3QI9A

Crystal structure of mouse cd1d-alpha-phosphotidylinositol with mouse valpha14-vbeta6 2a3-d nkt tcr
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
290
structure length
290
Chain Sequence
b'KNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title A molecular basis for NKT cell recognition of CD1d-self-antigen
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 80
structure length 290
sequence length 290
ec nomenclature
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qi9A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3qi9A01
4GRWH 3QWRD 1YY9C 4U49A 3U9UB 4JGJA 4IOFD 3S97C 4KQ3L 2VLLB 3FQRB 5SWQA 4P0DA 3BI9X 5TE6L 2D9QB 3CXDL 5IFHL 4LLVB 5F6IC 2EH7H 2MCPH 3VXTA 4DFHA 2Z31A 4FZEL 1FO0H 5C7XL 1UCBH 1HHIA 1QOKA 3OMZA 1BM3L 4M7ZC 4XNXL 1FLTX 2IC2A 1P53A 2VQUA 5GIRB 4AENB 3BE1H 3JVGC 5GJSH 4CGTA 4G7VH 1CFSB 1PKOA 4XPTH 1AGEA 5FYLE 4JPIB 5EBLA 1B4JH 2FEEI 2OSLB 5DA0B 2XTLA 3IAQA 3O4LE 3OZ9H 2ZCLH 5BRZB 5DQDL 4HIXL 4PJBE 2A77H 4WU5B 1S7XB 2EE3A 3EDFA 4LKCA 5GGRA 3LKSB 3PHSA 3CLEH 1C5CH 3CMOL 4UB0H 2H1PH 3PV6A 5HHQB 4HEME 3A6CH 4IEFB 5JW3H 1W72L 1J1PL 4NSKB 3GHBL 3HG1E 1I85C 4HG4K 2P49B 3ES6B 3I6LE 5FHAL 3RUGE 3U83A 3O81A 2J4WH 2VZVA 3RWFA 5D7IB 3VFGH 4QRRE 4OLZL 1VACA 1JRHI 5ESQB 2WZPD 1HE7A 1N59B 2ICCA 2IBBA 4LLUA 3ULVD 3THMH 2DQFA 4LHJB 4D94A 5HVFB 3UTSB 1YQVH 3ZTNL 3QQ4A 2CGRL 4L5FL 1TVDA 2WBJD 1BJ1H 2SEBB 2I25N 2UY6A 4X98B 3D39B 2WIIB 1NC2A 3IDYB 3N0PB 5JO5B 3HI5H 3U9UA 3FQRA 4YNYB 4QHUB 2DQUL 3FT2B 4LLVA 3K81A 4LP5A 4JGUA 3QXTA 2DB8A 2JB6B 3QXAB 3X17A 5T5FL 1G7PA 3ROLA 2V2WB 1FPTL 4AENA 3UX9B 3VW3L 5BXFA 1CFSA 1H3WM 5F7DB 1YEJH 4K94L 3VXUE 2DTMH 2OSLA 4NQDA 3DSFH 3ME0A 3GMLB 4BZ2L 5ADPL 3FQTA 5E8NB 5BRZA 3TVMC 4POZD 2FDBP 3GMRA 4P3CL 4WU5A 4UI2A 2C1PB 1S7XA 3CJJA 5EOTB 4DQOH 4FTVB 2IQAB 5HHQA 4NSKA 3FB7B 2DL2A 4P59H 2DL9A 1MH5B 1JHKL 1C12B 1XEDA 2HLAB 5D7IA 2XZAH 1U58A 3OXSB 4PY8I 5JNYA 2EE6A 1N59A 3IFPB 5ICXB 4LRIC 4DGIH 5IWLC 4DKDC 4ISVB 4R4FL 3UTSA 3QDGE 4YUEL 4OF0A 3ZE2F 3QI9B 1N0LA 4D0CA 3UJJL 4HPOH 5C0CA 1FCCA 3OAUH 4DZ8B 1KFAL 4ZTOH 5BMFH 2FGWH 2AI0L 1Q9OA 3CD4A 3D39A 3EYUH 2WIIA 3U36B 4Z7QF 5JO5A 1MHEB 3QJFA 2ZKHL 2WBKA 2I60H 4PJEB 4APQB 4YNYA 2V5SA 3CH8A 4QHUA 4D2NA 2NNAA 3N06B 4LBEB 5I1KH 4HT1H 3QXAA 1CICC 1G0XA 1PSKH 1IC7H 4X83A 4NO5B 1AD9B 3NPSB 2F53E 1H15B 2XWBB 4OZHE 5D2LE 4HSQA 4KDWA 4UV4L 5GRYA 1OQOA 2IAMB 2XN9E 4Z7UA 3PHQB 3V0VB 3KPSA 2CJUH 4LCWD 4J3WA 2ARJQ 3K1KC 3O3UN 3QUXB 3GMLA 4XBEL 2DKSA 1XR9A 3CH1B 5E8NA 3VH8A 4HJJL 2C1PA 3B9AA 2IWGA 5GHWH 4RAVA 4LCIH 4WGVB 1IGYB 4MB3A 5EOTA 3CK0H 4LLDA 3QRFM 5EOCH 2MQ3A 4FTVA 4NJ9L 2H6PA 2IQAA 2GK0B 1KB9J 2VTFA 2X4UA 3FB7A 4Y89A 1AHWB 3ZDYE 4OD1L 4J1UB 1ZTXH 5EIVA 1ACYL 3RVVC 2HLAA 3FAXA 1D5ZB 5DGQA 2ORBL 2VDRH 3MRHB 1G1CA 3CFBA 3E2HB 1L9NA 3IFPA 5GGRY 3U7WH 1Z9MA 2AXJA 4O2FB 4JFEE 3VD5A 4Y4HD 4PP1C 3GRWH 2ILLA 4XP5L 5GRVK 2EZ0D 5I16A 4HC1H 4XPHL 4IMKC 2P5WE 4YDIH 5CWSB 1ROWA 1RZGA 4R90L 5FO7A 3U36A 5I1EH 1MHEA 1UA6H 2R56L 1ZHBB 1D7FA 2VLRE 4PJEA 4APQA 1CQYA 1S7RB 2VLKE 3SDYL 1YEDB 4ZFGL 1MI5B 4LBEA 5IBLC 4OCXL 4JRXD 4MS8C 4Y8DC 5A40E 1NGYB 4NO5A 1R3HB 5DJ0A 2FZ3B 12E8L 4J7RA 1H15A 1PLGL 1GXEA 2IGFL 4KK5C 4EDWH 1YEEH 1FFOB 2IAMA 1UKQA 4U6TA 3PHQA 3L5HA 3V0VA 5MEQB 3WS6A 4O5LL 5DVMA 4JPKH 2IPUG 5F1KC 3WFBL 3CH1A 1JYVA 4P5TC 1GGCL 1KIUA 4MCZA 4ZUUA 1IGYA 3C5ZB 4NKDA 4YFEA 1MJ7L 3EYQD 2YHGA 1PX3A 2GK0A 4FA8A 4HAFA 3S8WA 5T3XL 5D7JB 4E42A 5D70L 5DRWB 2HT2D 3PGFH 4FQCH 4LPCA 3RA7H 5IEKB 2IPKB 3DUSB 1K9TA 5I15L 3E2HA 1P7KA 2BOBB 4Y5YC 1N8ZB 2R2CA 3VXOA 4LHUG 1A8JH 3TH3T 2C4XA 5DHVH 3UP1A 3VXNB 4JM2D 4O2FA 2OR9H 2PW2A 4H88H 4XWGL 4EUPH 3V52L 1ZE3C 4M5YL 2NY4D 1OGAE 4XMLH 1HWHB 1RAMA 3P4NB 5DA4A 2CKBA 1UH4A 2JTDA 3UYOD 2L4OA 3V6FB 2Z92B 3K8KA 4WW1A 3KPRD 3DVNA 5L8JB 2XY1A 3NZ8B 1L9MA 4GXVL 1S7RA 2AW2A 4XCNA 3F12A 4NO0B 2N56A 1R3HA 3U0WH 5C8JA 3LY6A 3TA3A 5IHUH 1E4WH 5AYUH 4LDEB 3RI5F 3S7GA 2NY1B 4PJDB 4QRUB 1A6VH 1GIGL 3WJJA 1BBDL 3TZVB 3FB6B 1EXUB 3SBWC 4NQED 5DUMH 3HZVA 5CLTA 4WENB 2EEAA 3HAEG 5F3HB 3Q48A 2G5BA 3JWDL 5FUOH 1T22A 3FZUD 3R1GH 3IDXL 1UZ8B 3FB8A 1S9XB 1LP9E 3STBA 2J8OA 3C5ZA 4G5ZH 4BJLA 3EYSL 4B7LA 4JRYB 2QQQA 5FCUH 1WWWX 4QNPE 4P57B 3IFNH 3ULUL 2EYRA 4NHUB 5EC2A 4KTEL 2GAZB 1M71A 1H3PH 1QFUL 4OIBA 1CGSL 1EERB 5FB8A 3DETD 5L2KB 5CZXC 4EN3C 3ETBF 5IB1B 3MV01 2BOBA 2ZSWB 4HKBA 1N8ZA 4OGYH 3WO4B 4HLJA 3VXNA 2DDQL 2CR6A 2PYEE 4GKNB 5DMGC 2LTQC 4EQ2A 2VXSL 4RMRA 4LHQB 1HSAA 1W0WA 3R8BB 2BSED 5KSVB 5E8OA 1NBVL 3LPFA 3P4NA 4F57H 4OGXH 5HYSG 4M5ZH 3ARDA 3V6FA 1TJGL 1XGPB 2Z92A 3BUYB 3QEGL 2F8XC 1SBSL 4JO2L 3NZ8A 4M62L 3AROA 3WO3B 1LO3L 1J8HB 4DKFH 3TT3L 1FFQA 4LF3B 5C0RH 4CMHB 4YXHL 4LSRH 1D5XB 4U0RC 4R0LA 4JDTH 2YUWA 5L0QC 4PJDA 5KG9B 2EDJA 4TSAH 3VFUB 1YN7B 3OQ3B 4XPFL 2VO5A 1U93A 1ZLSH 2HFGH 2Q6WB 5BQ7A 3W5MA 3VRJB 5D6CB 1IAMA 1S9XA 3C87A 5C07B 3IFLH 3NVQA 5D5MF 5T3XD 3O11A 4HQQL 3PL6C 3L3IB 2Y7QA 1JGVH 2GKIA 4OAWB 2BNRB 4P57A 2NTFB 3REVB 3AREC 4NHUA 1IGCL 2GAZA 1LE5A 2I5YH 1RUQL 1VPOL 2P42B 4LGRB 4HXAH 3MJ9H 3TO4A 5EUOA 1FZJA 2PN5A 2BXYA 