3QHZL

Crystal structure of human anti-influenza fab 2d1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
216
structure length
216
Chain Sequence
PVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVSWYQQVPGTAPKLLIYGNNERPSGVPDRFSGSKSATSASLAISGLQSEDEADYYCAAWDDSLNGFWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An insertion mutation that distorts antibody binding site architecture enhances function of a human antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Human monoclonal antibody del2D1, Fab Heavy Chain
total genus 49
structure length 216
sequence length 216
chains with identical sequence M
ec nomenclature
pdb deposition date 2011-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qhzL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qhzL01
2WBJD 3LSOB 4QOKE 4YHLH 5CZXD 4N68A 3BPLB 3EHBD 1CZ8H 2G2RB 1B0RB 1FN4B 1I8MA 4PLJD 2X1PA 1XF5B 1IZKA 4JCLA 2NTSP 3QUMA 1OD7A 1NBYB 5FOJA 5E2JA 1QSZA 3WFEL 5DD6B 2GJ6D 1RZ8B 1X5LA 2I27N 3VXUB 5D6DA 3HE7D 4N0UB 4HGMA 3KXFB 4K3JH 3ISWA 4ZDHA 1FGNL 4JZJB 5JNYA 2ZCLH 1SY6A 3O8XC 4FQPA 4JFYA 4EDXB 4JGUA 1UWEL 4MD5A 3FTGB 3HTLX 1T22A 4TYUA 4YHIB 3ZO0A 4AL8L 4AIZB 2XI9A 4RWYH 4LSVH 5CIPH 4NFBA 1TVHB 4MNHB 1MY7A 4X4MA 1UH2A 2JTDA 1D7FA 4JFFD 3T0XA 1M71B 1GSMA 2JB5H 2YS4A 3KYNB 4RZCB 4TSBH 4Y7MA 1U3HA 1J1PH 2DKSA 1HK6A 1YC7A 4Y4HC 5IMLA 2ICWB 3GHEL 1CE6A 1XZ0B 4PLKD 2YA0A 4NQEA 5FCSH 3LKRA 4KXZH 2Q3ZA 1S7SB 4M7ZB 4L3AA 5JXEA 4P48A 4KRMB 2R1XA 1W72A 2F53E 4QXUH 1DEEB 4HUVA 4LNRA 1OTSD 3M45A 1JWMA 2F74B 5DUBA 1I9EA 4WGVB 5D1XB 3S35L 4DZBB 1MFDH 3MGOB 4RQQA 3GZKA 5I19H 5DD1L 1HXMB 3S36X 4EN3C 3VW3L 4PRIA 1IKFH 1UXWA 4U1MB 2H2SD 2DWDA 3BPLC 3CZFB 3EYOB 3QNZA 4KVCH 1A6PA 5HY9A 1IGCL 3GNMH 1K6QL 1OF2A 1A3LL 4OB5L 2R23B 1PD6A 2V2XA 4K3GA 2XN9E 1K4CA 2V9RA 3F7YB 3V5HA 2EE2A 1KELH 1X5HA 4IS6A 3PWLA 1XAUA 3U7WL 4JFOB 1PVHA 4JJHA 4KKBC 2APTA 5FGBC 1V3MA 3A6BH 1X5YA 4DGVL 1JGDB 3W5NA 4O51B 2IGFH 5H94A 2EDRA 2WBKA 4Y4KC 3F12B 4NBZB 3MV8A 3F7VA 1LVEA 5FB8A 1RIVH 1B0GB 1DQDL 4FXKA 5KVFL 4F58L 1KG0A 5MENB 2NMSA 1U8JB 2CLVA 4JO3H 3KHQA 3RVVD 3SKNA 1QFWM 3TIEB 1RK0A 3OKNB 3SDAC 3VMPA 3MQIA 5BRZB 4ZD3L 2O5XH 4YDIH 1I1FB 3JV5A 5D7SH 3JWOH 2B0SH 2GSGA 1YEHL 1LO2H 3MV8D 4HFWB 1DUYB 4OZFA 4ZODA 1FFQA 2X4RA 5D7LB 4KMLB 4L3ED 4YWGL 3WCYA 1MREL 2ZJSH 4LF3B 4M8QB 1U8IA 4YDVA 4H5SB 2NY1B 3WFBL 5I1JL 3VE0B 4RMUA 1MH5A 1D6EB 4OGZA 1BQHG 4X6FB 3GEWB 2F8OA 3VRLF 2C3XA 5JQHC 4D8PB 4W6YB 2GEEA 3MLZH 4YHPA 1I8KB 4K9EC 1A2YA 3MA9H 1YPZB 2QADD 5DHYB 1DBJH 3E2HB 2PXYD 2ADFH 3CXDH 4NKQB 4RGMB 3QZWB 2DYPD 3H6JA 1BM3H 3PP4L 3ROOB 1YMHA 2O5ZH 1C1EL 4JKMA 1FAIL 2Z8VC 4HIXH 4HBCL 2YR3A 3GK8H 4LLVB 4PV8A 4XWGL 4XPHH 1CQYA 4R4FL 4XCEA 2AW2A 2A73B 3I9GL 4L29B 4AENA 3F62A 5BVJB 4PR5B 2WIIA 1MCFA 3EOBA 5IB2A 3PL6B 1JFQL 1YPZF 3QCVL 1RUMH 3DBXB 4XWOC 1EFQA 4NKMB 3PGFL 2C3VA 3BH9B 5IHZB 4GG8B 1RPQA 3VFRA 4H5SA 5J3HC 3SGKA 4Z5RB 5EU6D 4OUUA 3DETC 5FO7B 4OZFH 5LCVL 3NAAH 2W60A 3S3JA 4L3CB 2PYEA 2AQ3A 1TQCC 1FH5H 4JFEB 1ZGLM 3IDJB 3TA3C 3S7GA 3SDAB 2JJVA 3D5OF 2EC9T 3WL9B 4PJEE 1JZ6A 4YHOL 2A6IB 5AWNH 5C07A 3LIZH 1ZKAA 3PJSA 5KAQG 1BOGB 3FT4A 4R4ND 4P2RB 2AXFB 4R8WH 4XP9L 3ULSA 3V0AC 1CXEA 1SJVA 3QAZB 4GG6A 5JA9A 5CJBA 3CSBA 5IW1B 3U46B 2PO6C 3SJVE 4Z7QE 1MFCH 4M48H 4J12A 3F5WA 4YEEA 2X6MA 1NSNL 3RDTA 4MJ4A 3TBWB 5HBBA 3SDXF 1I8IB 3PG2A 5F6HI 4I13B 5EOTB 3O4LA 2ZOKA 1KIUA 3NCBB 4G8IB 3RVWD 4N0RA 3RY4A 1Y6NR 3MOBL 5TFSL 3EO1B 4LLQA 1ES0B 4Q6IB 2V17H 3KYOA 1IGML 1YEHH 4Y2DC 5ALBL 2O93L 1ZGLP 4WWKA 1BFOA 4MJIA 1UZ6F 1TMCB 3K8KA 2AXJA 4NO5B 2OCFD 2Y23A 3FFCE 5AD0A 3FO2B 4DOHB 4DFIA 3RA7H 5TF1L 3MV11 4NQDA 4PJDF 4MB5A 3KPRB 1YNTA 4IRJC 3PL6D 1I3VA 2VLME 5GGSA 4NNPH 1YECH 2VL4A 1B4JL 1ZAGA 2XWBB 3KPRE 2P5ED 5ESVB 4MAUH 4OGXH 4M5YH 4G6FB 2H1PL 4QY8B 1D5XA 4MB4A 5C0AB 1EGJL 2W07A 4R4BB 4WUKH 3ARVA 2EKSB 1CBVH 4HKXB 5IROA 3V8CA 3LS4L 3LN4B 2VKWA 4WTZA 1X5FA 4NM8L 1RUKH 4NM4L 3DX9B 3BZ4B 3B83A 4W4OC 2XIDA 4FZEH 4ZAKB 5DRXB 4M7LH 4HUXA 1S5IL 4RA0C 1NGZA 3H9YA 2XPGB 2Y5EA 1MEXH 1K6QH 1QNZL 3VFNA 3I6LD 1C5CL 5DT1H 2AJZA 2EDJA 2EDHA 3QWOA 5FK9A 3ZE2E 3KPTA 2VXVH 2Q87A 3I2CL 3RI5K 4XRCB 3NPSC 5FKPA 4G42A 5HDQL 1W0WA 5B8CA 2WIIB 5IB2B 2HVJB 1U9KA 2AV7B 2AABH 4XAWL 3UDWC 5INCB 4HXBH 5L0QC 4L29A 2LE9A 3VWKC 1KYOJ 5JORA 1HH6A 1YQ2A 3C8KA 3H42H 3H7BA 4MDJA 2VZ3A 1F45A 4OF8A 5FYLL 4MXQD 4IIQC 2W92A 5F7LB 2PYEE 4ZTOL 4NOBA 3W9EA 1RSFA 3RQ3A 5FGCB 5I8OL 1JHTB 3S5LG 1I1AC 2DBLL 1YPZA 4OLUL 3DUUA 2EDTA 3HUJB 1J88A 2KKQA 4XBPA 5CD3A 1MEXL 3CH1A 2NW3B 3RVTC 3TN0B 4OM1L 3X14B 5IOPA 5JPMB 1ZOXA 1CL7H 3O3EB 3NIDF 1T4KA 1RY7B 2LU4A 2YPVL 5FM5M 5BRZE 3T0DA 3U36B 4FG6D 3QNYB 4ONFH 2DQEH 3DXAA 1TIUA 4PJFB 1F6LL 2YD6A 4LP5A 3VJ6B 5JZ7D 3CPLA 2QQLH 1NEZG 3CFEA 2APXA 2HN7B 4XB8A 5D2LA 3AGVA 4I3SL 3RX8A 3DX6A 3HC0B 4JREC 5GRVL 2IBBA 3PWPE 5IVXB 3L5WB 4JQIL 4KV5F 2FLRT 1T0NA 2IEPA 4GUPB 3CFDB 2M2DA 3EDFA 4X4XB 3RWCB 4Q97A 1YNLL 1JP5A 3WXWH 2ZKHH 5IW3A 2AEPH 2C4XA 2FX7H 2J8UB 1BQUA 1T21A 5EPMB 3ZYIA 4X9IA 3VA6A 2CLVB 5GHWH 1DUZA 1XIWA 3ZTJH 2H8PB 2E6PA 3UEZA 2VSDA 2EEAA 2H26A 5FDWA 2Q76A 