3QI9A

Crystal structure of mouse cd1d-alpha-phosphotidylinositol with mouse valpha14-vbeta6 2a3-d nkt tcr
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
290
structure length
290
Chain Sequence
KNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular basis for NKT cell recognition of CD1d-self-antigen
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 80
structure length 290
sequence length 290
ec nomenclature
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qi9A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3qi9A01
1NGXA 2X10A 2XXCB 4L4TD 1IZKA 4E42A 1OSPL 3PWPE 5T5FL 5E70A 3KPMA 1VA9A 1H9VA 1XCQB 4PP2B 3FO1B 4PJEE 3P0VH 2AI0H 3IT8D 4LCIL 2DRUA 4TQEH 3RWJB 4N0CD 3W39A 4H0GA 1HN1A 4XWGL 1YNTA 1KEGL 1A7OL 1UQSB 1G7IA 5E6IC 3W81A 3R06B 1BFSA 5A40E 4AZ8A 1FLRH 1MIMH 4RFEA 1FL6A 2VDRL 1FO0L 2A73A 1T0NB 3BYYA 3NN8A 3ZZ1A 2XACC 3U0PB 2AK1L 5C08A 4ODUA 3DJ9A 4GXUN 5E8OB 1JGUL 1ZA3A 1K4DB 4ONFL 5HI5C 4JFPA 3DBXA 1FLTX 1NEZA 2HFEA 1A6PA 3PWNB 1YMHB 1KF9B 2AK4B 3OAZH 4K3JH 1SM3H 1ZLVK 5E24E 5ID0B 3GRWL 4KQ4H 4QHMA 3I85A 4RA3A 1G7QB 1UACL 1HSBB 3K0WA 4PTTB 1R24B 4M7KH 1VFMA 2A6DA 3V7MA 4WNQA 1S78C 3WLBB 4LMQE 4F7PA 3WMSA 4YX2L 3ULUF 3STZA 3G5VA 1A6ZB 5F8QC 3RAJL 2NW3B 4OZFB 4L4VD 4NUJB 1CZ8H 3AXLB 3CLEL 3H42L 1HXYA 2E6QA 4DKDC 3QIUB 2BVUA 3PL6A 5TQ0L 2VJXA 4NQXA 4H5SA 4U1SB 2D7MA 5MP6L 5D1QD 4M7LT 4XI5C 1T2XA 3IFNL 3ZYOA 4NN7B 5DRXA 4PBXA 3X11A 1A7PH 1FNGA 4ZPTA 3FB5A 5HDLA 1DQML 5DD5H 2P5WE 2CD0A 3WFZA 1RK1B 4PRBB 1XCTB 2WIIA 4MCZA 5F7FA 1BAFH 3ZT7A 2Y5TB 1OAZL 1UJ3C 1A0QL 5TDNA 2ARJA 3PP3H 4LNRA 3PNWB 2YKLH 5BVPL 1YMMA 4P2QB 4MYWB 1CL7I 2DQJL 1XGPA 4LEXL 2EE3A 5CD3B 3W0WB 4MJIA 4AJ0A 4Q9QL 3LKOB 4KKCD 5EOTA 3IU4L 4V1DB 1WZKA 5SWZE 1TQBC 3UJTL 1UWXK 1PX3A 2FCBA 5FYJD 3VXPA 1KCRH 1KEGH 2FATL 5FF6B 5KVGL 4LIQH 4XP9H 2VITB 2XFXB 5D70L 2X4QA 4S0UC 3CZJA 3FQRB 3WFEL 5J3HD 3V8CA 4YIQA 1VFOA 3HRPA 1P7HL 1IM3A 1D6EB 1DUYB 3G6JF 3GMRA 2G75B 4Z7UB 3EDDA 1IQDA 1O7VA 5E1AA 2F15A 2ADGB 1KCRL 5I19L 1CICC 1YZZA 4OTXL 3TBSA 1NCBH 2APVA 5F72S 1I9RH 4WHCA 1DE4B 2AJ3A 3PWLB 1HIMH 5I73B 5K59F 1PQZB 4D2NA 5JOEA 1CDJA 4LQFL 2HT4C 1QSFD 2V7NA 3RWEB 3CMOL 4K9EL 1CFNA 2IH1A 1KJ2B 3LN4B 5BVJA 5B38A 1CDYA 4E41B 1R3HA 1LNUA 1V3MA 2DS4A 1QLFA 3QWQB 1CF8H 4UT9L 3GI8L 4MQ7A 1CFSB 2X2YA 1NLDL 3L5XL 3VWKC 2PW1A 1EGJL 4R96A 1BVZA 1OAYH 4IDJL 4TRPH 3INUL 2J4WL 