3VD9A 1OTUC 5IB1A 1F11B 4TRPH 3DX7A 5JOFB 1MFBL 2G2RB 3QG6B 4GKNA 3WXWH 4NQCE 1NBQA 4K71B 2OL3A 2HJKB 3KXFB 4NZRH 3TO2B 5SX4H 5D2NB 1W0VB 3QXWA 1FH5H 1P2CB 1TNMA 3G6JF 3QUYB 3ROOB 1BD2D 5BVJB 3GUTA 3QNXB 2B2XL 3GB7B 1J8KA 2F19L 1X5XA 5I1IH 2VAAA 2IAND 4HZAA 2HT3C 3HCVA 3KYMA 2R15A 4XCCL 1XF2B 5K59F 1NJ9B 3BIAX 3L3GB 1OAXL 4ERSH 2RAMA 5D72L 2ZUUA 3RWDB 1D5XA 2NY6D 1U8QB 3I6GB 4KRMB 4MNHB 2F5BL 1OP3H 4LSDA 2CIIB 4XX1G 4DZBA 4GW5A 4H8WC 4EEEA 4GBXA 4TVSa 4KK8C 5L9DH 2VUYA 3W11D 3E3QE 3O4LB 2DQEL 4PJFA 4M7JL 3VWKC 3T0ED 3BPNB 5LGHH 4PJBB 5JR1H 1QBAA 1NC2D 2AJSL 3VG0L 1LK3L 5C07A 2DQIL 2HTKD 3WMSA 1YNKH 4AYFA 3ULUD 4Z7WE 5BZWA 2BSSA 4DVBB 3DX9B 3L3IA 2A9NL 3PWVB 5MI0C 4A2LA 2NTFA 3REVA 5J6HB 3N1MC 5EORL 3HG1B 4Y1AA 1WC7B 3RUGB 1LO2H 1MELA 3MRIB 4NZJA 2ADIA 3V5HA 1X7QB 1OP3K 2FB4L 1KN2H 3U0PB 4QRRB 1Q38A 2G2RA 2NZIA 2Z0BA 3QG6A 5J57B 4RGMB 1FBIH 4R97C 3TT1H 2E6JA 1J10A 5HPMB 4KHXH 2HJKA 2YOCA 1U8IA 2HLFD 3SDDB 3GKWL 3FMGH 3NA9H 3P3YA 1C08B 3QUYA 3ROOA 3CIQA 1KPUA 1NMBL 3SY0B 3QNXA 1NAKL 4GLRH 5F1OB 3GB7A 1IKFH 4ZTPL 3QR2A 4MDJB 1YEHL 4FZ8L 2WW8A 1XF2A 2WM0A 4OZIB 4CN1A 1NJ9A 3L3GA 3P73B 3BMWA 4IOSD 4OI9A 3GMMB 3TCLA 3RWDA 4NT6B 4NP4H 3WD5H 1U8QA 3I6GA 1RZFH 3BPCA 4LLWB 4ODVL 4ODSL 3PDOB 3LV3A 3VFWB 3VXUB 2IALB 2VXQH 1ZVSB 1C8PA 1N6QL 3VGEA 3LS5L 4GMTL 2BSTB 4PJBA 3SGJC 1AXIB 1G7JB 2F54B 1T3FB 2QL1A 1ZMYA 1RJZA 4ENEC 5KVMC 3A6OA 1FO0A 1WT5C 4OD3L 4UILH 5E6IA 3T1FA 3RWGA 4M8QB 2FBJL 2OMNA 3PWVA 4XPGL 4B0MM 5ESVB 1CGWA 4GG6A 2VXVH 4PV8B 5GS2D 4XC1L 4XP9H 1NFDE 2CMRL 3DHMA 3HG1A 2ARJA 3MYJB 2XWTB 5AG9A 1IMHC 4Z9KB 2VDKL 4OFVA 3MRIA 1X7QA 3PG2A 5FYJH 2YPLE 2XQYG 4N5EA 4G6AD 3IDJA 1GVIA 4ZFOA 5HI4C 2VQTA 2ID5A 3MOQA 3EGSB 4TUJB 4YGVA 4X7DC 1JTOA 3BUTA 3QDGB 1TCRA 3SDDA 1JWUB 4HFUH 1S5IL 3MLTA 1UGNA 3QDAA 4X9BA 1RZKC 5SX4I 2W9DH 3FO2B 5I75B 3ZMRA 4JY5H 5LQBL 1CCZA 2YRZA 4ZS7L 3DXAB 4L4TB 1K4CB 2CR3A 1JYWA 4OIAA 1ZVYA 4DJMA 1KEML 3P73A 1X5ZA 4RFEB 3IT8D 2CDFA 3M8OL 4NT6A 4H0HB 4HUWB 2F53B 4Y2DC 4OZHB 1QVOA 1QR1A 3QI9D 5B4MD 2QHLA 3VFWA 2XN9B 5I30L 4OCSL 2ITCA 1U8MA 2OQJA 3NH7L 2NY7L 5AWNL 2X1QA 2Y6SD 5GGVY 4S0SD 1T3FA 5DT1H 1MFDH 2Z93A 4FS0A 3B83A 1HHKB 4U1NB 1BQHB 1UB5B 1JGDB 3JSSA 4M8QA 4X7SL 1MIEL 2COQA 5K9JH 1T04B 4GS7B 3CUPA 3VA6A 3U30C 1X3DA 2O5YL 3MRRB 3MYJA 1OCWL 2XRAL 5EO9A 5C0NC 1RUKL 5HGHB 5JXEC 1KIRB 1IARB 1E28B 3UXFA 3NMEA 2XZQH 2AJYL 5T33H 3BKYH 4CBPA 4JREC 3QUXD 5IR1B 5CBEB 2KQNA 4X8JB 1CFNB 2WANA 4P46C 3EGSA 4TUJA 3QDGA 1N3NB 2MTPA 1E27A 1JWUA 4DTGH 1KCSL 4XCYB 4G8IA 1DJSA 1NUFA 3BN9D 4K7FA 3FO2A 2FX9L 2P5WB 1S9WA 3D9AL 4JLRB 4N1EA 5C6WH 1ZHNB 3O6FB 2VLRB 4GLRI 2FEEL 2Z35B 2VLKB 4K8RD 1NBYB 1X6NA 4PJ8C 4D9LL 4RFEA 2NY0B 5E99H 1NCNA 1XF3B 3MUGB 3OAZH 5I76B 1FNSL 1AE6L 2CQVA 3FRUB 2YXFA 4LRNH 5LCVL 1YECL 1HNGA 1JFQL 2F53A 4HUWA 1EEUA 2ATKB 4OZHA 5D2LA 2NXYC 3T1WA 2JJTA 2XN9A 3S34H 2J3SA 5ID1B 3GO1L 2V7NB 3EOBB 4KXZH 1BWWA 2FYYB 1KCKA 4E41E 1CXHA 5CJXA 3RIFF 1UEYA 4JO3L 1FVCB 1CXKA 5JW5B 1HHKA 4U1HB 4U1NA 4Z77B 1BQHA 3UZVB 1ZS8B 4MD0B 4PJIE 3OKDB 1I3UA 5F71A 4X6BB 1QQDB 1MI5D 4YFLF 2R8SL 1H5BC 3QA3B 3QRGL 1UWEL 4H1LH 3RL2B 1EMTH 3H6JA 3KJ6L 5DD3H 1I7ZB 2WNGA 3JUYA 3P0YH 1JNNL 4MXQC 3MRRA 1VENA 3OAZK 2CLVA 1N6VA 4K7PL 1I4FB 2X9XA 5GGVL 3AM8C 5HGHA 4H25B 4BK5A 3BZ4B 6FABH 4MVBD 1KIRA 3EYFB 4DVRL 3CFCL 2E7CA 4MJIE 5DVOA 4YK4B 5EIQA 5HHOE 4JFEA 1XGUB 1N3NA 2PO6C 5INDB 1CDYA 2CRIA 1OGAB 2A73B 4OB5L 3QWOA 2FWOA 3D5OF 3DRQA 4MQ7A 3WLWC 1G9MC 2H26B 1T4KA 2CUHA 4UT9H 1JWSB 1A14H 5M94B 5D8JL 3MLVL 5TDPA 3VD4A 1U2CA 5D7JD 1ZHNA 4BFEA 1INDL 3O6FA 3UTPE 2VLRA 2NPLX 2I9LB 3L3OA 2Z35A 4NRXA 2VLKA 1CL7L 3UTQB 3NIDE 4M1GH 2VXTH 1F6LL 4PRIE 1XF3A 3MNZB 3GRWA 3MUGA 5I76A 1CK0L 3T3MF 3FRUA 3K74B 4HC1A 3NIGE 4O4YH 1KXQE 1MFEH 2EICA 4MJ4A 1I3GL 2A9MH 2EO9A 3UBXB 4U1MA 2W9LA 5C6TH 2BNUB 4GJTB 2MHAB 2ICES 4IRJB 2V7NA 3EOBA 3P30L 3LD8B 4KKCD 3JUZA 2Z8WC 4JFQA 5D1QC 5ISZD 1J5OH 4LLQB 3IDNA 1FVCA 1U91A 5JW5A 4U1HA 3FB5B 1LP9B 4LARL 4Z77A 4PP8C 1I7TA 1KCLA 3OKDA 4NO0D 4X6BA 4ZOEA 3QA3A 1VEMA 3RL2A 5JDSB 1P84K 4OM1L 1TVBB 2AQ3A 1SEQH 3CSPA 1N7ML 2FRGP 3IRZA 2GSIA 4EJ1C 3E8UL 2IFFH 4H25A 3BZ4A 2NYYD 5HYQB 1VHPA 1RZ8B 2NY1D 3ZKXC 1KJ2H 3TZVD 1A4KA 2EC9T 2ENYA 3L3JA 5D1XD 5GRUH 2BVPB 3CFJB 2QQKL 4FXGA 1XGUA 1H3TA 2PYEB 3CFDB 3T2PA 1TITA 1L0YA 5FYLL 5INDA 4YDJA 3WFCL 4UDTA 3C5JA 2A73A 4MHHG 1DANU 4L8DA 5KTEH 4Z95L 2H26A 3I3DA 3MA9H 4POUB 4JRYD 1JWSA 4IRZL 1UJ3A 2E8ZA 2MCPL 2O5ZH 3H3KA 2FX8H 2HG5A 1D9KD 2C3WA 3GKZA 5J0BA 4Z0XB 2I9LA 4I77H 4NFDA 5DHVA 3UTZB 1B2WH 5L2KD 4I4WA 5E1AA 2EDOA 3MNZA 3WNNA 3E6FB 1JNJA 5GRJL 1F3DJ 1NEUA 4ZQKA 2YC1B 3G5VB 3RGVB 1JZ3A 3VD7A 2ZCLL 3O6LL 4WHYH 3UBXA 1FZKA 3RBSA 2AEIT 3ZE1F 4IRJA 1Q9KB 2QQNL 4LSSL 3SKJL 5AG8A 3TYFB 4V3EB 4GQ9H 2DJ4A 1QR4A 1DBKH 4RGNE 3VFVB 3A6CL 3G5YA 1HH6B 3C60D 4KXZI 3FB5A 1LP9A 5J12B 3PABA 5F9DC 2ITDB 3LZFH 5DUBB 1J8HD 3SDAC 1R3JB 1S7SA 4JKPL 3BP6B 3GGWB 4OT1H 5C1MB 1TVBA 3VFGL 4WTZG 2EXWD 3MGTB 1V3MA 1GC1C 1T83A 4JFHE 1UKSA 4ZPVB 2ZP0T 3MA7A 5HYQA 4S1DD 1RZ8A 1R0AL 1VADB 3GI9H 5IB5A 5DRXA 1FSKC 1YQVL 