1R0AH 3F58L 5L8LB 2XXCB 5D7IF 1AO7D 3LQZB 2VO5A 3BP4A 1BGXH 4IHOA 1MRDL 3LHPH 3AY4C 3TJEH 3RTQD 3BJ91 3OKEB 4P2QD 3ARBA 2PTUA 4PGZA 3RPIA 5GGQL 2VLLA 4DWHA 4ZSOE 4ESKA 1JNJA 1U6AL 3RKDC 3BJLA 3MXVL 3HZVA 5MI0B 4JRWA 4KK8D 2Y4SA 3RTQC 1RULL 1TDQA 4PRDA 3VI4E 3P4NA 5D6DC 1FFNA 3V5HB 4X80L 2YBRB 1IGJA 1KPUB 4FFWD 2DKUA 2VL5B 4P5KA 4AEFA 1S5HA 2E9IA 3HI5L 5K9QI 4U3HA 2ZUQB 5CJ5A 2WQ8A 4NOFA 1N3NA 3OPZH 1JNHA 1IC5H 4IRJA 5T1DH 1QZ1A 1ITCA 3H7LA 1QSEB 1H8SA 4I18B 3MOAL 5AEAA 3WSQL 4ZOCA 4LLUA 4GRLC 4WI5A 3LIZL 5CEZD 5DJXA 2D7MA 4JPKH 5MEOB 3GMRB 2AV1A 1CLZL 5HYJE 3PWPD 5A2KH 1Z9MA 3NGBB 3W39B 1IGYA 1T03L 1VEMA 5EIVA 2DTML 3D9AH 3TPUB 4LHUB 1J8KA 3RWDA 1XT5A 1FPTH 2ICWA 1KXVC 1TFHA 2NY3D 5E6YA 3VXTB 3A67L 4QHNB 4LCYB 4OLYL 1QLFA 4ELME 4ODWB 2UYLB 4PLNC 2UY6A 2D0GA 3VD4A 5DK0B 1G9NH 3P9LB 3T0EB 43CAA 4XPAL 1DP0A 4EN3D 1FYTE 1NGQL 3NZ8A 2DQJL 3BH8A 3BKYH 4UQ3B 1MAMH 4I0KA 3N1QC 2O5YH 5TF0A 1TZIB 3JWNC 3SDYH 2GKIA 4CVXB 3O45B 4OCSL 2OTWA 4F7MA 1R5IB 1AO7B 2XY1A 5C08A 2X1OA 5E8NB 3SKMA 5B22A 2OXGA 3DRQA 5F3HB 4ZS6D 5K59F 4YO0B 4OI7A 1MCJA 1FQ9C 4J6RL 2XKNA 3HZKA 2GSIA 1BIIB 3GJEA 1TQBB 1QO3B 5CINH 4UAOB 1U2HA 2X9XA 5GJTL 3DRTA 4P9MH 1FFOB 3CFBB 5ICZA 5KZCB 1G7HA 1E4WH 5FGBA 2V2WB 1MIEH 1UB6B 2VLRD 4U1NB 3IDXL 2BXZA 2B1AH 1A1NA 5ENWA 3BFOA 2FWOB 2OSLB 4H88H 1VDGA 1RUAH 3L95B 4H0GA 1JGVL 5I76B 3LKPA 2CMRH 3NABL 4F9LC 1PKQA 1WIUA 5F9JA 1A7NH 3FT3B 4L4TD 1GZQB 3BDYH 2P5WD 3ALXA 1FGVL 2XN9D 3G04A 2YD4A 4XPFL 4Z7WF 4FP8H 3MA7B 4YBLC 5EOCL 3O6LL 5IK3A 3QPQC 5D72H 1N0LA 4M7KH 4U1JA 4ZSOA 4OZGF 2VXTH 4MD4A 5DRZA 5C2BH 1F4WL 2R2CA 4M7ZC 1GGCL 1QBLL 4PRAB 1ZGLA 1J05A 2CK0H 3SDCC 1G7JA 32C2A 4ORZC 3LB6D 2FO1A 2ADJB 3KPSB 3TO4C 2NX5A 3KPQA 5IM7B 4X5WB 2Q6WB 1T2JA 3PHQB 3MZGB 1SYSA 2D7PA 1FL5B 4DAGL 3VFTB 1UM5L 5F8RC 5GSVA 3CSYA 1GOGA 5CEZL 5DK0A 4X8JB 3MTRA 5I8EB 2VERN 5F9JB 2GAZB 2ED7A 5KAQF 1A6AB 4KQ3L 3D18B 2IQAB 3OB0K 1NH6A 5C0CD 1FJ1A 4C55A 4H20L 5J0BA 2VISA 2PR4L 4RFNC 5IW6B 4M9OA 3BDXA 2EYSB 3ROLB 4X7DC 3OL2A 4P2CG 3UTPE 5L2KB 3S3SA 5E03A 4NSKB 1WITA 4S1SH 1N5AB 3ARZA 2YN3A 4UT6L 1G9NC 2WW8A 3DRTB 12E8L 1YDPA 4O2FB 4GXUN 3L7EB 5K9QG 4JPWL 4PGCB 2NNAA 4GQ9L 4R97B 3EJYC 2CRYA 1K8DA 4OZ4B 3PNWB 4OZHA 1AKJA 2HVKB 1AGEA 2XQYK 4YH6A 3Q1SL 3TZVA 2JJSC 1DDHB 4RGOL 2FIRT 4TSBL 5IV2B 3DV4B 1JCKA 2N4IA 3MODL 4N0FB 3MV9E 1S7XA 2FL5A 4C54A 3PWJA 2YC1A 4YQXH 3C08H 1WQVT 5I16A 4Q9RL 2XYCA 4LQFH 5J57B 4X4YA 5DMIH 4P59H 1VPOL 4ZNEE 5C86A 1J0IA 1T2QL 1FZKA 3TBVA 3WIFA 4P9HL 4TRPH 3EZ8A 5D7KD 1OPGL 5D7IE 4K94C 3UBXI 1EO8H 3SDAD 5C6PB 1BZ9B 3ZHDA 2EXYD 5C0BD 2CD0A 5CJXC 4CN1A 3MGTA 4J3UA 4LDLB 3GMRA 1ZMYA 1KN4L 1MCKA 1NUNB 3FCTA 2VABB 4Y16B 4OIIH 1G7IB 1IJ9A 4QRTB 4TQEL 3CDYA 1S7QA 3PDOA 4AEIL 1Z0MA 3D2UA 3TZVD 5CUSH 4GBXB 1RIUL 4LPYA 2X4OB 1DCLA 4S2SA 1M4KA 4XC1L 3O2WL 4EUPH 4HH9B 1U8HB 2RJMA 3GRWA 4Q58C 3BN9C 3DXAB 3P2TA 3GSOA 1VGEH 2AGJL 1Q94A 3PQYB 4J3XA 2ZKHL 4C56B 4CN6A 2F54A 3QXUA 3BE1H 4RGNC 5D6CA 2PTVA 4LCIH 3BIKA 4OF6A 2CJUH 5CILH 4APQA 2XZZA 2J5LB 5ITBH 3U0PB 2ADGB 4LDOB 3UAJD 5HYSA 5F3BA 1AE6L 1E6OL 2H32A 4NCC2 2AK4D 1EHAA 2D7TL 3O3UN 4LIQL 3OJMB 3O3AA 2OK0L 1UC6A 1FL5A 4Z7NF 4ODHL 1KOAA 3SGJC 4YX2H 1JRHI 1KIPA 5EBMB 2ENSA 3MC0A 3SKOA 4LLDA 3N1MC 1AY1H 3AREA 2GCYA 2BOCB 3DPBA 3C9NB 3U79A 2R2HB 5C7XL 1ZS8B 3GGWB 4I4WB 5DFTA 3L5XL 4U1KB 3HRZB 5D7JD 5EUKB 4CDGC 5E08H 1V7NH 4FOMA 2F19H 3T0BA 4FQ2H 4JFDD 3Q3GB 5DD3L 4QRPE 1XR9A 1G7PB 2XQBH 5J11B 4OZIB 1H5BA 2DI7A 4UQ2B 3SKJH 5H37H 1I85C 3ULVD 4IJ3C 1AGDB 2J6EL 1GJIA 2X7LB 4NWTH 2A38A 3EUUA 4YFDB 2GJ6E 4XPAH 5FUZL 2FYYB 4WI9A 3RGVA 3TN0A 4XBGA 5HI3D 2WWMD 5EB9A 3LCYA 5KG9A 2KZWA 3IFNH 4M93B 4GAGH 4OCXL 1JYVA 2E6QA 1S5IH 2MOVA 2CUIA 2WUBL 4G9FE 5DJZA 1X4ZA 2PW2B 2XG5A 1T6WA 1E4XH 2PETA 5E5UB 4LLYA 5C2UB 1G6VK 4OUOA 1I1YB 2HWZH 1XR8B 4F9PC 4TTGA 4HIEB 4WW2B 4F57H 1CE1L 4GFTB 3FO1A 1TJGH 4BKLA 1NAML 3OR6B 1XCQB 1IAII 3CC5A 2AXGB 4PJ8B 3N1FC 2F5BL 3VMOA 1AQKL 4PRPD 3GSVB 3NN8B 5I1KH 2I5YH 1EA9C 1YECL 4LLQB 5D1ZD 2FSEB 1ZE3C 5CJ8A 5KG9B 1MQKL 3C60D 1TZIA 3LS5H 2HKFL 3QDGD 2Z31C 4XHJC 4U6HB 1T1YA 1D5MB 1M7XA 4R2GB 4AH2A 4NDMA 2FYYA 1J9CT 1QHPA 4PB0H 4PY7B 4WI3A 3RWIA 3WFHB 1MCEA 4ELMA 4LAQL 1JV5A 1EHLH 4XNMB 2BSTA 3ZKNC 2FH6A 2HG5A 3NPSB 2D4FA 4WEUD 4X8XA 3EOAB 3AM8C 5CEYB 1UKTA 4ONOA 2X1QA 4Q2ZB 1A6TA 4GAYB 3LHPL 4JR9H 5E56A 5L0QB 4GG6B 3GDBA 4LSUH 2ICES 3RTQA 1IGYB 5IVXF 1IAMA 2ZUYA 4PY8I 1MHCB 2QSTA 3B4NA 2G5BB 4LGRB 1WWAX 3R06B 3RWEB 5CSBA 1BX2A 3TBTB 1I1CA 1SYVA 2FJFA 5DQDH 1P2CB 5EN2B 1X7QA 1WBYB 3QUYC 1P4BL 4NT6B 1I7UB 1FYHB 1O7SA 4D0DB 1OARH 4TRPL 5GGTA 1T1ZA 4PY7A 3WFHA 1ZLVH 4QHKI 1H3XA 1QSVA 4UUJA 1U0QA 4F37F 4ZPTB 3U4AA 4M6OL 4I3RL 2CKBL 1M05B 3BZFA 3NCCB 2VH5H 2ZUTA 1LK2A 5DJ8A 1FLRL 2FNBA 3UTSB 4WO4A 2R1YA 2YUZA 4G8EB 5HGGS 3QRGH 2QSCH 4GQPH 4M00A 4OV6F 1A4KB 1TCMA 1CLOH 2CXGA 3GSOB 3O3DA 1MCBA 2D7QA 1F11A 2GK0A 3MGAA 3H9ZA 5IMMB 3IFLL 3ARBD 3QP3A 3HMXL 4XMKL 5GGRY 4LSPH 5FYJU 4WFGD 2XZQL 4O2EB 4XPTL 3EHBC 1MQ8A 4M61B 2BVYA 1CTOA 1A1MB 3BQUC 3N0PB 3KLAB 4NPYB 2X89A 3I9GH 4NRXB 4P3CL 3PGFH 3S3PA 1HHGB 1A1OB 4MD0A 3U9UB 1QR1B 