3QHZL

Crystal structure of human anti-influenza fab 2d1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
216
structure length
216
Chain Sequence
PVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVSWYQQVPGTAPKLLIYGNNERPSGVPDRFSGSKSATSASLAISGLQSEDEADYYCAAWDDSLNGFWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An insertion mutation that distorts antibody binding site architecture enhances function of a human antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Human monoclonal antibody del2D1, Fab Heavy Chain
total genus 49
structure length 216
sequence length 216
chains with identical sequence M
ec nomenclature
pdb deposition date 2011-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qhzL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qhzL01
5F7LB 1B0RB 4EEEA 4Z7VB 3RZWA 4F80A 2AQ2A 1P7KA 2V5YA 5D5MA 1NKOA 4LAQL 5J1SC 2ITDB 3NZ8A 5ISZD 3DBXA 2B5IB 1YQ2A 4JQXA 5D7IB 1NUDA 5GGVY 1NAKH 1OM3H 1YYML 5FF6A 1AO7D 3NGBB 1BFVL 3PQYE 4KDVA 1SJEB 1NBYA 3AREC 5DK3A 4XX1G 5CJQH 2XOTA 2W07A 3ULUF 3X3FL 1I1AB 1DBKL 2VWEC 4QHMB 4L3EA 4KRMB 4PG9A 5ADOH 1LE9B 1X9QA 4XVJL 1IJ9A 4DN4H 2GI7A 4MCZB 4XNQA 1Q72H 3D3VB 4JRWA 5DJ8A 1A7QL 4FFVC 3RWFB 2VLMD 5E99H 2IAMA 4OGXH 1UM5L 3MZGB 3VFRB 1FV1A 2FO4A 5L2KE 1LK3L 5HDOA 2XY2A 2JE8A 1PZUB 2OTWA 3AMLA 3C60C 5BV7L 3FRPA 1FGVH 4XXDB 1PX3A 4R3SB 3WJLA 1C12A 5F96L 5F1NB 4LIQH 4APQB 4ODXA 4NM8H 1CD9B 1BM3L 1G0XA 3MUGA 3S34H 3VXRD 4MZ3A 2BRQA 3QJHA 5K9OA 2L4OA 5IOPB 1PFCA 1E4XH 1FORH 4FTVA 2E5EA 2X7LB 4ZXBC 1X5ZA 3MJ6A 1EHAA 1FL6A 1G1YA 5C6TL 1XIWD 1RIUL 2Q7YA 1RFDL 3GO1L 1SEQH 4NNXA 4PLKC 1PVHA 3P0VH 1B88A 5T33H 4PJ5D 3LQAC 4KJPC 3ZDYE 1I85C 3MJ7B 1G9NH 3U46B 3JUYA 3SDAB 2J7LA 1KNOB 3EDEA 4KPHH 2YD2A 3O6FD 3PWVA 4PS4H 2Z93A 4TNVK 3HE6A 1GH7A 3IT8D 4PJBB 3AGVA 2F74A 3MBEA 1S9VA 4Q9RL 5CD3B 5DQDL 4Z95L 5JTWA 5AG9A 4TPRL 5EZLA 4DGVH 2AXGB 2VQUA 3I2CH 5D7JC 5I16A 3CVHH 4KVCL 4RAVB 1NCCH 4P59L 4ZFFB 1B0GA 1I3RA 4ZUWA 4RQQB 4FQHB 3OWEA 1QP1A 3TBSB 4N0RA 3UBXA 3ZZ1A 3F12A 2ILLA 1U8HA 5I1LB 3DX8A 4LEOB 3VXMA 4JFDE 4N90D 3MLWL 5CCKL 1UB5B 2NMSA 3D25A 4NJ9L 1G7QB 3FTGA 4HPYH 2A6IA 4OQTA 5D2LF 2YUVA 3ZL4H 1T89C 5D6DC 5E5MB 1Y0LB 4YDIL 2CRMA 3NIFF 2NY0D 4YHNB 2PUQT 4LSSH 2C3XA 1FBIL 4Y4HA 5BVPH 4R2GD 2X4PA 1DFBL 4M43L 4KQ3L 4XP5H 2YHGA 3ZKMD 3M45A 3ARFA 1BX2B 4UQ3A 2MNUA 1QTYT 2EE3A 3MCKB 2FJHA 1BFOB 4DAGL 2G9HA 4KK5D 4X80H 3O6FB 3QXTA 2KUTA 2EKJA 2NLJB 4NQCA 3P77A 1JWMB 2PYEA 3BP4A 1F8TH 2XI9A 4RAHA 5TE6H 2P42B 1FVDB 4HKJA 2VQ1B 4CGTA 4HK3N 1IGYB 1WWWX 4NYLB 3IDYC 5IK3B 4LNRB 5IFJA 5CKGA 3TVMB 2VLRE 5KSBB 4C55A 3IJSB 2V2WB 2Q3ZA 2FCBA 1CGTA 3QUZB 4FZEH 4OLEA 4JRXB 4OFDA 2C26A 4Y2DB 1J5OL 3DO7A 4QTIL 4YHOL 15C8H 3P3YA 5KVDL 1YEIL 3UTQB 4P2QB 4X7SL 4L29B 4U31A 4FZ8H 1T22A 3OKNB 3ARBA 3WS3A 4Z7NF 2CXKA 1OP3H 4ETQA 4ERSL 1X7QB 1NMBL 5LQBH 4DUWA 4PGCB 2EIZB 4XP9H 1ACYH 5T1DH 2ATPB 5LCVH 2AABL 3FB7A 1YN7A 2WINB 3QXAB 3NA4A 4PGZA 2RIKA 4NN5C 4Q0XL 1F6FB 4BA8A 1EO8H 5JW3L 2ZSVB 3SPVA 1QLFB 5DDHB 4TNWF 1I75A 3T0WA 3SKJH 4I0PB 3DUUA 1MI5D 3TVMD 1HILA 2EDDA 3LN4A 1FFPB 4PJGB 3WL9A 4ONHA 3QNYB 3LKQA 4AG4L 5H37G 1CGYA 3O4LE 5BW7A 3TA3B 4GO6B 1F11B 1HXMB 1BOGB 3MUZ1 1PX4A 4PJ7B 1UB5A 3FB7B 1AXTL 3SDCB 4UI2A 4OLVL 3NMEA 4XNMB 4WY7L 3BEVB 3VFGH 5L88L 3D85D 3QZWA 5JA9A 1YJDL 2IANE 2R0LL 4NWUH 5DYOB 3IS0X 4NUGL 5IFHH 1RQ5A 2FJGB 4RMUA 2P1YA 4AH2A 1EGJL 4HMEA 2VSDA 1BLNA 1CFVL 2QQNL 4CVUA 4PJGA 3WL9B 1DEEB 2J5LC 5GRJH 3DXAD 2QR0B 4AQ1B 2HH0H 1MJ7L 2QTEA 2X42A 2WV3A 5J11C 1DSFH 1L0QA 2A74A 4JM2B 4Q9QL 4Y1AB 3RZCD 1GOFA 5FM5M 5EIIB 1C8PA 2X7LA 1WK0A 1NH6A 1KENH 4KK9D 1VACB 2P5WB 4K94H 5F88B 1M7IB 2G75A 4KZDH 1LO5B 1FNEB 1XGUA 4GOSA 3G08A 1K6QH 1OGAA 4G8FB 5IJKA 5E00A 4RDQF 3PNWA 4XVSH 1D5MA 4XAWL 3CLFL 4X6DF 5HHOB 2YUWA 4NKOB 5C3LD 1CLYL 3PIQB 4OGZA 4P48A 3PGDA 1JYXA 3LQZA 4LRIC 4QRRB 2C1OA 2HT4D 2BVTA 4TSBH 1OQOA 1INEH 3FTGB 5IMKA 3U30B 3U48A 1RZ7H 1BGXH 1L9NA 4MAUH 3WSQH 2QSCL 2VZSA 1RAMA 4CW1A 1J12A 4KHXH 3MYJA 4PG9B 2I5YH 1CG9A 1KG0A 1IL1B 1RU9H 3FQRA 1E4JA 4WTXA 1WT5C 5J7CC 3HZKB 4GKZB 4G5ZH 2HJLB 4RMRA 2BOCA 4XMPL 3GB7B 5E00B 2AEQL 5E5UB 1C1EH 2NW3B 4WI8A 1JWSB 3FQTA 3MACH 4MXVE 4WWKC 2Z4QB 2VL5B 4OLXH 4XPHL 1T5XA 2BX5A 2W91A 2EXWC 2IGFH 5JDSB 4OF5A 2XNAA 4LEXL 4D9QD 4XZUA 5B3JF 4P2YA 2X4SA 4D0DA 5I76B 1A3LL 3QDME 4HH8A 4NKDA 5DVMA 1DDHB 1NLBL 3ARFB 3IJYA 1OP3K 3WN5A 2IEPA 3HLAB 1FCCA 4HXAH 3U6RA 4IRSA 2QQLL 1FL6B 3OZ9L 1SY6A 3NCJH 1UWXH 3REWB 5BQ7B 5LGKA 1CD1B 1T1WB 2MPAL 1P4BL 3M8OL 1Y18A 3AMKA 2H3NB 3V5DA 1EDQA 3W2DH 4MD5B 3HE7B 2FR4A 1HHHB 4NQEB 2AXGA 3Q5YA 2YPVL 4M4PA 3DSNA 1IT9L 4L8SA 3WS6C 3RKPA 5DXWA 4MJ2A 4NPYA 1FLRL 5D7KD 3UZQA 5HVHC 5D6CA 5TQ0L 5B39A 3TWCH 3MX0A 1JK8A 1P4LA 3MRCA 4HWZB 4ZO8A 4ELMF 2CKBL 3UTSE 4OFYD 1U58A 4M02A 4EOWH 3QBTB 2DQJH 2M8XA 3CX5J 2QHLA 1KN2L 4QY8A 4X6DB 3PWPD 4NZTL 2FYYB 1N3NA 1NGXB 3RIAK 1KYOK 3QRGH 4Z76B 2XIDA 4NKOA 2VDRL 5INDB 3HZMA 3MV9A 4MHHG 2ZP0T 4K7PY 2VB5A 3VA6A 2O5YL 2IPKA 1CTNA 2CK2A 3TT1H 3P77B 4BSJA 4C56E 2COQA 4E41D 1IL1A 3FQRB 4NIKB 4MMXC 3P4MA 4R9HA 4P57B 2F5AL 2CJUL 4PJCF 4HJ0D 