3QHZL

Crystal structure of human anti-influenza fab 2d1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
216
structure length
216
Chain Sequence
PVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVSWYQQVPGTAPKLLIYGNNERPSGVPDRFSGSKSATSASLAISGLQSEDEADYYCAAWDDSLNGFWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human monoclonal antibody del2D1, Fab Heavy Chain
publication title An insertion mutation that distorts antibody binding site architecture enhances function of a human antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 49
structure length 216
sequence length 216
chains with identical sequence M
ec nomenclature
pdb deposition date 2011-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qhzL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qhzL01
4P4RA 2CDEA 4Q6YA 1UWEH 2AJYL 2LU4A 4DVBA 1DJSA 3BVNA 3P4NB 5B8CA 1NAMB 5LKNA 4O2CA 3DRTB 3QO1A 4R0LB 3P77A 1CR9L 3HE7D 1EHNA 2QADB 2FECI 1OAKL 4M7KL 2CIIA 2WBJB 4Z7OF 3FQXB 1P7QB 3L3IA 1QBLH 3MRHA 2XKNA 4P4KB 4PJXB 2Y25A 1E28A 3VFGH 1A3RH 2F5BL 2YD4A 4MSWB 5ANME 2DYPA 3VXQB 4EDWH 1AO7D 3LRHA 4MCYB 3EOBB 5SWSD 3A6BH 5SWZE 3BMVA 5AZ2H 3EGSB 3SGKA 5AAMA 4OKDA 4ZFOL 2Q76B 1T1XA 5IBUG 3W82A 1RHHA 1HQRA 4LPCA 4WWKC 2H1PH 5TQ2L 3KR3H 2ZCLH 1AQDB 1DBKH 3RWDB 2D7OA 1EIBA 1NCNA 3GHBL 4NSKB 2EYTA 1I9IL 2I60H 1G9MC 4X8JB 3W2DH 1WBYA 3K8KA 2AI0H 4DVRL 4NZRL 3VI3F 2VLKA 1F3DJ 2HFTA 4XP5L 1FNFA 3KLAA 4R4ND 3EDJA 5HGDA 4EZMA 4Z7WA 3H3KA 2HT4C 3G6JF 4H8WH 4EN3D 4OV5A 4Z7VF 5D1QA 3GJFK 3VE0A 3X12A 4PJ7F 3G08B 4LCWD 5JO5A 4FG6C 1JF5A 2OTWA 4KJWC 3MRIA 3OKOB 5J06A 1IL1B 3QEGH 1CICD 3O6KH 1RY7B 2XY1A 4M00A 4OCSH 4AQ1B 2KZWA 1G9NH 2EXYC 4NQCA 1XIWB 1D9KA 1HSAA 2FX7L 3KJ4B 1OARH 4MWFA 2A6IB 4H5SB 4NKQB 3OX8B 1LILA 2X41A 4YNYB 3SJVB 5IHBA 5I6XB 4RDQF 4DUWA 4ELKA 2FEDD 2I5YH 4U1HB 4F7TB 1R0AH 3HI1B 1Z9OA 3MR9A 1YEGH 4FMFA 2FIRT 2OBGA 1FSKC 1ZHKA 4B0MM 3FFCD 1L7TL 1B0RA 1G7HB 3NCFB 4GSDH 3M17A 1OOAA 3MUGA 2D03L 4ELME 4H26A 4LVOB 1BGXH 1TZIB 4PY8I 2YBRB 2XA8H 2YD2A 1MQKH 4GXVL 1Q94B 3TESA 1OSZA 1IM9B 4I48B 4LLWA 12E8H 4QXTB 3HZVB 1OM3L 1TETL 4XPHL 2NYYC 4HV8A 1FN4A 1VB9A 2VLJE 3RVTD 1CT8B 5CSGA 3GRWA 3PWJA 4OZHE 2YN5A 4PJCA 4YAQA 2XTLA 3ES6B 4F7MB 1BD2B 5CSZB 3BGMA 5CP7A 4A6YL 2GY5A 2FX9L 4O4YL 1OB1A 3VGGA 1UWXH 4WFHD 5DYOB 1IZJA 1RQ5A 2GAZA 4UT6L 3BFOA 4YDIH 2WZPD 4QXUL 2WK2A 1W72H 1V7MH 5C0RL 3WFEH 4NRXB 2P5WD 3HPLA 1BBJB 1HH9B 1Q0YL 1T7YA 2E27L 3GSNB 4PP1D 3A6CL 5DQJA 3F7RA 5LGJA 2CRYA 4JDVB 3FN0L 3P9WB 4UMGA 5MP6L 1U3JA 5DVOA 1PX3A 1U8JB 3C5SB 4DCQB 1U42A 3V7MA 1S5HA 5ESAA 4YHZH 3TF7C 1A2YA 1SYSA 1X5ZA 2GJJA 5FHBH 4AENB 1AD9A 1Q9WB 3D0VA 4KHXL 1CN4A 1S7SA 3HC0B 1CGYA 4OCYH 1S5IL 3PP3H 1FG2A 2WV3A 1UACL 1NC2D 1BF8A 2EYSA 1BFOA 3VFRA 4TPRL 5ABDE 2UWEF 5EFIB 3TVMA 4H8WC 1U8HB 4GLRH 1WFNA 5FO8A 4UUJA 3VWJD 1SBBA 1AI1H 1NCWH 4FQ2L 1CI5A 5D70L 4BZYA 4HWBH 3L5JA 3SQOL 1VGEH 1FVEA 1QFWM 4NIKB 4I0KA 2IPUG 2NNAA 3VCLB 2J6EL 4OQTL 4LPVA 4LLQB 1X5GA 2Y7QA 4YFLF 32C2B 4LSVH 3SGJC 2PXYD 3ZE0E 1SYVA 1F58L 4XBGA 5ISZD 1U6AL 3IDXL 4JO3L 4OLZL 4ZNCD 4BZ2L 3QDJE 2VDLH 2CRZA 2DM2A 3D9AH 3PIQA 3MBEB 2VDRL 4JG0L 4K94C 1DUZB 5FGCB 3WXWH 2NY4D 3O9WC 5J1AA 4IRZL 4JY5L 1A6UL 2D4FA 1R24B 4PGZA 4MD5B 1CLOL 5BVJB 2NX5D 4ZUWA 5T1LB 2H9GB 1K2DB 4IDJH 1CDYA 3PNWB 4NO3A 3LS4L 1HHGB 2QR0B 1RIHL 1SY6L 1ZS8B 3JTSB 2AQ3A 3ZTJH 2G2RA 3HNTH 4IOFC 3TYGL 2Z4QA 4HJGB 1IGYA 3ARRA 3R1GH 5DRWB 2AJ3B 2WBWB 4PJHF 4NHCH 1KPUB 2P8PB 4X4XB 3LN5B 2Z93A 4RFOL 4Y5VA 2NTSP 1XGUB 5DHYB 5HI4D 3ARED 4JLRB 5CEXA 4Z8FL 3HRZB 2FSEB 3TBYA 5DRXA 2BVPA 1B3JA 1SJVA 5IVNA 4P5TB 5H37G 1AR1C 1JN6B 5B39B 3BZ4B 5D7LB 4ZPTB 1EHLH 2AP2A 1WIOA 2X1XR 4N5EC 3NPSB 4KI5C 4MVBC 1VA9A 4LRIA 3WCYA 5LGHL 3SGEI 2VQUA 2W9DL 2M26A 1ND0B 3ZYJA 1YEHL 1MFEL 2DQHL 4JQIL 4KUCF 3OR6B 1XGPB 4KROC 1HKLL 3QYCA 2JJTA 3ULUF 2OX5A 1X4ZA 3TO4B 1U92A 1JZ4A 3H9SA 3FOLA 1H3GA 1XH3A 4IMKA 4JO4H 4ZPVA 5I8EA 3CX5K 3L3OA 3WFBH 1ZKAA 3B9EA 3FT3A 3SCMD 4JQXC 5IVZA 4JO2H 4MB5A 3AFLA 3HC4H 2QSQA 5ICZB 2PO6A 3CLEH 1MPAH 4JRXA 5A2JH 3REWB 3S98A 3C60B 3K4ZA 1MCQA 1OF2B 2VDMH 4UDUB 4HHAA 3QULB 4P23B 4QTIH 1ZHBB 1C5DA 3ALPA 2ICWI 2DQTL 1CG9A 1RVFL 2NR6C 4OBRA 4RAUB 1X5IA 3LOWA 5HYJA 3W5NA 3W11C 1MI5D 3EO0A 3HE7B 3F58H 4C57C 1FL6B 1PEWA 4MMZC 4OF7A 1YC7A 4NN6C 2B4CL 1FAKT 3MXVL 5K59F 1J0YA 1JWUB 2VLLA 5IVXE 2OZ4H 3HR5B 1G7MB 3BRFA 3B9KD 4TVPH 3T3ME 4YDJB 3E0GA 5C0ND 1AO7B 4OLEA 2DYPD 4YHPB 5SWSB 4QHLB 1J1XL 5F1NA 3NACL 4OI8A 3SE3C 1O7SA 4OF0A 5DEGB 2IBZY 4X4YB 2IWGA 4IRJD 4PBXA 4RAHA 5I76A 3C8HA 2AGJH 4KK5C 5CFHA 1P69B 3RNKA 2HT3C 4JZOB 4IIQB 3VDAA 3MLYL 3RKDD 4O2FB 4H88H 4O58L 2OQJA 4NZJA 5DI8B 4XP9L 2VERN 5DZOA 1WSST 5EOCJ 4JCMA 3K46A 4YXHL 2EKJA 4N1EA 1QYGH 2GSGA 1BVLA 3WN5A 4GMTL 3GSVA 5F3HA 4EN3B 3KDMB 1A4KA 4TNWK 1IKNC 2DJ4A 1XGRB 3WIFB 2HJLA 4LVNC 2HRLA 1CFTA 5D1QD 5AAWA 3GK8L 2VXVH 3RGVA 1XF2A 5BRZA 5GGUA 2D4DA 1CICB 3IDYC 4J3SA 1IGJB 4G6JL 4KJYA 1FVCB 1MWAL 3IXTA 4LIQL 5IB2A 1ES0A 5J13C 2IADB 4HGWB 4HC1L 1ADQL 5DJAB 1JPFB 3BZEA 1MEXH 3ARZA 2FHCA 2YPKA 1H5BA 1JHTA 1E6JH 4OGAC 2P46B 2WM0A 5FHAL 4D0DB 5HGGS 