2YPLA 4CBPA 1REIA 5EBLA 4UDTB 4PJAF 2V5SA 5FA4B 2AJYH 3L3HB 3PWUB 3R8BB 4UDUB 4RAUB 4BQ8A 1UXSA 2IMNA 5C0DA 5EU7E 4ONHA 1DLHB 5MENE 3SDDB 5AYUL 2BNRB 1A4JA 2GSGB 4UIKH 1VSCA 3P11H 2VLJE 5C0AD 1P4LA 1IFHL 4RAVB 3HUJF 2DTSA 1FFPA 4Z0XB 4OKVA 5AAMA 3TIEA 4BFGA 3QNYA 2DM7A 1M7DB 4U1GC 1KXQE 2W9DH 2BOCA 4NZDA 5B3NA 1CGSH 3PXHA 4HBQA 3MV7A 4U0QB 3QQ4B 1PZ5B 3JV6A 1CLOL 1CG9A 1C5BL 2UUDH 2UV3A 3C5SB 5KVFH 4YIQB 4JDTH 4F9LA 3QFJE 1Y18B 1OAXL 4LHUG 1GHFL 3MV8B 1DDHA 5A40E 3DX7A 3C09C 3BPNC 4JDTL 1HKLL 3OKLB 5LG1A 2ADGA 4JJ5B 3LMJH 1NCBH 1R5WB 5SWZB 1XF4B 1F3JA 3ZE1E 5EORL 1FV1A 2FCBA 4QHUB 4GXUM 2VQTA 3BDBA 2BRQA 4JFOA 1CICC 4H8WH 4XI5D 4K71C 4J3OC 2MPAL 2VXQL 1ACZA 1TCRB 2WUCH 1YUHA 3O3BB 4GRLB 1CD1B 2FB4H 1D5ZB 3DO7A 4R90H 5L2KA 1HINH 1CGTA 3VE0A 4ACPA 4EI6B 5ISZA 2EO9A 3MRDB 4YHZH 2WBJA 2PXYB 2YMXL 3EYVA 2OL3L 1LO4H 4YHMH 4QYOA 1K5NB 3HAEH 5HHMD 3QDAA 1SVCP 4Y4HB 4GKZA 5I73C 3WIHA 4KHTL 1KB5B 3SE3A 3V4UL 4L8CB 5BZDB 2R8SH 1KBGH 2V5RA 5GQBA 5C9KA 3VGGA 4ZNEA 5I1DA 3G9VA 2LVCA 3WEXA 2EDXA 1H8NA 3SKNB 1DEEA 1JNNL 4J8RB 4V1DB 4P9ML 3BPCA 5DJ6A 2XFXB 1BFTA 2VB5A 3KPLA 4I77H 3O2VL 4NWUL 1T66D 2A74A 1TCRA 1RZGB 5TDNB 5MENA 5IVNA 1ZLSL 4HS6B 3ORJA 5E2TL 4NQXB 5C9JA 1MHEA 4UTAL 1FV1B 3MSPA 5IVZB 4MJIE 4MS8D 2B2XH 1G9EA 1LD9A 1PEWA 1S7WA 4DW2H 3O8XA 3WLBA 5JW4M 4U1JB 5EA0L 3MLWH 3LQMA 3Q5OA 4OF3A 4WFED 5I15L 1JGDA 3ZDYE 1LDSA 4KJYB 1UZ8A 5LQBL 3HNSL 1DBMH 4MNHA 4Z7VF 3GMOA 4WU5A 1C5DB 3H2WA 3FQXA 1H3PH 3UP1A 4DKEH 2W9DL 1HHHA 5FHAH 1FZMA 3DVGA 3UC0H 1PAMA 3D0LB 2FSEA 3QO0B 4LARH 1NCCH 5HDOA 4OFPA 5CLTA 5I8KH 1WCQA 4U0RC 1U8MA 3NIGE 3LKPB 4WWKD 3RL1B 2ADIA 3HNVH 3GKZA 3UTZB 2COQA 1W0VB 4QTHB 1I7TB 1E4KC 5M7QA 5I1GH 2YD9A 1EK3A 3IDIA 3QEUB 4KV5E 4FNLL 4FQIL 3U6RB 5GZOD 2NY0D 5JDSA 3PHOA 4UDTA 1OTUC 3OG6B 5FCUL 3T2NL 4WTXA 4PJCE 4MX7B 4TNVF 3RDTD 1MCLA 4KI5C 4LPUA 4OCMC 1XIWC 1OVZA 1FCGA 3B6SA 4NQEB 1A1MA 4AG4H 1PLGH 4QRUB 4QCIA 3FQWB 3QEGL 1IC5L 1S78D 3QQ3A 2Y25A 3QJHA 4R2GD 1P84K 5SV3A 2DIJA 2R0KH 1KF9B 5EU5B 1S9VA 5DFVC 4KUCD 4P4KC 4QXWA 4U1SA 3P4LA 1YY8B 1QVOA 3QDME 1U2CA 1AD9B 4XCFH 3P0VL 2PYED 2EH8L 4EDXA 5JNYB 1MREH 2R1YB 3HLAA 3LVEA 3OAZH 1JTTA 1V7MH 3GGWA 4I4WA 2OLDA 3M8OH 2E5EA 2AJ3B 1T89A 4QNPE 5IVZA 3U1SL 4LRNH 3RPKA 1IARB 2B5IB 3PL6C 4LLDB 1JPTL 2BCKB 1A47A 1VACA 3P4OB 4HPYH 3FRUB 3S88H 3KS0H 5HVHB 1FIGH 2VQ1B 5DGRA 1WC7B 5ILTH 4F80A 3UTOA 4XH2A 3MA7A 3MLTB 4PV8B 3VD7A 5HHPB 4U0RB 1YNKL 5C70A 1I8MB 4CKVX 4S1RL 2IANB 2AGJH 4Z7NE 4YFLI 4LCUA 4PGDB 1BVKB 2DLTA 1U6AH 3TGXA 3QO1A 4ZO9A 4D9RD 4GBXD 4UZGA 3WDHA 5TE4L 1H3TA 3U2SB 4RCAA 3H9SD 4OCWH 1N3NB 2Y06L 3LDBB 4GAYA 2D9QB 4PTTB 3P0VH 3SCMA 2ZPKL 1JYNA 1UB6A 1T83C 3JV4A 1KPUA 3PP3H 4FABH 4NO0D 5LXGH 3SE9L 5CWSB 4JPVH 4DFHA 1J5OL 5C0RL 2PTTA 1I9JL 4LLMB 3VXMA 2P8LA 4UILH 1QO3A 5JPNA 2A83B 4DUVA 2F19L 1WFNA 3ARBB 3RPIB 4NRZB 3LQAL 1IAOB 1CIDA 1KCVH 1AH1A 1BVKA 4Y4KB 3IDYC 4IM8A 1WJ3A 4P46B 1SMOA 4WI4A 1HOCA 4XZUA 3FOLA 3K4DA 4OV5A 3ARRA 3TBSB 2FEDD 4YNYB 1JGEB 1MCPH 5E2UL 5M95B 2CLRB 3QDJD 1P9MA 3WNOA 4L4TB 4M5ZH 3HB3C 2GIYA 3QDMA 1ZT4A 4WV1A 3MLVL 3JSSA 4CJ0A 4QO1A 4DAGH 4OFYD 4QRRA 3TV3H 4XNUH 4AEHH 3O9WD 2GJ6B 3DYPA 2JJTA 3HLAB 4PJGE 3VXUD 2R4SL 3K0WA 4JY5H 4KAQH 5E1HB 3BRGC 5A3IC 4BZ2H 2VMFA 3L3GA 1WFTA 1EEZB 5I8CB 1CXIA 3CFIC 3QIBA 1ZLSH 4NN6C 5BS0A 2Q1EA 1IE5A 1YN6A 5EDXA 1AIFB 1S7VA 4GQ9H 1KLGB 2BVUA 3RHWK 4UNVA 3W39A 4EUPG 1H3PL 3IXTB 1K4CB 2HJFB 35C8L 3Q6FA 4OFDA 1RZKC 2A2QT 2X7LA 3O6ML 2ZUXA 5ILTL 1NFDF 5E99L 2YZ8A 4MB3A 4KTDH 4JDVB 2H3NB 5D1ZA 1VGEL 1RIUH 4ENED 5KSAB 3V79C 4OTXL 5F21B 4OIBA 3ILQC 4UQ2A 3PP3K 1H15A 3U1SH 4PREB 5J1SC 4N8CL 1KLUB 3ECBB 4YHZL 1CDBA 2A9MH 5IT2L 4UV7L 1NGPH 4UT7L 1FZJB 4AEIH 3FRPA 4LSSL 3RZWA 3LKNB 5BO1L 3QA3A 1WAAE 1FDLH 4R26L 2Q86B 3C8KB 3H7BB 4MDJB 3MRLA 1ZS8A 3C9NA 1BLNA 1C5BH 2HRLA 3JUZA 3PV7A 4L4VD 4XNQB 3VXME 1EPFA 4K3EH 3OAYK 4ZTPL 5C08E 3V7AE 3IDYB 5E4EB 3P9MA 2VC2H 5TPWH 2VZ1A 1CE6B 4KROB 5HGBB 3RKDD 5HSFA 2BVOA 4OLVH 4GRMB 3RGVD 3TNNB 3LS4H 5FYKU 1IEAB 1TETH 4RZCA 1KEGL 2ZUWA 3JVGA 2ZUSA 3OKMB 5F6HJ 4O5LL 3VFGH 3RU8H 3CU1A 3LRSA 1CGWA 5FFLA 1U3YA 1DFBL 1AP2B 4ORGA 3O4OC 5CSZA 2QTEA 1SJHA 3VXRD 3MUHL 1JZ7A 5DRXA 3KPSA 4H1LG 1XF1A 1T21B 2E6JA 1Q94B 3DMMD 2LFGA 5C0JB 3P4MB 3O9WB 4MXVF 4N0UA 3LN4A 2Z4QA 3H3KA 1YEIH 1F4XL 3QUML 2F53A 3QIUB 5D7KE 5I1IL 1SM3H 3ZE0F 1ZSDB 3B3IA 3EJYD 3P30H 4HSQA 3IKKA 3H9HA 3EOAA 4URTB 4LARL 5D2NE 5MHSD 1BEYL 4XCCL 1RU9L 3C2AH 3TA3B 1HIMH 2W9LA 3FT3A 4YHOH 4BSVA 5MEQA 1KENL 1MNUH 3B2UC 4N1HB 5E8EB 3CXHK 5AUMA 4Y4HA 2BSSA 1AHWB 3BI9X 4YBHA 4MQTB 5HYIA 1AIFA 1S7VB 5DMIL 4NN7C 1DSFL 2Q7NA 4OLVL 2B2XL 4JFQA 4R0LB 4YE4L 4ZFGH 4E0RA 3IFOA 5JZ7C 3GBML 5ICZB 3UTSD 3OR7A 3I85A 1P7QA 5I9QC 3VWJB 5DSCA 1B4RA 5JW4Q 5DHVA 5D5MA 5GGTL 3GRWL 4XXDB 3VGBA 2X1WL 3PQYD 1PY9A 5EZOH 2OTUA 1V3LA 1ZT1A 1I3RA 5GJSL 3VXSB 4ONGH 4HGKC 4JFHD 3RDTB 5MERB 1ZLUK 3DXAE 4ISVB 2A9ML 4EVNB 4YWGH 3SKMB 4I3RH 5KSUB 4K8RH 1IILE 3QXDA 4MAYA 3LEXB 1BAFL 3MRFB 3IVKB 1DTUA 3NA4A 4Y4KA 2OJZL 2AXFA 2LAAA 3BH8B 5C71A 3NZHH 4BSWA 2P1YA 3EIFA 5HHQB 1GGTA 1WWBX 4TTDC 4PGCA 43CAB 3HCVA 3T0EA 