1FQ9C 3F6IA 4OZGE 2YUVA 1X5HA 3SCMD 4OZFG 3HC3H 4D0DA 5HHQA 3IRZA 3C8DA 2KPNA 3TV3L 2QSTA 3V5DA 3H3KA 2WBJB 5MHSE 4MB5A 3NTCH 3VXQB 4HG4K 3WFCH 3D0LB 3VFTB 4PRPB 5IKCA 5L2JA 1EH9A 2VAAA 5C0BA 4QXGL 1IGCH 4TSBH 1NC2B 4LAJH 4DW2H 3G6JE 4LSPL 1ZLUK 1HKFA 4BH8A 4OZ4B 1X44A 1T66D 1S9KC 2ZPKL 1MLCB 3LH2L 2K7PA 4PJ7A 4UINL 3C2AL 4EBQL 4F57H 4MNHA 5KOMC 3F6LA 2YXMA 4P59L 2EDXA 3MRRA 3ARBA 5HGGS 3L1OL 4FABL 2H3NA 4QRRD 35C8H 4QXGH 4R0LC 2EXWC 3E6HA 1DN0B 4UV4L 4L5FL 4HIXH 5CAYB 3B5HA 3BHBB 4W4OC 3UBXI 4F15C 1E4WH 4FFVD 3KYMA 4FFEX 3I75B 3MGTA 5D7KE 1YQVH 4UDTB 1F4WH 4LLWA 4LHUB 1RZ8B 3HZKB 4OD2B 2VLJA 3LSOA 1DQTA 1KIRB 3GSNH 1AFVH 1T5XA 2CXGA 2FGZA 2OSLB 4I0CC 1XH3A 2Z93A 2B5IC 1D5BA 2X05A 1KB5B 4HS3B 4F37K 2YZ1A 4NZRL 1A14L 1NCUA 5ID1B 3DURA 2HJFB 3VXSA 1TITA 5BZWA 1JZ6A 1T0MA 4HUKB 1KENH 3L3OA 1H3VA 4JG0L 5I1JL 2UVFA 1XT5A 4YNYA 2IPKA 1NCNA 4M6MH 4FQQB 3HR5B 3G5VB 4ALAH 5F3BB 4Y5XC 2B39A 2VERN 4NN6C 4XBGA 1MFAH 4R2GB 4B7IA 5FOJA 3KPLB 1NMCC 1P2CA 1Q1JL 3VRJA 2BERA 4N9OB 1JZ7A 3D3VD 1I7UA 1WZMA 1T80A 4Y4KD 3P4OA 3E2HA 1QVOA 5I8CB 4OBSA 3D18B 3MXWL 1CT8B 5IFAL 3GSNL 2AJVH 1SYSA 2CIKB 3CVHL 3MODL 2QTEA 3I9GL 1I8MA 3HAEA 3BPOC 2Q6WB 2E7BA 2ITDB 4XPBL 3MRKA 1MHEA 3STBA 4YIQB 3BKYH 2OMNA 4RAVA 2B8OT 1MCRA 4JPKH 2C4FT 1E4XL 4PJHF 3FQNA 3BPNB 4WTWA 4X6EB 5ACZA 1UC6A 2EH8H 4HKZB 4DN3H 3G6JA 1G9EA 1HI6B 4KY1L 1WC7B 4X9FA 4HUWA 4HWUA 5L88H 3GMLA 3KYOB 5KVDL 4XCCH 3MGOA 1X6LA 1OW0A 4ZUVA 1CXEA 4EOWH 3RZCA 4PJ8D 2A0LC 4FQXC 2P46B 1IKFH 4LPUA 1AD0A 4XTRC 4PJIA 1R5WA 2LQRA 1RJYA 5E56A 1A7QL 1XF5B 3EOAA 1CLOL 1X5GA 5IBTH 4NIKB 3BDBA 2FX8L 4UIKL 3RX7A 3ISWA 3VFRA 4G9FA 1CQKA 5HYSA 2O61B 5I76A 1IGIH 1E6OH 5E08L 5K9JH 1M7DA 3C5JA 1UJTA 3O3BA 2F8VA 4R7NA 2VOTA 1TFHA 1O0VA 3TN0B 4OCMC 2A9ML 3FT3B 4HUUB 1TJIL 2BNRA 3PIQB 2EDYA 2BNUA 1UM6H 3MRFA 2IC2A 5B4MC 4QXWA 1CDIA 2XOTA 3KXFA 4GRLD 3GNMH 2LFGA 3CFEA 4FQPA 5GGRY 3U7AA 4IRSB 3FOMB 1TZHB 1MAJA 4NCDA 5ABDE 5MHSD 3SDDC 3GJEA 4HPYH 1LNUB 3CK0H 1KBGL 3SPVA 2DM3A 4Z7WA 1EAJA 1X5IA 1JF5A 1TJIH 1H3PH 1SJHA 3PP4L 4LCUB 3QULB 4NBZB 1LO2H 4RRPG 1C16A 3ULSA 43CAB 4YHNB 3FB7A 4KC3B 4I18B 3IU3A 4KK5C 3C8KA 1MH5B 3JV0A 2B1AH 1CG9A 3X12A 4X6DE 1U91B 3ARED 3MYZA 2AJZB 1KCVL 2P8LA 4N0FA 4D9QE 5E0QA 3RIAF 4KKLC 4FHBD 4PJAB 4POZC 3MNZB 2CDEA 3KNBB 4N1EA 2ICCA 4LVOB 1J1OH 2F58L 4TTGA 4XZUA 3NA9L 3WJJA 4R96B 4NDMB 3V6FB 3SE9H 3RA7H 3RVUC 3CUPB 