2GJ6D 1CS6A 3P9MB 3D39A 4RNRB 2R29H 5D1ZB 4LF3B 5JW3H 4PGCA 3HZMB 5CINH 3S34L 1S8DB 2WMPA 3KVQA 1XGQB 2IBGA 8FABB 1UXWB 3MJ7A 3TT1H 5F9OL 4KDTA 1Q9LB 2Z92B 3FT2B 1UWXK 2EECA 5MHSE 4J1UB 2APXA 3TBWA 2OR7A 3MRNA 3UPAA 3ULUH 4KDVA 3KNBB 2EYRA 1EERB 4I3GA 5C2BL 1N5AA 3FFDA 5C7XL 4XAKE 1CFNA 3VFOB 3OB0H 2BMKA 4QRTA 1FLRH 4KI1A 2DQGH 1JE6A 3J7HA 3ARUA 1Q9KA 4F2MA 5HY9B 3MRFB 4NBZB 2HJFA 1OW0C 1T7ZA 5C07B 3AAZA 3W9DA 4MAYD 1YYLL 2UY7A 4X4MA 2P5EA 3RY6C 2BK8A 2X4QA 4IEFB 3FN9A 1G1YA 1AKJD 3ARVA 4J2XA 1MCPH 5JPMA 3PP3K 3ARGC 4U1IA 5DUML 5EUOA 4GQ9H 1CU4H 2BSTB 5FM5O 3U7WL 1M7IB 2CDFB 5F89A 3SQBA 4L8CA 4YXLH 4Z7UA 4EI6B 2XTJD 4YGVB 3V4VH 4LCCC 25C8H 1BMGA 1YYML 1BHGA 3MO1B 4B53A 1FORL 3PHQB 5DD6A 1DQTA 1NFIA 2W91A 3LQAL 3DXAD 3O2VL 4ZNEA 4M7JH 3TO2B 2MOVA 4K3DH 4R3SA 3X3FH 3T65B 3GI9H 5T5FH 1NC2B 5FCUH 3EYFB 4DW2L 5F6IB 3JV6A 1KLGA 3HE6A 3GKZA 3BKYH 5GRUL 3SBWC 1IQWH 3VFVB 2A83A 4XVJH 1BQHA 4WNQA 3VXRE 1BAFH 3QIWA 2R23B 4JFQA 5DHVH 3O3AB 3VWJB 4PV9B 3IU4H 1BIHA 1NCDH 3MLXL 2ZUQB 1QR1B 3EYUL 4N68A 1EEUA 1I7TA 1LD9A 1XF4A 1P4IL 4LDLB 5IHLB 2MTPA 1LEGA 5IBTL 1QFUL 1KJVB 4YE4L 3MLRL 4HXBH 2PXYB 4OUUA 1KEMH 3EFFA 3ARFC 4BM7A 1KOAA 5LBSL 5BZWB 5ISZB 5AD0A 3WEXA 5SX5H 5FIEA 2J8UF 3KJ6L 3PWVA 4ZAKD 4LSUL 3LKRB 1X5HA 3PGFH 4K3EL 4P2RD 1PW3A 4LAQL 1WITA 4HD9A 2NY4B 3L5IA 3JWOL 1G6RH 1NGZA 3LKSA 4PGEB 4QRPD 5H94A 2NX5B 5FYKU 4DWHA 1YJDC 1NUDA 5EU7C 5H37H 3V5KA 4YZFE 3U4BH 1MH5A 2NLJA 2YUZA 3MRQA 3RPIB 2DM4A 4JO1H 1J05A 3TBSA 2JIXD 2QQKL 4LLVB 3KPPA 4ZFGL 5K9QG 3D3VD 3DGCR 3QR2A 43CAB 2VZOA 1CF8L 1J0IA 3IDIA 5AZ2L 5FOBB 4OLYH 2QSCL 4OFYD 2WQRA 3IDJB 5C0BD 2R0WL 4ZXBC 2HT2C 3D18B 4U05A 4XC1L 1G7LA 3RI5F 2H6PB 3BH8B 3U0WH 1UM4L 5ICXA 1RJYB 3CFDA 4LDOB 3TT3H 2I60L 4U1SA 1JWSA 2GY7B 5L2KE 1EEYB 4HMEA 5E7FA 2ZZUT 4WGWB 3WDIA 1T7XA 4V2CB 3PUCA 1LO5B 2O61A 3VD5A 5JXEA 5B4MD 5JTWA 5A16B 2K7PA 4U2ZA 3HCVB 5BVPL 4GRMB 1J86A 3SCMB 4HCRL 1J8HB 4PD4J 3O4OC 1N59B 1KUMA 5IQ7L 2E7MA 2EO9A 5C0IA 1KTRL 3MLZH 3KXFA 3T2NL 3QO0A 4I18B 2JKXA 2BVQA 2OJEA 3B2VL 1V3LA 1YUHA 1C1EH 1E4XI 1IE5A 3DBXA 3QG7L 1H3TA 5EUKB 1X44A 1DQML 1L7IL 1CDJA 3LHPL 3T4AA 3VA6A 5GISH 3DO3A 4DKFL 5I0DA 3CXHK 3G04B 3FFCE 1BOYA 4FNLL 1MI5B 3R0NA 5HYJD 4LRNL 1G1CA 4MXWL 1AGEB 5J4MA 2A74A 1PKQA 4PB9L 4NCDA 4X9IA 4Q9BA 4RGMC 3T0WA 1GHFH 3IU3A 2A73A 5CSBA 3RUGB 2EO1A 2IJ0C 3B9KB 4X5XA 3OAYH 3NTCL 5EO1B 1T20B 5DRNB 2V2XB 1FE8L 3GMQB 2XA8L 5T33L 1MQKL 4JFYA 1QSEA 2UVEA 3BP7B 1KGCD 5EU6D 5HD8C 5JW5A 12E8L 3VDCA 1NEZB 4IRJB 5ADOL 1G7IA 3VRLF 5DR5L 2ADIB 4XVSH 3IS1X 3S96B 3DX9A 4BH7A 3ZE1E 3ROLA 1FFNB 5J12C 1GJIA 3FTGA 4JFXA 4G9FB 1NMBH 1Q0XH 3O2DH 1JTOA 4HPYH 2P5WE 2H32H 3BPOB 5C9KA 4UIKL 4FQXC 1F3JB 4P5KB 1MF2L 1UB5A 4OI9A 3UMTA 4TVSa 3CFJA 4M43H 1LP9E 3G5ZA 4Q6IC 3BOVA 1I9EA 4MS8C 3MUZ1 5LVEA 1W72L 5E2TH 3RX8A 3RGVD 3JTTA 2C3VA 3EZ8A 2HFFA 4KTYA 3SE8H 3UJIH 4ONHB 5GJSH 2I24N 1I7ZB 1JZ5A 1KCVH 3HNVH 3L7FA 1TNNA 3KPRE 4LLUA 1HQ4A 1QP1A 1U8MB 2EDRA 4CVZB 2YD7A 1ZA6A 2B8OT 4JQVC 1I8MB 4L8DB 2OR9L 4J8RB 3SDCB 5E4EB 2W9EH 2MCG1 4WU7B 2NY5L 2ATKA 3BXNA 3LEYL 4B7LA 2P8MA 3TEUA 1ZMYA 3NA9L 4XMLL 1CXHA 1A5FL 3D39D 3KPMB 4OCYL 4PJAB 1DP0A 1T03L 7FABL 3AMKA 3WFDH 4WW2A 1E4XL 4QYOA 3OB0K 3SKOB 3MV7D 3D2UD 1UA6H 1U91A 1JIBA 3TV3H 5DJYB 5J9PA 5JQ6L 1O7VA 2QKIA 1KPRB 3UDWC 2B39A 4HKBB 4WWKA 1EV2E 1F11B 1MFDH 2QHLA 3CCHA 3STZB 4ZOCA 2JK5A 4L8SC 5GSRB 4ZG1A 3OXRA 3VXMD 2EKSA 4HIIB 2Z35B 5DSCB 2VWEC 3H3PL 3LQZA 4LHJB 4NNXA 1AQKH 4NDMA 3ZDYE 4D0CB 4GS7C 3V52H 1QPXA 4DN3L 3I9GL 1T4KA 5EBGA 3SDXA 3ZHLA 2MPAL 1NLDL 2FCBA 5A43C 3C5ZB 3TWCL 4ALAH 3PL6C 4LQ1A 4OGYL 2AEPL 4MAYB 1WC7B 3OAUH 1B4RA 1AKJB 1BLNB 1EFXA 1J9CT 4ODUB 3FQWA 2VLRB 4N0FB 5EO0A 2EDLA 2IPUK 3FB7A 5IB4A 1K4CB 4RZCA 3GSNL 4M5ZH 5ETUB 2XTJB 3VFNA 4O9HL 2APVA 3PV6A 4P2OB 4TTDC 4YFLI 4X6CE 5INDB 4XZUB 1MCDA 3DXAB 1A22B 2JB6B 2DQJL 2JJWA 1C12B 3QCTL 3WDHA 4C4KO 4NO5A 1GGYA 4I2XB 1MELA 1FNAA 4P3DA 3ULVF 4NQEA 1DBJH 2V7NA 3SY0B 2IMMA 4GUPB 3AU1A 2IF7A 3BDXA 4W68A 5JW4N 3BP5B 4ZDHB 2IANE 4TQEL 3QIWD 4NM4H 5I9QC 5SX5K 3QHZL 3OKDA 6CGTA 5HHQB 4WEMB 4ELMF 1CXEA 3IKCB 3TA3C 5J1TC 5E2VL 5F88A 1PZUB 1Q1JH 4KV5E 2C4FT 4YR6B 4HJ0C 5I16B 3V79C 3L5WA 5E8PB 2W92A 2B2XH 1PAMA 3CFCH 1S3KH 2OL3B 2N7AA 1VKXA 4FXGA 4XPTL 4ZAKB 4X98B 3RPKA 1A9BA 1FBIH 2FYYA 4OZGA 4OZHF 2J8OA 1R3LA 4QTIL 4UINH 4WHYG 1JYWA 1I9JH 4HMCA 4P2RB 4CAGA 3U6RA 2PW1A 3QDMB 3MV9A 1OL0A 4U33A 4QRPB 4MDIB 2NXZD 3RWEA 2AV7B 4JHWL 3SGDH 3OKMB 3MJGX 5DJZB 2W0FA 4TSBL 2C4FU 4ZTPH 5IV2A 5DURD 1MHEA 4GJTB 5E6IC 4LQFL 3JBG7 1CXKA 5I75B 2CK2A 5FYLD 4Z78A 1ZGLP 4ODXB 5FK9B 2JIXB 3HS0B 5T1KD 3PABB 1VPOL 2FJFA 2X10A 1K8DA 4P2YA 1EJOH 5TGBA 3PDOA 3STLB 3MLVL 1TJIL 3D3VB 4PJ8D 4X5LA 4Y2DB 3H9HB 4RGNE 3TJHC 1AGFA 1F6LL 2ZUYA 2ZSVB 3BW9B 3CZFA 4ZO6A 1IEBA 2E7BA 4X6DB 5C0FB 2R1WB 5C0BB 3O2WH 4MNQD 1UT9A 1KB5H 2VLKE 4TOYH 3BGFC 3T8XB 1OD9A 4LVEA 4Z7WE 1KIPB 4JPWH 2Y36L 3PWNB 5IBLC 3IDGB 1WLHA 3ZKXC 4XAWH 4TUJB 3WLBB 5L6YL 2B4CC 4OLVL 3QUZC 3GMLA 3SGJA 1PKOA 3IJHA 5F1SA 5CEZL 2AXJA 4N8VG 4NQCE 4FQLH 1HZHL 2IFGA 1ZEAH 2EE6A 3CFEA 4ZUTA 5I1IH 3WS3A 3QJHA 4JKMA 3KXFD 