1GIGH 1OAQL 1RZGB 3G6JB 3WFBL 3RTQB 1OF2A 2VISA 4R0LB 4YAQA 5JQ6H 5F6HI 5TQ2L 1R5IA 4L9LB 1N64L 3REVB 1P6FA 1PKQB 3RY4A 1OP5H 5EU6A 3VFPB 5JQHC 4MD4B 1HHIA 3GMQB 1JL8A 5T1LB 4QXGL 3MV7E 1LMKA 3BAEL 4MX7B 5E2UH 2EKSB 4YXKL 2B7DT 1MHHA 5I1AA 3IDYB 1RK1A 3ULUH 4OUUB 4PGDA 2NYYC 4Y19E 1CFTA 3CSPA 1P1ZB 2CKNA 3FQNB 3S5LB 4BFEA 3JV5A 3WIHL 3MRQA 1RUAL 3VWKA 4JJ5A 1OGAB 4LVOC 4ODVL 1I8IA 4QRQA 3VXTA 4Y16C 4LLDA 4PJ5B 3HAEA 2VJXA 5D72L 4P0DA 5ICYA 2PYEE 3EYFB 3NCYS 5SWSE 2DMBA 4MD4A 5E2WH 4PJFA 3GHBH 1WVZA 5I1CL 2VN4A 4JQVC 1FNHA 1KPRB 2MMXA 1GGIL 3CLEH 1DLFH 3A6CH 1XCQA 3H9SA 5I9QB 3GRWH 4F7PB 2AQ1A 1G9MH 2XG5A 4M7JH 5F7NC 1T1XA 1Q94A 4MDJA 2A6DB 5HHPB 3KYAA 3OJMB 3VH8A 2E7HA 3VXNA 3O8XB 1CYGA 3GGWA 3QIWB 4FNLH 1U8LB 3DSFH 4KUCF 4MA8L 3VXUA 2P7TA 4QLRA 5T3XE 5BVJB 4JO3H 1JPGA 3H3BC 1BAFH 4NUJB 2X2YA 5FYLH 2UZXB 3IDXH 3WIIH 1Q9LA 1WIOA 3HMXH 3WV0A 2OR9H 1JF5A 3QDMA 5DJ0A 3IAPA 4Z7WE 2E3VA 1PLGL 4FRWA 1MCSA 4I2XB 4N9GA 5HGDA 1LO0L 3EIFA 4K7FA 4OCLC 4F7PA 2DD8H 5DJ6A 3WIFB 4R4FH 2I24N 1XCQB 3H9SB 4JY6A 4L29A 1KCRL 3WN5B 2VC2L 1S7TA 4N5ED 3BIKA 1R3HA 1SEBA 2ZWLT 3O3DA 4Q6IC 1SYVA 3T65A 2ZCKL 1RJZA 3KPOB 2H6PB 3O3EA 3P9LB 1F4HA 1ZT1B 1P4IL 2MQCA 1KCUH 4J3WA 2X1XR 4AIOA 1IC5L 5IWLC 2XQBL 3TO4D 2HKFH 2WBJA 4KH2A 2BK8A 3WKNA 1J0YA 3S4SA 2GTWA 4M7ZC 2Q8AH 4LU5L 4P49A 2IPTL 3MA9H 1E4WL 3PDOB 1YYLH 3ZE2F 2JIXB 3Q0HA 5GS1C 1BQHA 1PEWA 1A9EB 2DQFA 1A5FL 4FFYH 1C5BL 2BNQA 3C8KB 4LCYA 4XTRC 3BVNA 2DLFH 1GGBL 2HYMA 1YNLH 1CL7L 3UTSD 4KV5E 4H1LB 3QSKB 4WHCA 2J8UA 4URTB 4C56D 1YMHB 2C3VA 1NBQA 1BJMA 4OCYL 4XBEH 4PBWD 3W82A 1MEXH 1ORSB 1JN6A 3P0YL 2DL9A 3W0WE 1IAIM 3UJIL 2D0HA 4MSWB 4OZ4A 4ZUVB 5JHDE 4DFIA 5EC1B 2NW3A 4I4WB 4EDWL 3MRLA 3STBA 2I9LB 3S36L 2NX5B 1GHFH 3I9GL 4JY4A 3SKOB 1MHPH 3PV6A 4KY1H 3ARBB 1HKLH 1MCEA 3O4LB 3IDNB 5BOZG 1RD6A 5JMOC 1HI6A 3MREA 4JLRA 5BV7B 3IXTA 2BSED 2FZ3B 4KVNL 4NQED 4MLIA 2NY5H 1C7SA 5AG8A 2H26B 3MRNB 3SDCD 1AXSB 1UKQA 4GAJH 2D7NA 43CAB 2NXYC 2R29L 3G5VB 3MCG1 2BNRE 1OAKL 2ZJSL 3VI4F 1S9XB 3FRUB 4LPUA 5IHZA 1JGVH 4X8JA 1FH5H 3X17A 3JV6A 5DI8B 3J8F7 3DGGB 3VFOA 3NN8B 1NDGA 5SV3A 3H9ZA 1QKZL 1WIUA 3V4PH 3T09A 4GAGL 3WHXB 2DM2A 4EI6A 3EO9H 4DOHB 1MRFL 2QEJA 1ADQA 4P4KC 5FUOL 3UZVB 3KPPB 4XNMA 4QRPB 4IOFD 5HDBE 3HN3A 2OTUB 1PW3A 3TCXA 3BKCL 4JDTL 3TNMB 4I9WD 2W9LA 2E9JA 4N5UA 3V5KA 1G6RA 5BW7C 2NR6C 3BKJH 1EEZB 2FX7H 4PJFB 4HLJA 3O4LD 5B38B 4PYGA 1B9ZA 1WCBB 4E41B 4NC2B 4H8WL 4JRYD 4PRDB 4UTAL 3NTCH 1NUNB 4QXWA 4QKXB 4LHUA 4DUVA 4M93B 2XNAB 1MCHA 3I50H 3QHZL 4RFEA 3WHXA 4ZSOE 1A7BA 5D2NB 3HI5L 2YUXA 2BSRB 5FCUL 2F9BT 1LD9A 5DMIH 3VXQA 2EDNA 2PETA 4QRRD 2V17H 1RIHL 4XC1H 1LQSR 1YNTB 4UILH 3VH8B 1ZT7A 3DVFA 3SBWA 2P44B 1WBXA 1J87A 1UA6H 3UTTB 1MFBH 1M7XA 2OR8A 1FRGL 5CWSA 1N7ML 3FB5A 4LCWA 3BYTA 2DQHH 5C0EB 4RISL 4FN0A 4J7RA 3AROA 3MRHB 1L6ZA 1MHCB 4I0KA 1HWGB 4HC1H 2QSTA 2D7OA 2FX8H 2EDXA 2NY7L 1ZOXA 1J8HE 3H9SD 4OD1L 5EZJB 1FC1A 1PGRB 4GQPH 4F58H 3FAWA 5E24E 3K1KC 5J12B 3QFJA 1FGNH 3IXAA 4X7TB 3FQNA 5EUOE 2VZ3A 4GKZA 3S8WA 2BY2A 1XR9B 3GKWH 1J1OH 2FIKB 1FFQA 3W0WD 4UINH 5GS1A 2BC4B 4AZ8A 3BGFC 1D5BA 1NGXA 4LPCA 5J9PA 3G6DL 2X1PA 3EUUA 5ILTH 1MQKH 3RL2B 1J10A 2FBJL 5HI4D 5TDNA 2EDEA 4PRBA 4AL8H 3LV3A 3ROLB 1SBSL 3NCYP 3B9VA 4G80A 4POUB 4J1UA 4UU9B 4LARH 3V4VH 3HC3H 4V1DA 3T3PF 4OLUL 4MD0B 4WW2A 1NBYB 2JKXA 1V3KA 3R06A 2O5ZL 2HFGL 3LRHA 1M6OA 5CZKA 3U9UB 1WGOA 5T1KA 1RUMH 3F12B 1XFPA 4XPGL 5IFAL 4PJAF 4R2GB 1YUHA 4MVBC 4OZ4B 3IU4L 4YEEA 1KB9J 3QHFL 4JFHD 4PRDA 3LB6C 3MNWB 3NBNA 4D9RD 1N5AA 1OB1B 4L4VB 3TA3A 2Z8WC 1DQDH 4OGYL 2VXVH 3MLRL 2AV7A 2VH5H 3RDTC 5KAQG 3U7YH 3NOIA 2W60A 3K81A 4H25A 4AT6A 2LU3A 5DJDB 1MJ8L 4YBQC 5DHVH 5ALBH 4QF1B 1RZ8B 3EOYG 5IOPA 1XF2B 4LAQH 4ZPVA 4Z0XA 4QNPF 5H35B 1GJIA 4YBLB 3I84A 4AEIH 1I9RL 5DURB 3VWJD 3MRCB 4HWZA 4LHQB 3R0MA 3KDMB 5A16B 5DWUH 2IG2H 2JTDA 1BVLB 2YD6A 3JWDC 2GSGA 3MRMB 4A6YL 3TBVA 4FFZL 4JQVA 1UZ8A 4M7KL 5EFIA 3QNXA 5F7WC 3FQUA 1NCBH 4PJBA 5L0QC 1CK0L 3BW9B 5GS2D 1CCZA 3LZFH 4F37F 1NL0H 2F74B 4Y16A 1QBMH 3FQXA 5E99L 4MDIA 1UM5H 2WM0A 5D2LA 4MNGE 1QSEA 4ZAKA 4L8BB 4P2RE 3U9PL 4YC2C 3HNTH 5F70A 2YXMA 3DECA 5F96H 1DE4B 3QI9A 3KXFA 4LIQL 4I0PD 4OCXH 1R3IH 1I9JH 3S34L 3DROB 4YJZL 4I3SH 1Q9LB 4D0CB 3BMVA 2Z92B 3JWDH 3LD8C 3P40A 4BZ1H 4N8CH 5DDHA 1QFWH 4AENB 1RIUH 1RFDH 5IWLA 1LDPL 5GJTL 5T33L 4GRMA 4IM8A 5EO1B 3H9HB 4PGDB 1BX2A 4UQ3B 3RGHA 5MENE 5DRZA 1T1ZA 1IGIH 3LHPL 5HYIA 4F8QA 2NR6D 1LEKA 1E6JL 2C3GA 4Q2ZB 5A2LH 3HCVB 1PEZA 2X10A 1ZVHA 4OIIH 4XWGL 1F2QA 4TPRH 3L5IA 5JO5B 4MNHB 1TZIA 1I7TB 4WHYG 4YHPB 1JF1B 5GRYA 1MJJB 4UBDD 3UTZB 3RNQB 2J6EL 3CH8A 4IDJL 2ZUSA 3RAJH 4PRHD 4G6ML 4LL9A 4O2FB 4JO2H 4FOMA 4JRYA 1WF5A 1G7LB 2DWDB 3ZL4L 5AYUL 1RK0B 3QIBB 3D39D 4NQDE 2UZIL 3LKPB 3C5SB 4HIJB 6CGTA 1FBIH 1ZGLA 4PUBL 4M43H 3DYPA 1CR9H 4H1LA 4OSUL 3QCTH 4DKFH 5HYJB 1P84K 5JO5A 2WIMA 4LSQL 5IBLD 2A6IB 2P5EA 2LTQC 5C0CA 4WI3A 5FO8A 1CZ8H 1EZVY 3BE1H 3B2UD 4P4KD 1T03L 1HHHA 1JZ5A 3V4UH 3BD5A 4JFXB 1WAAA 5ESAB 3UTPD 2E6QA 4DVRL 4NPYB 3GSUB 5EBMB 4NKIL 1IAKA 4YIQA 5CEZL 1P5VA 5MERB 4NDMA 1KJVA 1I1CA 1C16B 1Q0XL 4I18C 4ZAKC 