2XZCH 2H2SD 3NIDF 5FYLD 1PW3A 5DJ2A 3QDJE 5EZJB 4ZQKA 1MWAL 4HV8B 5E8DL 2YZ8A 5I74B 5J13B 5C08D 4GRLC 4L8CA 5TDPB 5IJKA 4I2XA 3IAGC 3GMOB 4XP6H 3AAZB 2DJSA 1N8ZB 1JWMA 4C4KO 3VI3F 4CUCA 3K4AA 4XC1L 4YPJA 3QB7C 4OI9A 3JVGA 4N0YH 4GUPB 4IM8A 4U0RB 1RMFH 3VFMA 4F9PC 3QXDA 2VISA 1JV5A 3ARFC 4ZAKC 4HWBH 5E2UH 1VACB 5CSZB 5DUBA 1V7NL 1G1YA 3UJJL 3VFNB 4NQXB 4GMSL 3KJ6H 4Y16D 1D9KD 1NBVH 4HFWA 4EDWL 3BI9X 5DS8B 5C0CA 4KPHH 2KBGA 2OZ4A 3AS2A 5CJQL 2QSCL 5MENA 7CGTA 1I3RB 2FX7L 4R97B 1CVSC 5KN5B 4M3KB 2J8HA 4P5TB 1MCJA 2BJML 3SE3C 1ORQA 3HFML 2R2EA 3VXRB 2HWZL 5H37H 4N8VB 5C09B 1QKZH 3V7AG 5HD8D 3WO3B 2G60L 3TJHD 1BD2A 3AREA 4HUXA 1YN6A 1ZWIB 3MOBH 1TTUA 5DVMA 3SDCA 4EEEA 4G3YL 3TNMA 1R5VB 2DLGA 3KPOA 4KH2A 3JTSA 1A6UH 2E7CA 5LWYH 5D72L 5IR1A 1ZE3C 3KPQA 4N0RA 4Q0XH 1NBYA 4YO0A 1N4XH 5F9JA 9CGTA 2NLJB 1T2JA 3PWPA 2YBRA 2FX9L 4QF1B 4OGYL 1E27B 5HBBA 1BBJB 3WIFB 5D7LA 3BVNB 5IBLD 5JMOC 3OKOA 3JBG7 2OI9A 3ARFD 5DRWB 1UCBH 1CE1H 5GRWA 4JFOA 3OJ2C 5LWYL 4ORZC 3CDGB 1DUZB 4LPTA 1JCKA 1FAIL 4HWEL 3QPXL 3QFJB 5T3XD 4DFIA 4Y19B 3KXFD 2D7QA 2X4RB 5FYJH 5HYJD 4DZBA 5BMFH 5IESL 1A7OH 1I4FB 5IMLB 4XP9L 4NCC2 1J18A 3F7VB 3IS1X 1JNLL 2MCPH 2MFNA 2CXKA 2VC2H 3KYKL 1ADQA 3W9DB 1HXMB 2I5YH 4YHPA 3O6KH 4ETYA 3GSNB 4NSKB 1EVUA 3TP4A 2Z4QA 4JGJA 2PO6D 1K3ZA 1G9ML 3CVHB 4HKXA 4HWBA 4NNXB 3TIDA 1FL5B 1LWRA 3EOBB 2PN5A 1Z2KA 4DKFL 3BRGC 3JTTB 1XF5A 5E8OA 3THMH 1BHGA 4GMSH 4P23A 1JGUH 3O6FB 3ZKXC 3GJFK 4ERSH 5D6CA 1PGRB 5GGRB 4MWFB 3IFLL 4C83B 3VW3L 5JPNA 3V6OE 2XRAL 4PRAB 5I75B 4LLDB 4K8RL 5F7MC 2K9UA 5D7JA 1QA9B 2GI7A 1AO7B 3HZVB 5HPMA 2VE6B 3MBEB 1VFAB 1U3ZA 4JLRA 4UT9H 1WQVT 2VN7A 5KVEH 4OZIF 1JHKL 5FUOH 1PAMA 2E9JA 1RD6A 3CPLA 5IB1A 3V6OC 2V17H 2CLZA 4M1CC 3ZKMD 1AIFB 5JIHA 1QFHA 3U7YL 4L1HA 2NXYC 3ZTJG 2W9LA 4QRRE 1XZ0B 3MLPA 2N4IA 2VDML 2YK1H 5FO9A 3RWIB 3ORJA 2OMBA 5J1AA 3ZL4H 5E8NA 5EA0H 3RPKA 5DURD 1FNHA 3CDYA 2I25N 4I13B 4J3UA 4PRID 4MDIB 2F74B 4YBLC 4G6FB 2A6IB 4Z7WB 2BY1A 4UQ2B 2YD6A 4TRPL 4NPYB 2PXYB 3DMMD 1JYWA 2DIBA 3GM0A 1W0VA 3ZSTA 5BVPH 4EVNB 5I6XB 3M1BA 3DROB 2BSSB 3O3AB 2R0ZH 1LDSA 3HKFA 5DRZB 1IGJB 1GZPA 1IARB 1A8JH 5EZOL 2BHYA 4I18C 1T89C 2DQFB 4Z7OF 5C0ND 3RL1A 4PJAE 1GAFL 2BNUB 2GK2A 3MRFB 5CIPB 5K9QI 1RUMH 5I30H 1RUQL 5E8EB 3TPUB 2VXVH 2OJZL 3ZKQD 1U58A 5IFJA 1FC1A 3F65A 4IHOB 1UA6L 1JGVL 3TJEL 2W0KA 1X4YA 2Y9RT 3IFPB 5I15H 4OD2A 3BH9A 5GZND 2ZCKL 