2VXVL 3FAWA 1VSCA 5FYJL 5MERA 3WHXA 2NW2A 5CKGA 3O9WA 4AIXA 1WZKA 3VDBA 3OAYK 5CJQL 3S6CA 2J88L 1RFDH 1IC1A 1U0QA 2IH1B 3ZE0F 1A7NH 1MEXL 3IGAA 1K3IA 1WV7T 4HPOL 1T5XA 4R7NA 3NZ8B 3P73A 1FZOB 3CZJA 3KLSA 4LKXB 4ONGH 2Q6WA 1C8PA 3MOBL 2FEEI 3UJTH 4PJDA 2R29L 1KENL 1OGAB 2VXQH 1D5XA 2YA1A 4H1LA 1KN4L 2X9XA 5CINL 2NW3A 3TCXA 3EYQC 5FA4A 5BO1L 1JV5B 4WFFE 1OP9A 1ACYH 1U8NA 5D71H 4QT5B 2PTUA 4YC2C 4TN9A 1ZT4B 1CTNA 3DARA 5F3BB 1G7PA 2B0SH 2A0LD 5EU6B 4ODBD 1CDBA 1FRGL 3DHMA 3UCRA 4PJCE 2DKMA 1LO0L 2CMRH 4WEUD 2DWEA 1T1YA 2NY0C 3VGBA 2HN7A 1WQVT 3P4MA 1JPTH 3QNXB 1MRFL 2YUXA 4KVNH 5D2LA 5DJ0B 3MRMB 1FLRL 2F19H 3IETB 2DQGL 4ODTL 2F54A 4G6ML 3FQRB 2OTUA 4UILL 4JQXA 5T3ZL 1EO8H 1VADA 1ORQB 4M7LH 2YWYA 4HFUH 4GW5A 1ZLSL 1CD1B 3O4LA 4MNHB 4FZ8L 3E6FA 2QQLH 4NFDA 5DVKA 5I18H 4NGHH 2BCKA 4IS6A 4UU9B 4GQ9L 4UAOB 4WJ5A 1KTLA 2OMBA 3SPVA 3QUMH 4YXLL 3RWCA 5EC2B 3BWUC 4ZMAT 1A6ZA 4PG2A 1JWMB 5I73C 2O5XL 3G6DL 1IQDB 3ZT7A 3U4AA 3GBLA 3QPXH 4TSCL 4PREB 4Y5XB 5FGRA 5CJ5A 3SOBH 4LSQL 3I6GB 1RZJH 3X3FL 4CBPA 1NANI 4XBPB 3I85A 3D85D 3GIZH 3MV7B 3D2UB 3DWTA 5EZIL 5HDBE 4DFHA 5DVNA 1XR8A 3SE3A 1JP5A 3HUJB 4TRPL 3SKJL 5KSUA 2LVCA 4D0BA 4PJGB 1QZ1A 1MJUH 2H2SC 3NCMA 4NKIH 5DJXA 1IGFL 1S7UA 3Q6FB 5IVXF 4WWKD 4YUEL 4NQVA 5CKAA 5FUOL 3IDNB 1BWMA 3DRQA 3T3MF 3H0TA 3TCLA 3VXMB 5A3ID 15C8L 3EO1B 2Q87A 1UCTA 1KCKA 1TCRB 2EH8H 2FO4B 3NABL 3QZWB 4X6EA 4PY8J 3MRBA 1IAIH 2ZPKL 4Z95H 3REVB 1R3HB 2FB4L 4FQPA 3LQAC 4HXBL 3FB8A 4HK3J 4RFEA 1FO0L 3VH8A 2BSED 2R4SH 1HHHA 4M6OL 3MOAL 4FTVA 4KY1H 4KJWD 1W0YT 3T4YB 3CDFA 5ICYB 3UXFA 4NHUA 3WO4B 1UCBL 1NAMH 3UPRA 1G6RL 3QUYD 2O5ZH 3V2AR 4R4FH 5F70A 2NY6B 1EVUA 2R1XB 2B1AL 3VXTB 5E2UH 3DTXB 5FYKD 3V6ZA 4AT6A 5LAXB 4POYA 4XX1E 1W0WA 4XPBH 3EDFA 4EOWL 4Q0XL 1YMHB 1NFDA 5LQBH 3D6GA 1U9KA 2CLRA 5F8QC 5T3XD 1Y18A 3U30B 1L0YA 4HFWB 4LCYA 3VRJA 2CRMA 1W2KT 3C9NB 3OZ9H 1NGPH 4JFFA 3VXPB 4OLYL 3MREA 3X14A 3QCVL 3Q5YA 3RGHA 3H9SE 3JWOC 2NYYD 3H7BA 2MKWA 1U8KB 3ZDZE 4HLJA 4Q9RL 2WSKA 4WHYH 3IDMA 3BP6B 4JRXE 4K7FA 3WLWC 3NFNB 4UT7L 4QRRA 1VERA 2NY2D 4KAQH 5FDWA 4L4TD 4BK5A 4NUJB 1OW0A 2XFXA 3I50L 4AH2B 1N5YH 5CMAA 1BECA 2R4RL 5D7IB 1Q9OB 1YPZA 1ZT7A 1YEIH 3DJ9A 4Y4HD 4P9HL 3RY6A 1OTUC 4IJ3C 5BS0A 5HYJE 5CJBA 3HPJA 3BIBX 2OZ4A 4M6MH 3CXDH 1C1EL 1NC4D 2HKHH 4QRUB 1EXUA 1R6VA 1RZJC 3ARGA 4CVUA 2AXGA 1OAUL 4LNRA 5EBLA 1U8PB 3QWOA 1TZHA 3UX9B 2PN5A 1YN6A 2ZKHH 2ZUXA 4KXZH 5DURB 2R2EA 1Q72H 2IG2H 1HYSC 4LCCA 4U2YA 2EC8A 4LLMA 3VGFA 2IQAA 2YOCA 3RWFB 4ZFZA 3V8CA 5I8CA 4V1DA 5T1KB 3DGGB 4HIXL 2XNAB 4NYLA 1QFOA 4Y19A 1YEJL 3ZKNC 4PJ8B 2JJVA 5J6GB 5FKAB 1DLHA 3CDGA 5C0CD 1HI6A 3GKWL 4UV4L 1EK3A 1J1PH 1U8QB 3SBWA 3SDDB 1RZFH 2VMFA 3ARDC 3T0EC 3K4DA 4HULB 2VQTA 5GS1B 4MNQB 1T2JA 5EA0L 2K1MA 3WIHL 5JXAH 5KSBB 3V5DA 4ACPA 1UB6B 4M93C 5GJTL 4Z77A 1YEKH 2ZCKL 2DMCA 4UQ3B 1KXQE 3RA7L 2VDQL 2V6HA 3S97C 2YD1A 1HYRC 1CIDA 1OTTC 2GT9B 4X99B 1Q0XL 3GSRB 4R0LC 1GIGH 2FBJH 2YEZA 5F7DB 2QADC 4N90D 5F7HA 5BRZE 4XNXH 2J8HA 2WBJC 4OCMC 5I15L 3ARFA 4FOMA 1O5DT 2VUYA 4NO0A 4HSQA 3N1QC 1FGNL 4OFPA 5CIPA 4CVWA 3WIIH 1FNEB 4G8FB 3FO2A 2HVKA 4X7SL 1I1AD 3ESUF 4NFCA 5JIHA 1PFCA 5HHOA 3D39E 1J10A 2V2TA 4FABH 4WENB 5JUEH 2A77L 1Y6MR 3LQMA 3UBXB 3WD5L 3EDKA 1RIVH 5GGRA 1ZANH 3NGBB 3BEVA 2IPKA 2PYFB 5FO7B 5HHVL 4XMKL 5DQDH 2P8LA 1RD6A 1GGCH 2HKFH 1KV3A 2ATPA 3QXAB 3UTPE 5I1GH 5EIIB 1DCLA 1PYWA 4YIQA 2M8XA 3A0OA 4FFZL 3VRIA 3JXAA 5C0JB 1BBDH 3S37X 3TYFB 4LLDB 3L6FB 5GZNC 1MHCB 2EH7H 2W1NA 5HJ3A 1AR1D 4YZFF 3S37L 1FL3B 4ZXBA 1A1NA 4Z5RB 5KN5B 4N5ED 1F97A 4QHUB 3QUXB 3RL1A 4XCNA 4HUVA 3EFDH 4XH2A 4NRYA 5GGTL 1LK3H 2DQIL 3TIEB 5F9AC 4E41D 1UYWH 1XIWC 3KJ4C 1UC6A 3E8UL 4OZFG 5E70A 1AY1H 5K9QI 1OCWH 1CVSC 2P5EE 1AQKL 1NGXB 1IVLA 5HI5D 4Z6AT 4APQD 5EUOE 1AJ7H 2C3HA 5IROC 2BJML 1YQ2A 1VACB 5LGKA 3LKPB 4NC1C 5E6YA 3OAUL 4UDTB 4ZFOA 2IEPA 3O4LD 1CDGA 4Z7UE 5BZDB 4I3SL 3KPOA 1WCBA 4FQCH 1W0VA 3VXUA 3MROB 5I1DA 5JA8B 1KFAL 3BZFA 2CDGB 3VD7A 3V6FA 4ZNEE 1O0VA 4CGTA 1OTSC 5CBEB 2UYLA 1JI1A 2IFFL 4JFEA 1UM5L 2BNRB 3IF1A 4OZIB 1F42A 4HS8L 5C6WH 2CLVA 1KPVA 4LNVA 3DNKA 4XBEH 3NIGE 3ESVF 1HOCA 1UEMA 1IFHL 1VFAA 4PV8B 5DMKB 3DX8A 2VZ1A 1GAFH 1OT2A 5GGVH 5FV1L 3D85B 1L6XA 1DBJL 3HB3C 3LEXA 1X6NA 2QTEA 3MRLA 3X13A 3MRKB 2DD8L 1XGYH 1PJ9A 3C6SB 3OKEA 6FABH 1AC6A 1P4BL 1BM3H 4NM4L 2BC4B 5E8NB 1RURH 1QLEH 4FRWA 5EU3A 1MY7A 2JF1A 4WIQA 4XPAH 1C16A 2UZYB 5IESL 1BVKA 2RFXA 2RJMA 4JY6B 4JZNB 1N8ZB 5MENB 2C7UA 3DUSA 1JGDA 5DMYA 3RWJA 5L2KB 3JV4A 3X11B 4FQXA 2R8SH 3F5WB 4D9LL 5EOQH 1SJHB 4CW1B 1NMAL 4R7DB 5ACZA 4WTXA 5IQ9B 3ULSA 2JE8A 4Q6IA 4PBVC 5E8EB 4YPGA 3CDCA 5SWQA 5IIEA 1FBIL 3ZE1F 4UINL 3RDTD 2RR3A 1M7XA 4AEFA 1I9JL 1QLRB 3CX5J 1H15B 1IGTB 5FYLE 2E6PA 3QUYB 4MHHG 5TFSL 3U4EA 2Q3AA 1SQ2N 1MFBL 4O2EA 1RULH 5EBMB 1HHJA 5D72H 5E03A 2CKBB 5KAQG 1GOHA 2Q3ZA 1HH6A 5TDOB 1U41A 2D2OA 4QTHA 1T0NA 1LP9F 5BMFL 5EZJB 4FP8L 3MGAA 3QEQE 5C0EB 3TNMA 4LSSH 4DUVA 3LH2H 1QVOB 4GKSA 1M1SA 1AXSA 5CILH 4NP4H 1UH4A 4NQDD 2LE9A 4H25A 4PRNB 3QNZA 4BSJA 1FNGB 3VXSD 2J4WL 4K8RC 4PJ5A 5JNYB 4MQXC 4PRPD 1AE6L 1WWWX 1A14H 2L4OA 4OJFH 4JM2F 3VFMB 5EPMA 