4CMHC 3KPNB 1FO0A 2AW2A 3VRJA 1HHGB 2WNGA 2FR4B 4XCEA 3KPOA 2DLIA 5F6IB 1DE4A 1FZOA 5AUMA 1OGAD 1FVCA 4PJ7A 3AS2A 3MRNA 2OL3A 4R26H 3D9AH 5EZOL 5CMAA 3TN0A 4I77L 3HC0B 3LDBB 4QCIB 5FYJU 5LQBL 2VABA 1U58B 3FN9A 1AHWA 4TRPH 4XP9L 2XFXA 2WWMD 5LCVL 3I85A 4LOUC 5HBBA 2R69L 2VOTA 5I8KL 3TBTB 5GRUH 1S5IL 2L7UA 3O6MH 5ESQB 3GSQB 4M6NL 2A0LD 2GEEA 1A7RH 2CRYA 4MJ6B 5I2IB 1RZIB 2C7UA 4Q6YA 1FQ9C 2NY2D 4C4KT 3JSSA 2P7TB 5GGQH 4CBPA 2B2XH 3ZHLA 2MTPA 4PD4J 2FD6L 4DUXA 5E2VH 5FGCB 4HUUA 4JFFD 3AS0A 1ZANL 2AS5M 1OGTA 3DI3B 3W11D 5TGBA 1LP9E 2O61B 2R1XB 3TCLB 4KHTL 5BS0A 5C09E 3SJVD 4WRLA 1FPTH 3RVUD 2FGWL 1AXTH 2ZUQB 4EN3B 1UQSB 1A21A 2YRLA 3EGSA 3PNWB 2NQCA 5IHUL 3UEZA 1G7MB 1X5JA 2PTVA 3RTQD 2VLKD 2VLKE 5I73B 1W72A 4D2NA 3LSOA 1XR8B 1TXKA 4PJEE 1FE8H 4ORGB 3F7RA 2JK5A 3TBWB 3INUH 1YY8B 1OCWH 5I8EB 1EGJH 4DGYL 4Z7OF 5CD5D 2XXMB 1AKJA 1OARH 2BHYA 1N0XH 4XMLH 4J8RB 1QSED 4HGMA 1F90L 4PG2C 2EEDA 3K4AA 3MBEB 2HH0L 3FRUA 4ETYA 1Q9WA 3CFCL 2CH8A 5SX5H 4J3VA 4XCFL 4ZD3L 1A6AB 1S7RA 4Z7VA 3QUMB 3JV6B 3FONB 3KXFD 3V6BR 3O11A 4PB9L 3MGTA 3LN9A 4HT1H 2GITA 1KGCE 1JPST 1UWEH 4PGBB 4NWTL 3DPBA 1J88A 1VHPA 3D1MC 4M9PA 3T2OA 5DEFB 1MJUH 4LVHB 3PG2A 4OCWL 4LQ1A 1MCQA 1MLBB 3CU1A 2AEIT 4MCYA 1OD7A 4P46A 4U1LB 3IJHA 4X6CA 2BVPA 2XTJB 3E3QE 4FQ2H 1M7IA 2FIKA 3RVVD 4TSBL 4UOJA 1IM9B 3IGAA 5GZOD 1INEL 1IC4L 4KKNA 1B90A 3PQYA 1RZKC 4HGWA 5J1TC 1HQRB 3FN0H 4BELD 3OXRA 5CBAA 4BQBA 3QQ9D 3PF2A 4HX1B 2BDNH 2Y1VA 2YEZB 1HCVA 3ULUE 2X4PB 3UPRA 4G5ZL 2H32H 4M5YH 5HYJA 3BX7C 5FKAA 1BP3B 3G5ZB 2AEQH 2L0DA 1TTUA 3P30H 4RAUB 1KACB 1CXKA 2R0KH 4LCUA 3RL1A 4F7MB 4OT1L 1BJ1J 3JWOC 1R0AH 2HT3C 1A3RL 1KXVC 1U93B 5FOBB 1A3LH 1QQDB 1D5ZB 3OKOB 2VE6B 3MRKA 4PV8A 5TDPB 2JJWA 4U6YB 1JWUA 4E0RB 2A9MH 1LK2A 4G6JL 3EOBA 3KYMB 3PGFH 2MFNA 4HD9A 4OI8A 3RVTD 1A6PA 3T2NL 1S9VB 3QDJE 4GRLB 1PYWB 4Y2DA 5EH1A 3QWOB 2Y06L 1AQKL 3GHEL 4F9LC 5IVXB 1MCWM 2HT2C 1AR1D 3U6RB 2QJDA 4ZPVB 4Z0XB 1U41A 2OBGA 4KK5C 4QHMA 3T1WA 1LE9A 3WLBA 4P2RB 1ZAGA 3PP3H 5T1MB 4JDZB 1KCSL 3SY0B 1MHEB 2PW2B 3CFKA 2BVOA 3RVXD 3NZHH 3GMPA 2VUOA 1FLRH 5FAAA 2YKLL 4QEGA 2FIRT 1I1FB 1FNLA 3FFCE 1NJ9A 1MY5A 5C0DB 5KVFH 2GSIA 3L1OH 1JGDB 2AJXH 1AFVL 5L9DH 3U30C 3VXUD 2Q1EA 3MUGB 1F6AB 3ZTNH 5C3TA 4APQA 2ED7A 3PP4L 4KKCD 3RDTA 1NSNL 1SJXA 3S35H 1GXEA 2FX9H 4OUUA 1NC4B 4XRCA 2DQCH 1BVKA 4OZHB 3TO4C 3NCBB 2OP4L 4N0UE 3SJVE 4LLWB 5F7UA 4M7LT 5FYJH 2ZUTA 2IMMA 2PO6D 2AQ3A 2H26A 1ZVSB 3TT1L 4PJ5A 1KCLA 2YBRA 5ELIA 4ODSH 4G8GA 4KKLD 1NBVL 1OY3B 2CJUH 5C0IA 4PJ8C 1I7RB 5FA4B 5GS0C 4RAVA 2AV1B 4U1HA 5GRWA 3U7WL 2YN5A 4YXHH 2M1KA 3NCFB 3H42H 4LQFL 4U1IB 3OR7B 1YECH 3PJSB 4ZO6A 1PQZA 5E2UL 3BAEH 3HZVA 1ULVA 3VD9A 1H0DB 4IMKC 4NSKB 5DTFB 3SGEI 4L8CA 5F6HJ 4M4RA 3DV6B 4BH8A 3ME0A 5E8DH 5EU6B 3VFPA 4Z7NE 3ILPB 4JM4L 2R4SH 1I1RA 2YBRB 1VFUA 1B2WL 1P84J 3IDJA 3WIHH 1Z3GH 4XGZB 4R3SA 3OJDA 3U1SH 5CJ5A 2A73A 4XI5D 4ZFZB 1ZT4B 4GAFB 3GMRB 2A2QT 1UH2A 3ULVC 1DBMH 4QHLB 1FAIH 5HHOE 4Q6IA 2ZNWA 3CUPA 4LCIH 3CDGB 1L4IA 1U8OB 4K3EH 3UCRA 5CEZD 2PTTB 5I2IA 4AIZA 5DJZB 3C5JA 2X4UB 3BOVA 1TDQA 1HSBB 3DMMB 3TH4T 4WU5B 1IKNC 2EDHA 2D7TL 1ZT1A 4X4ME 4RFOH 3U4AA 1T1YA 5FYKL 1G9ML 4FQ1H 3HE6B 3MV7A 4JPVH 4CW1B 2P5EB 5C0CB 2YPLB 5ALCL 2BFVL 3LEVH 4JQXC 2AK4B 2RJMA 4JRXA 5I1HH 32C2A 5FF6B 4MJID 5E8NB 2CIIB 3PWNA 5F7YC 2X4TB 3L5WB 4PLOB 1WEJH 4RIRB 1NCWL 4TNWK 5MENA 1CIDA 3QDJD 2OI9B 3UZEA 2ERJC 2BNRB 3IS1X 3OAUH 3IDXL 1U8JB 4HWEH 1C16A 3T3PE 1JHTB 1OAYL 2H1PH 1ZWIA 5IIEB 4NKDB 1NGPH 4JQIH 1M05B 2DD8L 3VG0L 3S97C 3GRWA 3QXDB 4PREA 2DQEH 1KCRH 3QXAA 2IQAA 3T3ME 2IQ9H 4IRZH 5GGRA 4XVTH 3UTZA 4M6OL 5DUML 3QUXA 4GUPA 2V7NB 4WFGE 5DJYB 2LV4A 4JDVA 5C07B 5KANG 3VFNA 5MHSD 2F19H 2VDLH 4U1NA 5F9WC 2AEPL 5FOJA 1H3GA 1P4IH 4K8RH 4U1MA 5M95B 3P9WB 1EUTA 5EUOA 3FFCD 2BNUA 4KFZC 5BZWB 3N1QC 1NFDE 1MF2H 1XF5A 3L3HB 4GRWF 3W0WB 3BSZH 3TGXA 3HHRB 3PIQA 4AQOA 1E6OH 4P3WA 4F57H 4WV1C 3SCMC 1NLDH 1EAJA 3MA9L 5FGBC 1TQCB 1E4WH 3O4LA 1HEZA 5DTFA 1T04B 2YA2A 3EJJX 3ESVF 1ZSDA 5E2TL 5KOVC 5E1AB 3QR2A 5IFJB 1NAMA 1TZGL 2GUOA 3FHAA 3DLQR 1CL7H 5C8JB 4JKMA 3D6GA 1I8LC 5INDA 1YUHB 4RSVA 5JHDD 3GDBA 5SWZB 1KXQE 2OQJB 4LVOB 4XHJD 4NKMA 3MV8E 1FZJB 2VL5A 2YRZA 1RJLB 3R1GH 3MRHA 5D1ZA 1A6WH 4NO3B 1DANT 4Z77B 1C5DA 1DN0A 3UJIH 1XEDA 3QJFA 7FABH 2HLFC 2X4OA 2OMNA 3QP3A 2BSTA 4K9EC 4KGJA 4BSWA 2BRRH 3AREA 3FCTA 4KMTH 1VESA 3LIZH 1TITA 5CP3H 4MB3A 1U8KB 1GHFL 3GI9L 1MUJA 3G9VA 1MHPL 4KY1L 3KJ4C 3R0NA 1BVLA 1U9KA 4R96B 1FZJA 1DR9A 1KELH 1JJUA 4LVEA 5JIIA 3GSQA 1Y6MR 3IU3A 3MUHL 5HHME 2RBLA 4R8WH 3CC5A 3HPJB 3QO1B 1GSMA 1YDPA 3EJZD 4PJGF 3O3EB 2E9BA 4HV8B 1L7TL 3IRZA 2R8SH 4RGNB 3CVIH 3MNZB 1UM6L 3O3BB 5CINH 1JK8B 1P4LB 3OAYK 4L8BA 1QKZH 4ONGL 2MKWA 3JZ7A 1MNUL 2AERT 2VAAA 2DI9A 1TVDA 1BIIA 1EAPA 2HTLD 4UNUA 3L3OB 5MI0B 2BNUB 5E03A 4AH2B 1P7KB 5D96C 5FFLA 2R2EB 1CF8L 3BKCH 3CDYA 3K8LA 4X7EC 1SY6H 4NZRL 1CGVA 1UACH 5KG9A 4MA7H 1WWAX 4UTBL 2Q6WA 5IW6A 5IESL 2Q76B 3TNNB 2DQTH 3NA9H 4NQVA 5DRXB 3EYOA 1OTSC 4CVZB 4H8WH 4P9HC 1ZT4A 3NGBC 5IQ9B 3I6LD 1NEUA 5T3ZL 1WCQA 4QHKJ 4KKBC 2P47B 3DETC 3Q1SL 3IDGA 1E0OB 5EO0A 4UUJB 4LEOA 1GYAA 