3QIBB 4F3FA 4Y4KB 1FL3A 5J11B 4YX2H 2EDKA 2VISA 4K3EH 3WJLA 3CFDA 4NQCB 1QLRB 2BMKB 5C07D 5B38B 4L9LA 3HI5L 3MRQA 1FFRA 4R4BB 3QUZD 3ILPB 3MCKB 2P43B 3ZSTA 1PGRB 3L5WB 1UYWH 4YBHA 4DKEL 4HKXB 5IEHB 2MQ0A 5D96B 1AGDA 4CDGC 2BNRD 4P49A 5J1AB 4Z0XA 5C0EB 1ZAGA 1PG7W 4CUCA 2A74A 5DJDB 5EH1A 3UTZA 2LVCA 4DGVL 4PR5B 3LH2H 2VZTA 2HAZA 3AS2A 2YC1A 3G5VA 2AJ3B 5EU4B 3RGVA 4GUPB 4NQTA 1S9KC 1CLZL 4I3SH 3KXFD 4DGYH 5I1HH 1I8MB 3LIZH 4KKBC 5CMAA 3VFVA 3DGGB 1JBJA 1TZGH 5EN2B 2FHBA 4K23H 1YMMA 1HH6A 2HJLB 3K4DA 3RX7A 1CDUA 2IBZX 4R7NB 3TN0B 5TE4L 4HKJB 4WV1C 4L8CB 5DUBA 4Z7WB 3HI1A 3X14A 4C57C 3BP6A 1K4DB 2YD7A 4LAQL 1H0DB 4OLEA 4KKLC 3AFLA 4OSUL 1RIUH 4PJHE 1S7TB 5CINH 3MGTA 1RK1B 4WO4D 1ITBB 5DC4B 4I13B 4ZPVA 5JXAH 1J11A 1VADA 5EUKB 4NOBA 5IQ9A 2X05A 1G7HB 3QIBA 1X4XA 4LDOB 4WCYL 4Y4KA 5FYLD 1QO3A 5F96H 3RDTA 3UO1H 3FKUS 4XVTH 2W0FA 4Q97A 2YK1L 2P47B 3QQNA 5FHBH 3O4LD 4NQCA 5BMFL 4HHAA 4PJAF 2NW2A 2BMKA 1UENA 2VDPH 3EDEA 4N8PA 1MCOH 2I60L 3BH8B 4R4BA 3ILPA 2DLEA 5HHNB 3MCKA 1D6VH 4J2XA 1EJOH 4NQUA 1TETL 3JWOC 3MJ9A 4YR6B 5I1KL 4JFOA 4HKXA 1FL5B 5FM5M 3RPKA 5IEHA 2J8UE 4PGDB 4FQJH 3WXVH 3HG1D 1HZHL 1B6UA 1QSFE 3I6LD 5GS1B 1MREL 5DJDA 5EOQL 3ARSA 3B2UC 1T66C 1U0QA 4BH8A 4C83B 1PBYA 2OK0H 4WFEE 2WY3A 1F8TH 2VIRA 3ARVA 4GW4B 4QRRD 4XMPL 4C54A 5CD5D 2NY3B 4PJ9B 4RMVA 3SCMB 4GUPA 1G7QB 2APTA 1A6ZB 2AGJL 1LNUA 3SDDD 4HWEH 1MVUB 3WV0A 1R5WA 1B4RA 4NFCA 3PWPE 4WHDA 5EOCL 3DGGA 1CGVA 4G8GB 1D3CA 5EN2A 4CVUA 2HJLA 4R7NA 5K9KB 4L8CA 3O2WH 1G0DA 1EV2E 4MA8H 3QFJD 4Z7WA 5GGUB 4C4KO 1T1ZB 1H0DA 4BYHA 4F37F 4LNRB 3PQYE 3W2DL 1JZ6A 2NY2D 3LAFA 2Z31C 5EG6C 4X5XB 5B39A 1SJHB 4BZ1L 4NDMB 1JFMA 3U7WL 5GSVB 3MBEA 2A6DA 2YSSA 1JWMB 2CDGB 2BJMH 3VXUD 1A1OB 1RUML 4RWYH 4F7CB 1YPZF 3WKMH 2ED8A 3TYGH 3KPOB 3RNQB 4WY7L 4G42A 3F58L 2F54D 4LSQL 4HJ0D 5I1EL 1UA6L 1K6QH 2Z4QA 4X6CE 3BH8A 2RB8A 1Q9WB 4RAHA 5HHNA 2Y9RT 4IMLB 2D9CA 2D0HA 1F2QA 2X9YA 4MX7B 4YR6A 3SDXF 1FL5A 2DMCA 4PGDA 1DBML 1Q8MA 3IFOB 3RZWA 4X4XB 5GS1A 5K9QI 5DVKA 3WNOA 2CSPA 3MACL 5FF6B 1WFOA 4EDWL 3V5KA 3OWEA 5T1LB 4C83A 3SKUD 1UVQB 4FFEX 1PY4A 3KVQA 4JPKL 2X5PA 3Q5TA 2C4FT 2PYFB 4U1LB 3P77B 3HNTL 2Y07H 2B5IC 2LU3A 1G7QA 1A6ZA 4F7MB 1KELH 3P4MB 1YC8A 3JWDC 5I1AB 4TPRL 3ULSB 1MLBB 4RISH 2Z9TA 2V9QA 1HOCB 3RWHB 1T1WB 4P9ML 3CDFA 1I1FA 1YDPB 4YHML 4LVOB 1BLNB 3RL1B 3RU8L 4XCFH 3O6MH 3AC0A 2W0KA 3D2UB 1Q0YL 5K9KA 3QIWB 3DXAD 3PGFL 4L4TD 2D0GA 4QCIB 4Y0GA 5I8CB 4K3DH 1FRGL 4LNRA 3S3JA 3WUWG 4IS6B 4X5XA 1TTGA 1NFDA 5IMKB 3L6FB 3B3IB 4Y4FD 3S88L 3ARFB 4HCRH 3GHEH 5GISL 2F53D 1CDBA 3ZYZA 2BZDA 2D03H 2YPLA 3TBVB 3T2NH 4XMLL 5JUEH 4F7CA 4XNQA 3NACH 1T6WA 1KCUL 4LASH 3KPOA 4KK9D 3QH3B 1J7VR 4EQ3A 5ALCH 1MCWW 1CXFA 1J18A 2CXKA 1T7VA 3Q3GB 4ZUTB 3NFNB 1Q9WA 1IQDA 3NTCH 3B9KB 2FHCA 4JPWL 2R23A 1U3YA 4KTDL 3VFNB 3IFOA 4OFDA 2MPAH 3U0WL 1KULA 2H2PC 1PZUB 5AYUL 3PUCA 4QTHA 2E8YA 5T1LA 4Q2ZB 1E4XH 2X4RA 2DWDB 4PV9B 4K07A 2PYFA 2QKIA 1X5LA 4U1LA 4P3WA 5E00B 3VGDA 3BP7A 1A3RH 3U7YL 2J7LA 3BVNB 4CMMA 4N90D 5I1AA 2H2SD 1MLBA 4WDIA 1TJIH 1UQSB 3RWHA 1T1WA 5E8EB 5DJAB 2P5WD 3WNLA 4WU7B 4E41B 3SGKC 5FCUL 3RL1A 1VFAB 4J23A 4N1HB 2NXZC 3D2UA 1VGKB 5DJZB 4ZUSB 1EHNA 1SJVA 1FFNA 3IDYC 3IFNL 3QIWA 3O6FD 1II4E 2XKNB 5TFSL 3ZTJH 4HWNA 3TJHA 2DMBA 2JKXA 5E9DD 3P11L 3LQZB 1OAZL 4PJIB 5I8CA 4N0CD 5IMKA 3L6FA 3B3IA 5BZDB 3BIBX 3UC0H 3ARFA 4EBQL 1XIWB 4R9HA 3U4EB 3MRCB 3TBVA 4ELME 4KZDL 4LPXA 1YEFL 2WUBH 4JG0L 3CDCA 3H9HB 3KJ4C 3O41A 5KS9F 3QH3A 5I0DA 1OGTA 3QXDA 4OGXL 3TF7A 5HHOB 2R1XA 5IW6A 5L6YL 5JDJA 3S37H 3NFNA 1N26A 5CEYB 3DV6A 5C70A 3O3BA 5IVZB 4IJ3B 1CBVL 5C0BE 2H45A 2F8OA 3X3FH 3OPZH 1HDMA 1IM3A 4NJAH 4XP4H 4GOSA 3SJVE 2VWEC 4OBRA 5JW4Q 3W0WE 4L29B 3C6LD 4MSWB 4PRIB 4OCWL 3RNKA 2VITB 4PV9A 4LHUB 3B43A 3LRHA 2EDRA 2I9TB 1HXYA 5CJOH 5E00A 4QRQA 2HFGL 4Q9CA 4XVJL 4KJPD 3LPGA 1LE9B 4L3ED 2YRLA 2R0ZH 3ARQA 4YXLH 1OGAD 1WISA 2XKSA 3HNSL 1UQSA 4G6JH 1YEKL 2QSCH 4UDUB 3LN4B 5ILTH 1RMFH 5CIPB 3VI4E 4WU7A 4E41A 2A6JB 1VFAA 3EO0B 5DC9B 4ZUSA 1AR1D 1XGRA 2XKNA 4MAYD 4H20L 2AABH 4APQC 3MLZH 3AS0A 4NKQB 1HIML 5IB2B 3TFKA 1GZPA 1X6LA 4XAKE 5E95B 5FO9B 4NUJA 4NBYB 1PEZA 3WLBA 1OQXA 1XIWA 2AJZA 3IJHB 1RFDH 5AEAA 3I50H 4FFVD 4AL8H 4WTWA 1MIMH 5FECB 2QHRH 3U4EA 4QOKA 4GKZB 5SV3A 1Q72H 4MJIA 2IAMC 5HHVL 4IRJD 5JQ6H 3WS6C 1FH5L 3H9HA 4O58L 5IBTL 1ZLVH 2H32B 2B1HL 5DD1L 3MBXL 2IADB 5IB3B 2W60B 2BY0A 4H1LA 4GT7A 3T4AA 5CEYA 3GNML 3MLUH 4FQHB 3FRPA 3F7RA 1I9RH 3GSQB 3ULUF 5FGCB 1YJDH 5EPMA 2FCBA 3DI3B 2HTLD 3U2SA 4OCRL 4ERSL 5HPOA 1MHHA 1F2XK 5IVOA 3HC3H 3H9SD 4L29A 3WHXA 2HA1A 4XNUL 3MSPA 4AIZB 3E2HC 3RHWF 4KRPD 1GGBH 4BQBA 4TULH 1EHXA 1U3HB 3DMMB 1NGQH 3PDDA 2PYED 3D25B 1OVZA 1ZLVK 3DRTA 2A6IB 4HPYH 1YNKL 5HYSB 4HW6A 5F7UA 5CIPA 4MQXD 1YUHA 3MV7E 3MFFB 4NO2B 3N50A 3MC0A 1ZK9A 3X3GH 4M1DH 1EFXA 2XA8L 5IB2A 1MY5A 4DOHE 4N8VG 4MA7H 5FO9A 4YO0B 5D7IF 4YWGH 2XIDA 4X4YA 3TA3C 5IFAH 4ZS6C 5F21B 3TT1L 4OCYH 3CFKA 5FECA 4LPWA 4XTRD 4GKZA 1F6AB 5ICYA 2VABB 3BDXA 3RJQB 1EPFA 4UNTA 3WJJC 2PCPB 1UACL 4QRPD 3FMGL 1GPOL 3K7UA 4L8BB 3RVUC 1EBAA 4NRYB 3CNKA 4PRNA 