3QEHA 3HR5A 1J8HE 2CMRL 4EI5D 4O2FA 1NDGB 5KBNC 2PYEB 3VRJA 1HEZB 4ZUUB 4OZIA 5IMOA 1GZPB 2HT2D 1NCBL 1VCAA 1S9XA 5TPWL 4HUWA 3VFGL 3LPFA 3WSQH 2EIZA 1OAXH 3HE6B 4KDTC 4FFYL 3BISA 4PJIF 4U1KA 3QUXA 1I75A 2VDNH 5FA3A 3KLHC 2APBA 2R0WH 4NQDB 1C7TA 1MLCA 4H0IA 4PJHF 1N0XH 3L5HA 1JPSH 1YN7A 4N8CH 1QQDA 4RAHA 1OGTB 1R3JA 2C1PA 5I1JH 5F7UA 4FRWA 4OF7A 4RFNB 4MNQB 4PJ9B 5F3BB 1J05B 4TNWF 4LKCB 5ALCH 1XF2A 3ULVH 1NUFA 3HAEG 1I1AB 4APQB 3HFMH 2B1HL 5D5ME 1FFNB 2VRAA 4YDKH 3VFUB 2YA1A 3TV3L 2EDWA 2EIDA 1NGQH 3WIIL 1TNMA 1YY9C 5DMJB 2KPNA 4PRBA 4KFZC 5CSZB 3I6KB 1BBJB 4LCCB 2BZDA 2W0FA 2GUOA 3QUZB 1I85A 2X4TB 3BZFB 3GSUA 3TJHC 3ZHKA 1IEAA 4HKBA 4GAGL 1Q0YH 4PRPB 2XT1B 1QR4A 1RD6A 2BHZA 3TN0C 3B6SB 3DOSA 4NFCA 1KT2B 4X7SH 4PG9A 2VLKB 1BQHB 4YBQC 3VRIA 2Y7QA 3V6ZB 1DQMH 4Z7UF 1J5OH 1TJIL 4GAJL 2VQUA 4P49A 4QOKB 3WMSA 4S10A 4JDZB 3OZ9L 3MOAH 3BT2H 3QPXH 4GW4B 3FL7A 4FXKB 5D7IB 5I1HL 3C5ZA 3O41B 1B0GA 1WZLA 4ODSL 2ESVA 4TVPH 2CKBH 4Y2DA 1N6QL 1Y0LA 4U6XA 1FVEB 1B4JH 2VJXA 4I1NB 3OKKA 3IDMB 5K9KB 4OJFL 5C0NC 5C07D 5E0QA 3G6DL 3CD4A 3O45A 4Q74A 1QA9A 3GI8L 3ARUA 4LSQL 5HGDB 1JZ8A 5GGQH 1A8JH 2NW3A 3X14A 2NTFB 3I6LE 4MNGB 4JVPA 2V7HB 4TSCL 4HUKB 3MR9A 4YDJB 1IQDB 1D5BB 3F7YA 1JHTA 4MAYB 5BZWA 1B6UA 5HHXH 5GS1B 1KJ2H 4UNTA 4AG4L 3NCFB 4TUJB 1XCQA 1JUFA 5C0EA 4XPGL 1I1AD 4WU7B 2ESVB 4UT9L 1KEML 2IQ9H 1NCWH 3UYRL 5DD0L 5INCA 1EO8L 2BNQD 3KJ4B 4Z7UE 3MBEC 1ZT4B 2FX7L 4YBQD 5TDNA 1P7QB 2IG2L 2EE9A 2NY0B 1NMCC 4X6FA 5KZCD 2IADB 3BPCB 4WWID 3KPPA 1HNGA 5JXED 1HXYA 1ZV5A 4NP4H 5I1DB 3EFFA 4WWKC 3KYMB 3RNQB 1KT2A 5T5FL 5E6IA 5KVEH 3S4SG 3N85H 3WLWC 4NQED 1QBML 1GHFH 1SVZA 2RGSA 3QWRD 4BQ9A 3U4EB 2XPGA 2X44D 2WWMC 3Q48A 1GH7A 4OSUL 1LEIB 3G5ZB 3QYCA 5BRZA 1N6UA 1FL3B 1UQSA 4GAFB 1VERA 3EKCA 5DUPL 5GSVB 3C2AL 4MZ2A 1LE9A 3QEGH 2Z0BA 2Z8RA 4DK3A 1NCWL 3VRLE 4Z9KB 2YPVH 4KGLA 5GGUA 3CMOH 1QFPA 1V8HA 4PJBA 4FA8A 1RJYA 4L8BA 1KIRB 4XP1H 4YHLL 3NACH 2IF7A 2Z4QB 4B53A 4JFDB 1I1AA 4HK3N 4JJ5A 4G8GE 3NCJL 1V05A 4G80A 2ARJB 3BX7C 5HGAA 3TA3D 5FHAL 4JAMB 2AEQH 5EOQH 4OLZL 3MLTA 4ODVL 3G04B 4HG4J 4X99B 5IB3B 4KJPD 2Y36L 5DDHB 4HS8L 4C59B 3JWDL 2AJSH 1DUZB 4ZUSA 4YE4H 3SKJL 5HHOD 4GOSA 4WNQA 3ESUF 3W0WB 3TNNA 2V2XB 5EU4A 4ZOAA 1T80A 3SPVB 3Q1SH 1YNLH 1IRAY 1OF2B 5EU3A 3FFDA 4MSWA 4LBEB 1RJYB 5C0CB 3MRMB 1RJLA 4QRSA 2R1WB 4NJ9L 2VTFA 1GPOH 1ZVSB 4OZHE 4K3EL 4RQQB 3QUKB 3ULVF 4HZAA 3TVMD 4UDUA 1S9VB 1EV2E 2F74A 2LU3A 1FDLL 4R26H 3CPLB 5FA4A 2P42B 5I17A 5IB4B 1CICB 4RFOL 4S2SB 1KLUA 4TOYH 1CIUA 4I9WD 5CJQL 4HMDA 2DLFH 4NCDA 4DKDC 1YMMB 3Q0HA 4QT5A 1A9EA 2FD6H 1F00I 2IPKA 4GKOA 4QRTA 5HYSG 3W2DH 4XXCA 3UJTL 2H1PH 2IADA 4V2BA 1BF2A 3MLYH 3LQAC 1CXHA 1F97A 1YEGL 4ISVA 3TNMB 2CQVA 2FB4L 4HLJA 1L7TL 4ENEC 3D3VD 2KDGA 1DQJB 4S1SL 1NC2B 4HUNB 1HH6B 3OKDB 3D0VA 4XAWH 5ITFA 4PJBE 1I3GL 3G6JE 3LKOB 4JFXA 5D5MB 1R24A 3NBNA 3P11L 3KYKL 4YGVA 1EMTL 3ZTNH 5KSBB 1YEJL 5J13B 1QRND 2H2PC 1HILA 1QFOA 4OQTH 4G6KL 3U0WL 3DVGB 3X13B 2AJZB 4WCYL 5INDA 5CINL 5H37G 4LLVA 3V5DB 2GJJA 1GIGH 3NH7H 1QD0A 3MBEA 2VDNL 3QQNA 1CDYA 3ZT5A 4RNRB 4GMTH 1Y0LB 4PJ5B 4Q9QH 3UPRA 4FFVC 1DZBA 1LK3L 1P7KA 5HYJA 3REWB 1LEKA 2NY1D 4RMSA 3KPLB 5ICXB 3DURA 5B3JF 2HMID 3OAUL 3DIFB 1ZHNA 5CZXC 4V1DA 5DJ6B 4JZOA 3X17A 4FQCH 3TH4T 3D39B 4YDVB 3CFKB 4L8CA 1DEDA 1NDMA 4M1DL 2AI0L 2EDQA 4OGAD 1T7ZA 5FAAA 3T0EE 1IFHH 3QFJD 1MSPA 1F4XH 2HT4D 4MQ7B 3U4EA 4N0CD 5IESH 4NZTH 3EFFB 1RK0B 1TVDA 4E9LA 3LQZA 2X4TA 3OAYH 5IKCB 4OFVA 2B1AL 2R4SH 1CTNA 1U42A 5BJTA 2DTMH 2XTJE 1BZ7A 2VQ1A 2F8VA 4QRPA 1MUJB 1WAAF 5JW4R 3RUGF 3P0GB 1QOKA 3FQRB 4NN6B 1KC5L 3J8F7 5LGHL 2PO6D 5DA0B 2ZNXA 4M1GH 4WY7L 1OWRM 1J87A 3GBNL 3FFCD 2WINB 1FZJA 5HYFA 5H94B 3RUGE 1T0NB 1K8IA 4M6OH 5ADPL 3KLHD 2X2YA 4HUMB 2FECL 5MEPB 1H0DA 1H15B 4CVZA 1N2RB 3ULSB 5DD1H 2ZG3A 3LEYL 2Y36H 4X6EB 2NYYD 1W0YT 4YX2L 4JY4B 3L3IA 1YQVH 2XWJA 4Q9CA 3AS3A 4KROC 1NCDH 1EZVY 3IDMA 3ARDB 4X6EA 2VH5L 2Z8WC 4P2RD 3FHQA 2VDOL 3C60C 4Z7OE 3RZCD 4JO2H 3JWDC 4ZYKA 1S9WB 1KYOK 5EBWB 4K8RD 5IMKB 3D25B 2A9NH 1NGXB 3O81A 3R0NA 4R7NB 1I9RH 2AVGA 3P73B 2FECI 4HUVB 3V6FA 4CDHA 3WNLA 4OAWA 1U3ZA 1RULH 4TVPD 1CK0L 1KJMB 5C92A 5BV7L 1BQHA 4NRXA 3BRDA 3LD8C 2AV7A 3AS2A 4JFDE 4H26A 1NLDL 3VFOB 2R69L 4JLRA 3FQTB 2FZ3B 1LO0L 3RL1A 1U91B 3ZDXF 4PS4H 1OAYH 2Y07L 4F7MB 5F7HA 2NX5E 5LVEA 3IJYB 3K46A 3OV6A 1TZGL 2ZUQC 3CVHH 3QZWA 1T04A 4WW1A 3QULB 4OCYH 2BY1A 1RK1B 1AHWC 4MA1C 2CLZB 2VXSL 1F3DJ 3O2DA 1T7VA 3QIUC 1J18A 4ETYA 2NR6C 3KWWA 4V1DD 4ZFZA 1MCPL 3FTGA 4YHIA 5E2UH 4FQQB 5B39B 4PG2A 3FO0L 4DCQB 2YK1H 1J1OH 3FAXA 4MVBD 4P3DA 1HZHL 5JHLL 2H45A 4KWUA 2DQFA 2V5YA 3IGAB 4WHYG 4POZD 1ZLWK 3WNPA 5J6GB 4LHUA 1DVFB 2DQGL 2DL2A 4PTTA 4PJGF 3REWA 3O0RH 5LBSH 5C0AA 2BJMH 2W65A 2CPCA 1PG7H 1GC1C 3FB5A 4XCYB 4BM7A 2WK2A 1DE4A 2XA8H 4JN1L 4D9QD 4Y8DC 1EX0A 3WEXB 4TSCH 3X3FL 4EBQH 1JK8A 4J2XA 3KPNA 4OLWL 3ARFC 3V5DA 5A43C 1PQZA 5KSAD 2D7TH 4M4PA 4YHYB 2DF3A 2E7HA 4P2YA 4U05A 3E6FB 3M17B 2MNUA 1MWAB 2VLRA 3QCTH 1VFBB 1A7PH 3TFKD 4KK8C 1YEDB 4P3DB 4WO4C 2NPLX 4DCQA 3VGAB 5DVKA 2RBLA 3BKML 3VXMD 1T7YA 1QNZH 3ELAT 1T1XB 2GYSA 2VLKE 1RUKL 3ILPA 