3L3OA 4OF0A 2EE2A 4PY8I 1NCUA 3H9YA 1CFSB 4BFBD 4U0RB 1IZJA 1R3JB 5DEGB 3VCLB 5EN2A 5ANMA 1QLEH 3WUWB 1K3IA 2ZCHL 3GBML 1FZMB 1YZZA 4CU8A 2I27N 5E08H 3SE4C 5H94B 4M6ML 4MD0A 5KVEL 2QHRL 1U92B 3MROB 1ONQA 4PJXA 5ICZB 3E8UH 5DUPH 4W70A 3WJJA 4Q97A 1MLBA 5DHVA 4U1KA 5TFSH 2WP3O 3GB7A 4DQOL 2R4RH 5IJKC 5ESVA 3T2PA 1V05A 4JHAH 3LS5H 3V6OC 1AGCB 2YZ8A 2ZUQC 3C2SA 4JEGB 3S3SA 1MCCA 4NGHH 4D9LH 3C8KA 3ZTJG 5BXFA 1F4XH 1VKXB 2VZVA 5I1EL 2ID5A 3GKWL 2EYRA 4QXUL 4FMFA 1VB9A 5E0QA 3QIUC 3H9HA 1IAII 1BBDL 2ADFH 4UDTA 5GJSH 5KS9A 2ICWI 1A4JA 1XCTB 3RFZC 5J8OA 4Z78B 1OLZA 5GRVK 3MV9D 1AKJB 2FBJH 5ETUA 3QFJB 5C2BH 4QTHB 3GNMH 2BNRD 3BDYH 3WFEH 4X9IA 3IF1A 4XNQB 4M1GH 2NX5D 2G75B 1FYTB 4JHWL 4M62H 4E41A 3V4VL 4X4YA 1FN4B 4PJHA 3UO1L 4K94C 3MRPB 4PTTA 4LASL 2A6KA 2DQGH 3WBDA 2HFGH 4HJ0C 3D39B 2YPKA 3CFIC 3TN0B 3W9DA 1FVEB 2FATH 1ZLVH 4MDIB 1BF2A 5K9OB 5JHDA 4FXLA 4D9QE 5B38G 1AXSA 2HT3D 4MB4A 3OF6A 4R4ND 3DV4B 3MXWH 3O0RH 4LRNH 3C08L 5FGCE 4Z77A 2X4NB 2LQRA 4OZGB 5D1XB 2G60H 4KDTA 1WZKA 5ISZA 5D93B 1PY9A 4G9DA 3VWKD 4WI6A 3WXWH 3FCTB 1Q0YH 2EH7H 2NY2B 2W65A 1BZ7A 2XPGA 1KIUA 3SDAA 5I8CA 4GRWB 4NO0B 4AEIL 3A6BH 5FKPA 3ULVL 3PHOB 5CUSL 4XPAH 3A0OA 3EO1A 1E27B 3OPZL 4DKAA 1EERB 2W60B 4H25B 4F37K 4KJYB 3RVVC 4L3ED 1MI5E 3RVTC 4EI5A 2Y7QB 3HLAA 4P2RD 1NCBL 2IPKB 3IYLW 4FP8L 3WNPA 2J8UB 1HDMB 3OJ2C 4I0PC 1HOCB 2X1WL 2W65B 1X5IA 3VFUB 2OTWB 3DYOA 4DK3A 2VDKH 3KJ6L 4DEPC 1EX0A 3D85A 5EA0L 1F2XK 2N7AA 4C4KO 1JN6B 3U9PH 3PWJB 2VXTH 5IROC 5FEBA 1VGEL 3MFFA 4E41E 4XXDA 1CLOL 1S7XA 3MLYL 4YH6A 3IDUA 1RK1B 2E8YA 4UU9A 1A4KA 4S1DC 1NCNA 4Z7OE 1BVZA 3I6LE 2VSCA 4O2CB 4CL7A 1CFBA 1J8HD 2JJUA 4QRSB 3AM8C 43C9A 3JWDL 1N4XL 1DP0A 4GW5B 3I3DA 2APBA 2ARJB 3PXHA 3AB0B 5I9QC 1CFSA 1U8NA 4CDHA 3HI6H 5ICYB 4JAMA 2V2WA 3HE7D 3RJQB 2LFGA 2WBJB 2VLJD 1C5CL 4ZOEA 4CADA 2UWEB 2EEAA 3GMLA 3KLDA 4Z8FH 4PJXF 4MWFA 4U6XB 3ESUF 1JVKA 5DMYA 4YX2H 2OL3H 5D2LE 2VIRA 3OKMB 3U36B 1DDHA 3V9FA 5IVZA 5DRNB 3W39B 1WZ1L 1NMCC 3AB0C 3G5YA 5F6IC 5I1DA 1N59A 3B9KC 3O3AA 1SJVA 1OP5K 1IC7L 2R39A 3GMMA 2XTJD 1A1MA 4TQEH 1H3PH 2CXGA 2HJFA 4F3FB 1M71A 2FJFB 3MYZA 4XPFH 1GCFA 1MCRA 1OAUH 4NDMB 4M7LL 1JGLL 2QADC 5CSGA 4AIZB 3L3JA 5BVJA 1KIRB 4HW6A 3KPRD 1G7QA 4G6MH 5BS0D 5EOQH 1NMCB 1G7HB 2ENSA 4U3XA 5EZIH 4GKNB 2D7QA 2PCPA 5HHMD 4J3SA 2PO6B 2Z8VC 1JUFB 5CILL 1FFOB 2WUCL 4LCCB 4O5LH 3RVWD 2HRLA 3T77A 3BD4A 1CR9L 2CDGB 5HDLA 3MJGX 3IFLL 3HG1D 5SWZA 4MA1C 3BGMA 3GSNB 3O2VH 3MJ9L 4U49A 2VZ1A 5C09A 3QZWG 3S37X 3BE1L 1ZWIB 1SMAA 3QT2A 3O4OB 4XI5C 5BZDB 2ICEA 4DTGL 1P9MA 3L5HA 4DZBB 2FSEA 4XCNB 1FZKB 1KPVA 1GGCL 4BJLA 1TJIH 3BHBB 3UJTL 4U6HA 5E4EC 5CEZE 4O51A 1FNGA 3I6KA 4OJFH 3PWVB 1TCRA 1DBAH 5A1AA 3EAKA 3GBNH 3KS0H 3ARUA 2W0KA 4WJ5A 5KVMC 3UYRL 2CSPA 4YDLB 5F3HB 5A43C 2HTLC 3VRIB 5CEYA 4EN3A 4KK9C 4GSDL 3T4YB 1XH3A 3OX8B 4N0UA 1LHZA 4Q2ZA 1FG2A 2DDQL 1W0WB 4PRPE 3PWLA 3VXNB 5GHWH 4WGVB 2OK0H 3WNMA 2QQKL 3L3KB 3GMOB 3FO0H 1EBPA 4TRPL 4D3CL 4EXPX 5C71A 2Z91B 1K3ZA 3DUSA 4GKOA 1DQQB 3HG1B 2Q3AA 3H7BB 5I8KH 4DKEH 3KWWB 3S5LG 1GOHA 1YMMD 4CKVX 2H41A 3L3GA 3DO3A 2AJSH 1SHMA 5GGQL 1S9WA 2WWKO 4U6VH 2MCG1 2FEDD 3UJJH 1RJLA 3EO0A 2XFXB 5LGHH 4NP4H 3BISA 1NUFA 1H3TA 4WFGD 2R0WH 2AXJA 5KSAA 1GZPB 2KPNA 4S1RH 3GSRA 2GT9B 2W59A 2G2RA 3DVNA 1F11A 3FQXB 5EUKB 2HFEA 2XICA 5AWNH 4X4XA 4ZS7L 1UEYA 1FL3B 1IAOA 3QO0A 5ACZB 3NIGF 3DVIA 4U1LA 3MC0A 4RGOH 4P2RA 2V6HA 5F7EH 1DANU 1YY9D 1ZEAH 3A6OA 4ONFH 4XHJC 3O2DL 3RIFF 2R2CA 2AGJL 3HZKA 3U79A 1FSKC 1P7QB 3CFDB 4ELMB 3N1FC 3WFHB 1A22B 4ODHH 1W0VA 1X5LA 4S1SH 2G5BA 3INUL 4QRSA 4UOW0 3DXAA 3DI2B 2CLZA 1D9KA 2A6JB 3OKEA 3FOMB 1CL7I 4Y4KA 1QVOA 3GSNL 4LLVA 5BO1H 3GSVB 3WFDH 3CFCH 4FQQB 4AIXA 2W0FA 2NY1C 1G9MC 2PN5A 3SKMB 3OGCA 1BQLL 2VDPL 5JPNB 5FGBA 1LO2H 3QIUA 5T5FH 5DURD 3VWJB 4Y4HC 3IXAB 2Z31D 4U1KB 1UWEL 2CIKB 2EDRA 5FOBA 2EDOA 4WI7A 1FNEA 1XGUB 3QFJE 5F1OB 4QRTA 2QKIA 2JCCA 5F88A 3LKRB 1JPSL 1LE5A 1DBBL 1FYTE 4GMTH 4PJDA 3NH7L 1KSRA 5HI3D 2HAZA 1SEBB 5C0JA 1CD8A 2Y4SA 2CUMA 4RZCA 3RVWC 4NZUL 3QCVH 3EW3B 3MOAL 5GIRA 3V52H 1T2QH 4KK8D 1F42A 3KPLA 4Q9BA 5EC2A 4P3CL 3HS0B 1CDJA 1LNUA 2KBGA 4RX4A 5J11B 1S3KL 2IAMD 4GKNA 1DQMH 2BMKA 2HT4C 2XN9E 4X99A 4OB5H 3L9RA 2BVPB 4WCYH 3IJHB 5I19H 1TVHA 3CCHB 3BYYA 3BZFB 3FB8A 5T1KD 5I0DA 4YHYB 5IB1B 1T80A 2BOCB 4G7YH 4IRJD 3D69A 3PXJA 3NACL 1MWAB 4ZSOA 3VFUA 1IEAB 2XZAH 3LQMA 2VLJA 3HNVH 4TVPL 4HXBL 4OV6F 1KEGH 4WEMB 4AENA 5C0BE 5EORL 2J88H 2XKSA 1FZMA 3AS3A 1XIWA 3UTQA 4ELME 1AGEB 3RL1B 4G6JH 3W5NA 3MNZA 3PGFL 4X6CE 4ORZC 3MRJA 3LH2L 3M17B 4UB0L 4XC3H 2EXWD 4YDVB 2V9QA 3QQNA 4GXVH 4YHLH 4ALAL 5TJWK 1UWGH 2IH3A 2XXCB 4GW1B 4WWKD 1INDH 2XWJB 2XRAH 2K7QA 5C09D 1RHHB 4HBCH 2IBZX 5CGYD 3TZVB 5H8DA 5CSZA 1HZHL 1ZV5A 2Z8RA 3DARA 5AUMB 4HUVB 4HF5H 4LOUD 5E6IA 4HZLB 3QDJB 4S0SD 3RJDA 4NFDA 5I8CB 3MGOB 3V0AC 3VFMA 5HI4C 1KN4L 1RUQL 5CMAB 3UC0H 4OLYH 1MFEL 2CMRH 2BSSA 3L3IA 4G6FB 1MHHB 1KCSH 4OM0H 5C6PB 3N06B 5IMKB 4V1DB 3NZHL 2VXQH 4Z78A 3I6GA 5LGJB 1XIWC 4Y16D 4UDTB 4P5KB 3SGEH 1OWWA 2IH1A 1XH3B 4EN3D 3CMGA 3V0VB 4MJ6A 1EH9A 3PWPA 1YEDA 4J3UA 4WEUD 2X40A 4P23B 4ZAKD 5IG7B 