3TVMC 3OGCA 3GMNB 4ODHL 4M43L 3F7PC 4XH2A 1MAMH 3MGOB 4UINH 2NY3C 3RU8H 1NCDL 5C07B 1PG7W 1OQOA 2IMMA 3ARBD 3FTGB 3TH2T 1A22B 3AUVA 1P4IL 2FGWL 3DUUB 2E6PA 3DVNB 3UAJD 1K8IA 1MEXL 3BPLC 4LAQL 1F3JB 1ZT4A 1NFKA 1F58H 3SKOA 5JW4M 4P4KA 3L5JA 4KRLB 1MRDH 2NW2A 3MXWH 1IM9A 5EO1B 1MWAB 2QADB 4F3FB 1CK0H 1EGJH 1J8HB 4XMPH 2J5LC 3KYAA 4KY1H 5DD3L 3QG7L 1NL0L 4KJPD 5TDOB 5TQ2H 2CJUL 2J6EH 3RUGF 1AO7E 1MEXH 4PJIF 4YWGH 5I8CA 1UB6A 4HXAH 5FO7B 1JBJA 5T1LA 3GSQB 4EOWL 3IXAB 3TBWA 3GSOB 1FIGH 3Q6GH 2R1YA 1JJUA 3WNPA 1ETZA 3VXME 3QISA 3GJEB 3PWJA 4IRJA 1SY6L 4KRPB 2WP3O 3HMXL 3SOBL 2VLRB 1VCAA 2H45A 4LPWA 5E94B 3PIQA 5K9OA 2OL3L 1VADA 2RR3A 1IGTA 4QCIB 3GMPB 3QCVL 3PWUA 4X7TA 4BYHA 1KACB 1ZK9A 4J3SA 3H9ZA 3RJDA 2HRLA 4L8DA 2DQDL 2IQ9L 2BDNL 5SWSA 2I9TB 1KIUA 1UVQA 3MLTB 3BD5A 1ZT7B 3FAXA 1T1XA 4JPWL 3MLRL 4MD4B 3VXMA 2HAZA 1YYLH 43C9A 2AAVA 1Q0YH 1MVUB 3EOAB 4DGYH 4PJ9D 4Q74A 5EU4B 2MKLC 2H32A 3DX8A 2IEPA 3OJDA 3HMXA 1AGFA 2NY4D 1XIWB 3O4LA 1J8HD 2P42B 4I8DA 2J8UE 4P46C 1B88A 3OR7A 2ADJB 5TGBB 3TPUE 2BC4B 4PRIA 2VITA 2X4UB 5CS7A 5FF6A 2A77H 3VFVB 3VI3E 4EI6B 4G8GE 1YYMH 1IC5L 1V7MH 3QRGL 1MOEA 5ADOH 5T1MB 3HCVB 5EU6E 4UNUA 1MCFA 4ETQB 2VDQL 2EDTA 4MNHB 3F7QA 4G7VL 1MFAL 1IAII 5I8OL 3LAFA 4KROB 4M9PA 5I1DB 2V7HA 4L8SA 2AJXL 4DVRL 4FZEL 4RNRA 4AENB 3O6LH 1FFOB 2PTTB 2VABA 3GM8A 1FVEA 4QXUL 4BSWB 1AGDA 5H94A 4J1UB 5ISZE 4HH8A 3MOAL 5HHOA 1C5DB 1EGJA 1S7XA 2E7MA 4W81A 3OXRA 3UPAA 3UYRH 4PRPA 5DSCA 4PJ8B 1A6AB 4WI9A 4G8EB 4MA1C 2JJWA 3PL6D 3H0TB 5DLML 2Q87A 1XGUB 3H9HA 5GXBB 4R26H 1QBLH 3IGAB 2AJXH 2H9GA 4JO3H 3UTZA 5DWUH 4LHJB 4NM4L 2X7LA 3U83A 1I7TA 2F53B 4O2CA 3REVB 1P53A 2X9XA 4KU1A 2NW3A 2AJUL 3AU1A 4CNIA 3MPCA 1L8JA 1FGNL 1IAKB 2DQGH 4F7PB 2VDQH 4UAOC 2VKWA 4F9PA 2NY4C 1KJVB 5H35B 1JI1A 1PEWA 4PRNA 1CVRA 3LEYH 2ADGA 3U0WL 1YEIL 4WFEE 3RWIA 4JAMB 5FO9B 3PWLA 1ZVHA 3UYRL 4B5EA 1R3IH 5CJXC 1W0WA 5GJTH 2APWA 3F7VA 2VRAA 1HHGA 3X3GH 2AGJH 1I3UA 1IQDB 1I7ZB 1FJ1A 4NO2B 3GMQA 4OAWB 3FQTB 4POYA 1IM3B 5E99L 4NZDA 3ZE2F 3W2DH 1U8NA 3D9AH 5HGBB 2F19H 4LSTL 4KZEH 1LO4L 4IRSD 4X6CE 5D1QB 2O5ZL 1DQLH 4JHWL 5B22A 1XF2A 1HOCB 3FN3A 1CLOH 4OZHA 4I0PA 3LQZA 4HH9A 4DN4H 5E5MB 3V4PL 3LMJL 4JDTL 2A83B 4XXDB 3SO5A 3QO1B 5D4QA 5C07A 1AQKL 2Q76A 5EOTB 3HHRB 3IJSB 3BZFB 5CD3A 2NY1D 1ZT1A 1BGXL 1MF2L 2P5WB 4PJFF 5ESAA 4K94L 4M5YH 4M62H 1F2XK 5CHNA 1YDPA 4DGIH 4WU7B 3QI9A 4M7KL 