K4DA 3GO1L 3I3DA 1NAML 1FGVH 2X42A 4GKSB 3WD5H 4EQ2A 3KYAA 4U6HB 1IGYA 2C1OB 2BJMH 4XVJH 3RY5A 4FABL 1FDLH 5LWYH 3D0LB 1P7KA 1J8HE 3RP1A 2DI8A 2Q6WA 2EICA 1U91A 1NKRA 5L9DH 4PRAA 4FFZH 1N4XL 1MHPL 3PP3K 1DLFH 4HCRA 1CS6A 2YD3A 1A1MA 3V0WH 4HXBH 3BH9A 5C6WH 2DLEA 1OF2B 3ARDC 4PJ7B 1RU9L 4YGAB 3O45A 4LHUB 3BFOA 5F21B 4ZOAA 1HSAA 1L9NA 4DFIA 2QQKH 5FO8B 4OIBA 4MJ4A 2V17L 1EA9C 3M1BA 3MRLB 1A9BA 5T3XH 4MJ5B 2XWJA 5C0CB 3AAZB 4HKXA 3MRPA 1X4ZA 4KKAC 1NC2A 3D87B 3KVQA 3RPIA 3LKPA 4XRCB 1PVHA 2MMXA 3GB7B 5BW7A 1JV5B 4MAUL 4Q6YA 2CLVB 4XC3H 5CJOH 5K93A 1G7PA 1P7HL 3TZVA 5MEQA 3KXFA 1HZHL 2VQ1A 4NKIL 1NMAH 4DUXA 1NFDE 1T1ZA 1ZA6B 4OCSL 3LRSB 4R90L 1D9KC 1BD2D 1CFQB 3C08H 1JZ4A 3MXWL 3UJJL 1A7OL 1UACL 2B4CH 2X05A 4WFED 4Z7UE 4Y5YB 4Y4HB 5F1IB 4MDJB 1MFEL 5I1AA 1YMMD 4ODVH 5TQ0L 3BISA 4XX1G 3ZT7A 4X6FB 1BGXL 1P7QD 1TJIH 2Y36L 5I1HH 1YMME 3FL7A 1DR9A 1NEZG 5IB4A 5DRXA 4EN3C 5ESQB 3S4SB 1OAUH 3QUMB 2CIKB 1YEGH 4K9EL 5DRNB 4NO0A 1S7XA 2XICA 4F7TA 4DTGL 3VFMA 3N1QC 5E2TH 4JGJA 5DF0A 4P2RE 2JJVA 2XY2A 3NZ8B 1T2JA 3VG0L 5L0QB 4GKZA 4JFQA 4BSWB 2OTUB 3MYJB 4WGWB 3I2CH 3MGTB 2NXZD 4H1LH 3WHXB 1KCUH 1XF4A 2WIMA 3PJSB 4M62H 4LEOB 3EJZD 1NLDL 1JPGA 3TEUA 5C7XL 3GMPA 4KY1L 2CLZB 2YD9A 2J8UA 3K0WA 2VN4A 2XQBL 1CDGA 4Q6IC 4D0CB 4YPGA 3PQYB 4NWUH 4YFLI 1QRND 2CLRB 1T0MA 3IVKB 5CBAB 3O2DH 3G6JA 4MCZB 4ODSL 4PJ8A 2Z35A 2NX5E 3GSXB 3TN0A 5ALBL 3UROR 5C86A 5ANMB 1Q1JH 4HX1B 1S7SA 4YHYC 2FGZA 4F57L 2UZIH 1AC0A 4I48A 1WAAF 2WINA 2V2WB 2YD8A 2AK4D 1T03L 1RVFH 3PP4H 3UPRA 5AYQA 1A47A 4QRSB 4JHAL 4YEEA 3QUKA 1YEKH 5CEYA 1U95A 4AG4L 1BAFL 4YHLL 4M7KL 2VDRL 4F9PC 2VLKB 4Y4KC 3GFUA 3VXPB 3MV8D 4EI5A 4LKCB 5C0RH 3A6CH 3ZSTA 5A2JH 1MCDA 5HYSA 3VWJA 3UDWA 3B4NA 3HR6A 4JFDD 3DGGA 1U8JB 5C09E 3RAJH 2JF1A 5E99L 1NCCH 2DMKA 2EYSA 3IDYC 2W07A 1MRFL 2ZPKL 3MNZB 1G9NL 2P48B 4Y19D 4M8QB 1TQBB 3CFKA 4D0DB 3FRUB 4OJFL 4GBXD 4S1RL 1GAFL 5JZ7C 3O6FD 2VDMH 4ZS7H 4GAJH 2BRRH 3ME0A 3SKNB 2AJ3A 3HMXL 3PWJB 5T5FH 2EYRA 1SJEB 4PRID 4PUBH 3K8KA 4X6EA 2COQA 1XH3A 1KPRB 3VXRD 4RAUA 4X6BB 4HS6B 1X5XA 1TVHA 2WSKA 1UXSA 2Z9TA 4X99A 4TUJB 1U8HA 5ITBL 4C56A 3TBSA 5IK3A 4LVNB 3QEGL 1GGUA 2YPVH 4TPRH 1UB6A 1BQHB 5F44A 5INDA 3TO4D 1YJDH 2PN5A 3ULSB 5I1IH 1CN4A 2A74A 2XIDA 4XNYL 1MREL 2YKLL 5I18L 1P1ZA 3RY4A 4HUUA 4XVSL 4DKEH 2C3WA 3BWAB 5CGYC 1KXVC 8CGTA 4XAWL 3VU2A 5D5ME 4F15B 3T3ME 3L6FA 1AD0B 5IW1A 3HFML 3VFRA 1MJ8L 3PWUB 4DK3A 1QA9A 3QDME 4HK0B 5FOJA 4OZHE 1MFBL 5DHYA 3C8HA 5HGDB 5MI0B 1PQZB 1DSFL 2WIIA 2YA0A 3GMQA 5E08L 2F5BL 3TYFB 4ZNCD 3QNZB 4QWWC 1AGDB 4Y7MA 3KYKL 2VJXA 2DM4A 4RISL 2FJHB 1RPQA 3OKMA 3VMPA 1U3ZA 1YZZA 4Q0XH 4MJIE 1TITA 1UJTA 3OXRA 4DGIH 3DO3A 4G8GA 1DEEA 2HG5B 4A2LA 5GJSL 4OB5H 2GSGB 4G7YL 4PJBE 5CCKH 4X83A 5CAYB 5DJDB 1JNHA 3U0PA 1HWHB 3ARVA 3T4YA 2X89A 1XZ0A 5KG9A 1D7FA 2FBJH 2B0SH 4YX2L 3VGAB 5TFSL 2BVQA 4Q9QH 2HTKD 1JFQL 2F8VA 4ZOCA 3ZHKA 1QSEB 2NY5H 3PV6B 5E1HB 3QUXC 3TIDB 2JIXA 5GSVA 1H3XA 4NZJA 3ULVF 4EDXA 1X4YA 5GXBB 1DBAH 4ORZC 4OBSA 4YQXL 3W0WE 1JRHH 4NCC1 9CGTA 4YGVB 5D2LB 5ERWB 5ELIA 4JHWL 2NNAB 3KPQA 3U9UB 2BNRD 3GSRB 1A7BA 4NWTL 2BNRE 3WS3B 5D1XC 4X8JB 2A9NH 3RNKA 3CNKA 2QHRL 2FIKA 3ARXA 3HPLA 3KPSA 5D6DA 4FQLL 1UWGH 1N26A 5F7MC 1D6EA 3W39A 3S36X 1A6AA 3PL6B 5FGBC 3D0VB 1MWAH 1T2QH 3HC4H 4J3SA 3VXSE 4RGNE 3NFPA 5GGUB 2PXYC 2VLRB 4DN4L 3EYQC 2HH0L 3BIAX 4ONHB 3EO1B 3N0PB 4GAGH 4ZAKA 4P5KB 3BQUC 3KWWB 2NY7L 4ZUWA 1XFPA 1A4KA 3L5WA 4AIZB 4Y2DA 1RUPL 4JG0L 1KB5A 2OSLA 4P99A 4ALAL 3NVQA 1FNGA 2QKIA 3AM8A 5EOCL 3MV9E 5EC2B 2HFEA 4OCXL 3T1FA 5TQ2L 4D9LL 5HY9B 3RKPA 2KL6A 3HE6C 2I9LB 2YPLA 3OB0K 4JFPB 4KJWC 1LILA 3QNYA 4LLMA 2PYEB 4Z76A 2HT4D 4PGBB 3ARPA 1JPSH 1MRDL 4OIIL 4UUJA 2GK2A 3O8XA 3V6OA 4HJ0C 1NCDL 1MCBA 3B9EA 1IM3A 4W81A 3EOBA 4H1LA 1FNEA 4J3TA 2IANB 1VACB 4HDIB 3E0GA 4MYWB 3IS1X 3RKDC 4UDTB 4KWUA 3P4MB 3OKOB 5T1LD 2BSTB 4JR9L 5FGSA 2DBJA 2ZCLH 3UZEA 4P5TA 3V4VL 2AERT 3RDTA 3VRIA 2VLLA 3C6LB 5GISL 4XHQA 2AJUH 1N2RB 3BHBA 3MX0A 1DBBL 1FQ9C 1RURL 2IADB 2VITA 3F8UB 3OKEB 1EO5A 2FO4A 3IFPA 1ZT1A 1F58L 2C3VA 3ARWA 5HGHB 1ZVSA 1HOCB 3NPSC 5I9QB 3T0DA 4QRPE 5C0DB 1AO7A 2X4OA 4OCLC 3FT2A 1QKZL 2YA2A 5DD6B 3QDGB 2RR3A 1ORSA 5HI4C 1I1YA 4BQBA 3CDGA 3SE9L 3LS4H 5D7JB 5D93B 2NLJB 1XCQA 1SBSH 3EO9H 1FYTA 1K8IA 4Y5XA 4X4XA 2QSQA 2VXVL 1L4IA 1X5GA 4HBCL 2D03L 1ZT7A 5L2JA 2NZIA 2DKMA 2L0DA 4D8PB 5J1TC 1YNLL 3D39A 1E4WH 3VA6A 4G5ZL 2CIIB 2P4AB 4P57A 