3MREB 4ZFOA 2YSSB 2VDQL 3GMPB 5DVLA 2VDOH 4NJAH 4UQ2A 3CFKB 4CUCA 5IMLB 1ORQB 4PJ8A 4WNQA 3PP4H 3K2UL 5FM5O 3QZWB 2DQCL 2AV7B 4K23L 3MCLL 4S2SA 1YDPB 3BRDA 1Q72L 3QFDB 2BSSB 3L3IB 1BQUA 3ZE0E 3KPPA 3LKSB 2HT2D 3V79C 4FG6D 4OV5A 3STLA 1AKJD 3CH1B 3FO9A 3GFUA 3WD5L 5IJVA 4WW1B 4Y5VB 2NZIA 3MRBB 4L3EB 3P73A 2OXGA 3UTTD 1I1AA 5I74B 1FFRA 2CK0L 3HMWH 3MRGA 1TTFA 1DEEA 4XNYH 2R2HB 5TH2A 5F97E 1TETL 1YMHA 1JPFB 1MLCA 3B9KB 1I7TA 1IGFH 2VYRE 5HDQL 4P9HL 4U6YA 1A8JH 4DK6A 1G7PA 3Q6GL 4JFZH 5GSRB 2BY0A 5HD8D 3EJZC 4I13B 4N0CC 4NQEE 4N0YH 3HRZA 3ZYOA 4J4PA 35C8L 1YQVL 3RIFK 2XKNB 3BESR 3GO1H 4JANB 4C59B 1Z0MA 3KYNB 4JFYA 4ODXB 5LWYH 3ALPA 2PXYA 1U3HC 1G6RH 1S7RB 4TUOB 1I3VA 3STZA 2G5BB 4KPHL 4PS4L 1M71B 2FJFA 2R4SL 4XX1E 3RQ3A 4YHKL 4H8WC 4I3RL 5E7BA 5LBSH 1AJ7H 4NN7C 1Z3GL 3GJFA 1WIPA 5CEXA 2ESVD 4F9LA 5EUOF 3FKUS 1IQDB 4RNRA 1YEHL 2WQRA 4ZUTB 1T20A 1NCCL 5LVEA 1JFQL 2D03L 1AC6A 3VCLA 1KNOA 3EDJA 5AEAA 5JIHA 2Z92A 3QIUD 2ZZUT 5EOTB 2YEZA 3EDFA 1TNMA 3E6FB 3MLZL 5GIRB 4HIIB 1OWRM 1MAJA 3MJ8B 4KTEL 3HZYA 2FHCA 4F7CB 1W0YT 4RFOL 4KGLA 3PQYB 1ZHLA 4GAYA 3K2MC 3NFSL 5ALCH 2WIIA 5KZCD 4BQ9A 2X4UA 5D70H 2ZUXA 4Y5VC 1HHGA 1DFBH 1LVEA 3FO1B 3QEHB 4XP5L 4ZTPH 5FDWA 3VXMB 1C7TA 2DOCA 4WTWA 4XP1H 5JA8B 4X80L 4P2OA 2XN9A 4ISVB 2OTPA 4JRXE 4MHHI 3BXNB 1F00I 3GK8L 4BFGA 2GK0A 4HEME 3JBG7 4QHKI 5JW4Q 3QUMH 1BFSA 2ADIB 4RA3A 3F6IA 4Y7MA 3FB6B 3QEUB 1AC0A 5CEYB 1M7DA 3FN3A 4MXVF 3V7AG 4P46C 5SWSB 4A2MA 2EIDA 1R3HB 3AC0A 4JFDB 3SKOA 4U1JB 2X4OB 1PQZB 3CVHA 1DL7L 1XIWB 3QDAA 2Q8BH 2WBJD 1NDMA 2YZ1A 4ZFGL 4YGVA 3ARDD 5TDOA 2Q87A 1CU4H 3D0LA 3CZFB 3RU8H 4M1CD 1BZ9B 5HD8C 3BSZL 1S7UB 3C60B 2XT1B 5DHYB 5KW9L 1MH5A 4WU7B 2LE9A 3FO2B 1RHFA 4JFFA 1XGTA 3G6AA 1S9WB 1QNZL 3N9GL 1HWHB 1XF3B 4JKKA 4YHZH 5F9OL 4QY8B 4P3DA 2AABH 3NCMA 5JW5A 4I48B 1M7DB 5D1XC 4WDIA 3L3HA 5JW3H 2X9WA 5HHPA 2OZ4L 1VEPA 1A7NL 3JTSB 4PJBF 4H26B 4PD4K 5KOMC 5ITBH 5KS9F 3D3VA 2V5TA 3SKJL 5FK9A 3RTQA 1KBGH 4I8DA 3U0TB 4V1DD 1KJ2H 2BERA 1LGVA 3GSXA 3VI3F 1CDGA 2NY5C 2OX5A 2CDEA 1RZFL 3LY6A 1T3FA 1IC1A 1KLUB 4UT9L 4BFIB 1IAOB 2WBWB 3QO0B 4LFHG 4ZO9A 1KEMH 3N0PB 1KFAL 3T0VA 2BRRL 4WY7H 1TMCB 2XV6B 3SEPA 2YPLD 1CGWA 3T4YA 2OS7A 5FO7A 1GGTA 2WIIB 4MQSB 1A7OH 1SYVB 2B39A 4J6RH 3GMNB 1JHTA 3GIZL 3HR6A 1YEJL 4HIEA 1G84A 3CGTA 2V2TB 2W1NA 3JV4B 5ID1B 1U42A 3VDCA 4XNXH 3BXNA 3B2UC 4IBLT 1ZT7B 1MRDH 2CD0A 3HUJB 2C3HA 3MSPA 2HLFD 4UUJA 3ZDZF 4CJ1A 5EO0B 2WWMC 4F7TB 5IB5B 2FJGA 2IADA 3RPIA 3SQOH 4F9PC 1CE6A 4IJ3B 4HH9A 2LVCA 4PJ8D 1P7QD 4PLJC 4YPJA 3B8SA 4KKLC 4OFVA 2F53B 3MLUL 3JTTA 1KLGB 2ZUUA 2GSIB 1SJHB 2RQ8A 3MFFB 2Y23A 5B22A 4ENED 4NO5B 4XGZA 3V0WH 2ESVE 4MQTB 4X5WA 2V2TA 4KROC 3OAYH 3GKZA 4H88H 4Z5RA 4XVSL 3D2UB 1LWRA 4S1QL 1W72H 5KANI 1JZ8A 2IC2A 5IROA 3VGGA 4I18A 3O9WD 5FXCH 1CLYH 3FOLB 4UTBH 3MLXH 4PRID 4NQTA 5FUCC 1I7ZB 3QG7H 2DQTL 3V6OA 5DRNA 3W39A 4I0PA 1CLZH 4WI4A 4M61B 4GBXC 4OI7A 1TZIB 1G7LA 3KYKL 1KIPA 3B6SA 2Z35B 4O00A 3BW9A 1CGSL 3QDMB 5DJ0B 3QDGB 4HQQL 4YZFE 5BRZE 3RWEA 2VIRB 3GMOA 3OGCB 3OKMA 4RMWA 5BRZD 3U36A 5GGTA 2JJTC 2EYTB 3OB8A 1LD9B 3R06B 1QRKA 2HWZH 1QSFA 2D2OA 5I1GH 2P8LB 2XA8H 1D6VH 4LEXH 1IRAY 1U91A 4KQ4L 4OCSH 1F3DH 5TF1L 4XCYA 3D5OF 4S10A 5IF0B 3MODL 3FFCA 2CDFA 1PG7L 1JPFA 4P2QA 5IHZB 5KVEH 3TM6A 4QHNB 4YHMH 2EDQA 3L7FA 3OSKA 2VXSL 1OW0C 3RWGA 3SCMD 1I7UA 1AD0A 3Q6FA 1JHLH 3PWJA 5GXBB 1T7ZA 5JXEA 4WTZA 4L4VA 5GGRY 4DZBA 4PJAB 3PUCA 5EZLB 4POYA 3TIDA 4YHIA 3LS5L 5K9QG 1J0HA 1X5XA 1F6AA 3ZT7A 5EU3B 3P4OA 3DX6B 2X1QA 5I73C 3KPQA 1INQB 2CO7B 1YPZB 4J8RA 3NABH 3F58H 5FUCE 2GW5A 1RIVL 4PRAB 2YSSA 1FL5A 5FYLE 4HKZB 1WSST 4QHNA 2X4RA 4IDLA 1A6TB 1XGQA 5E1AA 5TPWH 4JG0H 2YD1A 2EDJA 3CX2A 4X7DC 2MWCA 2HLAB 1OTTC 1AP2A 3F7VA 2JELH 2LABA 3M07A 3QWOA 1H8SA 5SWZE 3AXLB 4EOWL 1AGEA 3PHOA 4NN6C 4X5WB 2RCSH 4JO1H 2C5DC 4KUCD 2WZPD 3SDDB 4KV5F 1A1MB 3K74B 4HIHB 4TSCH 5FV1L 1J0KA 3HPLB 2ZCLL 3DOSA 4XWOD 4FTVD 1A0QH 4ZS6C 3BH9A 2V5SA 3PJSA 4XTRD 3L3KA 5CSZB 5IEHB 1BFVH 1BOGA 1PG7W 3DHMA 3IDMA 4M3JA 1GZQA 1U0QA 5FM4A 1IE5A 3TC9A 5ADOL 5GGTL 1X6NA 3FT2B 1RURL 1QSVA 4YO0A 3BGAA 3X3GH 3CIQA 2DQDH 4NRYA 1OAQH 1GC1H 1A7QH 1A6UL 2AAVA 3C60D 1L0XA 4X9HA 1NFIA 3WXWL 1FNAA 3TJEH 1Q0YL 2CUIA 3BPLB 1UB6A 2A83A 1QRNA 3KPSB 3VRLE 4ZUSA 2K3TA 5BV7H 1N2RB 1YNKL 2CLVA 1ZHBB 3HPJA 3QO1A 4YXKH 4JPKL 3O6FC 3VXPB 1YEEL 2DLHA 4AMKL 5IEHA 3OHXA 1ES0A 1PDKA 2JB5L 2P43B 1D5BB 1JIBA 3VXME 1LK2B 1JP5A 3B9KD 2YOCA 3BP7A 2F53A 1QFHA 4OFYA 2MQ0A 2W92A 1NFDF 2Q6WB 3WDJA 4FQQA 4GXUN 4YXLL 3EYSH 3TIEB 5GS0D 5IBUG 1UXWB 2GTZB 1G9NL 3E6HA 4WHYH 2OM5A 5GRZA 3QNYA 2VLKA 4F3FA 2WAHA 4TTDC 5KVGH 2Y07L 5HHOA 5J06A 4MNQA 1VGEH 4GLRI 5DUBA 3L5JA 3QIBC 1EK3A 4NSKA 4JFEA 2EYSB 3SGKC 3GRWL 5F9JA 4LNRA 3OHXB 4UDUB 1QBBA 3VW3H 4NYLA 2E8ZA 1D3CA 1AR1C 4M7JL 3ZDXF 2PYFA 3QUXC 2EE6A 4K7PX 3HRPA 2X4SB 3UDWC 1EV2E 5EBLB 1AQDA 4OZIE 2HG5A 4V2CB 3IFOA 1X5FA 2QKIB 4MB5A 4IMLA 3MLWH 5CCKH 1HN1A 1YEFH 4KUZL 4M61A 3DMMC 3CXDH 5MEPA 1KULA 3EGSB 4O58H 4YDIH 3UMTA 1QFUL 5HYQA 5SWSA 1FLTX 4HUNB 4MA3B 4MNQB 5DUBB 5CJOH 1H8OA 2X89A 4XP4H 3LSOB 1ZA6B 3LMJH 4HC1A 4XT1C 1WZ1H 4YHPA 