3H42H 3RNQA 4RGND 3QDGE 3BH8B 4X8XA 2FJGA 3V52L 3OQ3B 3QFDB 3B43A 3G5XA 4TSAL 2E7LC 1CXHA 3GSNA 4NC1C 5JLZA 5C09A 2DIJA 3RVWD 3PHQA 1AKJD 4PLKD 1I1CA 3FZUD 1Y0LA 3QUYD 1D5MA 5HHMD 4YK4C 2DBLH 1SYVB 2KUTA 1CGTA 5FM8A 4MNQA 1DBAH 5IGXH 2FX9H 4YGVB 4CVZA 2IG2H 3NCYS 1EXUA 3HNVL 2JTDA 3O2DA 5D9SA 5MP6H 5CEZD 5IEHA 1EEZA 2Q86A 3OB0H 4E41D 4M93B 3ULUD 5DD5L 2W65B 2BMKB 3T08A 4ODVL 5EBGA 1JPST 4YZFE 1EZVY 1BAFL 3RAJH 1MI5D 1U8OB 5IMKA 3UJTH 4QRSB 4P5KB 4YDJB 5I1CH 1C8PA 4HJJL 1S7SB 5FO7A 4H26A 3HA0A 1T83A 3HNVH 5I8EB 3PABA 4XPGL 4PJFE 1C08B 1U8IA 3E0GA 5HHVL 2Z9TA 4HWNA 4ZNEE 1CLYH 3TZVD 3VFWB 1CD0A 4P2RB 4CVXA 1BJMA 1A1OB 3ULVE 2Q8AH 5TF1L 3ABZA 3RGVB 4PP1D 2YUXA 3D85B 1A21A 5ALBL 4P48A 4QO1A 4YAQB 1OF2B 1DBML 1RZJL 2YRLA 2GTZA 4XRCB 1HHIA 3H7LA 1JHLH 4MD5A 4F7CB 4L8BB 1ZEAL 5HHVH 4OZHB 3BE1H 4UU9B 3HG1E 4Z7VA 1NC4A 4B50A 1MCEA 4LSSH 3OKMB 3ZDYF 5FV1L 5FFLA 1FO0A 2VDNH 4ZG1A 4FMFA 2NY1B 4WV1C 1VFBB 1FLRL 2VZ3A 1GGTA 4RFNB 3HFMH 3DX7B 3HE7B 1KG0A 3QQ3B 4HT1H 4JY4A 2WY3A 2YMXL 1P1ZA 1OAYL 4QOKE 1NAKL 2OL3B 2ZJSH 4NO0D 3KLDA 1W2KT 3PABB 2PTVA 4TOYH 4PRPD 2NMSA 3MNVB 5HGAA 3SEPA 1INDH 1JWMB 4HCRL 1I7RB 3OG6B 4JCLA 2CMRL 3SE8H 5MEQB 1PKQA 4WI4A 5J6HA 1MHCB 4GRLA 3O4OB 5AD0A 3MUJA 4OF3A 1I9JH 1Q9OB 4HT1L 5C9JA 3DVGA 2ZCHH 5C0IA 3INUH 4TNWF 4F80A 3NCCB 5JHLH 4WWKA 4G8FB 2EDDA 4IOIA 1T20B 5TH2B 2Y06H 1WUNT 4RGMC 4F7CA 3KVQA 5ICXA 2XKSA 3HZMB 5JMRA 3L9RB 4HDIB 3ZLQC 3NTCL 5KJRH 4F15B 1WFUA 5E6IA 4D3CH 5CGTA 1NGYA 2PYED 3VGBA 1FHGA 3O8XD 2P8PA 4PY7A 5EIQA 1PKOA 1FRGH 2ATPA 1ND0B 3O4LD 4NRXB 2R1WB 4OKVB 2D7TH 1M6OA 1N4XL 3BN3B 4Z0XA 1TIUA 4HC1L 2JCCF 5BRZB 5JORA 3R1GL 5HYSB 1PZ5B 2O61A 4RAUA 4PJEB 5D5MA 1NBQA 1RUAL 4JY6A 3S4SG 3IU3B 4R4NC 1MFEL 2P8LB 3P77B 2PO6B 4GW5A 2CGRH 2N7BA 3FRUA 3UEZA 5KSUA 2FIKA 4ZOAA 3HAEG 3TJEH 4XMKL 1MHHA 5J57B 3MRMB 5T3ZL 1JPGA 3ZMRA 1N6QH 2PYEE 2HN7A 1F3DJ 1OSZB 3H2WA 3OKLA 2N1KA 3R06A 4DAGH 2ADFH 1BZ7B 1MELA 5AZ2L 4HQQH 2ARWA 1A5FL 3WUWG 3ZDZE 2W0PA 5D70H 5K9QG 1I3RA 4UAOB 4DKFH 3BP5A 4R3SB 1Z3GH 5EIVA 1DQDH 2O26U 3VMNA 1MCKA 2ADJA 3AB0B 5ACZB 4DOHE 4HJGA 2XTJE 1ITBB 3TF7A 3TBVB 1IL1A 4WI6A 3RQ3A 3AY4A 1K5NA 1SYVA 5BZDB 1RI8A 2B20A 4X6CF 3VFPB 3TIEA 2LTQB 4HHAA 5T1LD 5IQ7L 3VFMB 1PEZA 3VXOA 3VWKA 2C9AA 4JRXB 1GIGL 4PJ7F 1C5DA 4H1LG 1IRAY 1ZS8A 1AGEA 5FHBL 1FVEB 3M8OL 3TN0D 1U6AL 3TF7C 3GO1L 4U0QB 3VG9B 1YUHB 4XPFH 1RJYB 1AP2B 