5KW9H 3R1GH 4I3SL 1G7QB 4ZDHA 1BEYH 2J4WL 2VDOL 1A7NL 3VXQA 4I18A 5I66B 3CPLA 1SMAA 3L3JB 3S36H 4LLAA 4NO5B 1WZLA 1N5YL 1VPOL 5MEOB 4KRPC 1GH7A 1V7NL 1RIHL 3UJTL 1NMCC 2W59A 4M43L 4P0DA 4GMTL 4HJJL 1CG9A 4YUEH 2G75B 4U1LB 4LCCB 3MA7B 4YPJA 4S0SD 2AXHA 3IB4A 4QRQA 4UILH 4JE4B 4AQOA 1GIGL 2N1KA 4JJ5B 1AR2A 1JWMB 4PJ5B 5K9OA 4NBYB 4P2CG 2ATPB 2BSSB 4UNTA 1NEUA 5FCUL 3L3IA 1R5VA 2HWZH 5HHOA 4MHHI 4MB3A 5IVNA 1GOFA 3R06B 5IROA 4WWKA 1NEZA 5EZLB 1PGRB 5GRUL 3HG1A 1LO0L 4K3JH 3B9KA 2FGWH 1W0YT 2J2ZA 3ALXA 5F6HJ 4CL7A 1IT9L 1OAYH 3ZE0F 3ZDYE 3O3BA 5H37G 4ZQKA 4R2GD 1IAKB 1KFAH 4QRRA 5JXEA 1ZHNB 2P8PB 4J7RA 2XA8H 1EHAA 2J7LA 5E8OA 5LAXB 2WWMD 5D5MF 5KSBF 1OP3K 1QFWH 2WUCH 3OGOE 3QXAA 4FP8L 3L95B 3QUZB 3QEHA 4K3DL 3V79C 3TV3H 2C9AA 3WN5B 1WTGT 3AS3A 1X7QB 4HFWB 4OZHF 1GHFH 2ZUXA 3BGFB 4OCNC 2JB5H 1QTYT 3LN5B 3T0WA 5CEXB 4H26A 1BQLH 3PIQB 2NY0C 1MH5B 3QAZC 1FZJB 3I6LD 4DCQB 4WEUD 4BA8A 4AQ1B 4EI6B 5DYOB 3TA3C 3ARGB 3G04B 4K8RD 4LK4A 3JWOC 1Z0MA 1CDCA 3GSVB 2BFVL 4PP1C 4WW1B 3WJJA 1G6RA 5IG7B 3WIIL 4LPUA 4PRHD 4XCYA 4KK5D 1IL1B 3MRFB 1NCBL 3HC0B 1ZXQA 5I8CB 5KN5A 3CZFB 4ZPTA 2EYTB 5IQ9B 3C60D 1HI6B 3HN3A 5F97E 1RFDH 3TZVD 3VH8B 3KXFD 4N9GA 4R9HA 2X41A 4KV5F 4PJGA 4F7PA 4LLDB 3VFVB 1U8PB 4KKCC 5AWNH 4LIQE 2Z4QA 3DPBA 4MXQD 4HQQH 4NSKB 4E41A 5JLZB 2DQUH 3EUUA 2MPAL 1A4JA 4LDEB 3DROB 5I17B 1KGCE 5MEPA 3E8UH 1DP0A 4HHAB 4J23A 2VDLL 1S7TA 2FX8H 3CXHK 2VUYA 4L9LC 3CVHL 4WV1B 4NO0D 3C5SA 4LLQB 4JY4B 1INQB 4KMTL 3AB0B 1NCUA 3QISA 2VDQH 1QR4A 3UTOA 4MA1C 3FO0H 5F6IB 3BP4B 2EDBA 1PG7X 5BS0E 1DQLH 3BP5A 1UM6H 1FIGH 1BREA 1CDBA 3MCLL 1TIUA 2ADIA 2A1WH 2PUQT 5EPMB 4PRPE 4GRWF 3H0TA 3TPKA 2CXKA 1CLCA 4X7SH 4LQFL 3IGAA 2PCPA 5H37H 3FOLB 1YPZA 3S5LB 3L3OA 1XGUB 2PYFA 3DRTA 2YPKB 1U93B 3TN0D 3FFCD 5HD8C 2FX7H 1EJOL 5D9SB 4M9PA 4V1DA 3BDYH 2EDYA 2R69L 2GITB 4RZCA 1T6VN 5KOMC 3T65A 1RJYB 1A6ZB 1X5HA 1ZGLP 4KK8D 1RUAH 3DARA 2ITDB 2H26B 4GSDL 2CKBL 3QCVL 43CAB 4QRUB 1DQJA 2R4RL 5A1AA 5ID0A 1B4RA 3HRZA 1JGEA 4EI5D 3MFGB 3DX6A 2R2EA 3VXME 4X4YB 3QH3B 4IIQC 2W0LA 5GGTH 3VWJD 4PY7B 1WCBB 4LLYA 4TNVF 1FFPA 4L3CA 4N90D 4I8DA 7FABH 1T7WA 3BO8B 1PD6A 3CK0L 5GZND 4LLUB 1RQ5A 4QLRA 4NO3B 4MNQE 5IMMB 2A0LD 3G5ZA 4QTHB 5BVPH 1WISA 2NY1D 3VA2C 4F7MA 2J12B 2ZUQB 4NN5C 3BEWB 2AJZA 4OZIA 3NIDF 3RX7A 1SY6H 4QHNA 4S0TD 1G9EA 4JM2A 1LP9B 4JKPH 2CO7B 2X7LA 3K8MA 4FQQA 5DVKA 1RIUL 2IPUG 1FNHA 2OL3B 3SKJH 4AT6A 2DQIL 1LD9A 3MRJB 3GGWB 4JRYE 1QR1B 4C83B 4EDWL 1N5AA 2K9UA 4B0MM 3CFBB 4U1NB 4ODTL 5DQDH 4C56D 5IWLA 1R5WA 5DJ6B 4BKLB 1T0NB 3VFGH 2ZCKL 1HXMA 5E2UH 1S9WA 5E7BA 3UJIL 4F7CB 1MCSA 4D9RD 1W0VB 1IC5L 5F96L 1BQSA 3AXLA 5F7EL 4I2XA 2EEBA 5TE6H 1J7VR 1JTPA 2FZ3A 5EBMB 1AR1C 1M05A 5DHVA 2KUTA 3O11B 4LASH 4N8CL 2I9TB 3JV4A 4G6JH 2ZJSL 1AQDA 4I4WB 3IDMA 3NCMA 4G6FD 2D7PA 1IKFL 5LGJB 1HQRA 2VN7A 4RIRA 1CICC 3T0EB 4RMTA 5IBUB 2PO6A 3FQNA 4FZEH 5DTFA 1HEZB 3KLAB 4HV8A 2X4TB 1E28A 4OF5A 4GRLA 1JF6A 4IOIA 4OLWH 1RK0A 1X5FA 4LBEA 3HNVH 4NHUA 4Y5VC 1ETZA 5CILH 1JHTB 3LPGA 3HE7C 2WBWB 2P42B 5GZOC 4DWHA 5I71C 5MENB 5JHDE 4QCIB 1QO3A 5DR5H 3IXAA 4S11A 4S10A 2EH7H 1NGPL 1I9IH 3QCUL 5J12C 4JPWL 1MCHA 1D6VL 4X5WB 2IFFH 3D25B 3QA3A 5I73B 3MCKB 2WBKA 3N9GL 4HUMB 2X89D 4ORGB 3VXTB 3HLAA 1T66C 2RFXB 2NQCA 4JY5L 2CRMA 3KS0H 1OW0A 4N0UA 4Q9RH 5I76B 1I1FB 1B9ZA 1PG7W 1QLFB 5BJTA 1PKOA 2BDNL 4LQ1A 2JIXD 1JI2A 5D7KD 1H5BA 2OQJA 1JF5A 1TENA 2OTWA 5DD0H 2ZUTA 3KG5A 5ACMA 2DIJA 4NQDB 1I7RB 4NKMA 2VXUH 3P11H 1OT1A 3NFNB 3VG9C 2V5TA 5IBTH 4GQPH 4G9FE 1HN1A 1G9MH 2W60A 1DL7H 1J0HA 4LLWB 3ULVH 5CJ8A 5HBBA 3SCMB 3TT1H 4XP1L 1G0YR 2O5YL 3JV6A 5HPMB 1M71B 3SDCA 3WXVH 5FYLE 4XWGH 4BFIA 1I8LC 1DTUA 4RMVA 3NCJH 4RAVB 4L8SB 2XKNA 2JCCF 3HZYA 3MODL 4XPHH 3A67H 3C5JA 1NJ9A 4LF3B 3KPSD 3TVMB 1NQBA 1JGUL 4ZTPL 4G80B 2Q7NA 4RA0C 1EX0A 4KUCD 1VGKA 5ITFA 1QNZH 1TZGH 2MOVA 1IGJB 25C8H 1A3QA 1MHEA 1UB5B 1N0LA 2C26A 4WI6A 1T80A 4AEIH 4ZAKD 4RMUA 5GHWL 4GXUN 3FO1B 2DL2A 2QV2A 4IDJH 1CT8A 1DBKL 3SDAA 5TPWL 3OZ9L 3KLDA 4Y2DD 2JK5B 3TCXA 5LGKA 5BMFH 5BOPA 2ORBL 4TVPE 3D69B 3RVWC 1UCBH 3BPNB 4UQ3A 5KSVB 1UWEL 2YPLD 3GSOB 4RX4A 1EUUA 1YEHL 3GZKA 3RL1B 1KJVA 3RX8A 4YO0A 4LOUC 3S34H 4PREA 1LO4H 2A9MH 3BE1L 3O8XD 4OFIA 1J1OL 1XGRA 1INEL 5KAQF 1MI5E 3DVGB 1CTOA 2Q8AL 4ZODA 3MRGB 4OFVA 1QD0A 2D7TL 2DQEH 1WFUA 1HSBB 2E7CA 2IALB 1J8HB 1EFXB 3S4SG 3UP1A 1NBQA 2VZ3A 3I85A 4HH9A 4M7JL 3CDFA 1QLRA 3S35X 4R0LA 5ADPL 