5H35A 1DQJA 5ECJE 1S7RA 1X6LA 2B1HH 1D9KB 4KROD 2ITDA 1T3FB 3DX8A 9CGTA 5E2TH 5TDPB 1BFSA 5AZ2H 1GC1H 3H9SE 4WFFD 5C1MB 3E6FA 3M17A 3GIVB 4IMKA 1UXWB 4U1MA 4MAUL 4OGXL 2EKJA 2E7MA 4X5XA 4P0DA 1YMMA 1FE8H 4G8GA 1ETZA 4JRYE 2QHLA 1I1YA 3VH8A 1NC2D 2Z8SA 4LLWA 3L5JA 1YDPB 1A6UL 3JTTA 1T2QH 3DVNB 1VKXA 1DQQA 1VPOH 4OQTL 4Z7WA 2OM5A 3L5WA 2EYSA 4HC1A 2R1WA 1QRNB 1MFBH 1HHIB 2HN7A 2YD8A 1FNFA 1FYTB 1P6FA 3DSFH 4I5BA 3GHEH 4PP1D 2X9YA 4JDVA 1MCOL 1MWAH 2QQKH 3FFDB 4MSWB 2BSSB 5A3ID 4DZ8B 2MPAH 1U8MB 2VXQH 1GGBH 2IFGA 5FUOL 4HWZA 4XMLL 2NY2C 4EUPB 3MRPA 3GRWH 4FQHA 5IFAH 3EJZD 1FORH 1IBGL 1DBKL 3TO4B 1HWHB 5HPMB 1KGCD 3GHBH 5HHNA 4JFFB 3O2WH 1QFUL 4OF5A 3QIBB 1LO3L 3HNVL 3GMPB 3QWRA 1FNLA 4RGOH 4AIZA 2UWEA 5F1SA 3FOMA 4NHCH 4DUXA 4ZNCD 5E8PA 3GSNH 2PYFB 1JHLL 3HAEA 4MXWL 5FYKH 1H5BC 4YHNB 3BO8B 3WS3B 3L7FB 4UT6H 1MPAL 4QRPB 3MLXL 5TJWK 3KNBB 4K3HA 5D1XD 5JIHA 5C0AE 3TT3H 1RHFA 1B0RA 1FN4A 5HYSB 2ZG2A 3D25A 3GI9H 3H9SA 4PJHE 4KQ3H 1PG7W 1PKQB 4F3FB 3O11A 1RUML 1N59A 5IB5B 2P8LB 3WKML 2Z31D 4OM0L 1O0VA 4KU1A 1W2KT 2CIKA 3BEWA 4XNQA 3WD5L 5GS1C 4F7PB 3RAJL 5IEHB 2D4DA 3H0TA 4OM0H 2BNQA 3ZTJG 1NL0L 1XGQB 5ICXA 3MLSH 1U8PA 3K8MA 1RZIB 3E6HB 1IKNC 4DGYH 1Z9SA 3MFGB 1HH9B 1A6TB 3C5ZD 2Y9RT 3IFLH 1WWCA 2UZIL 3LKQA 5GIRA 2XACC 3WN5B 3F7RA 4L8SB 2I9TA 2VABA 2C9AA 4RSVA 4OI8A 2FHCA 4EN3B 4CVXA 4NKIL 5DZNA 1J0KA 1BZ9A 1INQB 2L7UA 1BFOB 3CDCA 4NM8H 3QIBD 4Y16D 2PF6A 4NIKB 4PJ7A 5B38A 3KYOB 1WVZA 4NC2B 1YMME 3T65B 2AXGA 4K7PL 1IQWH 1M7IA 1OARL 4EI5C 2IC2A 1P4LB 5I1CL 4APQD 1Q72H 2GTWB 5DFVD 4PJAE 1FAKT 1IBGH 2BXYA 3FO1B 4PRNB 3RWJB 2P8MB 1L7IH 1V3KA 2V6HA 4Z7WE 1JFQH 5ETUB 5F6IC 5DC9B 3SGEH 2AJXH 1FO0L 2VDKL 1NCAH 1BQLL 4QOKA 3MRRA 5GXBB 3IU4H 1ZHNB 4MA8H 1X4XA 3QJHB 2E7BA 2YWZA 1SEQL 4LCCC 2BOBB 4PGEA 5FEBA 2F58L 1EMTH 3ZTNL 3K8LA 1I8LA 1X5XA 4F58H 1U8KA 4XX1G 3MRKA 2XQYG 4I0CC 1YEKH 4HX1A 2YEZB 3IAGC 2IALB 2ED9A 5ID0A 4RMVA 3CCHA 4GRWB 1NEZA 5KN5A 2YPLE 4HKBB 3GKWL 2RQ8A 3LKSB 3OF6D 3ULUC 3PV6B 3OX8B 4QOKD 1G7PA 4DQOL 3VGFA 4UU9A 2B39A 4JRXB 2VISB 2YHGA 4K7PX 4LSPL 4LNVA 3QUYA 5D7JB 3LQAH 4J4PC 3JBG7 2FD6L 4GG8A 2HJKA 1W8OA 5J6HB 3VW3H 3BUYB 4Q0XH 5F7NC 4D0CB 3DI3B 3M1BA 4K55A 3QIUD 15C8H 3RX7A 2Y6SD 3DROA 2DLHA 1RUAL 5GGRA 3PL6A 3PDGA 1R24B 2YD7A 3E8UL 4JPVL 4G9DB 1F4YH 4XWOD 1OGTA 5FGRA 4XCEB 1NANI 3GSNB 1MVUB 3SOBL 3MLVH 4JPKL 1LO5A 2IAND 1JGUH 3MV7D 4L4VE 1CE1H 3BGMA 3WLBB 3MJ6A 3QFDA 4FQXC 2J8UA 3GUTB 1LD9B 2BVPB 4PJ5D 4JFDA 3HN3A 1UA6L 3MJ7B 1NUDA 1WFUA 4Y5YC 5E1AA 4L8BB 1EEYA 1ZHBB 5T1LA 1F58H 1RZGA 3V95A 4GLRI 1S9XB 3IETB 2IGFL 4HIIA 1Q9LB 3KLSA 3MO1A 1BD2A 2X40A 2DJUA 4CNIA 2BFVL 2C5DC 1TLKA 2VLJB 3HI6H 4M3JA 5T3XH 1N4XH 5D93C 3VXRE 4NWTL 1MLBA 4N5ED 2XN9A 2EXWD 5CMAB 5EIQA 3KLDA 5KJRH 2VLJA 3ARWA 3FB7B 3X3GL 3UBXG 1CS6A 4ZFOB 2Y06H 2A6DA 1X3DA 1GAFH 4ELMB 3LN5B 4JHAH 5DEGA 1FAIH 5JXAH 4QRSB 5ID1A 5CUSL 5E7FA 5A2FA 1UVQA 1ORSA 1NFDE 4ODUB 1FGNH 5ENWB 4MS8C 3FCTB 4Z18A 4LSTL 4YXKL 2LVEA 3B9KB 6CGTA 2X4QA 3UX9B 3PHOB 2Q7YA 1U8JA 1GGIL 1NBVL 4PJ7E 3TYFB 5DJDA 5JHLH 3QFJA 2LAGB 5GS0C 1HHJB 5LXGL 5F88A 3W9DB 3FO9A 3LH2L 2XTJD 1FNSL 3IDIB 5F7MC 2PO6B 2YXFA 5FM8A 3ME0A 5T5NG 3VFWB 1G7MA 3WFBH 1QBMH 4MXWH 2F5BH 2DD8H 5B8CB 1R3LB 4JQXC 1Q9KA 4G8FA 1VFMA 3VI3E 5IB1B 1F13A 3DMMA 3BUYA 1KPVA 1J1XH 4BSJA 3W5MA 2IAMC 1FZMB 1TJGL 2W0KA 4Y1AA 3T0ED 3PWLB 5CILL 1PSKL 3HI5H 2WM0A 3OGCB 1EJOL 4Y19E 5ISZE 5TF1H 5C0BB 1NLDH 2J8OA 2IAMD 5L7XH 1FVDB 3MRHB 1TJHH 4Q6IC 1PSKH 3LRGA 1CFSA 2R2EA 3BGAA 1CK0H 5FO9A 1JZ2A 3ARDD 3CZFA 3IFNL 1XGRB 3L9RB 2GTZA 4N8VA 4FZ8H 3B9KC 3MGOA 1DLHA 5HGHA 1XCTB 1OLLA 4OCLC 1LNUA 4XBEL 3KYMA 5DVLA 4FZ8L 4XCFL 2ZOLA 3ZE0E 2VIRA 1ODAA 3VXRA 4P5TB 5GGSB 1RUQH 2Y7QB 3V6ZA 5D7LE 2X89D 5BZDA 1C8PA 4PJCA 4X9BA 1JGLL 5EZJA 3LKRB 2WBJC 1N6QH 1E6JH 3QPQD 2P5WA 1XZ0A 1KCUH 3ARBC 1K5NA 1YMMD 4QYOB 1UJ3B 3KPSE 4KZDH 3LS5L 1JRHH 2DJ4A 3LRSB 4YFEA 3QNXB 2OBGA 3BT2L 3QPXL 5I8OH 1CF8L 5FYKD 5LGJB 1YZZA 1KCKA 4AJ0A 4WHDA 4ODSH 3RVTD 4G7VL 3A0OA 5C0GA 4CMMB 2HH0L 4IRZL 4L4VA 2J1KA 3S35H 3BIKB 4FTVD 5TH2B 3T1FB 2BVQA 1IAKB 2R4RL 5BOPA 3L1OL 3DMMB 5DEFB 3V0VA 2JIXB 5DI8A 4Z76B 2FR4B 3KG5A 2FEEI 4ODTL 3PE9A 1L6ZA 2GFBA 4X6DA 2CJUL 3K7UA 5CGYC 5DHXB 1R3JB 2C1PB 2HLFC 3BAEH 4KVNH 1YN7B 3LN9A 4NUJB 2AI0H 1C5CH 3FO9B 4MMZC 5DT1L 4NBXB 1B0WA 1NCCL 3GMMB 5J13C 3TYGL 2WZPD 4FP8L 5FV2A 1ONQB 1ZLWH 3P77B 1E4KA 4JVUA 1F90H 3C5JA 4HPOH 3D69B 2V9TA 3G08A 5HDQH 1FNEB 4V2CB 4X6CB 1NCTA 2D03L 5I76A 1B6DA 3F8UB 1M6OB 2X9WA 1FRGH 5CLWA 3L95A 4KKNA 1NEUA 5E4EC 1ZA6B 4IMKC 4QTIH 3RVUC 1A7QL 1IAIL 1BM3L 4KKAD 2RIKA 3R0MA 4KGJA 2PR4H 1ZTXL 3SDDC 5IMOB 2NY6B 4XCNA 3H9SB 1WEJH 3QAZC 4TULH 1MIEL 2R0LH 1Q1JL 1H3WM 4EKXA 5AZEH 1JE6A 1SBBA 1CFNB 4D3CL 3PWJB 3UBXB 1OPGH 3MACL 1Q9LA 1NC4D 5KSBF 2WP3T 3MFFA 4ZUWA 3IXAB 1QBLH 4AENB 5BVJA 5E1AB 5IROC 2OQJA 2ZUVA 4O2EA 5I0ZA 1YYLL 1I1RA 3DSNA 1AGCA 1AE6H 4Z6AT 5D72L 5A2IH 2V17L 2FJHA 4MCZB 5FECB 1FRGL 2PCPB 1C16B 4AEEA 4GO6B 3G6AA 3QUZC 3SCMC 4ZFFB 2NNAB 1A2YB 3DMMC 2FDBP 4XNXH 3MLUL 5ANME 4HPOL 1K2DB 4P3WA 4Z0BL 5GRXG 1RQ5A 2HVJA 4PFEA 4U6YB 3TO2A 3L3DB 3ZHLA 