4FXGA 3VD7A 5JHDB 4AEIL 1VENA 5B4MD 3CSBA 1MAML 3LRSA 1EK3A 2ESVB 2DYPB 1ZT1B 4NHCH 5HYQB 4P4KD 1TXKA 3K2UL 4ZQKB 5E2TL 5F7UA 3BZFA 3QRFM 5C8JA 3LS5H 5T1MA 3QAZC 4U7KA 4J8RA 4E5XA 4F8TA 4M1CD 3ZKMC 2ZCHL 4WEBH 4JKKA 2A74B 4X6DF 3QO0B 4NQDE 3O3EB 5CZXD 5D7IE 4LCCA 3M8OH 3RDTD 2X1PA 1HI6A 4C58B 4MXQC 2VZUA 3MV7A 4R7DB 3GGWB 3SOBH 5HGHB 5EZIL 1C5BL 1LO0L 5IQ7H 4G42A 1QSFE 2QQLL 2FLRT 3MC0A 1WC7A 3TC9A 1KT2B 3QXWA 3SHSA 4FQXD 2Y07H 4L4JA 3D1MC 3K80A 3KLAA 4N8CH 3VXNA 3G08B 3ULUL 1TVHA 2J4WH 4XNUL 5DK0B 2OR9H 3N1GC 4L1DA 4I3RH 5T5NG 5CCKL 4JY6B 4S11A 5I8EA 4HKJA 2OJEA 4QLRA 4FA8A 3H9YA 1MJJA 4HMDA 4XC3H 1MI5E 5D1ZA 3P11H 3VXRE 4PJ7E 1H5BC 3BKYL 3VG9C 4G9DB 1M05B 5ENWA 2Z8RA 4GAYA 1A7RH 2ITCA 3BAEL 3BUYB 5C0EB 1DLFH 2Y6SC 3WIHH 1JE6A 3EO1A 1U93A 5CP3A 5EBWB 1K4CA 5HI3D 4Z76A 2XZQL 5KG9A 4I3SL 4HQQL 5F1IA 5CKAA 5IB4A 3RTQB 3BIKB 3IKCA 3EOTL 3O0RH 4UZGA 1LEGB 1RV6X 4HKBA 2DMCA 3A6OA 5CIPH 4YDIH 5C70A 5FYJU 3D0VA 1B4RA 4QT5A 2JCCB 1HNGA 2FGWH 3IFPA 3O2DL 4PJEF 1D5MB 2WBJA 5IVZB 3MBEC 4YHML 1T66C 1CDUA 4U1LB 3O3BB 3GNML 3CFIC 2IGFL 4MAYB 4C56A 3U82B 2P49B 4PV9A 1HILB 2VAJA 4XVJL 3BIAX 1DJSA 2Z91B 3JV4A 5D96C 4JRYD 4LOUD 4UDTA 5C2UB 1RIUH 4RNRB 3DUSA 4AENA 4JFFA 1GZPB 1IGJA 2ENYA 4OV6F 1KPUA 1IILE 1XGQB 1YY8B 3FB8B 1KEMH 2PYFA 4JDZA 4OZGB 3MQIA 3UDWC 2P5ED 3LEYL 2RBLA 1EX0A 5DZNA 3SGEH 3QXAA 4PG2A 1KLFA 3FO9B 2A83A 4XXDA 5DEGA 4WV1B 3DXAE 5ADOL 3QEUB 2AJYL 1CK0L 4UDUB 3TA3B 4P2OB 5SWZD 5MI0C 5DVKA 4UT7L 4PRPE 4RFNC 1QEWB 3MRIB 4GAGL 5ICZA 1LP9F 1JYNA 4RMWA 5IROC 2UV3A 4NM8L 3VRLF 4Q6IB 4KRNA 2WK2A 3DMMB 1QBAA 5FCSH 1F3RB 2PO6A 4M8VA 5IB3A 3GSWA 5DFVD 2DQUL 1UM4L 1TCMA 5EU5B 2LAGB 5DFTA 5JO5A 3G9VA 4QHNB 2XA8H 3SKNB 3DI2B 3ZT5A 1AQKH 4Z8FH 3EFDH 3A6CH 1IEHA 2Y25A 3OSKA 2G5BB 4DGVL 1S8DA 2J8UA 4PLOB 2B0SL 1IKFL 4JFYA 3RVVD 2OP4L 2BDNH 3CC5B 5C0AD 3IYLW 4QRRB 3SE9L 1N0LA 4JFFE 4JM2A 1LK3H 1A3RL 5IB4B 2V9RA 2VB5A 1Z9MA 4HK0A 4IJ3B 4NM8H 1KJ2A 3J8F7 1G6RH 3IB4A 1BIHA 4Y5VA 4LGRB 3BESR 1QFPA 4Z7WE 3QHFL 4LHUD 3RVUD 4OFPA 1IEAA 4JZNB 3T3PF 1DANU 1K85A 2F53D 3BD3A 4GSDH 4NZTH 1IT9L 1JRHL 5BV7C 1BVLB 1NBVL 2HT3C 2BVOA 2P5EB 4CDGC 3PGCA 4OCWL 3TPUA 4WCYL 4Y5YC 3O6FC 3ZKXB 3QIUA 2FX7H 2JELL 3VXTB 1PG7H 1ZXQA 2X4RA 1S7RB 1K5NB 2IBGA 4Y19E 1NGPH 3Q1SL 4O5LH 5TPWH 4DCQA 3G04A 4ZTOL 3U48A 1QBLL 4ZOEA 1ZOXA 2Q1EA 2IG2L 5F3HA 3BQUA 5GRVL 2H26B 3QA3B 4OCRH 3DGCR 4NGHH 3QNZB 