1FNFA 3RDTD 3MRQB 5C0FB 1KTDB 2V9QA 3SO3C 5ILTH 2DJUA 5ALCL 4Z7WA 1A1NA 5CGMA 2WV3A 3ARTA 3I50H 4ELMF 3B2VL 2IPTL 2GUOA 2APBA 3OGCA 5DJXB 3CXHJ 4NP4L 4YDLB 2B8OT 3MLZH 4ZFZB 1RUKH 2OS7A 4JPVL 2IG2H 2ADGA 1AO7D 3BZDA 3D18A 2E9IA 3RU8H 1RHHA 2LAAA 3P0YH 1G7HB 1WWWX 5T3ZH 1XGTA 1SJHB 4C4KO 2GTZB 2WBJA 2OCFD 1I3VA 2QSCL 5C3TA 3LD8C 4Z7VF 1OT2A 5GGTA 4ZOEA 1NFDB 2VAJA 4U7MA 4J3XA 1JUFB 3P40A 4FQHB 2YSSB 3SN6N 1G7JA 2C1PA 1UM4H 1O5DT 3D39D 5E03A 1R3IL 4XXDA 4YHKL 5HI5D 3PWPE 1RI8A 5IGXH 2VC2H 1RK1A 1U3HB 3UX9B 1FO0L 5IUSA 1AFVL 1X5YA 3EOTL 2DIBA 1QPPA 3KYOB 4OCYH 1TDQA 1TQCB 3ESVF 1J10A 3LEYL 5IW6B 2A83A 4RQQB 4JDVB 4O51B 1F6AB 4CW1A 4MCYA 5JR1H 3RWEB 1I85A 3S88L 4P2OB 5EN2B 2JJSC 4KUZH 4NT6B 3DI2B 1FORH 5FYJE 3SGKC 5HDQL 2Z93B 1Q9OA 5D2NC 1K4CB 3CFCH 1GPOH 4H0HB 1CQYA 3U6RA 4WWKD 5FUOL 1G84A 3HG1D 1X6LA 3QIWA 4WI4A 5BVJA 5KVFL 1NAKL 3BJLA 5D7LB 3N06B 4ZUTB 4QRRD 4UQ2A 4XBEL 5JXED 1OTSD 3QRFM 5KVDL 3BSZH 2NX5B 3BPCA 1HNFA 2O61A 3W11D 3ECBB 4DFHA 2YHGA 3MOBH 3GMLB 5J4MA 2AV1B 1NANI 5E2WH 2XZAL 3L5IA 5SWQA 3WO4B 4HKZB 5LGHL 5CEZH 1BWWA 3LSOB 4AEFA 3O3DA 3W82A 3QJHB 3RHWF 1MQ8A 1NGXA 1FNSH 3V52L 4AMKH 3VE0B 1BQHG 5DEFB 3WE6A 3GSNH 2H9GA 2FLRT 3S35H 2HFGH 1I7TB 2ZSWB 3FCTA 2DS4A 2B7DT 4L9DA 5EO0A 4ERSL 3NGBC 5F1NA 4MJ6A 2Q3ZA 3SGJA 1GVIA 1CDYA 5K59E 1P4IH 4JDZA 4XPGH 3DX7A 4Z5RA 4UT7H 3WUZA 5IESH 5LXGL 2DJSA 3HAEA 4I3RH 2GJ6A 2R2HA 1QLEL 3BVNB 5SWSB 2F54B 1YYLH 2NTSP 5IB2A 3QO0B 2BVOA 4LSDA 5HGAB 5DFVD 1DQDH 3ARDB 4PJXA 4Y0GA 5D1QC 1JF1A 4NNPL 4KTDH 3MA9L 2CMRH 5DURB 4GBXC 1B6DA 1C16A 4NN6C 5E6IA 3C6SA 1I7UA 3KPNB 3J8F7 1Q9KA 3C2AL 3OAZK 1RZJL 4E41D 5C0GB 5JIIA 3RGVA 3TNMA 4KFZC 1URLA 3IDJB 3FT3B 5SX5H 5EUKB 1XF1A 3GBML 3FO2B 4POZC 4AL8H 2CDFB 2OM5A 4PJEA 1NCAH 1DDHB 5DI8B 4D94A 2VLMD 4LCUA 4WFGE 3BYYA 5EU6B 1D9KB 1JZ6A 3EFFB 3MJ7B 4XAKD 2QADD 2XWTA 1P4LB 4NCDA 1F02I 3WKML 1AXIB 1QBLL 4P3DA 4X6CA 1NCWL 5FKAB 5IHUH 5D5MB 3UAJD 5FGCE 2NW2B 2B1HL 4PRDA 4EN3B 1WIUA 4PJFF 2Z8RA 4N8VG 1RZ7L 3QXUA 3QDMB 3QFDA 2HFFB 3QG7H 4OZHB 5T33L 3LN9A 5F7YC 1IAOA 1YEJL 1ES0B 1MCWM 1NAMH 1MCIA 2FCBA 5D6CB 1EVTC 3R0NA 3HZMA 3O4OC 4QXTB 4M5ZH 3RWJA 4ZNEA 2EIZA 2MNUA 4XPBL 5E00B 3V5HA 3WNOA 5D2NE 5C0AA 4QRTA 3D3VA 2VSDA 4FABH 4WHDA 3VFWB 4GRWH 4G42B 4G9DB 3RL2B 5JDSA 3WFEL 3B2UC 1P6AB 3WEXA 1F4XL 1T04A 4MLSA 3TIEB 4MNHB 1EBAA 3QDJA 1MY5A 3AREA 1MHPH 2NTFB 3V6ZA 3ILPB 5EB9A 4PJBB 1RU9H 3MUGB 2IQAB 2CDEB 4YHYB 1F6FB 5FFLA 1IGIL 1W0WA 3E2HB 5E94A 3KAAA 2V17H 4Q2ZB 4TTDD 5J11C 4UIMA 1H8SA 4FFVD 5DT1L 4LSRH 2HTKC 2D9QB 5JOFB 4MAUH 2OX5A 3STLB 1DVFA 1IM9A 4XPAH 1E4KC 2GCYB 3RVVD 4NKIH 1JWUA 4G8EB 4OCSH 3HI1B 2N56A 3OKNA 3MXWH 3UJJH 1UACH 4IRZH 4CVZA 5C2UB 4JM2D 3MJGX 2RCSL 3L3GB 1A9EB 4H8WC 1DUYB 3BZFA 1F90H 3RWHB 2OXGA 1XR8B 2AJVL 3IDYB 3MLTB 3PHOA 3LAFA 4PJIE 5EORH 5GS1C 2GW5A 5F72S 4JJHA 1YYMH 2ARJA 1CCZA 1CGVA 2ZUSA 1QHPA 4OZ4B 1VKXB 3VXSB 2R1XB 4RGNB 1MCNA 5EUOF 4ZD3L 3VG0H 4J3OC 3C5ZB 2A6DB 1Q8MA 1BIHA 1JMXA 4XWOD 4U6HA 2W9LA 3ZKNC 4PB0L 4Z7NE 5D1ZC 2C1OA 2R0ZL 4JQXC 4GRMB 3RTQA 4LSQH 1NDGB 3SGEI 2X2YA 5DD1L 4BELD 2CD0A 3D0LA 4KY1H 4OD2B 3MV9B 1MCRA 1F45A 1HE7A 1IGCH 2G5RA 3EDDA 5I1JL 1WEJL 2V9TA 1AE6H 1CD1A 1KCRL 4ODSH 2PO6D 4Y4FB 3UYPA 4W68A 1J0KA 4ONFL 3UTTA 3FQXB 3OHXB 4JFOA 3ULUC 4GRLD 2ICWI 3PGCB 3QDAA 2B39A 5A16A 3F7VB 4PJ7A 2CK0H 1H3PL 1T1WA 4U0QB 4UU9B 3RUGF 4F57H 3OKYA 3FT4B 4HF5L 4K71C 4PJAF 4WTZG 3HUJF 4L5FL 4PP2B 5F9WC 5FO8A 1KN2L 1T03H 5FK9B 3BGAA 5J89A 5C6TH 3QZWG 4LIQL 3I02B 4MJ5A 1NL0H 1UQSB 5C0CA 2DWEB 3AAZA 3OQ3B 5IVXA 4AG4H 1BAFH 4YHLH 2DD8H 4M7KH 2H8PB 2N7AA 2WAHA 4KH2A 4XRCA 2WNGA 1Y18A 1JV5A 2CLVA 2D0FA 3OX8B 3DX9B 4HXAL 4LRNH 1T6WA 1OSPL 4OUUB 1Y6MR 3LRSA 1KULA 1MHHB 1CFQA 1G7IA 5IVZA 3QIUC 5E99H 3FQRB 5F1IA 1DBML 1ZEAL 2VKWA 2I26N 1CGWA 4MDJA 1I8IB 1G9NH 3CIQA 2ATKB 4OJFH 5SX5K 1GAFH 4QO1A 3THML 1LNUB 3S4SA 5LKNA 1VEPA 3QUMA 5FUCC 2CIKA 1G6VK 1JYNA 3HMXH 2Y6SD 5DRNA 2KH2B 1WZKA 4P9HL 4OFPA 5EOTB 2EEDA 1I75A 4LARL 4APQA 1S7UB 4KROC 1S9XB 1PEZA 2BVTA 4NPYB 3NZ8A 2VTFA 3QUXB 4BSWA 2GAZA 2OTUA 3MYJA 4XI5D 4YHNB 4AIXA 3O2WL 5ITBH 2MQCA 2PTTB 3PJSA 3QEGH 4LEOA 5DRWA 4Y1AB 3QEUB 4URTB 5J1AB 1ADQA 1FCCA 2CLZA 3OKDB 3H8NA 4MLIA 1MREH 2YKLH 5HHQA 4D0CA 5K9KB 4MWFB 3PQYA 3KS0J 1T7ZA 2CLRA 4XVSH 2MCG1 3IVKA 2PF6A 5CBAA 4MCZA 5D1XB 4AZ8A 4XAWH 3GSXA 1M6OB 1FNLA 5ANMA 5SX4I 5GIRB 1MJ8H 4G8IB 2VXQL 5I16A 4ODWB 5H2BB 2PXYB 3RFZC 