1EJOH 1Z2KA 4YAQB 2YK1H 4QHUA 3U4EA 1EVUA 2K9UA 1H3PL 3VFTA 2VMFA 1QSFD 4MNQE 5DHYA 4LLAA 1UYWL 3F8UB 4K3JL 4PJIE 4HDIA 1OL0A 1XR9A 1WV7T 3TVMC 1ZA3B 3MRDB 3BN3B 4N1HB 5ICXA 5EOQL 2OZ4A 2WWKT 1OTUC 1H9VA 1RK0A 4QOKA 4FQIL 2JIXD 3TBTA 1IQWH 1WISA 4Z7WA 2WLYA 4GW1A 2EDTA 3V8CA 5DZOA 3MBXL 2H6PA 3LKQB 3P9LA 1ZLWK 3S5LA 1AGBB 1J5OH 3MOBH 15C8L 4YHIB 4X6DA 3IFLH 1KB5L 3BRFA 4F8TA 4JHZA 5EULV 1J1PH 3O2VL 2AK1H 3A67L 3EOTL 4UV4L 2ZG3A 2DLFL 1EXUB 4IIQC 2O61A 7CGTA 5T3ZD 4Y4KD 3VGDA 4DFHA 5HYEA 4X6BA 2ADIA 5M7QA 1A9EA 4N8PA 1GGCH 4OCYH 4XBEL 3RY6A 3SKNB 4ZNEA 3K8KA 1RULL 5K9JH 1LP9B 4G42A 4NN7B 2XG4A 4RA0C 5C09B 3VI3E 3VDAA 4OZIA 3P0YH 4JVPA 5AZ2H 3P4MB 2J4WL 5L2KA 1ND0B 3RWDB 4HWBL 5CD5C 3HS0A 2OJEB 3VFRA 4RMTA 5B8CB 2IPUK 3PABB 4M8QB 2AXFB 4HIXL 4TOYH 3L95A 4EKXA 2EXYC 2X6MA 2R1YB 3FO0L 4G3YL 1QR4A 5JIKA 1IAIL 2VLRB 3IKCB 4EQ2A 3PWPE 4HJGB 3VFGL 3ZKQD 1AGFB 4R2GC 5L88H 4R4NC 4LLQB 4OCRH 4HS6A 4NT6B 4YNYB 3JWOL 1AI1H 2MJWA 3MRQB 3OKYA 2ZJSH 3RWCA 4J2XA 4PY7A 3AAZB 3S3JA 4LLMA 1JGVL 4OI9A 5F1NA 4E5XB 4N8VA 5C0BB 1MRCL 2AV1A 2CR3A 4U1HB 4AY0A 1UADC 4GRLC 4KJQC 4HHAA 3O6KL 1CFVH 2D0GA 2QQNH 3V4PL 4JVWA 4X6CB 4RWYL 3B2VL 2VLJE 5J3HC 3T77B 3OB0H 3KPMA 5FUOH 1FIEA 1TVBA 5L2JA 5JR1H 1NGQH 3KNBB 1DSFL 1EJ6A 1N8ZB 1IKNA 3BWAB 5DJXB 4PRNA 4QHLA 1K4CB 4KK6D 1IGML 4BSVB 4NNPH 1KENL 4PP2B 3FJTA 2D9QB 2KZ1B 4XNZC 2F53D 3IDJB 3EFFA 4K94L 1RMFL 1JTPA 5BMFH 2E7LC 1S7XB 1IILE 1K6QL 2E27L 5CIPA 4K9EH 1A4KB 3T3MF 2EYTA 2NCMA 2YA0A 1ZLSL 1WWCA 2EC8A 4Q9CA 4PLKD 5CFHA 4RMQA 3LOWA 5C0BA 2CKBB 1T5WB 1I1YB 3LS4H 4XNZB 5I8EA 2UWEA 3GMLB 1VACA 2P5WA 2E9WA 5ADPL 3I50L 1K2DA 3HB3C 2P46B 3WO4C 2RAMA 4G8FA 4HPOL 2ZPKL 3L5WA 3NIDE 3BZEB 2APWA 2P24B 1PD6A 1RZ7L 3WMSA 4DN3H 5ECJE 4XBPA 4J3XA 4K8RD 5JOFA 3FOMA 3MRFA 4JFQA 3BKML 3BT2H 2I5YL 2NY6D 1D9KB 3GSOA 1UC6A 1RU9L 1HQ4A 1Q9KA 4FA8A 2YMXL 5F8QC 4PRBB 32C2B 4Y2OA 4BQ8A 4ZMAT 1FRGH 4NQVB 3U0TA 4Z5RB 2DKMA 1C1EL 1QFPA 1ZKAA 4Y4FB 5HSFA 5EU7E 1G1CA 2UVFA 2CO6B 4C83A 3L7EB 5T3XD 1G7JB 3WYRA 4BFIA 5IVNA 5DYOA 5CJXC 4HDIB 2GTWB 3PQYD 3BDXA 4CAGA 2R2BB 5ID0B 4OD1H 3ILQC 4JGMA 5L8KB 2DKUA 1I8MA 4YHYC 5EO9B 4YK4C 4F58L 4ZXBD 4X6FA 3D85B 4D0CA 1IFHH 4OB5L 5EN2B 3VFMB 1JI2A 1UG9A 4HS6B 1P53A 4F2MB 3GMNA 5I19L 3TV3H 4UINL 4KKCC 4K3DH 4MJIE 2B1AH 1CIUA 1OAXL 2XZAL 1RZ8A 4PJ5E 4HG4J 1R3LB 3X13A 4KZEH 4ZYKB 2NY6B 4G8EA 1KEGL 1OM3L 3WEXB 4QCIA 3E3QC 3THML 1NGZA 1KB5A 4DW2H 1T0NB 2ATKA 3FMGH 4BQCA 2EICA 1UZ8B 3TBVB 4UB0H 1WAAF 5TQ0H 1RPQA 2O5ZH 4CADB 5EFIB 5TE4L 4ALAH 4TVSa 4MD5A 3DXAE 1QO3B 4MX7A 4DN4L 4FQJL 2VDMH 4J1UB 1X4ZA 4AEEA 2OJZL 2W0FB 4L5FL 3LPFA 1VGKB 3BJ91 4WEBH 3SDCA 5D2NE 4I48A 2B1HH 4WW2B 4WV1B 5JMRA 3X12B 4LSPL 1AIFA 3G5VA 1J11A 4MQ7B 1FGVL 5E94A 4PB0H 1I9EA 4EZMA 1MLCB 4L3AA 5GZNC 1XGPA 2K7PA 5HHNB 1QR1A 2XTLA 1BM3H 4L4TA 3ISWA 3QUZD 1MCLA 2EDFA 1HQRA 3MNWA 4IIQB 4L4TE 3VXSD 1I9RH 5C0JB 4GRWH 5F1IA 2W9EL 5D7IA 4ODUA 4Y1AD 3RZCB 3M1BB 5KSVA 3T04D 1JGDA 1KJ3H 4OQTH 3SGJA 4X4MA 5EB9A 3ULVF 1K5NA 4NFBA 4A6YH 4LVNC 3FB6A 3N1GC 3T2QA 1Z6JT 2CRZA 2J12B 2ZG2A 5AAMA 2Z8SA 5E94B 5TE7H 1H5BA 3PL6D 4Z7UF 1VCAA 2W9DL 1VFBA 1J0IA 2BVUA 4GBXD 4GG8A 4GS7C 4KVCH 5GS2H 3MGTB 4M00A 4P59H 5D7SH 4G43A 4YHNA 5KSBE 2XPGB 1EPFA 3BKYL 4JN2B 4U1SA 3HE7A 3UBXI 5EIQA 2Z31B 1PYWA 1Q9WB 1TETH 3QYCA 4IHOB 4CVZA 4ODVH 4R7DB 4NJ9H 1CE6B 1I9JL 3ZLQC 4PJAE 5FB8A 1ZHLB 3TA3D 3MRGB 3KVQA 1O7SA 5C0ND 4LPXA 1QFWL 4MVBD 1YQVH 5HGHB 1F4WL 3MZTA 1LDPH 5GJTH 3T0EE 4KQ3H 4FXGB 1GGIH 3CLEL 5F89A 5FIEA 1BHGA 4KAQL 5C0EA 2NY4D 2X4RB 1Q1JH 1A6VH 4LPYA 5CBAB 3BIBX 5C0BD 1AJ7L 5TE6L 2JF1A 4MA8H 3DSFL 2DLGA 3GJEA 1GRWA 5KSUA 3ULVE 1N6UA 2F54A 1W8NA 2IBGA 1TQBC 1G7IB 4OZFG 4QRPD 1YEHH 4PRHB 3FQTB 4KRNA 4B53A 4PRIB 2W0PA 3RBGA 3QHTC 4Q6IB 3B3IB 4KI5F 3HB3D 1CLCA 3GGWB 4F15B 3U2SB 1U6AH 1LO0H 3WN5C 3BPLC 2VRAA 4CNIA 1XGYL 1YEIH 5CLWA 5ISZB 5HHVL 4MYWB 4R4FL 5E5MA 5F93C 3RWGB 1QSZA 3RVUC 3BQUB 4JRXD 5BXFB 2P5WD 4X99B 5JXEC 2UZIH 1XF4A 1FJ1B 5HYSG 5C08B 2YC1A 3HUJA 1X5AA 5DD5L 4HULB 3V2AR 5E8EA 1WCBA 4YE4L 1NGYA 5MENB 5ESVB 4P3DB 2X4TA 4ELKB 1ACYL 5T1DL 4PJHF 4AYFA 3CH1A 3FO9B 2KL6A 4HGKC 5E95B 2HJFB 1EO8L 5HGBA 1YPZA 3QUYA 4LU5H 1ZLUH 1B0RA 1U8MB 1I8IB 4QRQB 4YR6A 1JTTA 5I66A 3MJ7A 4C54A 5E70A 4MCYB 1S7WA 1FFOA 5DK0B 3FOLA 4UT7H 4U1SB 3QCUL 1A3QA 1RVFH 3VXSE 3TJHC 3MJ9A 4OLVH 1MEXL 1A9BB 4CVXA 4ZXBB 5D1ZC 1AP2B 5KW9H 1T4KB 5EWIH 1ZTXH 3TO2B 4P46D 5IB3A 5EC2B 1CDCA 1KB9K 2FB4L 1ONQB 1IBGL 1RY7B 4PJXB 3T4AB 5ICZA 4QO1A 1QSFB 1I8LA 3DX7B 4XMKH 3LAFA 3RDTB 3L9RB 1A7NH 4FQCH 4MWFB 1A47A 5H2BA 5GRJL 1MJ7H 1CE1H 5DD0L 5EU4A 5IM7A 4MSWA 2B2XL 5ISZE 4S1DD 2EZ0D 1A1NA 4WO4B 5HYFA 2DYPB 2DWDA 3OKKB 3VD7A 1ZANH 4UT9H 3DTXA 5FYKE 2PF6A 3FQWB 1QYGH 5GGUA 3PDGA 4PJDE 4Y5YC 3VXSA 2OXHA 2IBBA 4LNVA 2GJ6A 1FH5L 5DD3H 3WFCH 2HVJA 5DLMH 2A77H 3VXRE 3IXTB 3CDFA 1ZHNB 3VXRA 4MAYB 4JZNB 2CIKA 3EYUH 3S4SB 2Z31A 1RSFA 1NCAL 1YEJH 3MXVL 3SE3C 4UAOC 5I16B 3SGDH 3HI1A 4XCCH 3K0WA 1UXSB 1I3GH 1K4DA 1OCWL 1Q94B 3RGVC 1FIGL 4D0BB 3CDGA 5DEGA 3BKJL 5AZEL 1U3ZA 1H3WM 4WW2C 3VXSB 3G5ZA 2XKUA 4UV7L 2GIYA 5D8JH 3ARQA 1T20B 1MCKA 