4OCYL 3M17A 5C86A 1M05A 4ODVH 3CFJA 1U42A 3OJDB 5I1AA 1CDHA 5GISL 1MHHB 1NQBA 2NQCA 5FYLL 4ZS7H 1DBJL 3MRKB 3D0LA 5IKCB 2Z92A 3LHPH 4X98A 4D0BA 3T1FA 4WTXA 3HE7D 2B5IB 5IM7B 4K7FB 4LP5A 3ZHDA 3ELAT 2R0WH 5CBEB 1RK1A 4PRBA 5BRZA 3TT1H 1YMME 3IDYB 5FYKD 4U1LA 4PR5B 3D18A 4WW1B 1EFQA 3QHTC 5K33A 5T5NF 3K8LA 3P4OB 4G6FD 3WIHA 5IVZA 1OL0A 3B5TA 1INEL 3EJYD 5GGQL 5IFHH 4IMKA 3O2VH 1LQVA 1QSFB 3FONA 1LE5A 2Z8SA 3DROA 1HXYB 1EERB 2F8OA 1J1OL 4G6KH 1LEGA 1G7HB 3T77A 2HLFC 1JTOA 5JDSA 1CXLA 4NPYA 5HHPA 1A3RH 5EU6D 4I9WD 1Q9OA 4KK8C 4BKLB 2VUOA 1DE4A 2AJ3B 4HCRA 3QDAA 3DYOA 3TO4D 3CH8A 1QO3A 1LO5B 2DI9A 1A6TA 4YXHH 5T33H 4H20H 1KB5A 1I1AB 2EYTA 3ZTNH 5DQ9B 1DBMH 1NKRA 3KJ6L 1DEEA 4PJDA 1XEDA 4JRXA 4YFEA 4DK6A 4J2XA 2XQYK 1KIRA 4ACPA 3LKRA 4GW1B 1AIFA 2MTPA 2BNQD 5BW7C 4XNMB 2AK4D 3LMJH 4JDTH 2HTKD 1XFPA 3RI5F 4XWGH 3ROLB 1EEYB 1MIEL 3EJZD 2EDNA 4HS8H 4EI5C 4X83A 3LN9A 4OKVA 1ES0B 3MO1A 1NUGA 2GUOB 3L5WB 1RVFH 3TWCL 4RSVA 4LSRH 3IDNA 5FUOL 1FYHB 4O5LL 2EE6A 4IOFC 3HUJA 5A2LH 2BVYA 2H26A 3HI1B 5FYKU 4AIZB 3QXAB 4XBPA 4OD3H 5C0IB 5GSVB 4WFGD 5HGBA 4BH8B 1S7RA 4J3WA 2VKXA 2VDRH 3U30B 4MAYC 5T3XL 1KPUB 4UBDD 2NY6D 1YUHA 2ZJSL 2AK1H 2V17L 1N2RA 3UBXB 4HLJA 5IGXL 1NGXB 3GDBA 5MENE 4LRNL 3FB7B 4GBXB 2UZIL 4KPHL 1INDL 1UWGH 3OF6A 4QKXB 4ELMA 5E8EA 2VXTL 5EBLB 5F7EH 1PKQE 3QDJB 3BP6B 3ULVC 2R1WA 3T0XA 4KJYA 4G9FD 5EBMB 4Q58C 4L3EB 2P43B 4HHAB 1YC8A 1GGBL 2P24A 5CP7A 3VGGA 3SDDB 3LDBC 5K9OB 3BEWB 2R4SL 5FYJL 2VLRA 5TF1H 4MXVF 2R69H 5MERB 4BQCA 1CS6A 5ISZB 4HIJB 2VSCA 3EYUL 5K93A 2PTUA 4K23L 2WP3T 5E00A 3PWJB 1U9KA 5DHVH 3RTQA 3GMMA 3U1SL 4JFYB 3UTZB 1LMKA 5FYLE 1KFAL 1UT9A 3V6ZA 2M1KA 4YX2H 3W82A 1FAIH 4HWEH 1FNLA 3DMMC 1ONQB 3UC0H 4XAWL 4I2XE 5GGSA 4X5LA 5DF0A 1DVFB 2F53E 2ZPKH 1JPFA 2H2PC 3SGEI 2XZAL 3R4DA 4IIQA 4B0MM 3ARGA 4FRWA 4MQSB 3CFBA 5FYKE 1W8NA 3GHEL 1B0GB 1FBIL 1BP3B 3IDJB 5CGMA 5MEOB 3EKCA 4U6HA 5JW4R 3IU4H 4PJIB 3I2CL 1JF1A 3QPXH 3RDTC 3VJ6B 3BGAA 5GRJH 3SKUD 4LCWD 3RWHB 3FB6A 2FJFA 2F9BT 1AGBB 5CMAB 5E4IA 5IESH 1I8IA 3VFGH 4M02A 4HS6B 2Z8VC 2VC2L 3DTXB 1RZKC 3FO9A 5DHYB 4IOSD 4WO4B 2YA0A 2R15A 1AO7D 5TGBA 4YAQA 1U2CA 4KQ3L 5EUKA 2FH8A 5CJ8A 2CRMA 5FHBH 5CCKH 2XZZA 1EFXD 1IEBB 4K9EH 5L8JB 4JQVC 5EZIH 3ZYIA 4GO6B 5I18H 2GIYA 2XZAH 3VXSD 5ITFA 3C5ZA 3QPQD 1CG9B 4MA3B 1T2QH 5KS9E 3S3PA 5JLZB 1EJ6A 1TCRB 3ARFB 1EBPA 3V6BR 1ADQH 3IF1A 1ZVYA 3NZ8B 4HBCH 