4OCMC 1BMGA 5DEGB 5C0BE 1MJ7H 2Y7QB 3GIVB 2HT3D 1T5XB 3CDYA 3VXPA 3HCVB 4JFFE 5DFTA 2F5BH 1AGBA 3FRPA 3UTSB 4JO1L 5D7IF 4OI8A 1I1AA 4OBRA 5E8DL 2WUBL 1JPFA 1VFBA 3VWKB 4RISH 4GLRI 1TVBB 2XOTA 3SQBA 3KR3L 4YE4L 3DSFL 4OLXL 1ONQB 3PDDA 4IRSA 3IJHB 1SEQH 2V9RA 2VYRE 1I8KB 3HE6B 5GJSH 4G7YH 5DK3A 5GS2D 4R6UA 3DHJA 3ULUE 4TNVK 4CN4A 4M8QA 1MFNA 4D0DA 3FRUA 5DZOA 5IKCB 1I9EA 4YX2H 2V2XA 3MLUL 5TFSH 3SKNA 3PWJA 2C7UB 3QT2A 1RJZB 1I4FA 3P9MB 1JFQH 5LG1A 1KJ3H 3NTCL 1UA6H 5DUML 2RQ8A 1YY9D 1I3RB 1JGLH 1JNLL 4H88L 4S1DD 3H3PL 4NBZB 2CK2A 4HS6A 4ZYKB 3R8QA 1J87A 5I1GL 2X4RB 4TUJA 2D0GA 4GG6F 4K8RC 4Z7OE 3LZFL 3S98A 2X4NB 3QWRA 3R4DA 4LU5L 3U4EA 3MLVH 1BQHA 5FO9B 3ULSA 1ZTXL 5A3ID 3Q5YA 2JJTC 1VGEH 4L4VE 1W8NA 4QTIL 4RBPH 1D5IL 3BWAA 1T3FA 1G7MB 3NPSB 3DV6B 2R0WL 1YC8A 4FQLH 1AD0A 2IH3A 2AXGA 3PWUA 4MXQC 3GUTB 5FUCE 3GNMH 3S97C 4MJ2A 2HLFD 4HK0A 5FDWB 1M7DB 3QI9D 4DN4H 5IEKB 2R56L 2HH0H 1VSCA 3ZDZE 4NN7C 4FXLA 5HGDA 2YOCA 1PQZA 3EZJB 3BH8B 5DQJA 2Y25A 1RZIB 4MA3B 4LCWE 3DMMC 4ZG1A 1RUPH 4JG0H 3QNZA 3RA7H 1AGDA 1E4XL 2YK1L 1T1XA 5FV1L 1IC7L 4QF1A 2FJHA 1CZ8H 3JWOH 5CIPH 5TQ2H 2PW1B 4D9LH 4NQCE 4KRPB 1FN4B 5DLMH 4G43B 1NMCB 2GSGA 5E9DE 3QIWD 3G9AB 3W5MA 1HXYB 2QEJA 3CMOH 4O2FB 1U3YA 4PRPB 1MRDH 3V8CA 3BKJL 5FECB 2D4DA 1MNUL 3CH1B 3STZA 3K2UL 4Z7NF 3EYFA 5ESVB 2MHAB 1K3IA 1AHWA 1EVUA 3QG6B 3PV6A 3B8YA 4PJ8C 1MUJB 3TIDA 3TN0C 5CS7A 3FKUS 1NKOA 5FYLL 5BV7C 1MEXL 4M1DL 5I74C 4TN9A 3ZE2F 3C9NA 4N8VA 4JR9H 1RZGB 3IU3B 4LSSL 1SJVA 2FWOB 2YEZB 3QQNA 1BJ1H 4PGZA 2HMID 3UTPD 4KK8C 3IU4H 1B2WL 1L0XA 3O6ML 4YGVA 2CDGB 2YRLA 5ERWA 5HVGB 2QQQA 3NABL 2NNAA 3TT3L 1DBBH 3U9UA 1RURH 3D85D 1JN6A 3GSRA 3VXMB 2K7PA 4FOMA 4OQTH 4EI5C 4N0RA 4X8JA 4S2SB 3NIFE 4PG9A 4Z7VB 4JAMB 1OARL 4MD0A 3PWNB 4PD4K 1IARB 2XI9A 4U33A 3PGFL 5E5MB 1QKZH 4PJHE 2GJ6D 4MS8D 4KI5E 1U41A 4MNQB 5GS0L 3PL6A 2FJFB 5DJ2B 5GGUA 1KB5L 5AEAA 4TVPL 4F2MB 4ACPA 2NY0B 3QAZB 4UV4L 2VXVH 3JSSA 1DZBA 1IAMA 2D03H 3FB8B 3HZKB 4NKOB 4NQSB 3TA3B 4NM8H 4O2CB 2NY1C 3KWWA 5E6ID 8FABA 1YNLH 1MFDL 1YEFL 2FR4B 4AIZA 4YZFF 4G5ZH 1OTUD 4GW1B 4I3SH 5SWZE 2J4WH 2VDOH 3RGVD 1KUMA 5JW4N 4PR5B 1UZ8B 1N5YH 1VPOH 2NY4D 5F9DC 1V7NH 1ZHBB 4JRYB 1RIHH 3UJTH 4MMXC 5FUZL 5HY9A 1S78C 4M43H 4O58H 4GMTH 5TH2B 4JFEE 3T09A 5JOPD 2I9LA 4HJJH 3HMXA 1VESA 1UVQB 3SE4C 2Y9RT 4TSBH 3NN8B 4WU5A 1GIGH 4L3EA 4NRYB 1ITBB 3L3DA 3PUCA 3R0MA 2H2SD 4EXKA 4OGZA 5DGRA 1LE5B 3VGHA 3RGHA 2IANA 2ZOLB 4HDIA 4YBHA 2H1PL 4XCFL 3OF6A 5GRUH 4ZUSA 5E95B 4UDTA 1LO0H 3P4MA 4MA7H 4RWYL 3OKOA 2JKXA 5ABDE 3GJFB 2JB6B 3U0WL 3MV01 2QQNL 2MCPL 3VD3A 3P4NB 4MA1B 1FCGA 5INCA 1IEHA 4FP8H 4HEME 1N2RA 2KPNA 5C0AD 2IADA 3X14A 2K7QA 1XAUA 3MOQA 3OKEA 2EE2A 5DJAA 4UMGA 4NZRL 3LQAL 1XEDA 3U46B 3K1KC 5I8KL 4J6RL 5C0DA 4G6KL 5JHDB 3QDJD 1PW3A 1F8TL 2DRUA 2IPKA 5M94B 1IGFL 1V3LA 3QDGA 3DRQB 1NSNL 1IAIM 1KCLA 1HDMB 4TYUA 3BN9C 3JXAA 5D7JA 2D7OA 2IMMA 2NLJA 1FL5B 1CGYA 2GEEA 4OZFG 2ZUWA 1HHGB 4CU7A 1JP5A 1MF2L 4RBPK 4X6DE 5LVEA 3LVEA 4IS6A 2BFVH 4WTZA 5CSZB 2BVPB 1PEWA 3WIIH 4NQXB 2CIIA 1KTLA 3MROB 1GJIA 1BBJB 2DJ4A 1G7QA 4TSCL 2BNQE 1WVZA 4X5XB 4NQVB 2EIDA 5I66A 3ZYIA 3B3IB 3L3JA 5FYJL 3UTQB 2AVGA 4NO5A 4TQEL 3H9SB 3CXDL 1DVFD 5H35B 5DJCA 4HFUL 5KVEL 1HQ4B 4IIQB 4V2CB 4U1LA 4G9FB 4LCCA 2X4SB 2ZNWA 5GGQL 4JJ5A 2VDNH 4DVBB 2NY3D 1ZWIB 5IHBA 2MPAH 4PJ5A 4JCLA 1LO3L 2AJYL 3QPXL 3WNMA 2ATPA 4HC1A 1TJGL 1MIML 2BSSA 2X5PA 4P4KB 1FVDA 5GS3A 1FIEA 3TF7C 5BQ7B 3DGCR 3R06A 2VDLH 4UDUB 1ZLWH 5KOVC 1JGDB 2DTML 3CVHH 4NN5B 5D6DC 1ZE3C 5JUEL 1KB9K 2Y5TB 5HHPB 4IMKA 4J3UA 5E56A 3WL9B 1BFOB 2ZCHL 3LIZL 2P8PA 4L1DA 1AD9B 5LAXA 3VXOB 5FA4B 4E0RB 3L95A 3QUZA 1T83C 4F58L 4ZAKC 4QNPE 5EBWA 3WN5A 3VFUB 3I3BA 1NGZA 1X7QA 4HFWA 2B4CC 1C1EL 5EBLA 4F33A 1EXUA 1WTLA 4KQ4L 2B5IC 4X8XA 5ECJE 1JNJA 2VWEE 3LN5A 2X40A 4JFYB 1J0JA 4P48A 4CRPA 3UTTD 3PIQA 1EJOH 1PLGH 1MH5A 4OF3A 5FAAA 3RHWK 3AMKA 4EI6A 5DYOA 3GI8H 4OLUH 4LHUD 3G04A 3O2VH 5C2BL 1M7XA 2DL9A 5E4IA 5CIPA 1U6AL 5L7XL 3GSVA 3O8XC 2CGRL 4NOBA 4GSDH 1MI5B 4WW1A 2CKBH 1RZKL 3QCVH 3DX8B 2I60L 2VZOA 5C0CD 1IAIL 1NBZA 4IOSD 1TPXC 1FE8H 1IL1A 5JPMB 3MRFA 3HC0A 1KIPA 3VRLE 3CZFA 4OZGE 5ICYB 2IWGA 5IQ9A 5JPNB 1KN4L 3VGGA 1HI6A 5T1DL 3VH8A 1A02N 1MCOL 3HTLX 4OZFH 4KXZH 3GJEA 3HE7B 5JNYB 1KBGL 3GDBA 4P5TC 4LLDA 2ZUYA 1U8PA 2KZWA 5CKGA 3RDTC 4MD4A 1T21B 4NSKA 1DQML 5I71B 5JLZA 1A7PL 5IFAL 2Q86B 2BZDA 4Y4HD 3GBLA 3QJFB 5AG9A 5I17A 