3LKPB 3NZHH 4P2OB 2W60A 1OWWA 3T0BA 2LU4A 4LCCA 1WK0A 3MJGX 3G04B 3NCCB 5DEGB 1JE6A 2BNQE 3C5ZC 3GSQA 2I07B 3MLRL 1MQKL 3DURA 4UT7H 4OKVA 1KJ2A 3U4BL 2IJ0C 3OAYH 3VFPB 4NP4L 4M7ZB 3WD5L 2GJ6D 5KSUB 4EXPX 1P4BH 4O51B 1A7OH 5FYKH 4GO6B 4Z7UF 2DQTL 2PF6A 4P48A 2DIJA 3DMMA 5IHZB 3VXSD 3D25A 5F72S 2HWZH 3C2SA 1HEZB 1F6FB 4YBQD 3KYKH 2OTWB 3IETB 4UILL 4E0RB 3RPIB 4HBCH 5F7MC 1AY1L 4NKMB 1WV7T 2B7DT 2GI7A 3ARDC 4NO2A 2YA1A 4PJXB 4XP9L 3UTTD 4O02L 5C08E 1IFHL 4PRHE 1EHLL 4X5WB 1INEL 3OAYK 4YGAB 4JE4B 2R39A 4JM4H 4YO0A 3RQ3A 4PJHB 3PP4L 4K3GA 1S7UA 4NM4H 1BF8A 4HWBA 2UY7A 1L7TH 4Q0XH 4ONGH 3H3BC 4KV5F 5JORB 4R0LC 1D5BB 1F6AA 1VDGA 4JZNB 2VABA 4YZFE 5F6HI 3OKOB 2C1OA 2C7UB 1ND0A 4HFUL 5C2BL 3LKPA 3QNZA 4P2OA 5E8DL 4ZO7A 4GAYB 4TVPE 2V2TA 3TJEH 1KYOJ 1F4AA 3G04A 3TN0D 1OARL 2YPVH 1NMAL 4PJEF 5JIHA 2I07A 1CVRA 5GGQH 4N0UB 2X7LA 4OFYA 2J8UB 1RQ5A 1XAUA 5INCB 5J1SC 3VFPA 2JK5B 4S0TD 2NR6D 1BAFH 1QSFB 1BBJB 1YY8B 5KSUA 3TO4C 4O51A 3CC5B 5DRZB 2BY2A 5DJ8A 4RZCB 1LHZA 3GIZH 4Z6AT 4ZNEE 1ZT4A 3TVMB 3NIFE 2VDNL 3OF6D 5DT1L 4MNQE 1MFDL 4ESKA 1NL0L 1JN6A 4E0RA 3RPIA 1KTLA 1IQWL 3PWPB 1MLCB 1ZLUH 3EYVB 3DBXB 1F90L 3HB3C 1AKJB 1BGXH 1I85A 2OR7A 5F7LB 1I9IH 1HQ4B 4WI6A 2PXYB 2GITA 1QBMH 2XZQL 4UTAL 1H9VA 3BKYL 2NY3D 5CJBA 1WFNA 4PJ9D 5EFIB 2NY5H 5EBWB 3SCMD 3UTOA 1T2QH 5JORA 4NOFA 4ZSOE 3GMQA 3VMOA 3WHE0 2A83B 4GBXC 3ZE0F 1KV3A 4KDTA 4B53A 1WZKA 4JFYA 5E8PA 4G8GD 1ZLUK 2B4CH 4TQEH 5D6DC 4H5SB 3QT2A 3SGEH 4X6CB 5BW7A 2X6MA 3OKLB 4NN6C 5L88H 2E3VA 3I9GH 1IEHA 1U3ZA 3D1MC 1S9YA 5JPNB 1CICB 2J8UA 1MF2L 3OSKA 5INCA 2P5EE 4LRNL 4MJ6B 1JYNA 2BDNH 4F7TA 1QRNE 3TBSB 3BAEL 3EUUA 3R0NA 3D3VB 5J6GB 2C3HA 5FK9A 4OCNC 3CC5A 4PGBB 5DRZA 3S34L 2O26U 3L3KA 1T03L 1DDHB 1G9NH 1S78C 4RZCA 4KQ4H 4X6EB 3RWEB 4N0FB 3TVMA 5F9WC 5I19H 5FGRA 2XA3A 4U1SB 4QHLB 3PXHA 1UWGL 4G3YL 3PE9A 5DK2B 3AU1B 3PWPA 4PRAB 1MLCA 3KPMB 3QUYC 4R26L 2P8LB 1MCDA 3DBXA 3EYVA 4S0UC 1AKJA 5DD3L 1FG9C 4DK3A 1A7NL 3LB6C 1CS6A 4C58B 5E2VL 2YKLH 4PYGA 1V7ML 2PXYA 3PQYA 3ZKMC 1QYGH 3C8DA 4PY8J 3FQXB 5EFIA 4Q9BA 5EBWA 3RWJB 3LKNB 5C71A 2DM4A 3O0RH 3H8NA 4FFWD 4CAGA 4FNLL 1O0VA 2WLYA 3H42H 4OZFB 2B1AL 3JV4B 5CLWA 1SMOA 1AD0B 4UT9L 4JZOB 4ETQB 5IGXH 4PBVC 4TSCH 3E1F1 3VE0A 3DI2B 4H5SA 3HNVL 4OLVH 4PGEB 2R2BB 3QIWD 3QCTH 4X6CA 1Q9LB 4QXTB 2CLRA 3OKLA 2DMKA 4XPBH 5E6IC 2VH5H 4C59B 2QADD 4KKNA 1OAYL 1A7RH 4M1GL 3TIEB 1CICA 2E7HA 4C56B 4PB9L 3PIQB 3GEWB 3TBSA 2FJFB 4PD4K 4HG4J 4O4YL 4XNYL 5J6GA 1MFEL 5FFLA 5IQ7H 5ETUA 2A9ML 2NCMA 2CRZA 3HZYB 3LMJL 3V7AE 4PJDF 5C6TL 5HGAA 2CXGA 4N5EC 1DDHA 4HEPG 3G9VA 1N6UA 3Q1SL 5LG1A 4JVUA 4PG9B 4X6EA 4N0FA 1A9BA 5ACMA 4C4KT 4U1SA 4P5TB 4QHLA 1IL1A 4P4KA 3VH8G 1DQTA 4PLNC 1CZ8H 5IESH 3VFOA 1SJXA 3AU1A 3KPMA 3B9KD 3HZKA 1QPXA 2R4SH 1BVKB 2AV7B 1KB5H 1KJVA 4L3AA 3O8XD 5GGTA 2OS7A 1V3JA 2ZCHL 1IGFL 3GSOB 4MZ2A 4V1DA 4JO1L 4OJFH 5CEXB 4JN2B 2ARWA 1U8OB 1MRFH 2Q7YA 3OJVC 2WAHA 4PB0H 3W9EA 1CLOH 3FQXA 5JHDE 1I1AD 2VZOA 3LKNA 3WFDH 1A6WH 1HN1A 4QF1B 3VRIB 5TDOB 4PGCB 4S1SH 5I0ZA 4XWOD 1S5HB 1VFOA 3QHFH 4OZFA 5I1LB 1T0PB 4IMKA 3MA9L 4WFGE 5BVPH 4ETQA 1YZZA 5IW1A 1FL6A 3RX5A 4AG4L 1NDGB 2R2BA 1EGJA 1WFTA 5F9AC 2YA2A 4FFYH 1FLRH 1C5DA 4I77L 4HCRA 2AQ1A 4XNZC 5IF0B 5T3ZH 3C9NB 4WUKL 2ATPA 5C0BB 2R0WH 1WAAE 3SGEI 4RMWA 4XAWH 3G5XA 3IU4H 5HYJE 1UM4H 2FJFA 4RGOH 4XXDB 2MMXA 3SJVB 3RTQA 3HZYA 3CXHK 4HWBL 5E2UH 4ZG1A 3KR3L 2PKDA 4PG9A 3S4SB 4GQ9L 5HHOD 3EZJB 3KAAA 1QFWM 4P5TA 5CAYB 4URTB 5EWIH 4WEBH 1AO7A 3B6SB 1G6RH 5DLMH 4LPVA 3DO7B 1BVKA 2VLJE 5BJTA 5KSAD 3LS4H 3LQAH 4FFZL 3QUKA 5HGDB 3GSOA 2EE2A 1HILB 1XZ0B 4MQTB 4JN2A 4KAQL 1T6VN 1U8OA 2GUOB 5EZIL 1JVKA 4PRID 4WW2A 1MNUH 5ADOL 5IT2H 1AQKH 1DBJL 3CLFH 4EN3B 2NZ9C 4LHUD 4YX2L 3SE4C 3U0TA 1CN4A 1KNOB 5GS0H 2A0LC 5TDOA 2LTQB 3TWCL 2CD0A 4ELMA 35C8L 2JJTC 3O2DL 4PGCA 3IB4A 1S5HA 5HDOA 5I1LA 1ONQA 3FT4B 1T0NA 3Q6GH 3BJLA 3ILQC 3C09C 1FNGA 4PY7A 4H26B 3CDGA 2X42A 5LKNA 4G9DB 2A1WL 5CJXC 3DNKA 4M7KH 1NDGA 5FDWB 4L9DA 4NNPH 3TESA 3QDME 3RIAF 3B9VA 3HMXH 4FRWA 1NCDL 3T2QA 3V79C 3BH9B 3ABZA 2ZG3A 3RZCD 1P6FA 3BGMB 3LH2L 4GS7C 4D9QD 1PD6A 4NKIH 5DWUL 4XXDA 1FE8L 4U0RB 3SJVA 3W0WA 1ZEAL 5L0QB 3UZQA 4DGYL 3L7EB 3V0AC 3HAEH 2XZCL 2CLZB 4GQPH 3RVXC 3S4SA 1ZT1B 4KJWD 3PGDB 1Y6KR 3VCLA 2H9GB 1TZGL 1MCPH 3SE8H 5EIIA 4PJBF 5I9QC 5JZ7C 2XTJD 3AAZA 3B6SA 4EVNB 4IBLT 2VE6A 1R3LA 2ADGB 2LAAA 3PL6B 1QSVA 3MV7B 3L1OH 4YDKL 1CE1H 3TNMA 2ZUQB 2E6PA 1GOGA 3AREB 5GZNC 5ID0A 1TPXB 4DKAA 1HILA 5E1HB 5H37G 1AXTL 5DO2C 5JXAL 2GUOA 2R4RH 1BFSA 4DOHB 3RUGF 3HC4H 2HMIC 2JJSA 2NY0C 5F96L 1KSRA 1T0MB 3RWIA 4X4ZA 5FHBL 2X89D 1U3HD 3HR5B 4OF7A 2VDPL 2R0KL 4JHWH 2EO1A 5DI8B 1I8IB 1EJOL 1M4KA 4XMKH 3HZMB 4LSTH 5E2TH 1FYTA 3AXLA 1XF1A 2R1WB 3ARTA 1MAJA 2BNQB 5IKCA 1ZXQA 2BK8A 3BH9A 5SWSE 1HKLH 3DPBA 4KUZL 5CP7B 2ZG1A 3BGMA 1WCBA 3QEQE 4WI3A 3IDGA 2ADFH 2HVJB 2UVFA 3LRSA 4I18B 3RY5A 5LXGL 2YEZB 2W92A 43C9A 5DURB 3L7EA 3D18B 1ZT1A 3MRPB 5T1MB 2J6EH 4TSBH 3PGDA 2ZPKL 2H9GA 3UDWA 1NFKA 1YY9D 1X5YA 3VJ6A 1WEJH 4EVNA 1R3IH 1XR8B 3N1QC 1MCLA 4POYA 3MRBA 3MV7A 4LDLB 5MI0B 1UJ3C 3HI6H 