2HRPH 4U7MA 1ZVHA 4L8SA 3MBEC 3W9EB 1UZ8B 4OAWB 1TVHB 4JPWL 4MD0A 2BY1A 4LSPH 2UVFA 5D2NB 2Z31D 3KXFE 3MCLH 5GGSA 1S7RB 5IG7B 4K9EC 1CFQB 4XC3H 2NY2B 1FV1B 5IB5B 4S2SA 3O6FA 2BSSA 4L4TB 3QIBD 4URTB 4FQLL 4MJIA 4XNMA 1ZEAL 4JRYA 3PL6A 1N64H 3T1FB 4Y4HB 3OJ2C 2MNUA 1CQYA 3V4UL 1CZ8H 3K4AA 4YEFA 3Q0HA 1B0GA 5T5NF 1LP9B 1B6UA 1NC4B 2BFVH 2F74B 4YJZL 1PKQE 2VDNL 4MLIA 1RFDL 4P5TC 1FFPA 1I4FA 4YBHA 2IMNA 3OR7A 5MI0C 3TIDB 1FIGH 1QSZA 2Q8AH 1DQQA 1WZLA 4Y89A 2GUOA 2M1KA 4OGXH 5IW6B 1FH5H 2J6EA 3U0PB 3WE6B 3MNWB 3D87B 1QSEE 1OAYH 1KN2H 1MJJB 3DYOA 3ULVL 3EDEA 3EOYG 3OTTA 4V1DD 2DM3A 1XAUA 1WT5C 1H3PH 2BOCA 3TO4C 4N9GB 2HFEA 3S36H 4FFVC 5J6HB 1IAII 1MLCB 3MBXH 4E9LA 1KC5H 1ACYL 5C0CB 3ET9F 1YN7A 5KVFH 2FLBT 5EOCH 3WL9B 4L3AA 4GG6A 2FJHB 4TUOB 1ED3B 2I27N 4X6CF 5I1EH 3C60C 1OGTB 3BX7C 3OKYA 2Y1VA 4P23C 4M1DL 3CFKB 5F1OB 4M8QA 3ZKMD 3TA3A 2VC2L 4CU8A 3P0YL 3P9LB 3MACL 4EEEA 4M1GL 4MCZA 1AGBA 1I85C 1KTDB 2G5BA 3MXWH 3RWHA 3ZHDA 5DD5H 3B8YA 3HE7C 4OLUL 1KNOB 1RK0A 3MFGB 5IOPA 5DUBA 3I6KB 3IRZA 4XGZA 4HFUL 2PYED 4NO0D 3BKCH 2X1OA 4QCIB 4HF5H 1KCUH 4HT1L 1A7OH 4KV5F 5F1IA 5I1LB 2QQLL 2FWOB 4U1MB 5I18L 4CVXA 2LAAA 5KAQF 4PJFB 1IAKA 1I1AB 5HYEA 5MEOA 3H8NA 1DSFL 2FH8A 3NFSH 1KJMB 2AJUH 2FNBA 3EBAA 3VGHA 5C8JA 1U36A 1IC4H 1QFPA 5E6IA 4YPJA 1RUKH 1P7KA 1SJEA 4IIQC 1WZ1H 5BQ7B 2CO7B 4B50A 4F7PA 3JWDC 4X6CB 4M61B 2VUOA 3RWIA 1KCRL 2GTWA 1EA9C 3KYMA 5E2WH 4RMQA 1A7BA 5KANG 2NZ9D 4R4NC 2KL6A 2AXFB 4OZFH 5KW9L 1ZHLB 1F4XH 2K7QA 3BIKA 5E9DA 3SDAB 4G5ZL 1ZXQA 1Z3GH 4EN3C 4LSTL 4HUWB 5HYQB 1P84K 2DQUH 1FP5A 1V3JA 5J3HD 1D5BB 1A7QH 4L4VA 1CICC 4E41B 3SDXE 2VIRB 1MRDL 4D9QD 1DLFL 5I1AB 3PV7A 1I3RB 3I3BA 4NQSA 2ITDA 4HGMA 3QUZA 1IAIL 4Z95L 5I19H 1NGWA 4KXZI 5TQ0L 4X7DC 2FEDC 1HHKB 3MODL 5KVEL 3O6LH 4U1LB 1ZGLB 2WIIB 1KJ2H 1GRWA 5KS9B 4XCCL 4L3EA 4APQB 1VFUA 1C5CH 3U7YL 4Z7WF 4WUKL 4RX4D 3F65A 4GAJH 2O26U 3WFHA 5I1HH 2CLZB 1GVIA 3QXVA 1CDIA 2HJKA 4DGYL 4PFEA 2O5ZL 2DMKA 5IK3A 5F9JB 4L1HA 43C9B 1N3NA 1IMHC 3ZSSA 5T3XE 3LRSA 3MJ8B 1IEHA 4GAGL 1BQSA 5F7EH 4XPBL 3ZTNH 1KIRB 4X5WA 4Y4FB 1MJ8H 3F7YA 5DK2B 2Q86B 4NQEE 1ONQA 3ZDXE 2BVOB 5CZXD 1ROWA 1EMTH 1EPFA 2XWTA 4JFDA 4G8EA 4WU5B 1KEGH 4Y16B 5DUPL 2OJZH 1IAOA 2QL1A 1RZIB 3OKLB 3B3IA 3OZ9L 3ZE2E 1NGPL 3EYSL 4PRAA 3ZYOA 4NZTH 4HS6B 2BP3A 4KHTL 2FJGA 1LHZA 3MOQA 1NUFA 4WI8A 5KJRH 3UYRH 4RWYH 1P1ZB 1YECH 4P0DA 3O81A 4OTXL 4BSWB 4XX1G 1M71B 1T66C 1MUJA 1T04B 3L3KB 1ADQA 4UV7H 3DMMD 3HAEA 4YHNA 2FX8L 4LEXH 1FYHB 1VHPA 3FB6B 1K4DA 3MGOA 1UVQB 4PP1C 4F58H 5DWUH 2FR4A 4HIEA 5HDOA 2EDYA 4RIRA 4ETYA 4NZDA 4KZDH 5IMMB 4G6AD 4LHUD 4OZGE 4ONFL 1IM3A 5EN2A 5BV7B 1DBML 3KYOB 3HNSH 4PJCF 3V7AE 5I8KH 1QRND 3MV9E 3OV6A 3OKNA 4NO2A 1PZ5B 2VZVA 4YHOH 2BNUB 2Y5TA 3LMJL 1YEIL 2A6KA 5E5MA 1MJ7H 2W65B 5ID0B 4MS8D 5CJ8A 4RGOH 4PRDB 2HKHL 4GKNA 1NCAH 2D9QB 5HYIA 1UGNA 5F6IC 1QQDA 3FB5B 1LEIA 1MCWW 4KTDH 4FXKA 3HG1B 4WCYH 2JTDA 2FZ3B 4U7KA 5J1SC 4XNUH 4PP2A 3VWJC 2H26A 1KB5A 4F15B 2ZUQC 1QUNA 4Y1AD 3U9PL 4CMMA 3CNKA 4BK4A 1NAKH 3QQ3B 3CSYB 4NN7B 2CO6B 3CXHJ 4P5MB 4S1SL 4UTAL 4ZUSA 4Y5YB 3QQ4B 2AERT 1J12A 1QG3A 2IC2A 3VFTA 4ZD3H 4AIZB 2F53D 3PWLB 4F9PC 4NQDB 5LWYL 4XXDA 2PXYC 5EIQA 2FD6H 3VXSB 1MRCH 5TE6H 2V5RA 4GG8B 4PRPB 1FLTX 4YHKH 3U36A 5C6TH 3BH9A 3GB7A 2AJSH 1LE5B 5IM7A 2X4PB 2IH3A 4HUNB 1QEWA 2NY4C 1WWCA 4OFVA 3INUH 3FO0H 3BPCA 1CXLA 4MMXC 4U6XB 5HDBF 3TH4T 3N85H 2Z31B 3HI6L 4U0QB 5ITBH 5CWSB 2AK4A 4DEPC 3CLFH 2UV3A 3UZEA 4F33B 4P2CG 3GBNL 1I3GL 3O6FD 3QIBB 3SE4C 5FOJA 3MX0A 2WUBH 2CIKA 3PL6D 5CZVH 4AK1A 4JN2A 4UTBH 3IRPX 1GPOH 5I0ZA 5HI4C 5C0AD 3FKUS 4I77H 4YHMH 5D6CA 3Q6GL 1FZJA 1A2YB 1NBZA 4PJDE 3PWPD 5DZLA 5JUEL 4IMLB 3O11B 4U0RB 5I66A 3W81A 1S7WA 3P0VH 3MNZB 1TVDA 3QBTB 4EIGB 1EEZA 5JMOC 4KKAD 4U6YB 3P11L 2G75A 4NPYA 3IFPA 1CE6A 2I25N 4X9BA 4KI5E 1E4WL 2ADFL 1UM6H 1CK0H 3SCMC 2EH7L 4UNVA 3FAXA 4XRCA 3QFJB 4Q2ZA 5D2LE 3MA7B 5DJ8A 1S7QB 4AG4H 1S9VA 4I18C 3GMOB 3MGTB 5AYUL 4F80A 3EFDL 2F54E 3BJLA 1LK3L 5TPWH 4LSDA 5D8JH 4FFYH 4MXVE 5C92A 4CU6A 2N7BA 2N56A 3GEWB 3L3HA 1A3QA 3GMMA 4ZOEA 4QF1B 4BA8A 3VW3H 1GCFA 3O4LE 2A6DA 4E0RB 3BT2H 5DD1L 4LLYA 2XRAH 4ENEC 1QO3A 5L88H 4AZ8A 1LE9A 1FZMA 3IAGC 3QZWG 1AJ7L 2BRRL 1DVFB 1F90H 2PYEB 4MXQD 4KKCC 4Z0XB 3MRRB 4JHZA 3ZDZF 1JTTA 4PB0L 1A7PH 3B9KC 5HPOA 1IT9L 3SE9L 2VQ1B 5F9DC 2C1PA 1T22A 3QG6B 3OHXB 1DQJA 3GMPA 1IC5H 3QDGD 5HGHA 3GSQA 3DX6B 4P48A 3OJVC 4L3CA 3W0WA 1A1MA 3IFNH 1ODAA 4LARH 1QFWI 4GAYA 4WUUD 5IJKC 4IRJC 1CIUA 1MCRA 3ZMRA 1TZGL 4RMUA 5E6ID 5DDHB 5E00A 3OG6B 1LO2H 3EZJB 4YDKH 4WHTA 1JNNL 1Z5LA 4D9RE 3RKDC 3DV6A 1QOKA 3BSZH 1M6OB 3HFML 1FDLH 5IFAL 3ARSA 1GGUA 4YBLB 3GGWA 2YKLH 3BPOC 3TJHD 1T1WB 4FQQA 1LO4H 1FYTD 4RMSA 2XQBL 3ARDA 3T0EA 5GXBB 1XGYL 5E5UB 1JK8A 1NDMB 2VZTA 5KVDL 4M9OA 3M1BA 3L3DA 3Q3GA 1S7XB 1AR2A 1QLEL 2AV1B 4ORGA 4C4KT 1P5VA 4L4VD 1DQLH 2YD5A 4NWUH 4ZUUB 3P4NA 1NAMA 4L9LB 2R69H 3DRTA 5A2KH 4R0LA 3PGCB 2F9BT 4HWZB 4DQOL 4FTVE 3LKNA 2V17H 3UC0H 1BQHG 3QUZD 4JHAH 2WBJA 3FQXA 1P7QA 2ZNXA 4OD1L 3SDCC 3MUJA 2DIJA 4HHAB 4S10A 3S8WA 5C08D 4P4KA 4PJXA 5D9SB 1WK0A 1PG7H 1QD0A 4L3ED 1MHPL 5GS0L 2ENYA 