3WLWD 5J12B 1CLZL 2ZUVA 4HHAA 4JZNA 2XT1B 4WHYH 4G8GE 1CGSL 3P4OB 1IKNA 4AENB 5BXFB 3LH2L 4WV1A 2FATH 1INQA 3O9WA 4NGHL 2HVJB 4YDIH 3HS0A 1GGBL 1T7YA 3TP4A 4QY8B 1KC5H 1RIUH 3VDAA 1SYVB 3BP4A 2DQIH 3CFIC 1CDIA 3S37L 4OLZH 4EDWH 4Y5XC 1ZLVK 1U8OA 1KNOA 4ODTH 3A6OA 2ZCKH 3PWPB 4X80L 1MVUA 2M2DA 4JO4L 4JFXB 3VG9B 1QSFB 1AI1L 5HI5C 3AGVA 1IC5H 2B2XL 2APWA 5EO9B 2W65A 4MA8L 4I18C 3T2PA 5F7EH 1MHCB 3IRPX 3PQYD 3ARBB 3FOLA 5I1KL 1MPAL 1ODAA 4KHXH 3S5LA 1V8HA 3RWGB 2NZ9D 3PHQB 1XGUA 2YPKA 4Z8FL 5D9SA 2ICWB 4PV8B 3JBG7 1CGUA 1IQWL 4NO2B 2GITA 3RUGB 2VE6B 1CXKA 4RAHA 3WFHB 5AZ2L 5T3XE 1S9VB 3K80A 4PJAB 1RJYA 2D4FA 3QPQD 2ITDA 5I75C 2N4IA 3IETB 4M8VA 4QRUA 3FB7B 5CJ5A 1EMTL 3VD4A 6FABL 3T4AA 1VA9A 4RRPG 2VLKD 1F3JA 4WWKC 3IAQA 1UH2A 2WP3T 1NC4B 4X4YA 2A6KB 1I1AD 4PD4J 3B9KC 1KJ2B 3QH3A 1YJDC 4EJ1C 4PY7A 1WCBA 4LSPL 1D5XB 4Z18A 3JUZA 4TNWF 3SDYH 4NC1C 3U0TB 2EH8H 5JXEC 2FD6L 3BO8A 3DVNB 1DFBL 4LLUA 2DLHA 4NO3A 4FQCL 1NGPH 5IMMA 3L7EA 4JPWH 5F70A 4X98B 4QTHA 3KJ4C 3LRGA 1MCJA 2OXHA 3I6KA 3JUYA 3W9EB 3KPOB 3QEQE 3BEWA 3MV7E 4KTEL 2KQNA 2HN7B 3EAKA 2ICEB 1MAJA 3MO1B 1LP9A 1NLBL 2OR7A 3MJ9H 3SGDI 2BDNH 3D48R 1ED3B 2FH8A 2OL3A 2J5LC 5IHZB 3BZ4B 2HKHH 3GGWA 4JFHE 2OYPA 1FPTL 5C08A 4C83A 5I19L 4WO4B 4UNUA 3CFBA 1A7QL 2J8UF 3AY4A 1IGML 4BKLA 5DJ6A 4HK3N 1QYGL 1ZLWK 4LGSB 3RWDB 3ARFC 2ADJB 4YXLH 1F11B 4GW4A 4PB9H 3VFTB 4F7CA 4GG8B 3UEZA 3WKNA 3G6JF 4XP1H 1AJ7L 1W0VA 1XCTB 3ABZA 3SO3B 4HMCA 5DFVC 5EBMA 5F7LB 5J6GB 4BH8A 4J8RB 3MODH 4M48L 2R1YA 2I9TA 3U2SA 1IE5A 4NC0B 1JGUH 5B8CA 2APVA 4U7SA 4I4WA 2F53E 3OAUL 4I13B 4C59B 1OWRM 4M1GH 5LGJA 3T0EA 1JYVA 1U2HA 1KG0B 3LD8B 5EZIL 3KLAA 4YXKL 3N1MC 5GJTL 3TBYB 4A6YL 3IF1B 5TPWH 1RV6X 3OZ9H 2EEAA 4CDGC 5D7IB 3ZTNL 5F3BB 4MQSB 1FHGA 4XCCL 1JHTA 3SDXE 4BSVA 4OGXH 4DGVL 2XFXA 2ORBH 4LP4A 4ZO8A 2MTPA 2EXWD 5EU4A 1X44A 5MENA 4OSUL 3HI5L 4QCIA 5FO7A 5FGCB 1UWEH 3U79A 1QBBA 1EGJL 4GMSH 1DN2A 3IFNH 3CVHA 4C4KT 3VXUE 1U8KA 4Y16A 5ISZE 3PXHA 1YEHH 4D0BB 1XIWB 4X5WA 4LP5A 1UWXK 3MCKA 2PW2A 4ORGA 3VXTA 1INEH 4ODXB 2IH1B 5HVHB 1SQ2N 1HHJB 2W0FB 3MREB 3I6GA 5D2NB 5I76A 1I1FA 1QSED 1QLFA 4ZSOB 4B7LA 4LCIH 3MLRH 2D7TH 3O6KL 1QSEE 2XN9A 5GQBA 2VZTA 5MERB 2DQHH 4HLZG 4M7JH 5BOZG 3NZHH 4NRXB 1U92B 1I7RA 3VGBA 1QG3A 2EZ0D 4LSVH 4HUVB 2NCMA 3NFNA 4IMLB 5CWSB 1K9TA 3SPVB 5I6XB 5GRVK 3UYRL 1LEKB 1FFRA 3MRMB 3NFSL 1RJLA 3WUWB 5D2LE 4WFHD 4NQEA 3CSYA 5TDOA 3DECA 3WJLA 1UH4A 4RAVA 2V7NA 4XNQB 5CP7B 1UM5H 4JPIA 3TJHC 1KB9J 2ICCA 4LF3A 5CHNA 2EDNA 3TVMA 2DQJL 3U36A 4CN6A 4HULB 3CH8A 3X17A 4JEGB 1JZ7A 4G80A 3MLXL 3PL6D 1BP3B 4U1SB 1F13A 1U8MB 2VLRD 3NGBB 1L6XA 2UWEE 5FIEA 1AGFB 3G5VB 1EAPB 4I9WD 3FO1A 3GIZH 5EULV 3LB6D 3FN3A 2DQTH 3RY6C 1P53A 2E7MA 4U1HB 4YHKH 3WDIA 1IILE 4JFDB 4MSWA 4RFNC 3TO2A 2KKQA 1BJ1J 3DTXB 4I1NB 3V4UL 2H41A 3D69A 4PGJA 1F4YL 1FZOA 2VL5A 1KF9B 1JWSB 5KSVA 3LEYH 4HWBL 5D1QB 3EYVB 2OI9C 2OMNA 1HINL 3GSOA 4JANB 4NN6B 2E6PA 1PKQE 1CXLA 2OP4L 3RL1A 1WF5A 4FTVA 3S88H 3G5YB 4UIKH 2PYEE 4P49A 3DIFB 3I9GH 4ZTOH 3VI4F 2IAND 3MRNA 3R8BB 4XWOC 4HK3J 3TCLB 3BDXA 4XCEB 3MBXL 1DN0B 4M6OL 5F7KC 4KVCL 1FYHB 1XR9A 2FSEA 5EWIL 1J8HA 1EFXA 3QHFL 5F8RC 4XBEH 5FGRA 5KVDH 3OKLA 3MRQA 3IFOA 4O5LL 5C0FA 4K3EL 1KTDA 3DURB 4AH2B 4M9OA 2W0KA 4WFFE 4S1SL 4JCMA 4KDWA 1T4KA 1A0QL 2XZAH 5LGHH 5CGTA 5DJXA 3LEVL 2UYLA 5B39G 1EBPA 4Q9BA 1C7TA 2P5WE 1I9RL 4XXCA 5F7UA 3O4OB 4KUCF 1XF3B 1B0RB 1SJHA 3QDGD 3VW3H 2GTZA 3MRRB 4WW2C 1LDPH 1T20A 2SEBB 3WS6C 2AEPH 1QACA 5D7JD 2QQLH 5I8EA 1CIUA 2GY5A 2ED7A 1XGQB 2RIKA 3C2SA 2E9BA 1NFDA 3OXSB 3PDOB 4CDHA 4R7NA 3TNNA 1OPGL 4V1DE 1JNNL 1JUFA 3T2QA 3MV11 2EIBA 4NDMB 3U1SL 5LXGH 3HR5B 4Z7UA 1QLEH 5AAMA 3Q3GA 1OM3H 1GZPA 1HHIB 1NCTA 4JVWA 1QFUH 3BGMB 2AJSL 4CADB 1F42A 1YMMA 4PJCA 3INUH 3KYOA 5EG6C 3IKKA 1C08A 1C5BL 4HPYH 2NPLX 2BVEA 4JDVA 5HDLA 5JA8B 3C2AH 5EU7C 1RZJH 5J11B 2Y6SC 4NUJA 4P2RA 3RWEA 4P2OA 2V7HB 5DUBB 5I15L 2AI0L 4P2QE 4NT6A 4PJ5D 1XGYL 1A14L 2FYYB 1F3DJ 4FFYH 2Z93A 3GBMH 3LKNB 2LU4A 1A6PA 3SDCC 4OKVB 4U2YA 4XBPA 5JHLL 5BO1L 3O41B 1G1YA 2FECI 1Z9LA 4J4PA 4XB7A 1IEBB 1BBDL 5HDBE 4EOWL 4M00A 4WNQB 2BY3A 1X3DA 4OM1L 4ZUTA 3NAAL 2DOCA 2W92A 3WKMH 1WLHA 3W2DL 4CVXB 1BX2B 1NCWH 3MFFB 4WEMB 2NX5A 3ECBA 3EO0A 5GS1B 3QUZD 3NOIA 4BFBD 3FHAA 2HJLB 3G9VA 2AV1A 2IBGA 2GHWB 1N59B 2AV7A 3MC0A 4HKZA 3SDAC 3HC3L 4XNXL 5HYJB 3QJHA 4JFZH 5KS9E 1YEJH 1S7RB 1RHFA 5DEFA 5C0BB 4XPBH 1I7TA 2ZSWA 