2BVYA 1S8DB 3AREA 1BX2B 3GSNB 4RX4D 4YHNB 5C08B 4PRHB 5C2UB 3IKCA 1SJEA 2Q76B 4UIKH 2HKHL 2OYPA 3QHTC 2Q3ZA 1CD1B 3MV9E 3DUUA 4HX1B 4RWYL 2GK2A 3HE6A 1IC4L 4NKOA 2HRPH 3UYRH 4R97B 3HR5A 4XZUA 3T3PE 4E5XB 3S96B 4F2MB 2IH3A 2E7LA 3HRZB 3ET9F 3NPZB 2D0FA 2F8VA 5DI8A 4PJGE 2DYPB 5CS7A 1I8IA 4JGMA 4LEXL 5IBUB 1IILE 5I8KL 1JYXA 3HZMA 4FP8H 4NNYB 1I3RB 2FECI 1YEIH 2ZWLT 3OG4B 2BNQA 1LO5A 1ZHKB 3KLAB 4JDVA 5HDQH 1JMZA 4IDJL 1IGIL 2B0SH 3PWJB 5GGTL 3QSKB 5DFVC 2BRQA 3QDJE 4XVSH 1A7PL 1OTTC 5KSBE 3BN3B 1WGOA 2HVJA 4I18A 3TBYB 3SKMB 1OPGH 4O2EB 2E9BA 4WNQB 3G9AB 4JVPA 3KYAA 1FYHB 3HMWL 4OZHF 1MHCB 5D2LF 3D18A 3HHRB 1RIHH 1MRDL 1JZ2A 3WJLC 2FIKA 4MNQB 1JPGA 2D7MA 2UWEE 2GY5A 4L9LC 1R5VB 5I1CH 2VOTA 4Q9RL 1GGYA 2CK0L 4FQLH 1MPAH 1EGJL 2YD9A 2IBZY 4YHNA 5C08A 1KF9B 4PRHA 5T1KB 3QHZH 2ZNXA 1QSFD 4HS3B 2DOCA 4OQ1A 3ZDYF 1U8KB 4BFIA 3BZFA 3GJEA 3CVHB 4GG8A 4HX1A 1FNLA 1KT2B 5KANG 1KCRL 2OBGA 2VN4A 5H35B 1V8HA 2EIDA 3RGVC 4E5XA 3NFPB 3S96A 4F2MA 5C0JA 5IUSA 1HQRA 4ZSOB 3HRZA 3D0VA 5GZOC 4QHMA 3EFDL 4RMUA 3N1GC 3DUHA 3BWAB 5KN5B 4UTBL 5CFHA 4KROB 3RFZC 5J4MA 1N4XL 4KI5C 3BP4A 4YHLH 4NNYA 1QBLL 5J12C 3C5SA 1ES0A 3PWJA 1QKZH 1FGNL 4M7LH 1E4XL 3O9WC 5BV7H 1A4JB 4WHTB 2P5EB 5I1JH 3IVKB 1Y0LA 3BEVB 1EEZB 4QT5A 3TBYA 4BK4A 4O2EA 4WNQA 5HHMB 1QRNB 4Y2DB 3WCYA 3QIBC 4Y4KC 1R3KB 3AMLA 4XNMB 3RDTC 4CDHA 2AVGA 4XC3H 4ZNEA 2GYSA 5BS0A 3SGJA 4HMEA 4MNQA 1NGPH 3BQUA 1WT5A 3QCVH 2C3GA 4S11A 1JTPA 3PWNA 2Y25A 1B0RA 1JNHB 3NOIA 2PR4H 1CICD 1BJ8A 5BOZG 4KTYA 1WBYA 3U30B 4HWZB 3IGAB 3O2VL 4X0KB 1LDPH 4QHNB 1C1EH 3D3VD 4YHPB 3UJIH 1U8KA 3RI5K 1KCVL 1UM5L 1IGMH 3WNKA 1HI6A 4JREB 4NQDE 3WHE1 5F7YC 5H35A 5FXCH 1OM3L 2FIRT 2ZOLB 1CR9L 1RVFH 2MSPA 4ZAKA 3TNNB 3G5ZA 1JPTL 1XGYL 2HP4A 1BIIB 3BWAA 4FABH 5KN5A 3GK8L 1MRCH 2FL5A 3T2OA 25C8H 4OQTH 2Q8AL 1OHQA 5SWZE 2E9IA 1N2RB 1FP5A 1GSMA 3VXQB 2JB5H 3RVVD 5IJVB 2BOCB 1A4JA 2FH8A 1NDMB 4WHTA 2KZ1B 3MRDB 1X5IA 5DQJB 4NHCL 2VRAA 3VMNA 3BEVA 2DKMA 3C8KA 5I6XC 2VDLL 1JF6A 1TZIB 1QRNA 4Y2DA 4E9LA 4FQXA 4HIHB 2NXYB 5IJKA 3MBEC 4PGZA 2IPTH 5CZVH 5C0CE 3GFUA 3EO9L 3FN3A 3E6HB 5ILTL 5FKPB 2EC9U 1IEAB 4U6VH 1FNEA 3GI8L 4EOWH 4QO1A 1TFHA 3B2VH 4BQCA 2AABL 4XXCA 1LP9F 4G6FB 3MR9B 1Z5LB 1BECA 3GSXA 1JF1B 5IBLD 1H5BB 4MS8D 3FO0H 4ORZC 5D7LE 4C56D 3KPPB 3IGAA 4Z7OE 4QNPF 4WI4A 4QRTB 4DEPC 1DUZA 4X0KA 5GS1C 3QPQC 5A3ID 4YHPA 4NC0B 1MIML 1NKRA 4KK5D 3BYTA 2GCYA 4LCUB 1T7WA 1P9MC 3L7FB 2FEDC 4ODUB 4JN1H 2ESVD 1EIBA 5JQ6L 1I9JL 1GGIL 1IEBB 1A6UL 4LSVH 1S9VB 5JHDB 1CDCA 3IRPX 5M7QA 1A47A 2ZOLA 3TNNA 1S7QA 3JXAA 4UUJB 1VEOA 3MLUL 4LOUC 1A1NB 1AGFA 1I9RL 3H3PH 4YHZL 1DQMH 1SY6H 4HWUA 2DQJH 5IOPA 3VXQA 4TOYL 5BO1H 5F7EH 3P0VH 2BVQB 4PDCE 3EZ8A 1NDMA 5IHLB 3MRDA 5DQJA 5FM5O 4Q6IC 1GGBL 4TULL 1HKFA 3HLAB 1TZIA 3MNVB 5HYJB 1PG7X 2UZIH 3K8MA 4HIHA 4P4RB 5D7SL 5K9OB 3EO1B 4HPYL 5CJQL 1G7MB 1FGVL 1NGXA 3E6HA 4HGWB 1RPQA 1QA9B 2ZZUT 3EAKA 4GRLA 3CZFA 1IEAA 5HDBE 1IT9H 5D1QB 4CU6A 3V0WH 1I8LA 1FZMA 4PS4H 4M6NH 1V7NL 3MLSH 4HDIB 5AZ2H 5ESAB 1LO4H 5DR5H 3T0AA 2EIZB 5C0BD 5TQ0L 1BQHG 2VLJB 4S1RH 1XFPA 3KPPA 2WV3A 1QHOA 4P2RA 1QRKA 3FT3A 1LWRA 2VL5B 3BDBA 1E6OL 3CVIL 5DYOB 5KJRH 5L7XL 1SYVB 1QNZL 1H3GA 4XP1L 3ZKNC 4R96B 1KENH 4ODUA 2QQLH 2W1NA 5JHDA 3K2UH 3FO9B 1G6RB 4RA3A 5IVXE 4RRPA 4YHKH 2J5LC 3DYPA 4YQXL 3GSUB 3TBWA 1KIPA 1JMXA 3NN8B 3KPQB 1KB5A 4P2CG 4DN3H 4WUUA 5KVEH 1CTNA 3O4OC 1A1NA 5C9JB 2BY1A 1D5IL 1JGEB 2O5XL 1OAQH 2APFA 4LVOC 4YH6A 3RVTC 3C2AL 3QDMB 3LN9A 2AJUH 1CLYL 1QLEH 1ED3B 4QXUH 2BVQA 1CU4H 4XGZB 1WAAA 3DVFA 3GSNL 5CZXD 2XYCA 3MPCA 4EN3D 4GKSA 3RY6A 5MP6L 5HYJA 3MNVA 1I75A 2VDML 2DJUA 1IE5A 4JFPB 4GRMB 1WIPA 2G75B 1I9EA 5GXBB 1AI1L 1K2DA 5IIEA 1G7MA 5DQ9B 5GJTH 4HGWA 1QA9A 3MZTA 1F3JB 5KVFL 1QTYT 5GRXG 3ZYJA 1RULH 2ICEB 3MCLL 4HDIA 3C08L 4J3XA 4TVPL 1NC4D 2EIZA 5LAXB 1WBXA 4Z7WF 1R5IA 3DECA 1RHFA 5KOMC 2ED7A 3W39A 4WIQA 4DWHA 1L7TL 2VERN 2VL5A 4Q0XL 1AXSB 5DYOA 2O61B 3NCYP 5CEZH 1FSKB 3VXME 4R96A 4UINL 4YIQA 3JTSB 3DSNA 2BVTA 4ZUWB 1XF5B 3L5JA 4NCC1 1G6RA 2XXCB 3AGVA 4L4VE 1YEGH 2OR8A 4NZUL 2BVOB 4PRBA 2VQ1B 1A7QH 3NN8A 3KPNB 1LEKB 2VR5A 3GBMH 1MFCH 3LSOA 5J13C 3PL6D 2VXUH 1CIDA 5FUZL 1ETZB 4D3CL 3QDMA 1SM3L 3OKNB 3QUMH 1BAFL 2X41A 4JR9H 43CAB 1PX4A 3IJYB 1MWAH 4XGZA 5SWSB 2L0DA 4M43L 1OTUD 1S7WB 1WZ1L 4S1QH 1GYAA 2Q8BH 1BQSA 1JK8B 3BO8B 4UIMB 3CVHL 4GRMA 4EIZC 4U3XA 3LEYL 4QRSA 3FO1A 5E7FA 5DQ9A 2E6QA 1RZJH 3UBXG 1MFAL 4A6YB 2P4AB 5DRNB 3HMXA 5E6YA 4Y16A 1RZ7H 3T8XB 1ZV5A 3BP5B 4G6MH 1K5NA 4WV1B 1GRWA 1RZKL 2HT3D 3V8OA 5LAXA 1YNLL 4EI5A 2X1XR 4KDVA 5EU5B 3EKCA 1P5VA 3OKEB 1AIFB 3D85B 1AXSA 3QQ9C 1NFDF 2O61A 2X4PB 4FG6C 1UCTA 2AJVH 2AK4E 3NCJL 4OLUH 4RSVA 4AY0A 4KZEL 2X09A 4MJ5B 3MV9B 4WEMB 5FAAA 4HUXB 4KK8D 3T65B 3V4UH 4LU5H 4PRPE 3NA4A 2KDGA 4LSPL 1R24B 4HXBH 3VWKD 1N0XH 3A6BH 2VQ1A 3DVGA 3OKMA 2C4FU 1CFQB 4PJGB 4RMTA 1EJ6A 2BCKA 1OAKH 3UPRB 1J9CT 3VGAC 5H2BB 1L0XA 1FAIL 3LEXA 1ETZA 1NLBH 1WQVT 3VXRD 3OKNA 5CBAA 5C0AA 1XGQA 2RCSL 5TF1L 1DZBA 5FUCE 3IJYA 3QG7H 5EUOE 3MJ8A 4N0YH 4CADB 4NZDA 3QEQA 1F58H 1KEGL 3U82B 5KSBB 3KWWA 2MFNA 1JK8A 