2DIAA 4MSWA 3OGCB 3VXQA 3NAAL 5CUSL 4MCYA 4ERSH 3EOBA 1RUQL 1V7NL 4C54A 3KYKL 3DPBA 3EGSA 1NFDE 5ESVB 2Q76A 1NSNH 1ZHNB 3RZCD 1GOGA 3WNPA 3U2SB 3RRQA 2BX5A 5EU5B 4OQ1A 2VJXA 1AQDA 4C56D 3RWDA 4G43B 5HI3C 4JFFE 4NSKA 4KRNA 3LH2L 4CNIB 4X8JA 2ORBL 4MDJB 2MWCA 1SEBB 4AEHH 4LU5H 3MC0A 3F62A 3HN3A 3KPNB 5DC9B 1XCQB 3TJEH 3MRDB 2D7PA 3L5XL 4Z76B 5FYJU 4ESKA 3MCKB 3SKUD 4P59L 1QFWL 3G08A 4MAYC 4QRRE 5K9OB 4TSAL 4WHDA 1DEDA 1K6QH 3OKOA 5JHDB 4BQ8A 1IL1A 3TN0D 2HRPL 2NY0D 3DMMB 1XIWA 4M5YL 3SHSA 3RWGB 5JPNB 1D5IH 4MJ5B 5EIVA 4LSPL 4H5SA 3OX8A 2GIYA 3MCLL 1YPZE 1BX2B 3N1GC 4YNYA 4JKLA 3SJVA 5BS0E 4PJBB 4LHUB 5F7NC 2AJVL 4U1HA 4F7TA 4LFHD 2XTJC 4PTUB 5DZNA 1QRNB 4JM4H 5BRZB 4XCFH 3ZL4L 5IKCB 1FNHA 4K2UL 5IROA 1N64L 1G7HA 3VWKB 3CFBB 1FFOB 2R56H 1JFQL 1TZIA 5DA0B 4DJMA 3RIAF 4HKZB 3TC9A 2YBRA 4I0PD 4K3JH 2XI9A 5CGTA 1Q94A 3DVGB 3HHRB 2ESVA 5TF1H 1IM9A 1RJLB 3G6AB 4I48A 4V1DE 5I30L 4JPKH 1E27B 4QXTA 2XY2A 3HZVA 1JGLL 5EUOF 3CVHB 4XI5C 4Y19E 3S36X 2A6JB 1CT8A 4HH8A 4Z7UF 1MLBB 3KHOA 3QWRD 1RUPH 4OFIA 3UBXG 4A6YB 3S36L 3ES6A 4JKPH 5ESQB 4F7MA 1BD2A 3MBXL 2VN7A 2F53B 4X83A 5CSZA 5J56B 4DOHB 5F8RC 1CBVH 2YK1H 2WINB 3PJSB 3TBWB 3CSBA 3VA2C 4R90L 5DYOA 3QCUH 5EOCL 1U3HB 1SBSL 3I75B 3NIGF 3RVVD 4HUXA 4ZAKC 2H2SD 3RAJH 4NRXA 1BBJA 2R2BB 1A6VL 5DLMH 4EUPB 1HH9A 1NCCH 5ALBH 1BIIB 4J3WA 3GSNA 1IBGL 3MUHL 3MRJB 4JDVA 2DQEH 4F2MB 4YO0B 1CDCA 1U8JA 5AZEH 1TTUA 3C5SA 1PGRB 5LJYH 4HXAL 1J5OL 3T77B 4DCQA 3BO8B 3GDBA 2IBZX 2AK4D 3ULVC 2Y07L 2XZZA 1GGIH 1TJHH 3MRCB 2W07A 5I75C 4GMSL 4AENA 1Q9WA 2XZAL 5D96B 1QKZL 2P4AB 5HHOE 3HC0A 5D7KD 1CD9B 1L6ZA 1A7OL 1AGCB 2AW2A 5EU7E 4Y2DC 1GL4B 4FQJL 2HH0H 4G3YL 3NFSL 2YPVL 3T0BA 5L7XL 5EFIA 3PWPB 3BAEH 1U8HA 2P49B 1PQZB 3FQTA 4Z9KB 4HKXB 1YEFH 1QBML 5E99L 5JOFB 2O93L 2Y6SD 3FRUB 1Z9SA 4QRSB 1S9KC 1WZ1L 3GMNB 3VGEA 2KKQA 3VCLA 3MLUH 5JIKA 4LLQA 4GQPH 3BQUB 32C2A 5HHNB 5B4MC 1BZ7B 2DLHA 3L3GB 4MHHI 3UO1H 5I1KL 2CRIA 2NY7H 3ZYZA 1I1FB 2NY1D 4G8GD 3IFLL 4NUGH 5DD3H 1L4IA 4YX2L 2KZ1B 4N8CH 5AEAA 3MBEA 1J1OL 1DUZA 3MYZA 1U2HA 1R24A 4M1CC 4MD5A 5BVJA 5T1LA 2H9GA 4OCRL 1K2DA 2G9HB 3BISA 4P49A 3PNWA 4JPVL 4OKVB 4QHNB 3WLWD 1VENA 1HHGA 2BOBB 2QR0A 5AD0B 1ZS8A 4JANB 1CL7H 3JTSA 4U6VH 3DETD 3RNQB 1J0JA 4HJGA 2OSLB 4CRPA 1KJ2L 4QO1A 4HZLB 3G5XA 4PG9B 3VXUE 5DRWA 1C5CL 2AJ3A 4MA8L 3M8OH 4CKVX 1KPUA 2P8PA 4X4XA 1OTUD 2PNDA 3LN5A 3OKKB 4PR5B 4RCAA 1XGUA 5DHYA 1UADC 4JLRA 4JFEE 2FSEA 2YD9A 3QDGB 5F44A 1J11A 4P5TA 4LASL 2YSSB 2MCPH 4P3CH 1JN6A 5CD3B 3CC5B 2A9ML 3BZ4A 4N0UB 5D7LA 4ZPTA 4AIOA 1MCOL 5LXGL 2ZCHL 3TBSB 1TPXC 3WYRA 3ZTNL 2WBKA 4U3CA 1HYSD 4NOBA 4ZO7A 4OLWL 3TLRA 1ND0A 1OAXL 2Y5EA 3OR6A 3QEQB 1XGPA 4P99A 1P2CB 2NQCA 1WT5A 3TO4A 2JELH 3WNKA 5AG9A 1INDL 1KEGL 4LSRH 1H8OA 1U3ZA 4ZFFB 4L1DA 4G80B 3NVQA 3K8MA 1A3LL 1I7RB 3BP4B 2L0DA 4ODHH 1SEQL 3UYRL 5ICZA 4XPFH 3REWA 3C60A 2N4IA 1OF2A 4UDUA 3QULA 4P23A 1ZHBA 1IKFL 1MCCA 4D3CL 1RUAH 4RAUA 3NZHL 4HS3B 3C08L 2Q20A 4U1GB 1T89C 1QNZH 1I85A 4NKDB 2FGWL 4UAOC 5L9DH 2DQCH 1B88A 3CVIL 3HE7A 3GJFB 4WFGD 1CFVL 2CUHA 1DN0B 1RIUL 5ERWB 3EHBD 3QO0B 4FS0A 1FL6A 5I8KL 3VMNA 3STBA 2DJSA 3V6BR 1IGML 3C2SA 5C08B 4FQIH 4P9MH 2Y72A 4P4KD 1JWUA 4OM0L 3HR5A 4QY8B 4Y5XC 5KVMC 1UJ3B 4YDJA 1F4WL 1AO7A 4YHPA 1NCAL 5SWSA 4QHLA 3V0VB 3DI2B 1WFTA 1JRHL 3HZKB 4MD4B 5DEGA 3RZCB 3CGTA 4X4YA 3JV0A 5GZOD 5FYLH 3DSFL 1LEKB 1CGWA 4C56B 3DYMA 1QA9B 4WO4D 4JZOA 3T0AA 4IIQA 2VAAB 4IRSD 4PJ5E 3QIUB 1KYOK 4JB9H 4O2FA 4EXPX 3E3QC 5DI8A 1BFVH 1QPPA 1N6QH 2YRZA 1XZ0B 4PLOB 5DJ2B 5I1JH 1VEMA 1T7VA 1INEL 5B38B 1HE7A 1D5ZB 3FONB 2XG5A 3ECBB 3PDGA 3BE1L 1BZ9B 4EN3A 2VWEE 5E08H 3KDMA 3MLTA 4NZUL 1XGRA 3WIFA 3NH7H 4LCWA 4P3WA 2R15A 3HMWH 1MWAB 3TN0B 5FUZL 1CICA 4DTGL 3R06B 4LVHB 1IGJA 1FVCA 4OF3A 1E6OH 4MJIE 2X09A 5H8DA 3GZKA 4HGWA 4JRYE 3N85L 2BVYA 5DJAA 3V0WL 5ITBL 1JPFA 5D5MB 4YHYB 2VDPH 1WEJL 4CMHC 3SJVD 4X7FC 1R3JB 2VISB 1Q8MA 2FIKB 3PP4L 1AHWB 2ARJB 3P9MA 5I71B 4RNRA 5BV7L 2VDOH 3S4SB 4LF3A 3SDXF 2ICWB 3BKJH 4P57A 3HZMA 2VITB 1S8DA 3U30C 8FABA 2F5AH 2X1QA 1I9RH 4X6BB 1UXWA 4I0PB 3QPQD 5ID1B 1RZGB 5KOMC 4OIIL 1QRKA 1AP2B 2BNQD 1Q9LA 2Z92A 3FT2A 1IM9D 3P3YA 5LCVL 1A02N 4J1UA 2LTQB 3QIWC 1QSFD 1RUMH 2DLFH 1IEAB 4HWEL 4QYOB 2PTTA 3VFOA 4GG6E 3FZUD 4O5LL 5ADPL 1MVUB 3GSXB 4POZC 4YWGH 1UM6L 2XA3A 1DE4B 4WY7H 4KGLA 1CK0L 4PS4H 1II4E 1C08B 1MREL 5HY9A 1JCKA 3MRFA 5JW4M 4UOW0 5C07A 3THMH 5IEKB 3VJ6B 1IAIM 4AG4L 1WBXB 2WUCL 4H1LG 3O0RH 3ZDXF 1JBJA 3V4PH 4PJIA 1EEQA 3WMSA 4EJ1C 3MV8D 3L9RB 2P24B 5D8JL 1BZQK 5IUSA 4AMKL 3RP1A 3GRWL 3JVGC 3ZSTA 1OPGL 5HBBA 5DT1L 3ZE2F 3T3PE 2BSTA 2LQRA 2OK0L 3K3QA 1M7IA 1NGYB 1U8IB 2CDFA 4S1DC 3VW3L 4L5FH 3O6MH 1JGVH 4PRHD 4EI6A 4BH8B 2XRAL 1B6DA 4WI9A 4YGVA 4DZBB 2AQ1A 5EOTB 4R2GB 1MNUH 5D7JB 1T0MB 2V7HB 3MO1A 1JGUL 4CU7A 5HHXL 5FKPB 3PHQA 5IMOB 3FRPA 4JDTH 1MCEA 3TO2A 5CGMA 2NMSA 1NUGA 1T21B 3P40A 2G5RA 1YMMB 3T65A 3MLSH 4PJ8C 5F7UA 1NC2A 5ALCH 3EYFA 4PUBL 1DUYB 3WJLC 3T0DA 1GC1H 2MFNA 4OZGF 1JI2A 5D1XD 3VFNB 5DS8B 2XWJB 3SDDC 2XZQL 3VFVA 4LARL 1LVEA 2XZCH 3QI9D 1NBVH 3S88H 1MIMH 2R23A 1ETZB 2OXGA 3VWJA 3O3AA 4W4OC 4PV9A 5DK3A 