3CX5J 3ESUF 2ILLA 1Z5LB 4JFFB 4IHOA 4I77H 2UUDH 4BM7A 5D1ZB 2E27L 4D2NA 1NGWB 3MV8A 3WFEH 3QQ4A 2W0PA 1YN7B 2C5DC 1F4XH 3X3GL 2H2PC 1H3WM 5DC9B 5C09A 5ACLA 5JIPA 2Q76A 5CFHA 1NGYB 3BVNA 2FO1A 4BSJA 1M7IB 3BUYB 2Q8BL 3QO0A 4RRPA 5HGAA 1KSRA 4J3WA 1OSZB 3MUHL 2EDXA 1GC1L 3CZJA 1IGIH 3CLFH 4TRPL 2XRAH 2DDQH 5K9QI 3O6FA 3KPNA 5F9WB 5JORA 5DT1H 3CVIH 4DZBB 4WU7B 4H5SB 5JW4Q 3BIKA 3FO9B 3MTRA 3CX2A 4DVRL 1A6VL 4DZ8B 3FT3A 5EUKA 1T1YB 2BY1A 2E6QA 3OR6B 3G6AB 3SDDB 1G0DA 2BSRA 4NYLB 4KKBD 4PTUB 1FG2B 5DI8A 3EYSL 4OM0L 1YMHB 1P2CB 4P9ML 3EFFA 3MJ7A 4KQ3H 5F1KC 1BIIB 3QIUB 2BOBB 3TO4A 3RQ3A 4L4VB 2AJVH 5L6YH 2CRYA 4HBQA 2Q87A 4FXGB 3FQUB 5IQ7L 4M7LH 2WBJC 3X12B 4OCWH 2QR0B 5IR1B 3SJVE 2QJDA 3L5XL 4EN3A 1EEYA 2OJEB 1X5JA 3QDMA 2HFFA 2AXJA 4OZHA 1IC4L 5EU7E 4BYHA 4KROB 3B43A 3RWIA 3F7PC 2VKXA 4QXTA 4ZFOB 4WDIB 3CU1A 3MMEB 4M1CD 4KJYA 5E00A 3RJDA 2BOCB 4LCWB 4Q58C 2R0ZH 4HT1L 1H3TA 5JW4R 2GYSA 4G9DA 4MMZC 3RL2A 5HI3C 1CFTB 3UO1H 5HYSG 4WHCA 1FO0A 1BWMA 1GYAA 4MNHA 1WEJH 1VFMA 4MJIA 4NQCB 4K8RH 1KCRH 1YEDA 1BFVL 2FHFA 2OK0H 1J0YA 3QQ9D 4U6YB 4K7PL 4PJBA 5A43C 3MUGA 1L7TL 1TJHL 2F58L 4HJGB 4PJGF 2R2BB 2IQAA 2CDEA 2W9DH 3WMSA 4L5FH 1C5CH 1RIVL 1KN2H 4Q2ZA 3IXTA 3X13B 3MYZA 3IKCB 5I1LA 5JXAL 4FS0A 5IF0B 4WY7H 3CFJB 5FYKD 15C8H 3QWOA 3RNQB 5AZEL 4BJLA 3STLA 1K6QL 5L8JB 3H42L 1JRHI 1PJ9A 4EIGB 1S5HB 3ZYZA 1UZ6F 1P5VA 2GCYA 4HXAH 3W0WA 1BZ9B 4G3YH 4UTBL 3ZDXF 1OSPH 3L5JA 3HI1A 1XGPA 1YDPB 3WXWH 4PIRF 2HMIC 1DANU 1ZEAH 1DUYA 2V5RA 3VFNB 4GW5B 4R97B 3E3QC 2BXYA 1UJ3C 2BNRA 3MLTA 4LVHC 4F8QA 3T2OA 3RIAK 5C08D 2OR9L 3G08B 1FL3B 3QNXA 1WV7T 3IDGB 4PJHB 2IGFL 1IBGL 4OZ4A 5T5NF 3VXSA 2VIRA 1YPZF 5C9KA 3N85L 3NMEA 4MS8C 1N6VA 3LMJH 3C5ZA 4HS8L 3EYOA 1J9CT 2A6DA 1E6OL 4CUCA 4K23L 4YFDB 4DN3L 1O7VA 1C12B 4ENED 5D4QA 4GRMA 4P23C 1HSAB 5SWZB 1NDGA 3BEVA 5HHXL 4OD2A 1N3NB 1J0ZA 4XVTH 5BV7H 1A8JH 3MV9A 1WICA 3M1BB 3M07A 4JRXE 5DVMA 3RGVC 4LKXB 5CP3A 1NC2B 4QHMA 4U1JB 2NY4C 5AG8A 1WAAE 4JFEB 2EC8A 3T0ED 1CD9B 3GMRB 4Y4FA 3FQXA 2VLJE 3OHXA 1OP9A 4I0CC 2AP2A 2EDQA 3LKSA 3PGCA 3MNVA 5C0JB 2VQ1B 1CVSC 3Q6GL 4UU9A 3FOMA 5JIKA 3FT4A 3ULVC 4PP2A 4PBXA 3U9PL 1OGTB 5FK9A 43C9B 5MEND 4YHZL 3I02A 4HW6A 1UQSA 2H2SC 2FHBA 2DWEA 4NN7B 4E9LA 4HMEA 5HDBF 1WC7A 2XZCL 2EDRA 1OLLA 5IB4B 4Y16D 2P5EE 5DD5H 1UYWL 4OZIF 3DMMB 5KJRH 5T1LA 3WHE1 4NFCA 4JM2F 1N8ZB 3DX9A 4NO0B 2X70B 3JWDL 3V0VA 4OUUA 3KR3H 4YE4H 3VFMB 3DSFH 4OLXH 1HYSD 1MHHA 5D71H 4EUPB 1RZFL 4GKZB 3FQRA 3K74B 3ARRA 1AXTL 5KS9F 2VAAB 3NIGF 2XN9D 3MLYL 5AD0B 4JKMA 2ATKA 4NFDA 4R4NC 4QRPA 4IRJC 2P45B 4NQDD 1FDLL 5DK2B 1YUHB 3MLUH 3VCLB 2BHUA 1S7QA 3AREC 5EOTA 4RFOL 5ICXB 5C0ND 3T77B 4C55A 1S9XA 1T0MB 4PJ8B 4DQOL 2Z35B 4F9LA 1JHKL 4GQ9H 1ADQL 1YNTA 1DLFL 2NXYC 4H20H 3TN0B 2EDHA 4K94L 3V0WL 4UBDD 5I1GH 5I74B 4W4NA 2PTTA 3LZFH 4I48B 3CAFA 4GKNB 3TVMD 12E8L 2WINB 4PBWD 2G9HB 2BNQB 5D7SL 2F74A 2QQKL 3QEUA 5J1AA 4FQ1L 2RB8A 3OKDA 4HWZA 3MLSH 4WUUE 2WK2A 4JVUA 5T3XL 2J6EL 5I2IA 5J3HD 5DMYA 3QUKB 1U95B 4XMPL 5GGRY 1PZ5B 3E3QE 4EI5B 1JHLH 3F7YB 3WIHA 1M6OA 5CJOL 2R0WH 4IOFC 3RRQA 1FRGL 4K7FB 5C8JB 1JGVH 5GIRA 4CAGA 35C8L 4G8IA 4BH7A 3BW9B 1ITCA 2CH8A 3OKKB 4KZEL 3C08L 4OV6F 2CUHA 2NY3C 4WWID 5GGVL 2PETA 3LRHA 4ODWA 5GRWA 1BF2A 5DEGA 1EHLL 1CL7I 4B7IA 5CKAA 3GIVA 4HIEB 1T5XA 3ZE1F 2HVKB 2BNUB 2WANA 3HCVA 1TJIL 5I1HL 3WFDL 1OAUL 4FTVD 1E4XH 3QWQB 2YK1H 3MLPA 1QFWI 3VWKA 1TVBA 1JZ8A 1RUQL 1ONQA 5E2TL 4X6EB 1XH3B 3IJHA 4RAUB 1I8KA 3HE6A 1UXSB 3I2CL 4DOHE 4UV7L 1X4XA 3RTQC 4C56B 3V4PH 3ISWA 1KCUL 3BKJH 1J8HD 4TNWK 1EFXD 4QOKE 5IKCA 1MNUH 4YDKL 4ETQB 2EKSB 4JKLA 4LPCA 4NBXB 5INDB 1DQTA 3K2UH 3QR2A 1YA5A 5BRZE 3ULVE 2C7UA 1N64L 1RJZA 4LDLB 4KI1A 1N6QL 2EIEA 1W72B 4HKJA 4TSAL 4J2XA 3DUUB 2NYYC 4Z95H 1I3RA 1KXQE 3RBSA 1A2YA 4NQTA 1MEXH 4M1DH 3UTZA 1OP5H 4ZYKA 1BQUA 4XP4L 2X4RA 3VFRB 3H2WA 3ETBF 2GFBB 1B2WH 1P6FA 3O6MH 2X4NA 2B1AH 5DHYB 1DBJH 3PP4L 1OAKL 5FO9A 4OZGB 4X4ME 4PRHA 4KGLA 4TULL 2MKWA 3TBVB 3KLSA 3RX5A 3C60A 1OARH 4N5EC 1I8MB 4JY6B 2ESVE 1KCSH 1OTTC 4HIIB 1G7MA 2VRAA 2EDLA 3DV6A 4P46B 2ARWA 3OBAA 2AKRB 2GQHA 4DW2L 5GSRB 1QQDA 3RAJL 1KB5H 5IEKA 5LJYH 1X5AA 4UV4H 4OAWA 4G8GB 1JTOA 1Q9LB 1Z9OA 3BH8A 1ZGLB 4F7EB 3AC0A 3DI3B 1MFDH 4MA3A 3FONB 4KRLB 4ODHH 2NY2B 4GAJL 5DMIL 1KIRB 2BRRL 4P2RD 5HYFA 5DVOA 5IOPA 4P2OD 5T5FL 4APQC 4PBVC 2HAZA 2PW1A 3L3HB 4XH2B 1KENL 1OGAE 3FN9A 2JELL 3QUYA 3U4BH 5BS0A 3LQMA 5GSVB 4G43A 