4UIMA 5I19L 1U8HA 1DQLL 1REIA 5DZOA 5J9PA 1FORH 1FVDB 2DYPD 4ELKB 2UZYB 5CILL 1KN4H 5LGJA 1EX0A 4TVPD 2HT4C 3T8XA 1MOEA 3KPLB 3BP5A 4IRSA 15C8H 3LVEA 2EDHA 2UWEB 4LCCC 4ZDHB 1U8NA 4AMKL 4ONFH 5SWQB 3IS0X 1X9QA 2W9EL 2V17H 2P8MB 3VXTB 1QYGL 4JFZL 4OIIL 3IYLW 1V5JA 1JNLL 3I2CL 1AR2A 2X4PA 1RU9H 2IG2L 1ZGLM 3O0RL 4MNGE 1BEYH 1NAMB 1OP5H 1GJIA 3X12A 4HUXA 1AGEB 3T65A 3H42L 1U6AH 5EBLB 2DQGH 3BT2H 3IDMA 4WGWB 4D9RD 1R24A 4ODHL 4PJFE 1XCTB 1CT8A 3DMMC 4GH7B 4TSCL 2ZUSA 4CVXA 3VGBA 1CFQA 4ENED 4NC1C 3QCTL 1WWCA 3N9GL 3S35H 1J87A 4XPBL 5GGRB 1F00I 1T7ZA 2CO7B 2VH5L 4K3JL 5H2BA 4PPTA 4HIEB 4RGNC 3PV6B 1U41A 5T1KD 3KYNA 4K9EH 4KKAC 1F13A 3BKJH 4Y1AE 4WJ5B 3MRJB 3RY4A 1CWVA 4F58L 2EYTB 3JTTA 4M6OL 4BQ6A 3QDJA 4CADA 1EHAA 4H0GA 3KLHC 1OP5K 5KSBA 4Z5RB 1VACB 5HI4D 2MKWA 4CNIB 3P9LB 3VDAA 4WI7A 4XT1C 3LOWA 1GAFL 3DV4A 5AD0A 1Q1JL 3MREB 4P2OC 5A1AA 3KPLA 4F8TA 3MODL 4NWUH 1G9ML 4NCC2 5I17B 5KVDH 4HK3J 2EEBA 4HF5H 4HBQA 2P8MA 4PJIF 4B7IA 4GXUN 5EA0H 8FABA 1CLOL 2P5ED 5ACLA 1TCMA 4MXWH 1G7PB 3ROLB 5HHMD 1A6WL 1NAMA 3MX0A 4JQXC 4ORGB 5B39G 1X4YA 4M48L 1KBGH 2YD1A 5BXFB 5D7KD 1MJJB 5AUMB 4MAUL 4P9HH 4GRWE 1ORSB 2YZ1A 4L8SC 5CKGA 4NQDB 5BVPL 5KOVC 1XCTA 3FQTB 1O7VA 4U6HB 4HH8A 3GMRB 1DQDL 3VFTB 4HIEA 5SWZB 4GG6E 1U95B 4NC2B 4WJ5A 3MRJA 1Z0MA 5C0ND 1UM4L 1Z0NA 3ARBC 5JXED 4DAGH 4LK4A 2AQ2A 2EYTA 3NIDF 3WIHH 2WIMA 4M93C 4DN4H 1FJ1B 1U58B 4M6MH 4OLWH 1YYMH 1S3KH 5JNYB 4Z5RA 4JG1H 5DK0B 1C5BH 1NSNL 4CNIA 4P46D 3ULVH 3ESUF 3P9LA 2XWJB 2H41A 3NIGF 4R7DB 2M2DA 5EWIL 3WS3B 4YDLC 4D0CB 1G6RL 1XCQB 5C0CB 2DS4A 3MRMA 3MREA 4KDTC 3BMVA 4UBDC 2M8XA 3F5WA 3X13B 4AEHH 3QNYB 3G6DH 4RAUB 1GGUA 1Q9OB 3LQAL 3SPVA 2NXZB 5F1SA 5I17A 2YXMA 4LSUL 3QJFB 3WN5C 5TQ2L 5BW7C 3ARPA 3NFSH 1PEWA 2NNAB 4PJ8D 3ULVE 2P46B 1P7QA 3CLFL 5D7LB 1X4ZA 1G84A 2WINB 4OGZA 2NXYD 4ORGA 2HFFB 3FQUB 3H0TB 3ARUA 1MJJA 4I5BB 5DJ2A 5AUMA 3Q6FB 4Q7DA 3BD3A 4Z7UB 3MYZA 1ORSA 2EDWA 3KJ4B 4J3SA 3KPSB 1OD9A 3BIKA 1U92B 2FECL 4P23A 1XR9B 3VH8B 4U6HA 2EDBA 1V05A 1T1XB 3EBAA 3HMXL 4RAVB 3BDYL 5CD3A 4G6FD 1EBPA 4Z0BH 1MAMH 1UB6B 3VFTA 4LLDB 3S6CA 2ICWI 5SWZA 2H6PB 1U95A 2X4UB 4MXQD 4NKIL 3SQOH 2HH0L 1SMAA 4D0BB 1LK2B 2GJZB 1DFBL 4NQSA 2PXYC 1FJ1A 2F58H 1KLUB 1N5YH 1JHLH 1GC1L 2FGZA 3CFBB 1DEEB 5JHDD 5JW4M 5DK0A 4Q9QH 5BOPA 4M02A 2XWJA 4G8EA 4OQTA 2PO6D 4BKLA 4R7DA 3IXAB 3WS3A 1RURL 5D1ZD 5DXWA 2YUVA 2IFGA 1XCQA 1KGCD 3WLWD 4KQ3H 5I16B 3R8QA 3X13A 1LO0L 1N64L 3S5LB 3QNYA 5IFHH 4FQIL 4RAUA 4OF5A 5H8DA 3SGKA 3L1OL 3HPLB 5DD5L 1RZGB 1KC5L 1OSPL 2NY2C 5FO7B 4FZEH 5C7XH 4M61A 3ZYOA 5EBGA 1BM3H 4XNXH 4MD5A 4LVHB 1AJ7L 1WBZB 5A43C 5D7LA 1RIVL 5DTFB 5IMMA 3T0VA 3SDCD 3F65A 2WINA 5DUPH 2DIAA 4NUGL 5DJ0B 1CDJA 1ADQH 2HFFA 4LMQI 3FQUA 5F70A 5K93A 1QFWH 1D6EB 5C0DB 4HIXH 3H0TA 4I5BA 3Q6FA 4DW2L 1EVUA 4JHWL 3D0LB 1U92A 5IVXB 3B8YA 2VAJA 2AJXL 2D31A 3BD5A 3CMOH 5CHNB 5D1QD 5MEPB 3VWJA 4P4KC 1NCBL 1W72H 5E2TL 4A6YL 1T1XA 4OGAC 3GHBH 4MCZB 4ZUUB 3KYOB 4NKDB 4J3VA 1UB6A 5FHAH 1OT1A 2VLJD 2OJZH 1Z9OA 1F5WA 4S10A 2X2YA 4AM0B 2W0PA 4PLOB 4E42B 4LCWE 1PY9A 4D0BA 1LK2A 4I0PA 2GJZA 4X6FA 4H0IA 1FDLL 2JIXB 2BRRL 1KLUA 3ZTNH 1DEEA 2CGRH 1P7KB 4L5FH 1MCEA 3R06A 2EXYC 2YA0A 3VXOB 1BF2A 4RWHA 2XT1B 3JTCA 3IXAA 2PW2B 1I3VA 1MJ8H 1MCJA 1SY6A 1IZJA 2PTUA 3QPXL 3B5TA 1R3IL 1RHHB 3S5LA 2DQUH 2CKBB 1NUDA 3HI6L 4Z78B 3HPLA 1JGLL 3OX8A 2C26A 3PXJA 4WW1B 5T5FH 1Y6MR 4PJXF 1VSCA 3P9MB 3DVNB 4Y4FC 1FPTH 2AXGA 3JWOL 4UIKL 4XCNB 3F12B 1WBZA 4ALAH 3VW3H 2HYMA 5DTFA 1NEZB 3MRGB 1ITCA 1U9KA 4K94H 4PJHF 1BMGA 5C8JB 3TA3B 1W0YT 3FQWB 5LVEA 5FA3B 4BZ2H 5ADPH 3DWTA 3N85L 1D6EA 5C0DA 3BPLC 3RBGA 3VXMB 3RTQC 4WFFE 2ZNWA 4P3CH 1FN4A 3D0LA 5IVXA 3HZVB 4X99B 4GSDH 5CHNA 1I7RB 2G5BB 5MEPA 5DS8A 4JB9L 1T22B 3FB8B 1I8KA 4ZD3L 3KYOA 1EAPA 3SDAD 4ZUVA 3QISA 3BEWA 1A6TA 2OZ4L 1JHKH 1A6AB 1IAIL 4TN9A 1YPZE 3S36H 2J8UF 4AM0A 2EYRB 5EC2B 3D69B 4J4PA 1OPGL 1M71B 5HI3C 5FB8B 1TQCB 1CFBA 2JIXA 4WW2C 3FFDB 3UJJH 2H2SC 2X4TB 5DD0H 1J0ZA 4FQQB 4HKBB 2AKRA 1NAML 1KFAH 3QIUB 2AI0H 5E5MB 1KJ3L 2BFVH 3WFEL 1JPFA 1HSAB 1W0WB 2FATH 1V3LA 2ZKHH 1FHGA 5E8OB 1RHHA 2QJDA 4GAJL 1INQB 4Z78A 2DQHL 4FQLL 5F93C 3ARDB 3QDHA 3P9MA 4LPTA 2FNBA 4OF3A 5SWSD 4UV4H 1NEZA 3MRGA 5ECJE 1I1CA 4BUHA 4HULB 2Y5EA 1DR9A 2WWKO 1KPRA 4XBEH 3FQWA 2AK4B 1MSPA 5FA3A 4R0LB 4HJJH 2AEQL 4L1HA 3MMEB 3VXMA 4K2UH 1M7XA 4KKBD 4PRPB 3RAJL 1QFWI 4L4VA 4X99A 1U93B 4WWKD 3S98A 5BQ7B 4F9PA 1I7RA 4NJ9H 1BOYA 5AZEH 5K33A 4X8XA 4HUMB 1FC1A 4X6CF 3O11B 4J6RH 4B50A 1A6AA 4KKLD 1ACYH 2Y7QB 4PBWD 3C6LC 2P44B 2ORBH 3D85D 4ZOBA 4MWFB 3FFCE 2XNAB 4QY8A 4NQEE 3D69A 1LE5B 4G9FE 3SEPA 4XI5C 1UXSB 3TO4B 3DYOA 1FZJB 5EUOB 1UC6A 3MV9D 3QP3A 1KTKE 3FFDA 4KJPC 5D71L 2X70B 2JJSC 1G9EA 1X5JA 5ITBH 2X4TA 4A2MA 4XC3L 3DX7B 4FQQA 3CMGA 3VFMB 4XPHH 3QIUA 4KJYA 3ZDZE 5E5MA 2OL3B 1UXWA 2AK1L 3QCVL 3ZHKA 2R56H 4MAYC 3QUMA 5I8OL 1INQA 3SDYH 3GUTB 1FIGL 2PR4L 1MWAA 4ZFGH 4OCXH 1HH9A 12E8H 4P2QD 2VAAB 3B2UD 1C1EL 4IHOB 4PJ5A 1PLGH 3HCVB 3KYMB 2IGFH 1NUNB 5DJCA 1C16A 5GSRA 1IGML 2OTPA 4KU1A 4L3CA 1B90A 4OLYL 4WHYG 3IAGC 4O5LH 3CZJA 2B20A 2AK4A 1DTUA 