1QR1A 5IJVB 5GS2D 2CK0H 2DTML 2F8OA 5EU4B 4HX1B 1P9MA 1MFAL 3I84A 5E9DE 4ISVB 4Y7MA 1IGCH 1WF5A 3RX7A 1NBYB 1I1YB 4KUZL 4HIHB 4CUCA 4G42B 5K9KB 4TUKH 3LN4B 4F9PA 4MA7L 1KJVA 3ARBD 4L4VE 3QNYB 3RIFK 2PXYA 1MIEH 1RZKH 1LO4L 5AYQA 1A21A 2FO1A 5BZWA 1S7VB 4U1NB 5ISZA 2NY1B 1KCSH 4G8GB 4FZEL 2A2QT 4KKBC 4R26H 1ITCA 3QEHB 3AS0A 4JR9H 3MBED 2AEWA 4X0KB 1NLBH 4OCLC 4PGEA 1CTOA 4RAVB 2D0FA 2NTFB 2AXHA 5JDSB 2AEQL 2NX5A 5T1LD 1AGDB 4V2BA 5K33A 3UC0L 3Q5TA 2CGRL 3NGBC 5EH1A 1RK1B 3SE4A 1L0QA 1N4XL 3EW3B 4LLVA 2X40A 4TNWF 3VMOA 3PQYD 43CAA 4QXGH 1DBBL 4F57L 4MNGB 2Q8BL 1LDPH 4UQ2A 1QBBA 5FOBA 3FMGL 3WIHA 4CN1A 5FYKH 1NSNL 2CKBH 2A0LC 3IDJA 4JFDE 4RMVA 5DEZA 5F96L 1G0DA 3QUXC 1BQLL 2H6PA 3BH8A 5TGBB 3LVEA 1RJYA 3AM8C 2OM5A 5KVGL 4U1KB 5T3XH 1EEYA 2XXMB 1LO5A 4JE4B 2QQNH 1ZLVH 4PJDF 5HHME 5A16A 4MZ2A 3TJEL 4BQCA 3HCVA 3ARTA 4GRMA 3SCMA 1PVHA 1J8HA 5GS0C 1A7RL 4ONOA 2CJUL 5FYJD 3S3SA 3O3EB 4I18A 4H20L 4G6KH 4EBQL 1DDHB 1K6QL 2G60H 2J7LA 3C60D 3MLWL 4P23D 4O02H 1A4JA 5EUKA 4HJJL 4KI5F 4L8BB 5I2IB 3G04A 3MMEA 3ALWA 4RQQB 2Y9RT 1HHIB 2F8XC 1GC1C 1MI5A 4MA3B 4LLAA 5JIIA 3CIQA 5D2LF 1AGEA 1LK2B 2DI7A 3WKML 2CXKA 3H6JA 3RUGA 3DV4B 3AUVA 4FN0A 4MXVF 3B9KA 1PLGL 1EAPB 4LHQB 2E7HA 1BFTA 2R56L 1T20A 2ZG3A 5DRNA 5EO1A 2V2XA 4WW2C 3GMQA 1S9YB 1QHOA 4DAGL 3NCCB 4KUCD 3BP7A 2F15A 4ZSOE 1RZKC 5GGTA 1ZVYA 2EDOA 4HH9B 5IJKA 1NEZA 1UFUA 4IRJA 5DK0B 4I3RH 2DLTA 3D0LB 4OV6F 1EVTC 4JN1H 4WO4B 5A3IC 3S96A 4HEPG 2XN9B 3N9GH 4IRSB 1FFNA 3VFPB 3FO9B 1AFVL 3DSNA 3PF2A 5T3ZD 2R0KL 3BDYL 4JZJB 1CL7I 1CBVL 3H7LA 1F3JA 4P5KA 4XNQB 3QFDB 1MCWM 3QCUL 4KTEL 5FA3B 4YK4B 4Q9QH 1W72B 3O45B 3K7UA 1PDKA 3QXDB 1LQSR 3GHEH 1M05B 3RAJL 2AK1H 3ZLQC 2IPTH 2WWMD 5JHLH 4U3XA 5ALBL 3AVEA 2AJXH 4ONHA 3QAZB 3QUYC 2DQEL 4KC3B 2R1YB 1RZ8B 4XWGH 3FT4B 4NKOB 4G6FD 1U8MA 1B4JH 1F4HA 5D7KE 4CVZA 3L95B 2DDQL 2QBWA 2JB5H 1I8MA 4CDGC 4L8DA 2YR3A 4J8RA 4Z7NE 5EC1B 3SDCA 4QWWD 5IGXL 1KELH 1KXVC 4WU7A 2OI9B 1I1CA 2VXSH 4RMWA 1ZTXH 2GJ6A 5DVLA 3E6FB 5AWNH 4GRLB 3KPMA 1QLFB 5D1ZD 4YQXL 4PJAA 3D5OF 2AABL 5IMKB 1TLKA 4K94H 2EDNA 1NL0L 3U1SL 1VFBB 5DRZB 3SKOA 3ELAT 5H35B 3GO1L 3WFCH 2LABA 5DJYA 3DVIA 3IXAB 4J23A 1L0XA 3NCJL 2BNQB 1KPRA 3PE9A 1QFHA 4HKBA 3QHFL 1KLUB 5GSVB 4WFEE 1J0KA 1N2RB 1F11A 2FECL 4GBXD 5CZKA 1QSFB 3STZA 5GSRA 1IGIL 2DQFB 3G6JB 1Y6NR 2Z35A 3BJ91 3CVHL 1GSMA 4H1LH 4X80H 5DSCA 3MJ6A 3MLUL 4BELD 4Z7VB 4PJ7B 5D2NC 1EDQA 1NFDF 4K7PX 5ILTL 3HTLX 3NCYS 2NY2C 4D0CA 2GKIA 2VZUA 3UO1L 2NY7L 1XF3B 4K7PL 3C5ZA 4WHCA 4XP4L 2R0ZL 5DFTA 5C07D 3HMXL 4MAYA 5DD3L 1WC7A 4Y4HC 4BQBA 4X6EB 5GQBA 3M45A 4G7YL 1T66D 3MV8B 1AKJA 1BLNA 1U95B 3QXWA 5C9JA 1N0XL 4ODUA 3LIZL 4JG1L 2VLRA 4N0FA 5GGVY 4S1QL 1B0WA 3A67L 5I1CL 3L5HA 3EOTH 3ROOB 3OF6A 5JOPE 1K4CA 1P84J 4PRHB 3V5HA 4LVNB 5ETUA 2ZJSL 4P2OA 5INDA 4XZUA 1JGEB 5C0GB 3DXAA 2JB6A 1C12A 3BUYB 3W0WE 5J13B 4K07A 1GGBH 1NCBH 3H42H 1BPVA 1CGSH 4I2XA 1YPZF 2HTLD 3M07A 1JHLL 3HLAB 3SY0A 4GUPA 2YRPA 3LV3B 1GZPB 1FFQA 2MCPL 3P30L 4GKZB 1K8IB 5D1XB 4LDEB 1MVFA 3L1OL 2IGFL 2VE6B 3BP5A 3QI9B 3LY6A 4DGIL 4ZDHA 5HHQA 3IKCA 3KPQA 4TULH 3X3GL 5TH2B 3T0EE 4YR6A 3B5TA 4YHLH 1A9EB 3ARBB 5I74B 5I16A 3RU8L 2ZSWB 1H0DB 5IT2L 5DQ9B 3UTTD 2OL3A 4XNYL 3NCYP 1J88A 3TH2T 4ZAKA 4WFGE 4X98A 4K71B 5KTEH 3KPTA 4P2RA 3QDMA 4U1JB 1R3IH 1RUAL 1D5MB 4JJ5B 1I1AC 4QRPA 4MDIA 4PJXE 2AV7A 1HILB 2WW8A 5L0QC 1KXTB 3OKMA 3WNLA 5DJZA 3BUTA 4JY4B 1YNTB 5C09B 3N1MC 1MAMH 1N26A 5J8OA 1ZA3B 2PR4H 4JFHD 4ODXA 1OAZH 4ORZC 5FK9A 2JIXA 5E56A 3HS0A 2UWEB 3BEWB 3PABA 2ZUVA 5C2UB 1F8TL 3QWOB 4KQ3L 4MJ6B 1RZ7H 1X6LA 3STLA 4RISL 3D3VA 4D8PB 3PQYB 4HKJB 4PRID 5JR1H 4Y2DA 3MA9H 3H9HA 2ZSVA 3BW9A 1ZLVK 4F7EB 2XKSA 3SDAC 4OFYA 4X6DA 5EORH 5TDNB 5C0FA 2R1WA 5C0BA 3P4OB 4OCWH 3TGXA 1SM3L 4KWUA 2D9CA 3MNVB 2PCPB 3IJYB 4YBQD 4YDVB 3ARQA 1NKRA 3T8XA 3C2AH 4KGJA 3LZFH 4FQ1H 1KIPA 4N0CD 3PWNA 3IDGA 4TUJA 3WLBA 2AKRB 2Y4SA 3LAFA 2ZOLB 5HI5C 4BKLB 4NN5B 2H2PD 1J8HD 1U58B 4NJAH 4R8WH 4KU1A 2VDKL 4JFZH 4NRZB 4APQC 4MX7B 1MFCH 4Z77B 3MZTA 1XR9B 3PHOB 3NH7L 3UTSD 4LK4A 2HTKD 3I6LD 4XP6H 4PY7B 1FPTL 3P4LA 4XVTL 4UB0H 3T0VA 4JVPA 3WKNA 1G7QB 2EIBA 4WEBH 5HVGB 2IH1A 2GW5A 2W60B 2JCCE 1FFRA 3NCEB 3QRGL 4PJHB 3WNNA 4NC1E 4CDHA 3NZ8A 3CK0H 1FZOA 3IJSB 4PG2C 4ENED 4LKXA 4HQQL 2DBLH 2RCSL 5FO9B 1ZVSB 4ODSL 4YXKL 4GT7A 1OGAA 2VDOL 2ESVE 1U3YA 1VCAA 4KKCD 2Y06L 2YPLE 2YC1B 1JV5A 2KUTA 2V5YA 1I9RL 5JLZA 2FBOJ 1T6VN 5DMIL 4QT5A 4M48L 5D7SH 2VR5A 3U9UB 5F3BA 3EO9L 1INQB 5EU6A 2R39A 4OCXL 5CBAB 5KSAD 3QDAA 4GW4B 5T1DH 1CE1H 1BD2E 1JHKH 1RUML 1IRAY 1FGVH 1MAJA 2DLFL 4ZTOH 3QNXA 4G7VH 1RU9L 2HAZA 5DJ0A 3MRMA 4LEOB 3IETA 2BDNL 5F7MC 1JF6A 4G9FD 4M3JA 3FQRA 4ZXBB 5BV7C 1V5JA 3KPSD 3HC3L 1K9TA 1ORQA 3QJFB 1ZAGA 4PJEE 2YMXH 3O0RL 4OLXH 1CD1A 1YEEH 2IQ9H 4MNHA 3RDTC 4CN4A 4JKKA 1ZV5A 4OB5H 1K3ZA 4UU9A 1T89A 4M6NL 3RVXD 3VFSB 3O4OB 4G6FB 1U8OB 5EC2A 5F71A 1JWMA 3TH3T 4WW1B 2B20A 3SDCD 4F15C 4LMQE 5J57B 4ODWB 2DF3A 4QOKD 4PREA 4TYUA 4Y5XA 5CIPH 2HG5B 4Y5YC 3I6GA 5DFVC 1NCUA 1T6WA 4XBPA 3MV7A 2ERJC 3W5MA 2D7QA 3D2UA 4BZ1L 1AD0B 4AL8L 1KULA 3EYVB 3HUJA 1T0PB 3IF1B 5DHVB 4PJGA 1HOCB 