2DLGA 4JLRB 4KJPD 4FQXC 4J4PD 3TWCH 1I3GH 4PRPA 4OF8A 4O2FA 5FDYA 4JN1L 3QDHA 2YPVL 4XMLH 3EOYG 3KPQB 5D7LE 4Z7WF 3UBXG 5ESVA 5I1IL 2MHAA 2NX5D 2WLYA 4YIQB 1HKLL 3KYMB 4YDJA 2NZ9C 4DKEL 4RWYH 1IRAY 1BLNB 3FFCA 1BVLB 1NFKA 4OFDA 5TE4H 5A2FA 1RZGA 3IU3A 4UI2A 2FWOA 3D1MC 1D6EB 3W39B 2QQNH 2MCPH 2YEZA 5T3ZE 1KEML 2E7LC 2OZ4A 2CDGA 1WITA 1QEWB 3PGDA 1Q72H 2AEIT 3VXMA 5DJZB 4IEFB 4NZRH 4R96B 5I8KH 1MLCA 1I1AC 3NACL 1GGIL 3L5WB 5KZCB 3PWNA 4G6KH 1BM3L 2YR3A 2OSLB 4EXPX 5C09D 1F8TH 1IGFH 2HFEB 1NSNH 3T1FB 3K81A 4MNQA 1EFQA 1PZUB 5BZDB 2F54D 4IRSC 1NUFA 5JDJA 4Q0XL 1D5ZA 5SWSE 2F54E 2YPLB 4ZUUA 3ARDD 2AEWA 1MF2H 5B38G 3QEQB 4OB5L 2W9EH 5DURD 3MV7B 4Z76B 3V5KB 3BRDA 3VFPB 1GL4B 5D96C 3IDIA 4UUJB 2FR4A 5K9JH 5GRZA 2DQCH 2XZQL 1J18A 4TSCH 2B0SL 1IM3B 5F9OL 4FXKB 4H1LB 1TPXB 1HNGA 1L0YA 1LK3L 4TQEH 4Q9QL 1C5DA 1ZHBA 2NY5L 4JRYA 5IVXE 1TFHA 2O5XH 4HFUH 5KVEH 3OTTA 5F89B 3MRCB 1ZVHA 3KYNA 1MELA 4YWGH 1UVQA 1LO2H 4P5TB 1D9KD 3V6FA 5GGQH 3VRIB 1R3HB 3BKML 5EU6E 1LO3H 2IQ9H 3QPXH 5F7FA 1TJGH 1MIMH 1NGQL 5T5NG 1NFIB 3ZE0E 5E4EC 2AQ3A 1LE5A 4RGMC 2ZOLA 4KK6C 5EU3B 1KPVA 3H9ZA 3IFPB 5IVOA 5CEZE 2DTMH 2C3VB 1ZVSB 4EN3D 5KSBE 3QDMD 2BVYA 2F53B 3GJFA 5C0EB 2JB6A 2ZCHH 1UWGL 3CFDA 4JN2A 3T08A 5FA3B 1U42A 3MR9B 3P4NA 2XQYG 2LQRA 3DYOA 1Q9WA 2OR8A 1R24A 3WUWG 1FYTB 1H3GA 2WZPD 1K8IB 4Y5XB 1ZT7B 5L2JB 5CJQH 3SDXB 2ZOKB 3U46A 3G6DL 1T0PB 1P5UA 4HMDA 3BYTA 4P57B 1OP5K 4KQ4H 4L8DA 4MJID 5JHDA 3STBA 3FQTB 2YC1B 3NPZB 4NRZB 1AKJB 3MRDB 2YZ8A 2IJ0C 4PJXF 3DRQA 3VXUB 1G6RH 5ISZB 5HPOA 3GBNL 3F62A 4PTTB 4K9EC 1FL5A 1XF2B 4ZUVB 4BQCA 1CG9B 1D5BA 4U7KA 1HHGA 2G5BB 5DO2C 5HTSA 5C2BH 1REIA 1KYOK 1U6AH 4PG2A 5CSZA 2BVPA 5GGSY 3OJDB 1JPSL 4ONGL 5JW3L 2I60H 2P49B 5I75B 1IAIH 1BBJA 4KV5E 4X5XA 4NQVA 5HHOB 1AHWC 3KPRE 3B3IA 3UTQA 4PJEF 5F3HB 1KN4H 4M61A 1NEZB 1CK0L 5H35A 3B9KB 4HC1L 3W0WD 1Q0YH 1HQ4A 4IIQA 4XPTL 3RZCB 2R39A 3GHBL 4G9FA 2EZ0C 2X4SA 3O3BB 4ZQKB 4LVEA 3BPOC 5IFAH 4X6CF 4DVBA 1ZWIA 4NOFA 1CF8H 2AJUL 2YS4A 4JHBA 5KSAC 4LGRB 1MJJB 2YA1A 4P4KA 3QEHB 1CLZH 2FLBT 3VFSB 3KPPA 5BQ7A 4LPTA 5BZWB 1CGSH 3BJ91 4UDUA 2DB8A 2C3XA 5JZ7D 4KPHH 4I5BA 1JGDA 3LH2H 4JQIH 2V5YA 4NGHH 2Y5TA 3WL9A 5HHPA 3VXSD 2VDPL 4RGND 1BFOA 1YC7A 3BKCH 2UWEB 3C5ZD 1QUNA 3AS0A 3S37H 1AD9A 1K5NB 3VXOA 2CUIA 2J5LB 2F5AL 3I84A 4GRWE 5J7CC 4E0RA 3OG6B 3EO9L 3P30H 1TETH 3FAXA 1WZ1L 1E27B 3VFUA 1SBBA 1QVOB 3D9AL 1EHNA 1AI1H 3ARFB 5J0BA 1G6RB 3MV9D 3GI9H 1E4WL 1U8NA 4MA8H 4WCYL 1G9NC 4QEGA 1BEYL 4AYFA 4LSUL 5I1KH 1MPAH 2VDKH 1MQKH 5E2VL 4JFYA 4JKWA 3S36L 4Y4FD 4ZPTB 4L8BA 5CGYD 4U3XA 5HJ3B 1PKQB 1R3LA 3BZEA 2J1KA 1IQWH 1CU4L 1WBXB 5HDOA 5C9JA 3F12B 4PJGB 1MJUL 2YD4A 5AZ2H 4KKLD 5E8NA 4FZ8L 4UILL 1MI5A 5IM7B 3EDFA 6FABH 5JPMA 1UT9A 3LS5L 2XTJC 4RMQA 4HUNB 5JPNA 2ZZUT 1E6JH 2ZG3A 3CMGA 1D3CA 4QHLB 1SM3H 1ORQB 5CINH 4K3JL 4LSPH 4PPTA 1WBZA 5JNYA 2FD6H 5JQ6L 3H7BB 1H0DA 3QFJE 1KFAL 4FQCH 1QP1A 3VMNA 3NIDE 3PF2A 3QJFA 5DEZA 4Z9KB 4X7DC 5JA9A 3TV3L 4QRPD 2Z31C 2P5WB 4MX7B 4MDIA 2XACC 3P4OA 1MWAB 2ADIB 3MJ6A 4AENA 1CFVL 2VABA 3H0TB 1NLBH 3T1WA 2HVJA 5C71A 1SYVA 3QUXD 2PYFB 2PR4L 1QSZA 1BQLL 5D72L 1KIQA 5T1MB 1FPTH 1JPTH 4V1DB 1A7QH 2QTEA 1QYGH 3PWPA 3BAEL 4JFXA 1KEGL 5DHVH 4XNMB 3EJYC 3CDCA 2RJMA 2DI9A 4Y1AE 5CSGA 3O4LE 2YWYA 3ARBA 3HRZB 1LEIB 1JGEB 4PJ7F 4Z0BL 3PHQA 3HNSL 4M48H 3CLEH 4C54A 2ICWA 3QQ3B 4FRWA 3JTSA 4PV8A 4S1QH 5IP4A 4LLYB 4CN1A 5IMLB 2VE6A 4P2QB 3WFHA 2GJJA 5IVXF 1S9VA 4HQQL 1UFUA 1CBVL 1I7ZB 2DQUL 2IAMB 3IETA 1YNKH 5EZIH 3EYQD 4YXKH 1TTUA 5GJTH 1LO5A 5I0ZA 4A6YH 2I07A 1NC4A 4F7MB 3PWLB 5FYKL 2FX8L 1KJ2A 4XCCH 2R0KH 3UTSE 1CL7H 4QHNB 5TDNB 4OFKA 3VWKD 1D5XA 4L4JA 2UZXB 4TUKL 2X7LB 4YJZL 3U0TA 1YEEH 3HI5H 4FNLL 3DVNA 3FO0L 2RBLA 5JMRA 1J05B 1CLYL 3RVTD 4ELKB 1HHHB 5CD5C 4Q9CA 2YD1A 3HE6D 2OI9B 1N5AB 3TPUA 2O5ZL 1P9MA 4X98A 3GKZA 5KS9B 3DXAE 5DHXB 4JQVA 1TVDA 3SOBL 4LPYA 1FFQA 3DBXB 1FIGL 5DS8B 5AUMB 3W9EA 2OL3L 1HXMB 3RVXC 1VCAA 2ICEA 5IW3A 4L3EE 3EHBC 3MO1A 4HUXB 3UBXA 4X7SL 3M8OH 3MRBA 3FB5B 3RKDD 5IHZA 3BZ4A 2FX7L 2VL4A 2XTJE 3GMOB 4WO4A 4DUVA 3JV4B 3ZKQD 4HPOH 4X9IA 5FHBL 1OD7A 4H25B 3IFLL 3RWDA 2ADJA 5A40E 3UYRH 1DANT 2JCCE 3U4AA 3VFTA 4P3WA 1Y6NR 3B5TA 1XCTA 2HKFH 1UH3A 2FIRT 1ZLSL 1NBYA 3B83A 5J6GA 4KMLB 4FN0A 2H32A 4IDLA 3OJVC 3DETD 1IZJA 3DVFA 5FHAL 4J1UA 4M93C 3QIBC 3MLXH 1EEQA 3SQOL 7FABL 1FAIL 1KGCD 1QO3B 2X4UB 4JZJB 2EDDA 4WW2B 1PX3A 2P8LA 3SKUD 1R0AH 