4LCUB 5K59E 2IGFL 4MGXA 1TCRB 2NY3C 4OLZH 3O3BA 3MLUH 1WZMA 4WU7A 1EEZA 4PJ9B 5E8NA 1ZXQA 4K2UH 4LLYB 1VEMA 4WWKB 3B9EA 5DMIL 4AK1A 3QI9C 1NKRA 2FLBT 1CFQA 4ZOBA 3TLRA 5HHXL 3MO1B 4HK0A 5FO9A 2BOBB 4HXAL 2I60L 1TPXC 3CMOH 1K85A 3Q48A 4LIQE 4Y4HB 3WNNA 3MLXL 4OD2A 1QVOB 1MSPA 5L2KB 3QG7L 5C0IB 4C56A 5JPNA 2FH6A 3QULA 2MPAH 2I25N 5F9AC 1MFAH 3BP5B 2PO6A 4NQDD 1TPXB 5AD0B 2HTKD 3W2DL 1CG9B 1KG0B 1YEGH 4JN1L 3VFSB 1RJZB 3CSYA 3PV7A 3SDXB 4Q74A 3WEXA 2HN7B 4IJ3C 2P8MB 1IT9H 4XBPB 3BQUD 3NPSB 4PJ9C 5KSBA 2XA8L 1QRND 2A9NH 5DZNA 1A3RH 2CKBH 3VWJC 3GSRB 1J1OL 5C0DA 3F7YB 1T0PB 1KN2H 4YDJA 3ULUC 5DD6B 1I4FA 3WKML 5AAWA 5ILTL 3S37L 1JHLL 1BOYA 5GSVA 4HS3B 3P11L 3T2NH 3T0EA 3L6FB 2CLRA 3MBED 1T7WA 3ARGC 5HHQB 2F53E 1ZHKA 1AH1A 1ZE3C 4OFIA 1R5IB 1I7UB 4ZUTA 1OGAE 1OAZH 3O6LH 4KRPB 1ZVSA 1KXTB 4AEFA 4OGAC 3REVA 1NBZB 3WDIA 3ZHDA 1RUML 4XAKE 3SKUD 3JTSA 4MJ5A 4U3HA 4LP4A 2E9IA 1JCKA 2F5AH 5K59F 1GIGL 4ZTOL 4GRLA 3EYQC 3NPZB 5BCAA 3MMEA 3IU4H 3DURA 3MV8B 3EYOB 4B7LA 4JPWL 3ARXA 3HG1A 3UROR 3BEVA 5MEPB 2YXFA 4X5XB 1KV3A 5GSVB 1Q8MA 4WUKL 5TPWL 1EO5A 1PZ5B 4CDGC 1KF9B 5SV4A 4JJ5B 4PJ9A 1YN6B 2VLME 2F58H 1U3HA 5CLTA 4JDZA 1Q9OA 3ULUL 3W11C 5GSRA 1UH4A 3ZHKA 1IM9D 1N3NB 4H1LG 1NSNH 1T7VA 3S35L 1ZVYA 4TSCL 5ANMB 4HFWA 5J6GB 3NIFE 3TP4A 2ZCLH 1J8KA 1RJYB 1YJDC 5EPMA 1P6AB 1F02I 3OF6D 2IPUG 5CGMA 5T5NF 1WLHA 5HVWA 1J0JA 5GGTH 5DJZA 43C9B 5E2WL 1U8OA 3X3GL 2ICWJ 2EIEA 2I26N 4MA1B 3C9NB 1GC1L 3PHQA 1QBML 4N0FB 1CBVL 4G6AD 3A6CL 1KPUA 4WU5A 1ZLWH 4WHTA 3RY6C 1UFUA 3U7WH 4UQ2B 4YXHL 1CVRA 4XVUC 4MAYD 1JGUH 4E9LA 4JZNA 3U0WH 2VZOA 1DJSA 1C08B 2NYYD 4LSRL 1KC5H 3K8MA 1F97A 2JB5H 5EU5A 5F7DA 3ULSB 2C3WA 2A83B 2DB8A 3KPSA 4ZUSB 3RI5K 4F7CA 1OT1A 5HYQB 3O11B 2HKHH 2VWEE 3WIIL 5D1ZB 3QXVA 1DQTA 2R2HA 5KSAD 2Y72A 3KLHD 4Z0BL 2ESVB 3CAFA 1PLGH 1M4KA 1BD2D 4JFDD 1ZGLB 1HOCA 5IK3A 5L6YL 5E6IB 2AXFA 1MFDH 1AD9B 1T5XB 1T5WA 5CZVL 1XT5A 1E6JH 5I8OH 5DVNA 4PRPA 1QSEE 2ZCKH 2R1YA 4OIIL 4XWGH 1TJHH 2JCCE 4K55A 5E6IC 5KTEH 3E2HC 1EHXA 3L3DB 5D9SA 3OJDB 4ZNCD 5I15H 1J7VR 2PXYB 3VW3L 3L5XH 4D8PA 2LU7A 4O2CA 4GG6E 2A6DA 2AJYH 5H35A 4LHUD 3MGAA 1VFOA 3LEVL 1FC2D 5HYSB 1LEIA 3DX8B 4GW5A 4WFED 2QR0A 2EEBA 3PWPB 3O2WH 1FDLH 3BH9B 1LO4H 1U8PA 4W4OC 2BC4A 1YEFL 4KUZH 4ZFOL 5MP6H 3R8BB 3OAUL 4O58L 5CBEB 4FFYL 1VFMA 4KROD 4KXZI 1II4E 1EUUA 3RWHA 3UDWA 5LXGL 5FYJE 4XP4L 2NTFA 4X6EA 1HYSC 3BQUC 5EOCH 1AQDB 3L3DA 5D9SB 1MH5B 3LMJL 1D5IL 1LO5A 2DTMH 5D6DA 4JRYB 4DKFL 2R0ZH 4N8VG 1SQ2N 4M1DL 3VRIA 1EJOL 4LCWD 3O6FA 2IQ9L 5A2IH 3C8HA 2G9HB 1FFPA 1R3LA 1HINL 2WBKA 1QRNB 4PBXA 1I3UA 1BZQK 3FT3A 4EDXB 2FWOA 5GGVL 1UYWH 5J6HA 3MPCA 4YBLC 3VJ6A 4JO4L 2FBOJ 4G80B 5D71H 3QPXL 3TO2A 3SDDC 4PJHB 4YQXH 1MPAH 4DVRH 1S7QA 4NN6B 1TJGH 3U4EB 1CXFA 5CEZH 2ZUYA 2YC1B 2HRPL 4KDWA 3ZTJH 5BJTB 1CWVA 3MBXH 5CGTA 2WK2A 1NGWB 4HKBA 5ICXB 1PAMA 2DL2A 2Y5EA 4UOW1 2OMBA 2R1XA 5BS0B 2DM3A 4G7VH 3ZSTA 4DGIL 5JHDB 3STZB 1T22B 3OKNA 2DQFB 1JZ7A 1IAKB 4YIQB 2AK1L 3A67H 3EOTH 4KTYA 4LSUL 1VADA 4OAWB 5DO2C 5J57B 1KJVB 4G8IB 3QUKA 1OAKH 1A14L 1KUMA 2DMCA 2GCYA 1GGYA 3QDGA 4MXWL 5DR5L 3T0XA 3AXLA 5B21A 2HMIC 1U2CA 4OQ1A 1S7SA 4PTUA 1Y6KR 4TUJA 4U1GC 3U4BH 1ZHNA 1WTGT 2AXHA 2ICCA 3TN0C 3V5KB 1A7RL 4PRPB 2O5XH 4EUPA 3EO9L 2NY2C 2DMKA 3TESA 1MREH 4GMSL 3DJ9A 1DBJH 1MRFH 5EC1A 1A6AA 4LFHD 4G9FA 3C5ZA 5DF0A 4B41A 1N6QH 2NW2B 1S7TB 3LIZL 1WC7A 2Y5TB 2C4FU 3MLSH 4WO4D 3WE6B 3IVKA 1T2XA 5IMOA 2FX7L 1LEGB 2CGRL 4HKJB 4X9BA 4RFEB 5HPOA 1I7RA 4XPBH 4Y88A 1CFNB 4XB7A 1IAIH 1MIMH 1F58L 4ZDHB 3QIUB 3JVGA 5IT2H 3IETB 1DEDA 1UJTA 5C7XL 2AJ3B 3G5XA 4R8WL 3IDGB 4OCNC 5FGSA 1HSAB 4KRPC 3UXFA 1KPRA 1DQLH 2DBJA 3QDHA 1L7TH 1FO0L 2V5MA 4OLWH 2KZWA 1A6TA 2ZSWA 3LEYL 4DGYH 1RIHH 3DTXB 4QOKE 1OB1A 4RZCB 1UGNA 4HSQA 1ADQH 4L8SC 3B2VH 3GJFH 4RWYH 3WS6A 5LG1A 2JJTA 2JB6B 1NGQL 2MCPH 2V9RA 4O4YL 2ZG1A 5GGSB 2JK5B 2R15A 3FHQA 2H2SD 2DQHL 5TDOB 2WINA 4G6KH 5D1ZD 3TEUA 2N7BA 1IGMH 2YD8A 1SY6L 3FT4B 1MJJA 2QV2A 4U6XA 2X5PA 1MCOL 4HBQA 1JNLL 3GZKA 1RMFH 3NPSC 2EYSA 3NA9L 3F5WA 4RFNB 4WFFD 4YK4B 2HP4A 4N1EA 4K9EL 1Q9OB 3HG1E 1EHLL 4LDEB 1A64A 1RUKH 4WNQB 4BSVA 5I30H 4OF3A 4IS6A 3EHBD 5ADPH 5CZXC 4G8IA 2NY3B 5BRZB 4JPIA 1CD0A 1KCVL 4QRRA 4XXCC 1ND0A 4N9GB 1MCNA 4W6WB 4WW2F 1BJ1H 3F6LA 1CXHA 4P4KB 5IMMA 1P9MC 3QUXD 4L8SB 3G6DH 4CRPA 3FN0L 3BKMH 3BT2L 1G0DA 2BDNL 1MUJB 3G9AB 3EOAA 3AY4C 4AL8L 1JNJA 4U0RC 5IHBA 5E08L 3QI9B 3VRLF 4GKSB 2PW1A 5F7KC 3U46A 6FABL 5L7XH 2ZOLB 3B5TA 3CK0L 1XGQB 3X11B 1G7MA 3TYGL 3W9DB 4POZC 1GZPA 1MAML 4JKPL 3H2WA 2E7CA 2NY0C 4PJIA 3HC4H 3SDCC 5J4MA 1J1XH 4AT6B 3BD3A 2X9YA 4NQCE 3W81A 3TNMA 4BUGA 1LDSA 3W0WA 3KPNA 5FHBL 4OZGA 3FFCB 3GJFB 1U8HB 5I1LA 1D6EB 4U0QB 3CVHB 1JZ6A 2GAZA 2PW1B 3RA7L 1PSKL 3HR5B 4PJFE 1V7NL 4K3DL 5ID0A 3PGCA 4NOBA 4YDLC 1R24A 2J8UE 3WO4B 5C9KA 3DYMA 2AI0H 5I1JL 2HA1A 3N85L 3G6JE 1ZLUK 5B3JE 25C8L 3QQ3A 1MY7A 4LLVB 1NMAH 2EKSA 3OG6B 4KMLB 4U1GB 4DW2L 3FMGL 1AHWB 1BECA 1RJYA 5D2NC 2XYCA 4FFZH 4H1LH 3MV8D 3QAZB 1Z9SA 3OKLA 3NCCB 4O2EB 3IAGC 1GAFH 1MVFA 3TA3C 2FNBA 1NAKL 3H8NA 3ZSSA 3OKDB 4FQJH 3LZFL 2VDML 1YYMH 1FL5B 1T6WA 2OJZH 5DK2B 