1YJDH 4GW1B 1MIML 3C8KB 3Q6FA 1JZ8A 4WI7A 1I7UB 4GBXB 5JZ7C 4MA1B 2PW2B 3IDNA 3LS5L 5HGAB 3QB7C 1CLYH 3VXMA 5HI3D 3EO1A 5E8DH 3CAFA 3S35X 3SDYL 1TCRA 3QZWA 1T5WB 4QHMB 1KJ3H 2E9IA 1JUFB 3OXSB 5CP3H 4TUKL 3PGDB 2Z31C 3S35L 3REVA 2FATL 1FO0B 3ZYIA 5K9JL 1R3HA 3MJ9H 4EQ2A 1A0QL 4XP1H 3QIBC 3PWUB 4NKMB 1OSPL 1KCSL 3C5ZD 2NPLX 4OD2B 5DD0H 2AJYH 1FZKB 4R4BB 5D93B 3T4YA 1G6RB 5ICYA 5DHXB 3JV4B 1CR9H 1G9ML 5GRVK 4KMTL 1OAKH 4M7KH 2VLRD 5BOZG 3TZVD 2R1XA 4O51B 3HI5L 3VXTA 2D7TL 1X7QB 3DTXA 3IAQA 5LAXA 1CVRA 1S7TB 3OF6D 2N1KA 2XWBB 4U0RC 3T08A 3RFZC 2F5BH 4NQXB 2DMBA 1YMHA 4P2OD 2F58L 5D7LE 4HFWA 4MQ7B 2V2WB 3B8SA 2DLGA 3IS0X 3C9NA 3VXPA 1T1ZB 1HH6B 5EG6C 2AVGA 5TQ2H 5SWZD 2EEAA 3GHBH 5CEZE 1I9IH 1HEZB 3QQNA 4WTWA 4XI5D 5IP4A 4DVRH 4GKSB 4NZRH 3NMEA 4KRMB 3ZKMC 1U8KA 2ENSA 4XP5H 5FYJE 4KMQA 3BP6A 4BUHA 3NFNA 3TFKD 4KK9C 1Z0NA 1P53A 4LKCB 1OAQL 2X4RB 4G9DB 1A6WL 1EGJA 4NUJA 1LNUB 4J3OC 3F7VB 4AH2A 3UTTB 4N8PA 3AGVA 5D7IA 1Q9OA 1R5VB 2FX7H 1DVFC 3OMZA 5CCKL 4KZEH 3B6SB 5F7WC 1YEDB 4GG6F 4QRUA 5GGSB 3QDMD 3JVGA 1U8PA 4S2SB 1UWEL 2CD0A 1H3WM 1MQ8A 5FXCH 1L7TH 1AO7E 3ULVD 5SWSE 2D03H 2L7UA 1QBLL 1KIQB 3HAEG 3RWFA 1WBZB 2YXFA 1X5YA 5T1KA 5FECA 1YZZA 3DGGA 4UT9H 4GXVH 3VFGL 2XNAA 1I4FB 1A3RL 2OP4H 3T3PF 4PJ8A 4PRIB 4EDWL 5J6GA 5FKAA 2NZ9C 4YBLC 3WJLA 4Y2DD 3A6BL 1OM3H 1A1OB 3JSSA 4E5XB 1TETH 1U8QA 3MSPA 4XPHH 5L8JB 3SDDA 3F7PC 4MQTB 4MNQA 3FO1B 4I3RL 4W4OA 3U79A 2UY6A 5J3HC 5KSBA 2H1PL 3DIFB 3ARPA 3KR3L 3D1MC 1UB6A 2ZCLL 4P46B 1DBKL 3L7EB 1IZKA 3LDBB 3N9GL 2CUIA 2VLJD 4A6YH 5GIRB 5TJWK 2H32B 2FX9H 4L9LC 2J8UB 4O4YH 2GT9A 4X99A 3GSRA 2AI0L 3W2DL 5I8OH 4UT6H 4LCWE 4S0SD 5F7DA 3MZGB 1S9WB 1F2XK 1MCFA 4UIMB 5HVHB 3CSPA 4H8WL 2X44D 3UTSB 1F5WA 1Q0YH 3GHEL 1FHGA 5IB1B 4MCZB 4XCYB 3MYJB 1FNEA 5MP6H 4H0IA 3QEGL 4G8FA 1F6AB 1L9NA 3O6KL 1BF2A 4OCSL 3QT2A 5JHLL 1G9NL 2EDWA 2Q7YB 2EICA 1OARL 4M1CD 3UBXA 2I9TB 4KHXH 4GLRI 2PYFA 4Y4KD 5FO7A 5BOPA 2I5YL 1S5IH 2VOTA 1R0AL 3SO5A 1I8IB 4HWNA 1ZTXL 1MCBA 1YEGL 4YH6A 5AWNL 3S5LB 3QXAA 5CZXC 1UACH 5EIIA 3KS0H 1OGAD 4GSDL 4TPRH 2C3GA 4K94L 3TBVB 2D7MA 2J12B 3TYFA 4LLDA 2BRQA 1BGXL 3KAAA 2VZSA 5F6HJ 1EO5A 1MHCA 3AS3A 4FQ2H 5D70H 1JPGB 3NFPB 3SQOH 2DJUA 3MRPB 5KSAB 5KN5A 4Z5RA 4XXCA 4QHUA 3QUXA 3C5JB 1MCJA 2X4NB 3FQUB 2NXYD 4AM0B 2J6EH 3TIEA 4OQTH 2ADJB 3AM8A 3GMRB 3RHWK 2V5TA 3DMMC 1T3FB 4WFHE 1Y0LB 3BWAA 1F58H 2GITB 5FM8A 1CGUA 1I3VA 2J5LB 4G6AC 1K85A 4PJIE 1G7JB 5C86A 1NGXA 3IDXH 4JO3H 4ZUVB 4OLZH 3TPKA 4BZ2H 3PHSA 1DEEB 4F3FB 1V3MA 3BGFB 3KPSB 2VDRH 2Z8WC 4JG0H 1X5KA 5HTSA 4IRZH 4JY5H 4YDIL 1A6UH 1MCIA 4XT1C 1VACA 1CLOH 3LKPA 4UDTA 3ZKXB 1V7ML 3WFEL 5BZDA 5IVOA 1CDUA 4HIJB 3LS4H 5DJCB 1RIHH 1SY6H 5BJTB 3MROA 4OGZA 1FNSH 1BJ8A 3O3BA 4W6XB 2CDGA 3TYGH 4LGRB 4LCUB 1U93B 1VESA 2ZOKB 2BNRA 4OZIA 4RFOH 4YHZL 4P2QB 5FHBL 4Z8FH 3CH1B 4QOKB 1AXIB 4PLJD 4PV8A 5DMKA 1GGBL 3RBGA 5DJDB 5E8OB 4BUGA 5BCAA 3UTQB 2APFA 3D85A 1OY3B 2HVJB 3MRKA 1U3HC 5HGBB 2QJDA 2W9DH 2D7NA 3C6SA 1YEHH 4JQIH 5F7LB 1EUTA 4EXKA 1HKLH 5E8NA 2BC4A 1YY8A 1AI1L 1NCWL 1S9XB 1NEUA 4HWBL 1VGEL 2A38A 1UKTA 5ISZE 4JY6A 4PGBB 4JZNA 1N8ZA 5MENA 4S11A 4X7CC 3X11A 2JLLA 3F5WA 4LSVL 1SJHA 4CW1A 3RTQD 3O6FC 4R7DA 3K81A 3N1PC 1W8OA 5IQ9A 3CU7A 5CEYB 4QRQB 2DQTH 5D96C 1RVFH 2NX5E 5E8EA 1U2CA 2X4TB 4UOW1 5JIPA 2HYMA 1QLRA 2VDLL 3D9AL 1H15A 3KG5A 5IMLB 1IGTA 3WXWL 3QUYA 4I1NB 3TZVB 2NY6D 2OYPA 2B4CH 5CD5C 5EBMA 4IDJL 2CKBA 3TPUB 2LVEA 5TDOA 4OZ4B 2ADGB 3EOAB 4RSVA 3QWQB 3MV11 1ZT1B 5EZJA 2PR4L 1HDMB 1LGVA 1NBQA 5C0EA 3CUPB 3HNTL 4U49A 4Q9CA 3VI4E 5M94B 4J4PC 4KKAC 1J1XH 4XHJD 3R1GL 1QVOA 1X5FA 2R9HC 1M4KA 4NHCL 1ITBB 5DJ6B 2P44B 5JR1L 2IBBA 3BQUC 3MA9L 4XNZB 1EUUA 3IT8D 5ANMB 4PRNA 5FF6B 1FNGA 4PP2B 5JNYA 4Z7NF 2H26B 5SWZB 5EORL 1F4AA 5IR1B 3VFMA 4ZSOB 3UZVB 1EHLL 4O58H 1QBAA 4XP9H 5BXFB 3W9EA 1FC1A 2AQ2A 5SV4A 1R3KB 1UZ8A 4OAWA 1TVHA 1WFOA 4YXHH 2R2HB 4GRWH 2VR9A 5D2NA 5DC4B 4GMTH 4ZS6C 3I6LE 1S7RA 3CPLB 3D48R 4FQHB 1CFQA 5IG7A 4JO4L 3WFBL 4POZD 4IHOB 1XF1A 1FV1A 5IB5A 1NFKA 5C0DB 4L4TA 2DS4A 3GM0A 3GSOB 1WICA 5SX4H 4R8WL 4JO2L 4RMRA 3SGEH 2DOCA 3HC4L 4G6JH 1KYOJ 2MHAB 3CLEL 3T1FA 1MPAL 2DB8A 4LIQH 4MXQC 4Y4HA 2BHZA 1MI5E 1HSBB 2ED7A 2VDML 1LP9A 1ADQH 1NC4A 3WSQH 3HAEH 2F74A 3ILPB 5EO9B 4WEBL 5C3TA 3L3JB 1IILE 3RUGE 4JPIB 5FHAH 4RRPA 3TIDA 4S1DD 5EBWA 3UAJC 4HDIB 1LMKA 2CIKB 3F58L 1X4YA 3S34H 1G0YR 3GI8H 5IW6A 3U0PA 3NOIA 3WE6A 4Z18A 3MNWA 1KSRA 1MJJA 3NN8B 5F9OH 4A2MA 2OZ4L 4N9GA 4TVPL 3RZWA 5J6HA 1NMCB 1NJ9B 1MLCA 1OLLA 4AEIH 5C0CA 4ELMB 3GJEA 2KQNA 1HXYB 3WL9A 2Z8VC 1FL5B 3B5HA 2XACC 2FJHA 3SDDD 4TUOA 1ED3A 4AJ0A 5C2BH 4XCEB 1OGTA 5C7XH 4JGUA 3CFKA 3BPNC 4LPYA 2AGJL 3DVNB 4KJQD 3KYNB 3P9LA 5MHSD 2KDGA 2BSRB 2VLJB 4U1GC 1KTDA 4H88L 4Q58C 5K93A 1ZE3C 4XAKD 5JQHC 4OZHB 1KNOA 1YYLH 1QYGL 2H3NB 3I6KA 1JYVA 4F7CB 3NIDE 1U8LB 4F37K 1VGKB 4KKBD 5DUMH 1UJ3C 1YEEL 4QCIA 1HXMB 3AMLA 3VU2A 5I1LA 2FWOA 2EDTA 4U1MA 4PJFA 3D25B 1I1AA 4OB5L 5IEHB 4TNVK 3QUMB 1BWWA 2GJ6E 1KJMA 3E2HB 1YYMH 3AB0B 4K7PY 3RZCC 4PJAE 1FORH 3O3DB 3LQAH 3RL2A 3DHJA 4XB7A 1C5BH 3O2VH 4RDQG 5CHNB 4Y4KB 1E6JL 4KPHH 4PRBB 1R5IA 3GSWB 4KRLB 