2ENYA 4XB8A 3M17B 3WLBA 5B38A 3TBYA 3IF1A 5BVPL 2XQYK 2G60H 4N0FA 5F3BA 4XC1L 4P2YA 4NJ9L 5FKPB 1SY6L 3O9WC 5E8PB 3BI9X 3QUYD 2E5EA 5BS0D 4CMMB 3QO1A 3SJVB 3NBNA 4KRPD 1OY3B 1VFUA 5J57B 2OP4H 4D0BA 4F8TA 1XIWA 1KYOJ 3TESA 2I5YL 5DQDL 3GK8H 4PRPD 3UMTA 5GS2H 4D3CH 4C58B 4WIQA 3WIFB 3VFGL 4FFWC 4L29B 5E2UL 5F88B 5DMGD 5CBEB 1HIMH 3MREA 5EH1A 2EXYD 3JV6B 5D2NA 2ZSVA 3SDCB 1LE9A 4WUKH 5HHME 4M6OH 4QXGL 4KVCH 2XKNB 1A3LH 5D8JH 1PG7L 1U9KA 3C5JB 5EWIH 3QHFH 4PRBA 4M5YL 2GTWB 4R8WL 4ZFFB 1U92A 3WFZA 5DGQA 3B6SB 3BD4A 4HUVA 5HHVH 1G7LB 4ELME 2DM7A 3TBWB 4K3EH 3HAEG 4LGPB 5LQBH 1LEKA 4S1SH 3MRMA 5ITFB 2ZWLT 3KPMB 1A0QH 1JIBA 5E1AB 3WUWA 3VXMD 1D5MB 4M4PA 1MCFA 1IMHC 3JV0A 4OLWL 3P9WB 3LEVH 3SDAB 2BP3A 3HNVL 3GSUB 4XNQA 3B8SA 2R4SH 4GS7B 5CP7A 1MFAH 1K2DB 4X4ZA 1I9RH 5KSUA 5CILL 4Z7VE 1PBYA 4I3GA 3LKQB 5ACZB 1NBVL 2X9WA 4MNQD 2FRGP 1EIBA 3CSBA 4U1SA 4XVUC 2LU7A 1QBML 2NY6D 2NY0D 1AGFA 2V5MA 3LQZA 4XGZB 3A6BL 1ZLUH 2EH7L 3G5VA 3SE3A 1EAPA 2G2RB 1I9IL 5EIIA 1OPGH 1JNNH 3U1SH 2IFFL 4P59L 3F6LA 2ZUQC 2R15A 4PP1D 4U1HA 3ZT5A 3T8XA 4HGWA 4CVWA 3T2NH 1CGTA 4EVNB 4WJ5A 3DNKA 3DTXA 2HRLA 3BXNB 4PJIA 4O9HH 4Q9RL 4N68A 3ZMRA 4JRYD 4UTAL 1JWSA 1GXEA 5D1QA 3EYVA 5CZXD 5DD0L 2BRQA 5EIQA 1V7MH 4KKCD 2D3VA 4UAOC 3P11L 5FYKU 5E7FA 4JPKL 3T3PE 5IBTL 1A14H 1G9ML 4OF0A 1GOHA 3EFDL 4EUPG 1AQKH 1A1NB 1IQDB 4V2BA 5JHLH 3VXNB 5BO1H 5EZJA 3U7YL 4CNIA 3ELAT 3B9AA 3TCLA 4XCEA 4P5MB 4PRNB 3OGCB 1RMFH 1ZANL 3NCJL 4OGYH 1RULH 4EOWH 1OAXH 4NM4H 4JRXB 5B8CC 2CR3A 3NAAH 4RMRA 2FL5B 2DM3A 1INDH 3W2DH 1XGTB 5HVWA 1JZ2A 3GMMB 3LPFA 1KPUB 2VLJB 2C4XA 2WBJB 1NDMA 3DURA 3T0EC 4AH2A 1AP2B 4F3FB 2FEDC 1PYWB 3HC3H 4HIJB 4XNXH 5TDPA 4M02A 1ZHLB 4KAQH 1BJ8A 1G7JB 4PV9A 3IS0X 2C1PB 1MFCL 1KV3A 4XXDB 4EBQH 1VB9A 1ZVYA 5JHDD 4YHOH 4YHPA 4A6YA 1UCBL 1GSMA 2P5EB 3HAEH 2E27H 1N0XH 3MBEB 1FJ1B 3H6JA 3LKOB 4XHJC 5HD8D 1XGQA 4Y16C 1HYRC 4X0KB 3V7MA 3X3GH 4HWUA 2VR5A 3OXSA 3PDOA 4KTYA 3OB8A 2HRPL 4BK5A 3ZKSD 4MAYC 3UC0H 2AGJL 4OLVH 5IFHL 3HR5A 1EGJA 1LO4L 1SHMA 2A9ML 2Y06H 4I0PC 2CJUH 1HHIA 1Q9OB 4WHTB 2Q8BH 2BMKA 4FMFA 2A6JB 4UB0H 4WGVB 1TZIA 4CADA 5FB8A 5L2KE 4U0RC 1GC1H 4FQIL 1JYXA 4XPFL 2AABL 4TRPH 1F4WH 3OJMB 3H9SE 2P24B 5BVJB 1KT2B 2CSPA 2E7HA 2QSTA 2ERJB 4G9FD 4WRLA 4XP6L 4N1HB 3F65A 3QSKB 2GSIB 3OR7A 2V7HA 4DVRH 2FB4H 3BPCB 5FYLD 2FYYA 4BK4A 4P4KD 4QHUB 1JVKA 3GRWA 4OKVA 4UBDC 3K2MC 5SWQB 2CUMA 3O41A 3EYSH 2ENSA 3O3DB 4OM0H 1IEBA 4U1KA 3ZT6A 1HH9A 3MLZL 1NGXB 3O6LL 2Z91A 4P4RA 4JM4L 4P9MH 4WUUB 4WNQA 3WE6B 2H9GB 4PJFE 1J88A 2Z8WC 3P0YL 3WSQL 1UJ3B 2XPGB 5EO0B 5IQ7H 4CVXA 2BVUA 5FM4A 1IEAA 4LVHB 5F1NB 4MJ6B 3KJ6L 4HLJA 3QULA 3MSPA 1N59A 4R7DB 5MHSE 3SKOA 2VXSH 3DX7B 5GS0D 4LHUG 2X6MA 1IC4H 3WNPA 3QHTC 4TVPD 2GJ6B 2WLZA 2RHEA 4YBQC 1S7RA 3X3FL 5T1KB 3TYGL 5E5RB 5C0BA 2X10A 5ENWB 5IB2B 4BZ1H 2BVOB 2XKSA 3FFDB 4JFFA 1EAJA 4HT1H 1AR1D 1JF1B 4OCYL 1NGWA 4MZ3A 1C16B 4P23B 1YN7A 3C6SB 2AQ2A 3U48A 4BUGA 2X4QA 1NMBL 4YBLC 1UADC 2MWCA 1E4JA 1Y0LA 1MI5D 4HWBA 1TCMA 5FCSH 4KUZL 2GKIA 5CSBA 4OD3L 3F7RA 1M7IA 4K3GA 4OCRH 4K7PH 4DOHB 4W4OA 3MACL 1L7TH 1F4HA 1Z9MA 5TE7H 4QOKB 1OSZA 3BD5A 1R3KA 3P2TA 1P4BL 2DBLL 1RIVH 4LCUB 1ZLUK 4CU8A 3IDXL 5BRZB 5DUPL 3HE7D 4Z0XB 1EDQA 1CR9L 2ZKHL 4JG1L 3K46A 4AK1A 4YFEA 4MGXA 4WU7A 4H5SA 4P3DB 4DKAA 1JMZA 3FO9A 5MP6L 1DE4B 3HRPA 5AZEH 1K6QH 4DZ8A 3M45A 1T1YA 4PRDB 3SDDA 3G6AA 4UTBH 3D2UB 4MXWH 1BECA 1FG2A 1KCKA 1IAOB 4XXCC 1FNSL 4AMKL 1BIIA 3HZMB 3K7UA 4B5EA 2BOBA 1ROWA 3K1DA 3S35L 2HFGL 4L4VA 2DAVA 2V6HA 3SE8L 3V5HB 1I9JH 2DQFB 4FXGA 5C0AB 4EKXA 3D3VB 5IMKB 3X12A 2ESVB 5EUOE 5IR1A 1S3KL 3F5WB 4IRJB 2D2OA 1U0QA 2VISB 2ZUUA 1T22A 2OJEA 1FZMB 2IGFH 1IBGH 3PWPD 1A3RH 3N1FC 4Q74A 5M7QA 1JJUA 3AREB 3MZGB 5IT2H 4HS8H 4YDVB 2AEQL 4I3RL 1QSFE 3QI9A 1ACYH 3PNWA 4ZFOA 4WDIA 4K23H 3RIFF 1YYLL 3ARBD 3MMEA 3RVUD 5C3LD 2NXYB 3WHE0 2JJWA 3KHQA 4DN3H 1TTGA 5IB3A 1TQCC 4LCWA 4NQEE 1DQDL 5TGBB 4O2EA 4DK6A 3FRPG 5E94B 2EDEA 4GXVL 4NNXB 4HWEL 1K8DB 1CFTA 4Y88A 3LV3B 5FYJD 3RUGE 1OGAB 4NQCA 1VADA 1JBJA 1AGEA 4PJAE 3HUJE 1CXEA 1U2CA 3WFCH 4PJDA 5IFJB 1IM9B 5E9DA 1CD0A 1FLRL 2H45A 2NXZC 3H9HB 4HS3B 4OV5B 4KJPC 3T3PF 1NC4D 5C0IB 4YR6B 4J4PC 3QXVA 3OKNB 1NCAL 4L4TE 5DSCB 4M7ZC 3EJZC 4ZXBA 1RZ8B 3U9PH 4O02H 3PV7A 2DWDA 3X13A 3EGSB 2DN7A 4MD5B 3BWUC 4YHZH 5F7WC 3BZFB 3IKCA 3RVWD 3NCCB 3LHPH 4PS4H 5KVMC 3PHOB 3CFJA 3HZVB 1ZS8B 3RNQA 1UYWH 5DD3L 5IHUL 3WYRA 3DSNA 3WO4C