3RWCB 1B9ZA 4MNGB 5CKAA 1RV6X 1CDHA 3RKDD 1K8DB 3ARYA 4M03A 4O9HL 3MMEA 5F6HJ 4DZBB 2G60L 2EIEA 4GW5B 4RIRB 4AT6B 4M8VA 3JWNC 4GBXB 1MCHA 2GTWB 4PRPA 1TMCB 1MRCL 4KI5E 4JQIL 2DWEA 4PJFB 1MJ7H 1JHTA 3UDWC 4AEFA 5EZOH 1YMME 2X4SA 1YJDC 3NABL 1BFTA 4RDQF 5T3XH 3M1BA 5DK3A 3O6KH 5D70H 1I1RA 4NN6B 1WWAX 2CIKB 5BZWB 2BSSB 1OSZA 3ARGA 2Z31D 1DEDA 4U3CA 3HN3A 4O2CB 5I15H 1HHGA 4ODXA 4MWFA 2ZUQC 2XNAA 1TPXC 4Y1AB 4KRPC 3HUJE 1UXSA 3PJSA 4XWGH 3V5HB 2ADIB 2IPTL 3V52H 2AEWA 4M5YH 2X70A 3GJFK 3EOTL 1U2HA 1NFIB 2N7AA 1S7VA 1L7IH 1TNNA 3HE6C 2CH8A 4ZO8A 1CQKA 3VFMA 5F9WB 5E08L 3MGOA 4U6VL 2E7LC 2CPCA 4ONOA 3D87B 1U8IB 4YEEA 5K9QG 4JKMA 3MRFB 4GXVH 3QXUA 1KPUB 3OV6A 2OI9C 2OJEB 5C3TA 3NAAL 4IHOA 3IF1B 5E2WL 4M1CD 1DQQA 1OAUL 1GIGH 1PYWB 1BBDH 4J12A 1UZ6E 3TCLB 2QR0A 4MA1C 1YYLL 3RWCA 4I18C 3F62A 1BD2E 4MNGA 2C3VB 1K8DA 5DC0A 3ZL4L 3BPCB 4RIRA 4U2ZA 4AT6A 1YN6A 3V4VL 2DM7A 4ELMF 2GTWA 3WDJA 3LV3B 1TMCA 4GRWB 2KQMA 4NZTL 2RGSA 3EYSH 2IANE 4XPAH 3SOBL 2K9UA 1B6DA 4OTXL 2V5YA 5D6DA 3QEUB 3MNWB 2RIKA 3BGAA 3MOAH 2OTUA 4ZXBA 1RJZB 1FO0B 3ULUH 5HXMA 5KVGL 4KTEH 4YAQB 2CIKA 5E6IB 3T1FB 3RWGB 3KS0J 3P0VL 2XQBL 4JHAL 1CGSH 4MXVE 4O2CA 4KJQC 4GG6B 3C6SA 3PDGA 4L4JA 2ARJB 2XG4A 4PREA 3ZO0A 1EO8L 4KRLB 1E6JL 2VXSH 1NFIA 2ICWA 1FG2B 1FFPA 4NQDD 3IDJB 4ZFOB 4XVUC 5BRZD 4JFXB 1IT9L 5CSZA 4YGVB 3V0WL 3U6RA 5L2JA 4W4OA 1TCRB 3LN5B 4M6NL 4QXGL 3MLSL 1J05A 1G7LA 1LO4L 4M62H 2EDQA 3MRFA 4OZ4A 4QHKI 3MLTB 1LO3H 3VI4F 1CVSC 1ZWIB 3TT3H 4UZGA 4BFGA 2OJEA 4NGHH 3QFDA 2I24N 2YN5A 2Q7NA 2H2PD 3A67L 3IF1A 3KG5A 1PYWA 2CDFB 1I1YB 2QQLL 1CD0A 2ZUXA 4XPFH 2ZG2A 3RHWK 3WE6A 4DUVA 4JKWA 2C3VA 1TTUA 5I74C 5ALBH 2ZJSL 1QVOB 3UTSD 1QR1B 5HI5C 5C0CD 3QWRA 2ITCB 3INUL 1U8MB 2OQJB 3EDJA 2JJWA 4HQQH 3D39D 1TJHL 2NXZD 3QEUA 3MNWA 2Z93B 3BQUC 3LKOA 3WIFA 1IGCH 4YAQA 2CKBL 1RUQH 5F88B 4XNZB 3QO0B 3MJ7A 4LKXA 4QXUL 4F80A 5GS2H 2VUOA 3CUPB 2Y5TB 2R9HC 3HPJB 1MFBH 2DBLL 3OR6A 5EO9B 2Y23A 3BKMH 4PRDA 4FQ2H 4U7KA 3AVEA 1WSST 4TUKH 3MQIA 1FG2A 1HSBB 2XZZA 3KPSD 3P2TA 5IB4B 4JJHA 4JFXA 1KOAA 3Q2CA 3EJYC 1GGTA 3LN5A 2DQCL 4ZAKC 2F19H 2G9HA 1E27B 2DF3A 2DLFL 1OL0A 1BFVL 4NWTH 5E7BA 4KROC 4G8IB 1ZWIA 4FTVD 4K7FB 1S9WB 3WIHA 1OAXH 5FYJE 3ZYIA 2EDXA 5D72H 4X6DE 2NY5C 4NNXB 4G43A 2EEDA 1I1YA 1CIUA 5DVNA 1HCVA 4Z7VE 3P4OB 1UH2A 2WBJA 1BVLB 1NCCL 4EDXA 3MLWL 2X4NB 2DQEH 2X10A 2NW3B 3E0GA 4M7JH 4FQXC 3MOBH 5D2LB 4YPJA 5IJKC 2Z91B 1LK3H 1CF8H 1DLHA 2B4CC 2DQIH 3GBML 1MHPH 3C09B 4OZFG 3DJ9A 4AH2B 2A9NH 1TIUA 3F6LA 1YNTA 4KY1H 3L3DB 2R2HB 5F9OH 5EORH 4RDQG 2OP4H 4JR9L 5F88A 4APQD 4XXCC 3QO0A 3BD4A 1H8NA 2APVA 2EH8H 4U3HA 2FB4H 4S1QL 3VFRB 2Y5TA 1UFUA 3HPJA 4LCWB 1EH9A 2CLVB 2P45B 1G9NC 1OTSC 4YPGB 2FJGB 1J12A 2IAMD 1GZQA 3SKOB 1HSBA 1RZJL 3GKWH 5IB4A 1RZ7L 3AB0C 3GBLA 1NAKH 4JFEB 4WFHE 1ZVHA 3GMOA 5E56A 3QWQB 5I9QB 2VZUA 2LQRA 4PG2C 1NLDL 3QWOB 4ZTPH 2FWOB 1YEHH 3DRQB 3QAZB 1M7DA 4FZ8H 4MQ7B 3GM0A 1T4KB 2DIBA 3MTRA 3K4AA 4KHTL 5TDPB 3L5XH 2H8PB 3OR7A 2AJVL 4TYUA 2ZCKH 1CXEA 4G6KL 3L3OB 5E94B 4K8RH 4NRXB 4NNXA 4R2GC 3DX8B 2IMNA 1J1XL 3VDCA 3SE4A 3V4UL 4LU5L 1A64A 3P4OA 4HIIA 3U9PH 1BVLA 1N6QH 1N0XL 2X4NA 2NW3A 2BP3A 4GMTH 2Z91A 4PD4J 1F4YL 4U1MB 1F42A 4YZFF 2Q3AA 4LFHD 3TLRA 4OD3H 3HC0B 2BVEA 4AH2A 3SE3A 2OL3L 2GY7B 4GRLC 2QADC 2FBJH 4XPGH 3ZTJG 3LPWA 1NLBL 4JFQB 3L3DA 4XC1H 3IDNB 1I8LC 1U91B 2R2HA 1CI5A 4I9WE 2CMRH 1AGBB 3IU3A 1JP5A 1WVZA 4FMKA 1I7TB 2VDKH 1JRHL 3G6AA 4X7TA 1ADQA 2R0LL 3L95B 3MRLA 3GDBA 3VFRA 3LEVL 4NCDA 4LCWA 3TA3D 2GSIB 4ZS6D 4YPGA 2D7TL 2FJGA 4QOKE 3SKOA 1A4KB 3RVUD 1W72A 3L3JB 3PV7A 3VGFA 5TE7L 2F15A 1S5IH 3DOSA 4AEIL 2BC4A 1DCLA 3S4SG 1MI5E 4FXGB 3NIFF 15C8L 4YDJB 5LQBH 4UDTB 3C5JB 3O8XC 4L8DB 3C5ZD 4ZS7H 4QGTA 2V17L 1UJ3B 4P5KA 1JZ4A 1KEMH 3T77A 4Y5XB 4OV5B 2HG5B 2H8PA 3M8OH 1PG7L 2AEPL 4OFKA 5E94A 4GFTB 1BEYL 3DX8A 5DHVB 4I4WB 5E1AB 4EUPB 5I66B 5F7KC 5LBSL 1U6AL 2DQGL 5EO1A 3RY6C 4JY4B 3NH7H 4ZQKB 1CXLA 2NY7H 1UM6L 3VRLE 4KVNL 4GW1A 5EU6E 2ERJB 4AQOA 2AP2A 4PJ7E 1T1YB 1FZKB 1NCAL 4LLYB 3CXHJ 5HHXL 2Y06L 3HC0A 2ZOKA 1LQVA 3OKYA 4X7SH 3ARDD 1MIEH 3MCG1 2Y72A 3G5YB 4JRXA 5E6ZA 4K9EL 3GBNH 1AGBA 3PABB 3CCHB 1E4JA 1D5MA 2XRAH 1LEIB 1RUKH 1S7SB 3L95A 3I3EA 5IHBA 3GSRB 4X80H 1F4WH 1YPZA 2CKNA 4R3SA 4CJ0A 3MLXL 4QTIL 3FFCB 4NN7C 1A3QA 4G9FB 4ZOCA 1TDQA 5ERWA 4U1IB 3MA7B 5IB5B 5DRXB 5ISZE 4F3FB 4GMSH 5I1GH 1FL3B 3FCTA 5MHSD 2VISB 2HKFL 2ZSVA 1XF4A 1F4XH 5KSAC 3D9AH 4HKZB 3LQAC 4L9LB 1DL7H 3MRQB 4HD9A 4HF5L 1J0IA 2EH7L 4OUUB 3UPAA 4KK6C 5EA0L 5EBMA 4Y5XA 4D9LH 4OV5A 1AGDB 1FO0L 1UCBL 3UEZA 1FNSH 5F97E 1AE6H 3BXNA 5LCVH 1BIHA 4U0QB 1EVTC 2A74B 4JM2A 3OG6B 3TO4D 1T2XA 1FVEB 3BE1L 4UAOC 5GS0C 4ODTH 5GJSL 4EUPA 3ARRA 4G7VL 4XP6H 4XPTL 4YC2C 1IC5H 5I66A 3P9WB 1DE4A 1B4JL 3GO1H 4JY4A 1BVZA 3OZ9L 4HGMA 5B3JE 2ED9A 4Z7NE 4JRYE 2JLLA 2A77L 1T1YA 4NC1E 4JO3H 3G08B 3CU1A 4LLYA 3KPRA 1CLCA 4PTUA 1IBGH 4ZFOL 5I73C 3CLEL 1C5CL 4Y5VC 4Y7MA 5CMAB 4Y16C 4UB0L 2HN7B 2H1PL 1J0YA 3HB3D 2FR4A 2R8SH 3QRGH 1YMMB 5JW3L 3RZCC 3CSYB 1JNNH 1RJLA 3CCHA 2NX5E 1B0GA 4I3GA 4K7PH 1LEIA 3MXWH 4RQQA 3HI1B 5GGVH 3X14B 