2FRGP 5FUCC 5CGYD 1PY9A 5BQ7A 4DW2H 4X6CA 4M61A 5JW3L 5GRUH 4PJXF 2K9UA 4EVNB 5ACLA 1T7WA 3TT1L 1ZHLA 1TQBB 2Z91B 3SDAA 1ORSB 1YJDL 4HUWA 5HYQA 5HVFB 1P4LB 2EDEA 5HHPA 3U83A 3QUXD 1D5BA 2NXYB 3TN0C 3ULUL 5D6DC 4LVHC 3DURB 4E41A 3VXRD 5IBTH 2VIRA 3OGOE 1QFUH 2YWZA 4YE4H 3RVWD 3MLRH 5I1AA 1GZQB 1I3RA 3F12B 4WV1B 1KG0B 4GXUN 4YHYC 5LBSH 3V6OC 3KJ6H 3LKOB 1A6AB 4LSUH 4U1LA 1ZGLA 1AHWC 5GS0D 2SEBB 2VLRE 2WIIA 5KS9A 4K3EH 2GSIB 4APQA 4X9GA 3DO7B 5I71C 4JGMA 2E7LC 1NDGB 5DD0L 3JWOH 2KQMA 2MQ0A 5F7YC 2CLZA 4ETQB 5FB8B 3ALXA 3BKMH 2XTJE 2VZ3A 3LKNB 1OWRM 3DUHA 1MCPL 3QDJB 4I0PC 3C6LB 5F9JA 2OLDA 43C9A 1CU4L 3DXAE 4HG4K 3MJ8A 5IWLC 2QQKH 4MZ3A 2ILLA 2LTQC 5E1AB 4ZFGH 1KIRA 4I2XE 4Y4FA 2XPGB 2Q86A 5DK2A 3CDYA 2BNRD 3V4VL 25C8L 1M7DA 1MSPA 2BVOA 1FQ9C 1CF8H 5MEPB 5TE4H 4M7JL 4WU5A 4Y16A 2QSCH 4J3TA 2JCCF 4K3DL 4J7RA 1RZIA 2R0WH 3GI9L 3OKLA 5T5FL 5FCUL 4XC1H 4HS6A 4OD3H 4R97B 1UM4H 3BKYL 1JL8A 1P1ZA 3FOMB 1IQWL 3RVVC 2Z8RA 4XVJL 1FIEA 4BSWA 1BAFL 1M71A 1MCSA 1YC8A 1T04A 3IU4L 4AQOA 2QV2A 1NCDL 3L3KA 4PJ9D 4ZQKB 3FB6A 2FEEL 5BVPH 1DFBH 1UVQA 4HCRH 2P48B 3S3JA 5B39G 4DKDC 5MEND 5IMMA 3IVKB 1WAAA 5IQ7H 5L2KD 3T2NH 3GUTB 2X4OB 3KYOA 4P2RE 3QDME 2D0GA 2X1WL 3RTQB 4R2GC 3B2VH 2X6MA 1KEML 5D7JC 1PZ5A 4QRPE 3QG7H 2BNUA 3CJJA 1DQMH 1L7IH 3LHPH 5JMRA 2W65A 5ID0A 1UQSB 2XKUA 5TDPB 4DKFH 4KZEL 1NUNB 3RDTA 4PRDA 4FNLH 5CJOH 3ULVE 3PGFL 1FNLA 4LRNH 2VL5B 1F6FB 4MXWH 2V9QA 3EAKA 3FB5A 5ITFB 4PB9H 3HG1A 4MB3A 4LGSB 2BHUA 3AROA 1FVDB 4XTRD 2FZ3A 2JCCB 4U6HB 3D3VE 4PJEF 5INCB 3T2OA 4M02A 3O8XB 3U4BL 3NTCH 2Y6SC 3QQ3A 1CFSB 3CSYA 4JO1L 4P5MA 1FE8H 4UT9L 5T33H 4X6DE 5E1HB 4Y5YA 5C0BE 3QQ4A 2IAMB 2OP4L 4UBDD 2ESVB 4AIZA 2ZP0T 5IVXB 2YPLB 3PWLA 3GFUA 4NQDA 5ADOH 3VXSA 3WDJA 4XMPH 4LPWA 4GG8A 4PRPA 2HLAB 3E6HB 5DR5H 4N8VB 4HW6A 2NY1C 2YRLA 4S1RH 5TE7H 1OP5H 4KK6C 3VFWB 1LE5A 5GRZA 2X4PA 4LCIH 2W9LA 3U0WL 1CWVA 4UIKH 3TT3L 4U6XA 5I8OL 2Z31A 3BHBB 3DX7B 1MF2H 3U46B 5B3JE 5CWSA 3BDBA 4Y0GA 4I8DA 3RVUD 4HUXB 1H3VA 3UPCA 4F33A 2EIZB 2BXYA 5FGBC 3QIBA 3DETC 2E9BA 1QTYT 3D69B 5E94B 1LO3H 2MQCA 3MLZL 3N50A 4PJEB 4PYHA 1JF1B 5GISL 5EDXA 3VGAB 2OR9H 4E42B 1OGAE 2NY5H 4R96B 4IOIB 3LEYH 4JFOB 4IMLA 3UYPA 3NA9H 3O11A 4XMLH 1T80A 2GJZA 3KPRD 1A6TB 1A5FH 3MRGB 3MNZA 1R5WB 1T03H 7FABH 1E4XH 1GHFL 2D31B 4U6YA 5E5RB 1YDPB 1Z0MA 2EXWC 3K2MC 5AUMB 1KGCE 5EU6E 3DLQR 1DN2A 4JAMB 4JM2D 5JQ6H 3T04D 1I8LC 3FQTB 3LPWA 1GGTA 2KBGA 4JDZB 3QFJA 3MA7A 1S7QA 1AH1A 3GMOA 3MGTA 1G9NC 5DEFB 3H3PH 2DWDA 4F8TA 3IFOB 4XVSL 3MUY1 3R8BB 4PLKD 1F3RB 4DN3H 2I9LB 3I9GH 5IW1B 1HKFA 3AXLB 4QF1A 2MPAH 1NMBL 1NLDH 2B1HH 3O2DL 3TWCH 3K2UH 4OGYH 4E0RA 4HPYL 2AEPH 3EHBC 1XGTB 2MJWA 3DUUB 3WNMA 3SKMB 1DVFA 2PYEA 4P4KC 4Z0XA 4Z7QE 3MRRA 4HGKC 5HYSB 1QACA 4M43L 4GO6B 3JV5A 4C83B 2VQ1A 5E2TL 3KLHD 3QG6A 3OHXA 2FL5B 3GSNH 3SE8L 2FH6A 3UJIL 5GJSL 3DX6A 4KRPB 1FNSL 4NNPH 3DROB 1KCVL 3HNVL 4O9HH 1TTGA 3N0PB 5EB9A 3G5XB 2HP4A 1FJ1B 5GZOC 3W39B 2DQJH 1WTGT 3QCTH 3SO3B 1P7HL 3MV7E 1BJ1J 5DDHA 3GSUB 4EI5D 2W9EL 1KCLA 4KFZC 3KWWB 4WO4C 3O41B 4NNYA 3HUJE 4IRSC 3FHQA 1M6OA 4PJGE 3CU1A 5TF0A 5CP3A 5MI0B 3WFDL 4JZJC 1T1WA 1UA6L 4EIZC 3MJ9A 3VXME 4QEGA 5SX4I 3TV3L 4TQEH 3IKKA 1RJZB 4YK4C 3QHZH 3SDAD 3E3QE 5B3NA 3FRPG 1NDMA 5E2VH 1S7XA 5GS2H 2AV1A 1MFDL 5L8LB 3BN9D 3VXRB 4WVRA 2IAND 3QAZC 4KH2A 4UZGA 4ZUUA 1XF5B 4L9LA 4B7IA 3PGCA 3H9ZA 3SGDI 4HWZA 3BMWA 2X5PA 2W0LA 2NY5C 4X4ME 3LRGA 5IB3B 4ZS7H 5I6XC 4XPTH 3V52L 4K8RH 5KSVB 2H41A 2OI9C 4DN4H 5D9SA 5DGRA 3OBAA 1SHMA 4GRLC 4ALAL 4RX4A 3UJJH 3OGCA 4JHWH 4X7TB 2VNCA 2VABB 4LVOC 4TSBH 1TFHA 3QPQC 2VXUH 3C8DA 5ESVA 4LQFH 4K9EH 1HINH 1ZHNA 3OL2A 2EZ0C 3WV0A 3U2SA 4JFPB 3BIAX 4L29B 5EU5A 1VPOH 4M5ZL 2ARWA 5DTFB 5H2BB 4G43A 3MLVH 4Y4FD 1TJIH 2VYRE 3VD9A 4CNIA 4RBPH 3E1F1 4MDJA 3FZUC 1SEBA 2BXZA 4Y16D 3TBTB 3KPNA 1XCQA 3MRDA 1UKSA 3QH3B 2AJZB 2X2YA 4Z76A 3FCTB 4RGND 3U0TB 1C7TA 4N0YH 3MCKA 2GI7A 5T1MB 5K9OA 1UXSB 2Y36H 5JHDA 2E9JA 3OJDB 4KKLC 4XPGH 1I8KB 4PJ9B 5L6YH 3DMMA 4OLVH 3RWGA 1XEDA 3RY4A 2VLKD 5JPNA 2ZUTA 1AIFB 4MJ5A 2MQ3A 5CEZH 1Q1JL 2R2CA 5D7IE 1BX2A 1E4JA 1HZHH 2VN4A 1HNGA 1JZ6A 3R8QA 3MLTB 4PJBA 4LHUA 4Q74A 1KTKE 4LCWB 5HPMB 4PTUA 5FYJH 1QRNA 3HZYB 5IKCA 3KPLA 3UP1A 2B2XL 2X4UB 3CFCL 3ORJA 1S3KL 1XCTB 1J18A 5CJQH 4NQCD 1D9KD 3CFIC 1E4KC 5F7FA 2J88H 3VWKA 4NC2B 3CFBA 4BFIB 1J8KA 3LSOB 2DL9A 1FFOA 3WSQL 5EZOH 4QHKJ 4HKZA 5ENWB 5CLWA 1YA5A 1H9VA 4HPOH 4WTZA 4DKAA 4PJIF 5MEQA 4I4WB 1ZSDB 5JDJA 3DVGA 2X7LB 5D1XC 4ODVH 1RJCA 1RJLA 3G6AA 1E27A 3HG1D 5EZLB 3MOBH 1KENH 3FFCB 3CVHA 3QI9C 2HMID 4UNUA 2GK0B 4ZTPL 4P57B 1KN4H 2IALB 3GI8L 4Y1AA 2EDDA 4EDXB 5BO1H 5ECJE 2A6JA 1OP5K 1MLBA 4HZAA 4DZ8A 2P7TB 1Z6JT 4A6YA 4KK8D 2W0PA 1EJOL 4MNQE 5ESQA 3KGRA 5DFVD 2F53A 2P1YA 4AEIL 1FRGH 3LKQB 5KSBE 3ARBC 5I74C 3HMXA 3UTZB 1LO0H 2WINA 3PJSA 4WFFD 2C3WA 4LBEB 1U3HA 5IF0B 3S5LG 1OVZA 3G5YB 1P6AB 2GFBB 3I75A 2PTTB 1MRFH 3O2WL 8CGTA 4K71C 4KQ4H 4LOUD 1KB5L 2R2BA 4TOYL 5JZ7D 4EUPA 4ODTH 4G6MH 1DBAH 1BOGB 4MAUH 1BIIA 2DAVA 2DKUA 3JWDH 3MRJA 4UILH 5DA4A 5T3ZH 4YO0A 3FQNB 3S9DB 4JRWA 4XAWL 3T77A 3BD4A 3BO8A 1NEZG 3AY4C 1ZLSH 3MRCA