1DL7H 4G3YH 1LMKA 3V5KB 3TPUA 4JO4L 5B21A 1J7VR 1KB5H 2AK1H 4LRIC 5EZLA 4EIGB 3U2SA 2XWTA 4R96B 2CDFA 2X4RB 5D7LA 1R3IL 1FVCA 2R2BB 1G0DA 3VXQA 3QUXC 5AUMB 3CAFA 5MEND 4HMEA 1O7VA 3CK0H 3GMQA 4PJDB 4I0PA 4WV1C 1NSNH 1A7RL 1GOHA 4Y5VC 5I71C 3IKCA 4L1HA 3VFPB 3VFTA 1TXKA 3RY6A 3EAKA 3B2VH 5I6XB 5JIIA 3Q3GA 3GSXB 5DF0A 4P59L 2OMNA 2QADC 4U6VH 3U30B 1EAJA 4PGEB 3NMEA 3SDCB 1T20A 3CVIH 4D9LL 4HJGB 3DX8B 4C57C 2H9GA 4OLEA 1Q8MA 4EVNA 2VITB 4U6VL 4WDIA 2VE6B 3IFPA 4FQJL 5GRJH 3S34L 1YPZE 5B4MC 4YHKL 1ZT1B 1RU9H 3WHE1 5IGXL 3K81A 1BQSA 3BWAA 4YGAB 4X6DE 1DLFL 2GTWA 5TQ2L 4K23H 4U3CA 2R15A 3WJLA 3SDXB 1FIEA 1SM3L 3MNVA 4U49A 3BD5A 5D1ZC 3K80A 2VXTL 4NC1E 1QKZL 2E8YA 3EO9H 3AU1B 3FB6A 4R97C 2O5ZL 4MJ5A 4NHCL 3CMOL 2R23A 5JOEA 2ITCA 4KUZH 3ZDYF 5I1IH 1NMCB 2P48B 5D6CB 4V1DE 3OXSB 5DUPH 1ZANH 4A6YL 3VMNA 4BKLB 2JELH 1F8TL 1FBIH 1MIMH 3QIBC 2AEIT 4KRPC 1EZVX 2R4RH 2A0LD 3HUJE 5FUOH 2X4PA 3HB3D 1JGVH 3QJFA 4HUUA 1OAQH 2UZXB 4LCWA 3MCKB 3W81A 1P1ZB 1YYLH 3RU8L 4LCWD 1BIIA 3GJEB 4O5LH 2XKNB 1WAAA 1OGAB 3HZKB 4OD2A 3RL2A 2DIAA 1FC1A 1LO2L 2R9HD 4D0BB 5D2NA 3HMWH 5J4MA 2R56H 3D85D 3OKOB 4PUBH 2IG2H 3TCXA 4ZO7A 4W70A 1KCUL 5AAWA 1IM9B 4Z8FL 5IUSA 5B39A 5EC2B 1QG3A 2CH8A 4LAJH 2OL3A 1BZQK 1H5BB 2HKFH 1WTGT 1KTKE 1GGYA 3KJ6L 3FN0L 3P9LA 4U6TA 4PJ9C 3S36H 1I7ZB 4LHQB 1F4WH 3F58H 1WEJL 4JZJA 4Y5YB 3IDGA 1KB5L 2AK1L 5T1KD 3BPOB 1G6RA 3EFDH 2R2HA 3EYSL 1BGXL 1NFDA 5J1AA 1U91A 3QHFH 2J88H 2XRAL 3VWJD 4O58L 1VFAB 4PR5A 2VUYA 4JG0L 4NO0B 5IHLB 4PJCB 1P7QD 4YHNA 1T6VN 3HI6L 3RIAK 4G42B 1UACH 1ZEAH 1RZKH 2N56A 2EXYC 1JGEA 4KVNL 35C8H 4JO3L 3G5YA 3WXVL 3P73A 3I2CH 4JGMA 3LY6A 4P46A 3TYGH 1A5FH 3LSOA 5DJ0A 1RZFL 4OZ4A 1CCZA 2J5LC 4NRZA 4NKDA 5CHNA 1BWMA 1FLTX 5TQ0L 1GOFA 5ACLA 2OL3B 4PREA 2EDOA 4KAQL 5BQ7B 1UH4A 2PXYA 2VXUH 5DURB 3BP5B 3QDJB 1CDHA 1CFSB 4EI6A 3I3BA 1N5AA 5DD5L 3RIFK 1MH5B 4M8VA 3C6SB 4Y1AE 1D5IH 3HZYB 4DN4H 1MI5A 4JKPH 4QXGL 5K93A 1ZT7A 4EI5B 3TFKC 1MAKA 4H25A 5IWLC 1VADA 4WEBL 1FYTA 4I5BB 4LCWE 5DLMH 4Y1AB 4P57B 4M5ZL 3NGBC 1EGJH 4PBWD 4OGYL 4WUKL 5LBSL 3X12B 1EEZA 4LCWB 1UWGH 4NRYA 3V5KA 3WFDL 1R5WA 4BH8A 3HRPA 4FMKA 2DBLH 3HPLA 1IMHC 3OKNA 1II4E 5AYQA 5CBEB 2EEDA 3RVUD 1E28A 2NXYB 2XICA 3MNWB 5AD0B 3T3PE 5TDOB 2ZPKH 3X3GH 4X5WA 5E8DL 2E8ZA 5ERWB 2HLFD 3TBVB 1H3VA 3MV7B 5T3XL 2C4FU 4G5ZL 3FB6B 2ZG1A 2FBOJ 4YPJA 1C08A 4LQ1A 5T1KB 3H3PL 4GW5A 5EG6C 5K9OB 1KN4H 2JK5A 2BHYA 1AD9A 3BWAB 1WWWX 4LEXH 4MJ2A 2WUCL 4LSVL 1NDMB 1IT9L 3HE7C 5FGCE 1D5IL 4MXVE 4S1RH 1VFOA 2ZCLL 5HJ3A 1CGYA 4EZMA 4LRNL 4UAOC 3DV4A 1CZ8L 3LPWA 1I9RL 5SWSD 4LQFL 2VLRB 4M3KB 3IETA 1BVLB 2PN5A 4WENB 2SEBA 1J1XL 1PQZB 3FRPG 3EYQC 4ZXBB 2ICEA 2NXYC 2V2WA 4DZBA 4HJJL 3TN0D 1R3KA 2AJVH 5EFIB 2NY4D 2VDQL 3UYPA 3HC4H 5JOFB 1LO5B 2WNGA 4IOIB 2P47B 2EEBA 3T08A 4X6DF 2IH1B 1MFAL 3CIQA 3UTZA 2MKLC 2HTLC 2K1MA 4KI1A 1FG2B 2AJUL 4Z76A 2FR4A 5D9SB 4KK5D 2EYRB 3OMZA 5IF0B 2X4SB 5T1MA 4ZG1A 5CFHA 4YR6B 4BFEA 4JO1H 1NMAH 1NCDL 1NL0H 3WDJA 3ARFB 4X98B 3T0AA 3B5GA 5EO9A 3T4AA 1WBZA 2ADJA 5EC2A 3EJJX 4Y19D 4ODWA 1HYSD 4QHNA 4FQJH 5GRJL 2EE6A 3R06A 4HWBH 4HWUA 3STLA 3A6CL 4QCIB 4NJAH 4RBPH 5GGSY 2BVEA 4PJCF 4YHPB 3EO9L 1J0YA 1KJVB 2NLJA 1EIBA 4H26B 2EKSA 4CW1A 5DD6A 1MI5E 4PRID 4QT5B 3V0WH 3TT3L 2M1KA 5JHDA 5ICYB 3OBAA 3MLXH 2PW1B 4N9OB 3MX0A 4AT6B 3NFNB 2VDRL 2OJEB 1LNUB 1P84J 4P99A 1N5YH 1XCTA 5EBWA 2DM4A 2ICEB 3QUMH 1ZVSA 1WK0A 4LASL 5DWUH 5CBAB 4K9EH 2GTZB 3WUWG 4NO5A 1RJLB 1VB9A 2LQRA 4O9HL 1I1FA 3T09A 2ICWJ 2JJSA 3QDGB 4XMPL 1S5HB 4JHAL 1PFCA 4WNQB 1FFOA 1JNNH 2GITA 3D0LA 3QO0A 1FNHA 5E4IA 2IBZX 4L3EE 2YKLH 1S8DB 3BSZH 4L9LB 1X5GA 4G7YH 2DDQH 5DJ2B 1C5DA 3DHJA 1KPVB 1C1EH 1MCNA 1F3JB 1RV6X 4Z7UB 3L3KA 5HI4C 4RISL 3HNTL 3EFDL 3BN9D 3HFML 3F12A 4GS7B 4XPHL 3OKLA 1LQSR 1C08B 2BNUB 3HPLB 3OJVC 3CDGB 4NQSB 5DJZB 4MXQC 2X5PA 4Z7UA 4ZMAT 5C08D 4UBDD 2JIXA 5DI8B 3MLZL 5DEFA 3R4DA 5AG8A 4LHJB 3X12A 2A1WH 4HS3A 2HTKC 4HFUH 1PYWA 1DBAL 1DBJL 3O6LH 3MUY1 3VDAA 1N64L 1VADB 4P2RA 1X5ZA 3IS0X 4RGND 1S7TB 2R0WL 3BDYL 4P4RA 3MNWA 3CK0L 1I3UA 4P23A 4HDIA 2DQTH 3QDGA 2D31A 3SOBH 5KS9F 4WCYH 5L88L 1CQKA 1FL3A 1OHQA 5F7DA 3RJDA 4JZNB 4H8WC 4DVBA 4JFEA 1WUNT 3TWCH 2F54E 4QRQB 2E7LC 2W60B 4LU5H 5IHBA 1G0XA 4N8VG 2BSRB 4NKDB 4F3FA 2MJWA 3DHMA 4F7CB 4L5FL 5F89B 5E6IB 5JHDE 4DK6A 3S4SB 3L6FA 3VFRB 3O4OB 4LNRB 1KFAH 1RURH 4HWEH 1F5WA 3S96A 3TVMB 3FAWA 3VXSE 5JHDB 3U36A 4Z95H 3I50H 5ANMB 4ERSL 43C9A 3WDIA 3UO1H 4D2NA 4K7PY 1CICD 4XI5C 5E95B 3CH1B 5HGHB 3N50A 4I2XA 4YUEH 1A3RL 3HUJA 3QI9A 4FQLL 3TPKA 2DOCA 2UVEA 1XF4A 1CR9L 3ESVF 2A6JB 3AFLA 3MMEB 3MUGA 5DJ0B 1RFDL 4XNUL 4TUJA 1JI2A 5I75C 3ROOA 3D87B 2P45B 4JEGB 1AGCB 2V7NB 3ZDZE 3AXLB 1IQDA 4FN0A 4RFOH 5GS2D 3ARQA 1K3ZA 2ZUUA 4R4NC 4XWGH 3VD9A 4O02H 1GRWA 2O61A 4D8PA 4ZUWB 1B90A 3O8XD 1OAKL 1F4AA 4S11A 4X6CF 3VXPA 3ZLQC 5CSGA 1UWEH 2E9WA 5J1AB 5I1AA 3BSZL 4WI8A 4HWZB 1CFQA 4GLRH 1K4DB 1OP3K 5CGTA 1KSRA 1LK2B 4YGVB 1A0QH 1U8QA 4KZDL 1RZ8A 3CVIL 4D9LH 2EIEA 1JWUA 2I60L 4KQ4L 2FJGA 1JGLH 2HTLD 1U3HD 3EDEA 4NGHH 2FATH 4NCC1 2VUOA 4ONHB 3OX8A 4MHHG 1NGZB 3P40A 4RAUA 5HD8D 5DYOA 4K2UL 3QG7H 3QISA 