3EHBC 4EI5C 1M1SA 2J4WL 3O9WB 3GSRA 1HHHA 4DVRH 3VGGA 3FFCA 4NQEA 1C5BL 2DQDH 4G9FA 3ULVL 3HUJB 4KJWC 4U1IA 3THML 1PVHA 5IQ9B 4GBXD 3W9DB 1QO3B 3RDTB 2W0FB 4OB5H 3FTGA 5J1TC 4HHAB 5D8JH 2NW2B 4HV8A 4HKZA 3MLVH 4BA8A 4U2YA 2PTTB 1INDH 4K55A 2WWKT 4FQ1H 3NFSL 4IIQB 1CL7H 4OUUA 4WHCA 4JFOB 3F6IA 2FLBT 1OW0C 1CK0H 4Y1AD 5DMIH 1A0QH 2DLGA 3TC9A 3MUZ1 5HD8C 1FVEA 2DM3A 4BQ8A 4BH8B 1YEJL 4HUUA 2DTML 1SYSA 1S78D 2VIRB 3DSFL 3I02A 3BRGC 3P30H 4ETYA 1BD2B 1DLFH 4BM7A 2VZ1A 3G08A 4OZGE 2BNRE 3A0OA 1LNUB 1BZQK 3CX2A 1R5WB 1AFVH 2WQ8A 3QUYD 4LARH 1MAML 2IANB 4DQOL 2HN7A 4F33B 4JPVH 3WFHB 3CSYA 4IRSC 5IBUG 3ZLQC 4OM1H 5JPMA 3LB6D 3S37X 3MV8E 4P59L 1N7MH 5FM8A 1J0HA 3E8UH 2NY6B 1GH7A 4J3OC 3LKRA 3O9WA 3ZKMD 2XZAL 2F58L 2YRPA 1WAAF 1N5YL 4U05A 5KS9A 5B39B 5I6XB 1LGVA 3IXTB 3HUJA 2QQKH 4DGIL 3TV3H 3MBEB 3VI3E 2A6DB 4UOJA 5FYLH 1CE6B 2YSSB 3W9DA 4HPOL 1P7HL 3OAUL 4JO4H 4W6YB 4Z95H 4ZTOL 3TGXA 4G42B 4IRZH 2FGWL 3EYUL 3CSGA 5T5NF 1NCUA 2Z4QB 3RIAK 2PTTA 5FYKU 5E6ID 3MV11 4IIQA 2C9AA 4HT1L 1NQBA 1BP3B 4HFWA 1PSKL 4Y2OA 1IC7L 1WZMA 3TIDB 2X40A 2ADJA 4DEPB 5DUPL 5GRJH 3DVIA 1ADQL 5IM7A 5IG7B 3P4LA 3O6LH 5DJXA 1QFWL 1GOFA 3V5KB 1IAOA 4CU8A 3EJJX 4N5ED 1TTFA 1M05A 2CJUL 2QQNH 4LSSH 3SKJH 3ALPA 2DN7A 5KW9H 1BD2A 4PLJC 5GRVL 4HK0B 2VLME 5GHWL 1G1YA 4LCIL 1QZ1A 3CK0L 3TH4T 2IANA 2Z8RA 2G5RA 1I1FB 3O3AA 4JKPH 4QLRA 4DK6A 4F33A 1ZA3B 3WFHA 2E5EA 2OJZL 4R4NC 5FOBA 1UJTA 2C5DC 1PQZB 4Y19E 3BPOC 1ZTXL 1KTDB 1RJCA 4PGJA 5LWYH 1R0AH 1F4HA 4I48A 1KACB 3CU7A 2H3NA 2R69H 2VDRL 3SO3C 3RP1A 1NFDB 4Q6IB 4X7FC 4CVZA 2X44D 3IXTA 2EYSA 4FN0A 5HHPA 1JL8A 5FV2A 5F1IB 3T0EA 1MJ8L 3GRWL 1CE6A 2YPLB 3BJ91 3AS3A 4XNQB 2VLLA 4HC1L 3QFJE 4OZIE 4YDIL 4DKEH 3BKCH 5A2FA 4ZYKB 1IQDB 4G80B 2YUXA 2OX5A 5GIRA 4ALAL 3ZSSA 2R23B 4DGVH 3TIDA 4JPIA 1P4LB 4NM8H 1CL7I 2ZUYA 1EAJA 4X6DB 5IG7A 4QTHB 1JGUH 3PF2A 1P9MA 2F54E 1YEEL 1CLZH 1LMKA 2X4RB 5E03A 1X5HA 3IAPA 5KANI 4Z7VB 2QKIB 3LKSA 1TVHB 2J5LB 3BP7B 4GSDL 2A38A 4YE4H 3QDGD 4PYHA 2VB5A 4HK0A 2KUTA 4CMMB 5JMRA 4WDIB 3O4OB 3ES6A 1FNFA 5GRWA 5TE4H 4ZODA 1NCWH 1CGYA 3OXRB 1ZA3A 4LAQH 3B4NA 4OSUH 3S36L 5TPWH 1FFNB 5ESQA 5BV7C 1PQZA 4V1DE 1KTDA 4FQCL 3RA7L 1EK3A 1JCKA 2NZ9D 4WCYH 3WNPA 4WTXA 4Q6IA 2UV3A 5DD0L 2YK1H 2SEBA 4U1KB 2A0LD 2OR9L 5F1IA 4H88L 4X98A 2BFVL 2XN9D 2FATL 2J88H 3ILQD 3V7AG 3O41B 3DXAE 3FT2A 1OGTB 4L4TE 3QXDB 1MCQA 4P23C 3DX6B 2R1XB 1TETH 5E5UB 5IW6B 2JB6A 3K1DA 2WWMC 2WP3O 4RCAA 4ZYKA 2Q86B 4PJCE 2V2WA 3DV6B 1HZHH 4G80A 1K3IA 3PGCB 1MREH 1QFPA 3O3BB 4MZ3A 5EOQH 2HVKB 5F7DA 1P4LA 1HNFA 1HDMB 3BSZH 5J3HC 1IM3B 4XMPH 4X6DA 5IHUL 4N9GB 1E4WL 1A6VL 4K2UL 4P99A 2AGJH 3RVXD 1RJYB 3RNKB 5DUML 4Z7VA 3MXVH 1HXYB 1TVHA 4QRQB 4JFED 3T3PF 3HE7C 5FUOL 3R1GL 4RRPG 1DN2A 5BCAA 1QACA 5JZ7D 5AZEL 2F5AH 5C86A 1AO7E 4G5ZL 1Z3GH 1KLGB 5J13B 4PJGF 4YJZL 4J6RL 1MH5A 3OXRA 1NH6A 1C12A 2W07A 1RSFA 3W2DH 5DF0A 3OXSA 5GZND 5CGYC 5C09E 3OBAA 1LILA 1XGRB 2VLRD 4BZ1H 3PWLB 5DO2D 1H3PL 4Q58C 5ICXA 2VLKD 1WIUA 4KFZC 4ISVA 1GZPB 3OGCB 2HMID 2NY0D 3QI9A 5FGSA 4N90E 5A16B 5F89B 5ITBL 4NUJB 1RUMH 3WLBB 3VA2C 4DZ8A 3GZKA 4OGYL 3DYMA 4U1KA 1CFTB 5KSBF 2AJZB 1K8IB 5HYFA 4WY7H 3EJZC 3F58H 1MCBA 3TCXA 1MCKA 4LSQH 4QOKB 3M17B 4WFFD 2VJXA 4MJIB 4F57L 5E9DE 3DX6A 4M5ZL 3UPCA 4HUKB 4LIQH 4H1LB 3VWJC 1XH3B 1RUAH 2Q86A 1DBMH 2UWEF 3T4AB 1AD9A 5T5NG 2XKUA 3PGCA 2XWBA 3F8UB 2JCCE 1OT2A 1M7IB 4DKFL 5A3IC 3MACH 2HVKA 4FMFA 3H7BB 4PLKC 5EPMB 1GL4B 3U2SB 5EDXA 1MHHB 5C0RL 4LSRL 1A1MB 4N9GA 3QUXA 4XHQA 3HNTH 1H8OA 4I0PC 4JDTL 3WHXB 3RVWC 3MUY1 4JKLA 1RJYA 4TSAL 4YHYB 5DZNA 4LIQE 4TPRH 4YHOH 1ZLSL 3BGFC 3JV6B 4P9MH 5EU6B 2F74B 4YHMH 5EZOL 1ACZA 4RFNB 3DRTB 2HRLA 4PJ7B 3RU8H 1X5KA 3IFLL 1AHWA 1Q0YH 4G8FB 3O6KL 1KLGA 2KL6A 1KJMB 4J1UA 1YUHB 3VGAB 2R29H 1FRGH 1D5ZA 1JGVL 3MRHA 2V5TA 3FN9A 3RJDA 1U8JB 1PKQE 2EE9A 2I5YL 3S88H 1MCCA 3PWLA 5GISH 4HXAL 3MJ9L 1EFXB 4LVHC 3OGCA 3MLPA 4L3EE 4HIJB 5A16A 2DD8H 5F89A 4TRPL 1L7IL 4UQ3B 1KCUH 4X4YB 1CFTA 1K8IA 5HTSA 4D8PB 3WXWL 1VERA 2RQ8A 3CFKB 5CWSA 3M17A 3QCUH 4NZRL 5ICYB 5ISZB 1ZHBA 4PRNB 1PDKA 1YEDA 4KC3B 1MI5A 4JPWH 3WFZA 1CYGA 5TH2B 1HYSC 4ZFZB 2Y36H 4LCCB 4KTDH 1NGYA 1XH3A 4KMQA 1FYTE 1AC0A 5ENWB 5I1IL 2FZ3A 5D93C 5JOPE 1M7IA 4QWWC 1T89A 4MVBA 5DFVD 3H7BA 1FFOA 3DURB 3LQMA 4LLAA 1RI8A 4OKVB 1KJ2B 1OTTD 5MEQA 3FFCD 1A1MA 2KH2B 4X5LA 5D1XB 4G9FD 4J4PC 3ELAT 3Q5YA 4HMCA 3U7YH 2CO6B 1DVFC 5L9DL 4UNUA 3JV6A 3ISWA 4XPAL 5EU6A 4W70A 2F74A 4GKOA 1TQBC 5LGHL 5JR1L 4PJ7A 2D4DA 3MOAL 1PZ5B 1D9KB 4G8FA 5D7JA 5DRWA 5TFSH 4Q6YA 1KJMA 4WWID 3H9SE 3P11H 2VZ3A 1OAZH 4W81A 4W4NA 4WVRA 5IEKA 4RGNB 2ZUVA 2IPKA 3DUSA 4OLXH 1U8JA 2V6HA 1MCFA 1WTGT 3CAFA 2NX5B 4EBQH 1LO2L 1CD8A 5EZJB 5L8KB 1WWBX 2XI9A 1MCIA 3PHOB 5ACZB 4HIJA 4QEGA 4FQPA 1KN2L 4KZDH 1S7UB 4CN4A 1YEFH 1EUTA 1OP9A 2X4QB 4JG0H 4UQ3A 3U1SH 3RGVD 1FBIL 4D8PA 4KHXL 5L6YH 2E7LE 1MFNA 5GZOD 1ULVA 4M4RA 5ISZA 4Y8AA 5TDNB 2C1OB 3C60B 4HH9B 1ND0B 3NA9L 4OD2B 4KI5D 3QNZB 1BWMA 4NO0A 2V2TB 1XGTB 3RX8A 1CBVH 3B8SA 1ZGLB 4F9PC 5TH2A 1YMMD 3GSWB 4ZFZA 4NGHL 4XHJC 3KS0H 2APBA 1IKFL 5ENWA 5HVHB 3O9WD 4QRUA