1CQKA 3R4DA 5D1QD 4EN3C 3SO3B 1FN4A 3ZTNL 5FDYA 3ZKNC 1RV6X 3QA3A 4M7ZB 4PGJA 1DBKH 2RFXA 5IB4B 4LSPH 4XVJH 3B9DA 4IRSC 4FQXA 1QEWA 2H8PA 3IFPB 2Y36L 5IGXL 5IM7B 3ULSA 4L3CA 4OCXL 1R3IL 5C08E 3LKOA 4HS8L 1SBBA 4EIZC 4TUOA 5GS0H 4OD3H 3OL2A 4PLNC 2WW8A 1UWXK 4N8CL 3HCVA 4YPGA 5IW3A 2B4CL 4XPAL 2DYPD 3OPZH 3KNBA 5C2UB 1KIQB 4NM8L 3QUMA 1CFNA 4JCLA 3X14B 1QOKA 3E2HB 4G9DB 5F7FA 1E4XL 1D5MB 5F7MC 3I3BA 4NCC1 4I9WE 3TYFA 4NM4H 1Q38A 4LQFH 3FQUB 1QEWB 2H8PB 4YZFF 5F1KC 4GFTB 3QUZC 3BPNB 3MLTA 5IVXF 1JI1A 4P2OC 4RGND 4QT5A 1EEUA 4TN9A 5TE7L 1IEBA 1BWWA 2X4QA 3QUYD 2ORBL 3IFOB 2W9DH 2BSRA 5BV7C 2FO1A 1I1AD 3F7PC 4JRYE 4Y5VA 3G5YB 2KQNA 4BZ2H 5EA0H 2YPLE 2QADB 4GAYB 4B7IA 3OXSA 2DI7A 3BIKB 4HUMB 1B2WH 2F8XC 2D31A 2EO1A 4XAKD 3IDIA 4XVUD 5HI5D 2FEEI 1HNGA 5D7JB 1JRHH 4FFVD 2D4FA 3B5GA 1TIUA 1NEZB 3L95B 3WFZA 1YPZF 1XF1A 4NNYA 5F72S 5DC4B 5C0RL 3RKDD 2RGSA 1NGYB 2E6PA 4U05A 1L6XA 4YDKL 4C56B 4M5ZL 4GRMB 3RPKA 5CZXD 4KAQH 4CN1A 3AU1A 3MUY1 4JM2F 1EMTH 5DI8A 4BKLB 4ZFFA 1G7JA 4NFCA 4Z8FL 4LSSL 1CT8B 3RNKB 4QXTB 4J12A 3WCYA 5DQ9A 1V5JA 4AEHL 3VXUB 5I71B 3REWA 3DWTA 2X70B 1H3VA 1WBZB 3TBYA 5C0AD 4XXCA 4NKIH 5SX4I 1JNNH 4V2BA 4JCMA 1G6RB 3RL2A 4IRSB 1F8TL 3CPLB 1ITBB 4JFFB 5EOTA 1U6AL 1NGPL 4JQIL 5KSUB 5K33A 3BUYA 4IMLB 4NKMB 4D8PB 4YDJB 4L3CB 2IFFL 3OR6B 3CFJA 4XVTL 5D6CB 4JVUA 3GBLA 3MRBA 3C5SA 2I9LA 4FTVB 5B39B 3D9AL 4HS3A 4L8DA 1CTOA 2NX5A 3CFEB 2X1OA 2YD4A 3P4LA 4O5LL 2ENYA 4UIMB 4XBGA 4YHOH 2BVQB 1X5HA 3N1PC 1WICA 2PW2A 1LO3L 2P4AB 3OG4B 3VFTB 3MRJB 1I1YA 1DVFB 3PWUB 3T0BA 3RWHB 5C6WH 4MJ5B 1XF4B 3WNLA 3DHJA 1QA9A 1S9XA 3V6ZA 2GK0B 1WITA 5IBUB 1UQSA 1UJ3A 3QQ4B 5EU5B 4JB9H 4LPWA 5F7DB 2LU4A 5D7LE 3VFWB 1XMWA 1BLNB 4EVNB 1TZGH 1DBAL 1LEKB 1N5AB 5J6HB 2FWOB 1I1AC 4UT7L 1NJ9B 3SE9L 3RWEB 4E5XA 3DVGA 2ICES 3BFOA 3MV9E 3PP3K 4Y0GA 5IR1B 2C1PA 2OCFD 4Y4FD 5I66B 4ZDHA 1BIHA 2BCKA 4HUKB 2BMKB 4HHAB 2AKRB 3R1GL 1TENA 1JPTL 1V7MH 5LJYH 5IHUH 3ES6A 5E9DA 5DJCA 2OK0L 4Z7UB 3D48R 7FABL 5GISL 2NXZD 3E6FA 4D9RE 4FMKA 2FB4H 4HLZG 5F3BB 1IBGH 4RGNE 4XNUL 2NY4B 5SX4H 3OQ3B 5IMLA 5JHLH 1OARL 1YJDH 1CICD 5LKNA 2R0LH 4NWUL 3EJYC 5I74C 3QFJD 1MELA 4FQCL 4JREC 1CE1L 3PGDB 5DD0H 3TT3L 4NUGH 1BREA 4RCAA 1SJHA 3HA0A 4HWUA 1VFBB 4ZD3H 2A1WL 4WHTB 5IVXA 4LPVA 2ZOKA 3ARFC 4PTUB 5A3IC 5IP4A 2APXA 4NP4L 3ZT6A 1F3JA 3VXOA 2VO5A 3UTSA 5I75B 1U3YA 1UCBH 1O0VA 3SE8L 1DUYA 5TH2B 3KYNA 5D1QC 3VXPA 2XZCH 1MFNA 3SO3C 1T0NA 2ATKB 4R0LC 1NFKA 3AVEA 1J8HA 5K9QI 2R8SL 1CDUA 2P8PA 1MJUL 3QDJA 4Q9QH 3CFJB 4OCWH 5J0BA 4HJJH 3ZE0F 4Z76A 5GGUB 4GH7B 2Y6SC 2VDNH 3CFEA 3UPRB 4TULH 2IAND 2AGJH 3IJYB 5DJDA 1NC2B 3MXVH 2GJ6B 4YFDB 4ORGA 4RAUA 1EHNA 2XQYG 1IC4H 4ODHL 5L8JB 1I9IL 1EA9C 4Z7QF 1P2CA 2ITCA 4NZRH 3CLFH 4OUOA 1EBAA 4XAWH 2PR4L 5E8PB 5DVOA 5IESH 5JIPA 4K7FB 4NQXA 5MEQB 4M5YL 4ODTH 5E6ZA 5DA4A 1KJMA 3SHSA 1BGXL 3WSQL 1OSZA 1ZS8A 1IEAA 4ZSOB 2AJVL 4OLZL 4ZXBA 1R0AL 1VKXA 4M9OA 3FRPG 4XMPH 4A6YB 4IOSD 2GJZB 5I1AB 4PRHE 2F54B 3MACL 1U95B 4XP6H 5CAYB 3ARTA 2OSLB 4D94A 3QEQB 4X7FC 2I60H 5FV2A 1QLEL 2R1WA 1D9KC 1OP9A 5JNYB 4X7CC 3HZVB 3PHSA 2GFBB 2NNAB 4PRAA 2ZKHH 2N1KA 4PGEA 3HFML 4GBXB 1IGYA 4UAOB 3VMNA 2ZUVA 3DV6A 4BH8B 4PJDB 5HTSA 3MRPA 2XWBB 4EUPH 3ARYA 4JFOB 3Q5TA 4KI1A 3OZ9H 5BZDA 3KYOB 3LKNA 3NCJL 3PDDA 5IQ7L 4KROB 3O45A 1WFTA 4TUKL 3VD5A 5CJBA 3OR6A 3QEQA 3I6KB 3HNVL 5SWSD 2YKLH 5BOPA 1JNHB 2APFA 3L7EA 3ARRA 3BZFA 1AIFB 4J4PD 3OJVC 2ICEB 2O26U 5I17A 2VISB 5E56A 4HKXB 4WO4C 5L2JB 1BBDH 1RZGA 2ADFL 2I07B 2PXYD 2Z9TA 4XC3L 1DVFA 3PWUA 1QG3A 4L9LA 4JY4B 3P11H 4NZJA 5C9JA 1C5DB 1DN0B 1QFWI 1JF6A 3BDYL 5CP3A 5FYJD 1C12B 4FQXB 5E4EB 3NFNB 4WTZG 4NHCL 1JHKL 3O81A 1HZHH 4NQEA 4OGXL 4W6YB 2D4DA 1GGUA 4LASH 5IHLB 5FYJL 3O6LL 5HGAA 3FFDB 3K46A 1YMMA 5I1KL 1HKFA 1N2RA 3DIFA 1U8JA 1A7PH 4OLYL 2QLVB 2VDRH 4ZODA 5I17B 1G6VK 1KIRA 2OYPA 2UYLB 1I7ZA 2R56L 4CVWA 3SJVB 3ECBB 4LCWB 1MHEA 1U8QB 3QDGE 1FORL 3LVEA 4PBVC 2J3SA 2NXYB 3DBXB 3MXWL 5KS9E 1O5DT 3FQWA 4HWNA 2NXZB 4H0HB 5DJCB 4ODWA 3QQ3B 5I76A 1R5WA 3BN9C 1VGKA 2LVEA 1MCWW 3ZKXC 1F3DJ 3TIEA 5JQ6L 1A1NB 3QULB 3CX5K 4L3EE 3K80A 4RMVA 5KBNC 2P8LA 4JM4H 3VFOB 5DMKA 3QIWA 3O8XA 2FGZA 1FO0B 4K23H 3VRJB 1T2JA 3HKFA 5D1XA 3ULVH 3E0GA 2ARJA 4Q9RH 4F7TA 1IKFH 2ERJB 2JJSA 3MRMA 1W2KT 4DGVL 5D7KE 5DJ8B 3RWFA 4F7EB 5TDPA 1D9KD 3KLSA 2Q86A 2BJML 2D7PA 4UNTA 3LN5B 1B3JA 4H5SB 3AFLA 4K3EL 3HMWL 4FP8H 4PJHE 4HFWB 4ESKA 4X6BB 1TZHB 5DJ6B 1CBVH 3DUUB 4M48H 3VGAB 4XWOC 3LKOB 2OLDA 4FQ1L 4EI5B 1D5XB 4JPVL 4QYOB 3UYOD 5IJVB 2NLJA 2BFVH 1B6UA 4NQCB 4NO2B 4P23D 4ZAKB 4CMHB 4IRJC 3T0EB 3LKPA 4WUUD 1NEZG 5BVPL 2ZUWA 3GHBL 4W68A 1U3JA 5E1HB 2JCCB 1KC5L 4NO5A 3VH8G 3V5HB 3NCEB 1G6RL 4P4RA 2JJVA 5F8RC 3KPRA 5JORA 3TYFB 1WT5A 3VWJA 3GM8A 1KLUA 1H3XA 3MTRA 4Z0BH 3CPLA 2UUDK 1HH9B 1X4YA 2ARWA 3H9SE 2KKQA 3UTOA 4DVBA 3VG0H 3GMRA 1UZ6F 1BFTA 1BAFL 3FB5B 4LRIA 4ZFZA 5FYLL 1KT2A 3UBXB 4LCYB 5DUMH 5D7LB 4JFQB 4ZUWB 5L8LB 3AM8A 2ICWB 4DOHE 5EOCJ 1U8IA 3MLZH 2F19L 2VDLL 3S4SG 1TJHL 4HIEB 4YUEH 3ZKMC 1N5YL 5ANME 3VGAC 5GS1B 5KVDH 1OF2B 4KTEH 4K8RL 2B0SL 1HYSD 1CS6A 4FZ8L 2DF3A 3HNSH 4LCCC 5C08D 3NFSH 4JZOA