4BH7A 3BVNB 3STBA 3VH8B 3CCHB 1G0YR 3EZJB 2NY4C 5JOPE 1HIML 3FQUA 2VXUL 4KI5D 1CI5A 3VRIB 3D69A 4EOWL 4G7VH 4BH7B 2D2OA 2OYPA 2VLKA 4JPIA 3EO0A 5C09A 3OXSA 2Z31A 4Y4FD 2MQCA 4IOSD 1JF5A 5ESVA 3R8QA 2A6DB 2DYPA 2ORBH 2ZP0T 5F7EL 4Y0GA 4KK6C 1KULA 5GS0H 3ZKSD 3F7VB 8FABA 1FP5A 3UZVB 4WHTB 2BNUA 3GO1L 2A77H 1AXTL 2GUOB 5F96L 1EUUA 1JV5B 3V52L 3DGCR 4PJGB 4EQ3A 2X70A 3ZYOA 2VDQH 3O3EA 4J3TA 4BFBD 1RIVL 1QLRA 1EEYB 2YPKB 3MYJB 1EFXB 4WDIB 3ZT7A 5D1QB 5F1IA 4CMMA 2FO4A 3U0TA 1VFBA 1MCOH 3BYYA 1ES0A 4Q6IA 1FZOB 3QFDB 5CP7A 2P4AB 5HHMB 1CDJA 3A6BL 3HC3H 1JRHL 3G5XB 4PRPE 4PGJA 1J0HA 3SDXA 2XXMB 4KUCF 5L9DH 3ETBF 4FTVB 2NY4B 5TE7L 1BPVA 2E3VA 1P5VA 3RGHA 4LEOA 1X7QB 5EN2A 1EO7A 4OB5H 5I66B 1W0WB 3SJVD 4BELD 1KLFA 3DROB 2Z91A 4U1IA 4GH7B 2OMBA 1EHLL 1Q1JH 4NQCB 3TVMA 2R1XB 3O6KH 2W38A 4D9QE 5EO0B 3SDCA 3GM0A 3BXNA 5F9DC 1W8NA 3CVHA 2ZCHL 4OGYH 2DRUA 3O6FB 1KJVA 2WAHA 4CW1B 2CUHA 1GC1L 5EWIH 2EDLA 5JUEH 1XGQA 1IGIL 3VD3A 1A7BA 3T4YA 3ZZ1A 1AC6A 5HVHC 3LKSA 3Q2CA 1TJIH 1MHHA 2ATKB 5MI0C 4X7FC 3WV0A 1NAMH 3MZTA 2CRMA 2H6PA 4OZFG 1Q38A 1UWXH 5I73B 5HHVH 5BRZD 4I8DA 2YN5A 4XP5H 2NW2B 1PYWB 3V6OA 3NVQA 2BOBA 3V6BR 3MREB 3T0VA 5JXAL 4YBLB 3DUHA 3HRZA 2DICA 5IB1A 5E9DE 4FFVD 2AERT 1R3LA 3S6CA 5I66A 4FQXD 2PXYC 3O4LD 2VDLH 4HJ0D 3WS3A 4YPGA 4Z95L 3L3KB 5A2JH 5CGYD 5GZOC 3CFJA 1NFDB 1XGUA 3TT1L 4QHKJ 5HYJD 1Q0XL 3I75B 4LLYB 4KPHL 2FJHB 3PABA 2Q7YB 1MFEH 4KRPB 3QT2A 1RAMA 2DAVA 2FO4B 4PJ7B 4WGWB 5BZWB 3U0TB 5B38B 1CLCA 4RDQG 2GK2A 2ZSWB 3OWEA 2V7HA 1I8KA 4AMKL 4B7IA 3WFDH 4H1LA 2SEBB 3T2QA 3HS0A 4MQXC 3GBNH 5C3TA 2C7UB 1MCWM 2FIKA 3QG6B 5CGMA 4M1GL 4WY7H 3S5LA 4IRSD 2J8HA 2ZOKB 2YXMA 3C6LA 3E0GA 1XIWD 1UGNA 7FABH 2XN9B 5CMAA 2I9TB 5B8CC 1RZJC 1ONQA 5ALBH 4K7FA 3UDWA 1AD0B 1QRNA 2E9JA 1AI1H 3MV7E 3VWKA 4XBEH 3C5ZB 1MRCL 3MXWL 1QLEL 1UB5A 1YEJH 3GMNA 3RNKB 3QXAA 5IFHH 4ERSH 1QEWA 3O9WA 5SX4I 5C07B 3MJ7A 5D8JH 4HIJA 2GI7A 5KS9B 4O2CB 1JGUL 3V0VB 2QV2A 4A6YA 2JB6B 1A3RH 4F15C 4G8GB 4U33A 4G7YL 1UG9A 5B39G 3TF7C 1KG0B 3C60A 3UTTD 3F7PC 4JG0H 4PJXA 1JPTH 4HPYL 4M93C 3L3JA 5I71B 2FJGB 4NUJA 4PRPA 1MCSA 2VLRE 1L9MA 2BJML 4HHAA 4G43A 4PJFE 3U7YL 1WZKA 2CO7B 3VXTA 3RI5F 3VXNB 3PGCA 1TQBC 1GGUA 1OAQL 3VXPB 3TWCL 4Q9QL 1U3JA 4FQXB 3G6JF 4DQOH 4YXLH 4P5TD 3VFUA 1XGTA 1T1WB 2J3SA 4JANB 2DQTL 1ZT7B 1NBVH 2ATPB 2R0KL 3PUCA 4KK5C 3ZE2F 2DM3A 1T5WA 3QDMD 4F7TB 4BA8A 3OGOE 4Q9RH 4OCYL 2EC9U 5DJXB 1GYAA 4PG2C 5IFJB 1QQDB 4HH9A 3PNWA 2X42A 1DANT 5IQ9B 1R3HA 2A6JA 2AJYL 4LL9A 3AB0B 3D2UB 1Z9OA 5HHNB 2BDNL 3BYTA 2KL6A 5IQ9A 4RNRA 5F1KC 2JCCA 3TM6A 1IGFH 2I07B 5FA3B 4P5TA 4TUKL 2PNDA 4A6YH 3QRFM 4F2MB 2EO1A 2AJXL 2HJFA 3MBXH 1X9QA 5C3LD 5LAXA 1MVFA 2XWTB 3UPAA 1MJ8H 3LDBC 4KKLC 5E9DA 4F7CA 4HUWB 1FZKB 2Z35B 4U31A 2IPTH 2OJZH 3PGCB 1CLYH 4RRPA 3L9RA 2WBWB 4JFEE 4GW5B 2GAZA 3IDGB 4I9WE 3WO4C 4X6CE 4UB0H 4PGBA 4IHOB 1MFNA 4U6YA 3TO2B 1ZA3B 2UZYB 4EOWH 2PO6A 3VFWA 3MV9B 1X5JA 2BK8A 2WMPA 3RAJH 2OZ4L 1Z3GL 1DFBH 1DBML 5DJDB 3SGKC 2YUVA 3JZ7A 4P2QE 4CN4A 4ETQA 1VGKA 2NY6C 4ZDHB 1T3FA 1L0QA 4ZXBC 3JWOL 3MRNB 3PWNB 4OQ1A 4OV5B 4KQ4H 5DGQA 4D0BA 2YA2A 4Q0XL 5A1AA 4YXHH 1CGVA 2QQNL 4PJ5E 1BWWA 3IXAA 4Z7VE 5DK2A 4PLJC 5D4QA 1BFVH 4M6NH 5FHBH 3QIWA 4ZFOA 1DL7L 3BPOC 1QRNE 3AAZB 2EH7L 3RP1A 3K2UL 1ZHLB 1BJ1J 4KK9C 5GRVK 1IC7H 4UV4L 4NO3A 5J11C 1RMFH 4MA7L 4ZPVA 2B7DT 4PTUB 4DTGL 3OJDB 3CJJA 3D39E 2JJUA 3EYOA 4CU8A 5KOMC 4XGZB 5IOPB 1YEKL 1KCSL 4OZGA 3PP4H 4K3DH 4DGVH 3D18A 2DS4A 3DUUB 3OJDA 3AC0A 1S3KH 2P43B 4KKCC 3SPVA 4XB7A 5CS7A 2OTPA 1YC8A 3SEPA 4ELKA 4PJ8C 1KPRA 3GJFB 3L5IA 3MNVB 5DDHA 4X99A 4CU6A 4AMKH 3MRGB 4R3SB 1UFUA 4B0MM 1EH9A 2IH3B 2BCKA 2BY2A 3PXJA 2OR9L 5LGKA 2ARWA 2QHRH 3QEQB 1NAKL 5KANG 4PJDE 1EEUA 4HLZH 5TGBA 1MQKH 4TPRH 5C0JA 4O4YH 2J7LA 5A16B 3VFVB 1T20B 2XNAB 3EOTH 1G1CA 4I3SH 1FL6B 1IAKA 3BQUA 1LO3H 1C12A 4JM2C 3GSXA 3GFUA 4QXGH 4LEXL 4LIQE 3BIBX 3OB0H 4MA1B 5C0GB 1GGIH 4PJHA 4F8QA 4XP6H 3PV6A 1ZA3A 3R1GL 4MD5B 4JFYB 3EJZC 4PGBB 5IF0A 1IM9A 4IDLA 1TPXC 3U0WH 4GRMA 3P0YL 4XC3L 5HGBA 2A6KA 3OKOA 2JCCE 3ES6B 3RWDB 4JREB 4FXGB 1P9MC 4Z7VA 4JY5L 1MFEL 3SHSA 1WCBA 1HHIA 2MWCA 5BVPH 3CX2A 2ICWI 4QGYA 1Q0XH 4NZUH 4JZOB 2GHWB 4F37K 3DURB 3NIFF 4OCRH 1LEKB 2D03H 1OAUL 5IEKB 3FT2B 1ZLVK 3GMLB 5FKAA 1KELL 1P7KB 1WF5A 4HKJB 3A67H 5ACZB 2YUWA 3FONB 4OT1L 1U8LB 1XFPA 1WZMA 3TEUA 1U93B 3QQ9C 1PEZA 3DRQB 5F3HA 5FO9B 5E8NA 4K9EL 3O0RL 1B88A 1RJCA 1H9VA 1DR9A 4MCYB 2EZ0D 2HFFA 3ULUF 3AU1A 4PYGA 4QWWD 5E5MA 1EDQA 3MR9B 4YDJA 1HKFA 4C4KO 1KLGA 4HXAH 3MYJA 5J06A 2NX5D 1JVKA 2NTFA 1NKOA 4RFEB 5F9WC 2X4UA 3PWPB 5JIKA 3LV3B 3GMOB 4OSUH 3QIWD 3S88L 1E6OH 2VLLB 1BBDL 1K8IB 5C0CE 1PDKA 4IDJL 3WIHL 1Q9WB 4G8FB 5EOTA 3SGDI 1OAYL 2UYLA 2HH0H 4IRZH 4JB9H 1SY6H 4IMLB 4L8SA 1I8LC 4HULB 4G43B 3LKOA 4HHAB 4MDIA 1KCRH 2C3GA 1T7XA 3FQRA 2FLBT 5ERWA 4Z7OF 1MELA 2HT3D 1NGWA 4Z7QF 4YK4C 3MXVH 4ZS6C 4HS8H 3ARFD 2J88L 3GO1H 1DBKH 2HTKD 2NXZD 3M07A 1I9JH 2F9BT 4KJPC 2VZUA 1QEWB 1OTTD 2J8UE 4IIQB 1NFKA 3WJJA 1ORSB 4ODUA 4YEFA 3B8YA 2YUXA 1I9IL 1UJ3C 5GIRB 4ZO8A 1FVCB 1MJ7H 2R2BA 5E00A 4BZYA 5D7LD 4JRXE 1HH9A 3ULVL 4R96A 1Q9OA 3BWUC 3ZE1F 5EZLB 1BD2E 1MLBB 4Y88A 3FN0H 3KPMA 3MJ9L 4Z8FH 1JPSL 3C6LB 2VSCA 3DO7B 2J6EA 4MVBC 1BD2B 1IC4L 5I1AB 4GXVL 4OJFH 1OD9A 1D6VL 1H3UA 4JQVC 5L7XL 3MRMA 4OFYA 3V9FA 1BFVL 2DQUL 3GI8H 4TNWK 4LLAA 1QSEE 5IIEA 1Z0NA 5D1QD 2HKHL 2NCMA 2CGRH 4JB9L 4EEEA 3G6AB 5HYEA 3W9EB 4XT1C 4KK6D 5LGHH 1J0ZA 4N0UE 3DV6B 3G5YB 5GGVL 1GAFL 4P2OC 1ACYL 4M6ML 3WBDA 3UC0L 1KB9K 1KTLA 1JL8A 3MCLH 5KJRL 3LEVL 2KH2B 5H8DA 2QL1A 3BO8A 2HFGH 3SJVB 2WLZA 4HAFA 1WZ1L 1MHPH 4LVOC 4X4ZA 2GW5A 3HAEB 5EU6A 1D6EA 2Q8AH 5KSBA 4JVWA 1A5FL 1AQDB 3PQYE 3S37L 4XPGH 5KVMC 5IJKA 4S1DC 5GISL 4LRIA 4GUPA 4WI7A 1B2WH 5IMKA 2VAJA 4LF3A 1A22B 2LTQB 5ITFB 5HHOA 1K9TA 3WFCL 3QXTA 5FF6A 1DUYA 5F71A 3REVA 2E27H 3UZQA 4ZTOH 4NYLB 2MCG1 4NKOB 1V3JA 3MV9D 4KTEL 5K9JL 1OQXA 4A2MA 4PJIB 2XRAH 4RIRB 5E8OB 2NXZB 4MQSB 1P4IH 1RUPL 1WBXB 1KBGL 2J6EH 3CLFH 3T4YB 3PIQA 5LKNA 4DVRH 3KLAA 4NPYA 4X5XB 5KSVB 4RMWA 4FQ1H 3VXOB 3ZKXC 5C0ND 2CKBA 1N7MH 5IVOA 1OB1B 3IRZA 1P1ZA 2NY5C 4DKFH 1UM6L 3C6LC 1LEGA 4Y4FC 2B4CC 1G9ML 2IBZY 2NY1C 2H32H 3TCLB 4JFPB 4LLWB 2Y6SC 1UCBH 4CJ1A 2HLAB 4LEOB 3C6LD 1EJ6A 2VDKH 5L2JA 3TIDA 4P5MA 5JQ6L 3ILPB 3INUL 1AJ7H 1KFAL 1RURL 5AZEL 3GKWH 4M7LL 4XNZB 5EUOE 5C0EB 1W0VA 3QFJB 4CRPA 4M43H 5EH1A 4PJ8D 5C2BL 1WIPA 2ZJSL 3BP7A 1LK3H 3KS0J 1J8HA 5TDPA 5IHUL 4MJ5B 2B8OT 4R0LA 4E0RB 3B9KA 5GRWA 5F1IB 5C6TL 4Y19A 4HF5L 3QWOB 5D7SL 3HR6A 2NY2D 5L6YH 2PKDA 3SE8H 3EO1A 4NZJA 1S7RB 4M5YL 3SY0A 3BZEA 1RZ7L 3RA7L 1T5XB 3BE1L 3OKYA 2X70B 2BMKA 4PJXF 5MEQB 1F90L 3KPRD 5BS0D 2NYYC 5DUBB 2HA1A 3SCMD 2AXHA 3FMGL 3O8XB 2IFFH 4JQXA 4JM2D 4N90E 3ZSTA 3MLUH 1Z2KA 1A14H 4YDKL 2LV4A 3A6OA 4G9FD 1U36A 4NQXA 5C9JB 5I1CH 3FB5B 4XCYA 4MZ3A 4G6FD 4NNYA 3CLEH 1PGRB 4QY8A 3GM8A 3T1WA 5D2NC 2VN7A 2K7QA 5ESAA 4H88L 3P4MA 2AKRA 4PJ5A 3TJHD 3ULUE 1HHKA 5I1LA 4WRLA 3T8XA 3NFPB 1LP9B 2R2EB 2GJZA 5C0IB 4BQCA 2VDML 1AJ7L 3AMLA 1JMZA 1N59B 5IB5A 4PP2B 5C0BA 4GRWF 2EDBA 5HHOB 4K7PH 3RBSA 4BK4A 3SY0B 3BZEB 2R56L 1MVUA 4XMPH 5A2LH 2OR8A 4WW1B 4JQVA 3ULUH 2XZAH 4MJIB 1JWUB 4ALAH 1DVFA 4FXLA 4UV7H 3WO4B 1T83A 2O5YL 2C26A 4AK1A 3WKNA 1E6JL 2V2TB 3AS1A 4JFXB 4OCSH 1ED3B 1YEEL 2VLJD 3OR6A 4S1DD 1BEYH 4XCCH 2X4NB 1A21A 1XH3B 4G6AD 5KW9L 5J56B 1KJMA 3C5ZC 4JG1L 2V7NA 1XR8A 1EHNA 1F8TH 3B5HA 2HLAA 3EYUH 1TVBA 1SMAA 5F1OB 3W82A 1FLRH 1OTTC 3WN5C 1FNGB 4ZS7L 3ZT6A 3IJYA 2X4QB 4GW1B 4NJAL 5J9PA 3FN3A 3ECBA 1EGJA 4UB0L 4CADA 4XMKH 5D1QC 5JIPA 3D2UD 3OXRB 1RVFL 4M7JH 2FZ3A 1U58B 4BZ2L 1CLYL 3VXOA 3HPJB 2IPKB 4WFGE 4J1UA 5DURD 5ANMA 4J3WA 1UKQA 3MRPB 4HCRA 4R4FH 4G6JL 1PKOA 1WBXA 3S96B 4KJWD 3THMH 1WZ1H 1NGYA 5GGVH 3VH8G 1YJDH 5K33A 1GGBL 4U6XB 1LDPH 1CDUA 2R0ZL 4R7NA 1IEHA 4JY6A 3KDMB 4JM4H 4F15B 4PRHD 3MRCB 5HDLA 3MLPA 1MFBL 3CSPA 5I8CA 3EDJA 2ZCKL 3KXFD 4PBXA 4Z5RA 1UWXK 4Y89A 1AGFA 4HWBL 1CFTA 1T0PB 2FGZA 4JDZA 2MFNA 3ARDA 4MWFB 2MMXA 3MRJB 3QUYD 5EUKA 4WFHD 1MI5D 1IT9H 5T5FH 5KVEL 4NKMA 3FO0H 1WFOA 4XPBH 1FNEA 1CXFA 1HHGA 3RJQB 2AJSL 2KZ1B 3TP4A 1KENH 4BSWB 1P4BH 4J1UB 3K1KC 2RFXA 2YD3A 3IJHA 5DVMA 5MEPA 3B5TA 1RUQL 4HD9A 3GIZH 1R3IH 1ND0B 2DB8A 3BKJL 3DYOA 1F6AA 5F6IB 3X11B 5DO2C 1IEBB 3TVMC 5B38G 2MHAB 5JPNB 4C56E 2BNRE 1JBJA 1HQRA 4ZAKC 4F57L 4IS6B 1UT9A 1TJHL 4XHJD 3OR7B 2IJ0C 4RA3A 5DD0H 1A7NL 5J8OA 2WANA 3BAEL 3WUWA 3PGDA 5I75B 4J3VA 3GSQA 1R6VA 25C8L 3QNXA 5BQ7A 1T1ZB 5EO1B 1U8LA 3N85L 4HFWA 3KPNB 3JXAA 2VR9A 3K2MC 1O5DT 1JF1B 4WI6A 2R29H 2GJZB 1G7IA 4MGXA 3V6OC 1KN2H 1OTSC 2F5AL 1CYGA 2MTPA 2YD2A 2A0LC 4QHLB 3WE6B 1A64A 3UROR 2YRZA 3NIFE 5ETUA 5J7CC 2DQHH 3WIFB 1U8OB 5CJOH 3UYOD 3DARA 4GSDL 3V7MA 4C83B 4N1CA 4S0TD 5FYLH 3SDXE 3SGJA 2BRRL 1NDGA 4LP4A 1JPFB 3RGVC 3DUSA 5HHXL 3KYNA 4FQQA 3BP6B 3MLRH 2JCCF 4MLIA 3BOVA 4I77L 4QXUL 1RZJL 4XP4L 4QF1A 1JZ4A 3OKDA 4O02L 5IP4A 2JKXA 4KY1L 4UOW0 4ZAKD 5DD5H 1DQML 3GB7A 5BXFA 4AH2B 4HK3J 1L0YA 4U1SB 3SE3C 5BMFL 2AEQL 5EOQL 2FHBA 5EU5A 1T22B 5F9AC 5HPMA 1A02N 4Y19B 4XXCC 4FABL 4KJWC 3N9GH 3FZUC 3GSVA 1HILB 1FG2A 1WGOA 4KKAC 1LO4L 4YHML 3QEQA 5K9KA 3ARGC 3TZVB 1RZFH 1CR9H 1AGBA 4GS7C 4PV9A 5DQ9B 1T66C 3WN5A 2XTJC 2IH1A 4U4BA 1G7LA 5DJCA 2NY7H 5F88B 5L2JB 2APFA 3B43A 1FIGL 1NPUA 1DQQB 4ELMF 2XG4A 3MRQB 1JPGB 2WWKO 1JPST 4ELKB 1U41A 4E41A 1NGXA 1A6WL 3B9VA 5C6WH 4HJ0C 3QHFL 4LKXB 2D7OA 4K8RC 3K4ZA 4L3EA 4X7SL 5DC4B 1EFXD 1VA9A 1S7SA 3BW9B 3V6OE 4YAQA 3RGVB 1MCRA 5DRNB 4DW2L 1CN4A 3PIQB 2WV3A 4KZEL 4L8DB 2CDGA 1YQVL 5HHOE 2VXSH 2FX9L 3TA3A 1ZEAL 3RVXD 4OIAA 3ARDC 4HMCA 4NWUH 5IG7B 3SE9H 5BS0B 1AY1L 4XNYH 4HIIB 4KJYA 1TZGH 1CT8A 5HGAB 3LPGA 4DGIH 1PLGL 4NQCD 2C3HA 5DQJA 3BP6A 4PS4L 2VE6A 3V4UH 1ZGLB 1HDMB 3U4BH 5SWQB 5EU6B 3HC3L 4MD4B 2YWYA 1HQ4B 2W1NA 1MHEB 4DGYL 1U8OA 1DLFH 3FOMB 4K8RL 4MNQA 4NQTA 4PJ9A 5TQ2H 5HPOA 3RDTC 2DLGA 5BJTB 2CLRA 1QBBA 1MLCB 4LVEA 2VWEE 4X7TA 1ADQL 3N1PC 4M1CC 4P23C 2JELL 4LVOB 1JK8B 4G80B 2Z92B 4ZFOL 3RIAF 2CDGB 2DLIA 4AYFA 3FHAA 4GKSA 1FCCA 4XPTH 5EUOA 4NRYB 1MJUL 5EO1A 5H2BB 2AEWA 3LMJL 1Z5LB 2EIZB 5GGUB 3SQBA 4ZFGL 4LASH 4P57A 2DLFL 5DWUL 3F65A 5FDYA 1MCHA 4U1NA 4PP1C 1XGPB 4TQEH 12E8H 3HZYA 1T89C 3RVWC 2OZ4A 4BUGA 4KI5F 3SO3B 3BP5A 2VZVA 3QDJA 5ADPH 4XHQA 5HYJB 15C8L