2CKBB 2VYRE 3S5LG 2GJ6A 4PRIE 1EEUA 3WJLC 4GG8B 4LCUA 2XRAH 1T1YA 1XMWA 4G6ML 3PP3K 4IS6B 4Y5VB 3UTSA 4HZAA 5CINH 2EEBA 2BMKA 4U6VH 1K6QH 4DW2L 3QDGB 4QY8A 1AQDB 3BMWA 3CUPA 1X4ZA 4PJGE 5IHUH 3WLBA 4GG6F 3MODH 4XP1H 4QRRA 1DL7L 1SVCP 5GSRB 1RJLA 3KXFB 2XTJC 4YHLH 2H32H 4G9FE 1N7ML 3TT3H 4XB8A 3PUCA 1CD9B 4HJ0C 2W9EL 3D69A 3T4YA 2NZ9D 2EKSA 4J12A 3AS1A 2R9HD 4FQ2L 4NO2A 3QJFB 5F6IC 3T3PE 1QLEH 1I7ZA 4P23C 4LPYA 1AR2A 4V2CB 4YUEL 4XNMA 3RU8L 3HAEH 3L3IB 4XCEB 1DQQA 2ATKB 3P0YH 4QWWC 1RZGA 5JORB 5C08B 2Y7QB 3KPNA 2Q8BL 3T0WA 1U8LA 5IROA 3CFJB 2PCPA 1Q9WB 3MA9H 3U9PH 1AO7A 3HZVA 4FZEH 2Q76B 2BOCA 1JUFA 1BBDL 2V2TA 1MRDL 4CBPA 3GBNH 3GSRA 1X6NA 3D25A 4K3HA 2AERT 4K9EC 2X1OA 1HH9B 2IPTL 5IEHB 3NIGE 1L9NA 3REVA 1YPZB 5C9KA 1N3NA 4XH2B 1TZIA 3DSNA 1EXUB 3K1KC 4JDZB 4X80H 5ISZA 5MERA 3QHZL 2UUDK 3HC0B 4HUUA 1RK0A 1QACA 2DM7A 3KLHC 4QRUB 4Y4FD 4NT6A 3U7WL 1XH3B 2Z93B 4M6AA 4GJTB 4QXUH 4Y2DC 3VRLE 2NY0B 1OHQA 2BVQB 3Q6GL 5EB9A 1JZ3A 3UPRA 1IC7H 3ARBC 4JFEB 2Q8BH 4UTBL 1A2YB 1JNHB 1KTLB 2EYTB 5IM7A 5HDBF 4N90E 3GMOA 2C5DC 5FKAB 3RWGB 1OQXA 1A6VL 3QNXA 4OFVA 4K7PH 3IDGA 1W0VB 2J1KA 4NC0B 2AEPL 2Y07L 4N8CL 3IFOB 5C6TH 2VLRD 1DBBL 2OI9B 2JIXD 3S4SA 3QHZH 4D9RE 1HINL 4AT6A 2DQGL 4R0LA 2R1YB 1YECL 1HHIB 3MLRH 2V2WB 1JRHI 4PJBF 1YMMD 2F74A 4OZ4A 1FVDB 2IAMD 1RUKL 3G04B 1D6VL 3LOWA 2DM2A 4FTVE 5IWLA 3DNKA 2EDEA 5GRZA 1KB5L 3VWJA 4FN0A 4PJGB 1FIGL 2Q6WA 4CGTA 1Z9OA 2K1MA 3VH8G 5HDOA 4O2FB 5HYJE 1T1ZA 4BK4A 3ARWA 2VLKE 3KXFE 4RAUB 4DK3A 1JPTL 1OCWH 1RZ8A 3LKRB 5J9PA 2KL6A 4WI5A 3TFKD 2X4QB 3AREB 3QIWC 4HUXB 4Z0XB 2YPVL 3QQ9C 1LDPL 2D0HA 4AG4H 1UG9A 4YHOH 1S7SA 5IB2A 3QIBB 3OX8A 4D8PB 4JFHE 3RVWC 1JHTA 3DO3A 1NJ9B 4XX1E 1A7QH 2CLRA 2O5ZH 4C56E 1EO5A 4L9LC 1BQHG 4UIKH 4DN3L 3SJVA 3MXVL 4DWHA 2B4CC 1QFWI 5F9WC 4U7SA 3T77B 1OTSD 4LKCB 3S5LA 1IC4H 4OIIH 2OI9C 3QDGA 1RJCA 4KMLB 4NOFA 4LHUG 4M3JA 1V3JA 3EHBD 5ESVB 2VXQL 1CIDA 1VDGA 2IFGA 4X6BB 3TBSB 3EBAA 1C7SA 1N59B 4LGSB 1ACZA 4M6NL 4U1MA 2AS5M 3RL2A 1ZS8B 1P7QB 4PIRF 4NNYA 3IXTA 4J4PC 3C5SB 4JN2A 2IANA 2ICWJ 4M1DH 3ZE1F 4X7EC 4AG4L 2C26A 1CE1L 3TT1L 1KBGH 3FQRA 1S7WB 3EYQD 4OCYH 3BSZL 2VABB 5GZOC 3DRQA 5TPWL 4P4KB 2EE9A 4ODSL 3P3YA 4PREB 1A6ZA 4ZTPH 1MJ7H 3TCLB 4U3CA 3MRLA 2FD6H 3DO7A 4MX7A 4WEUD 2ICEB 2W07A 3CSPA 3LKOA 2AEIT 1OPGH 3S36H 4KRPD 1B3JA 1IAMA 2NY1C 3BP5B 4R3SA 4N0CA 4QOKB 2IMNA 2GTZB 4XRCA 3SJVB 4TVPL 4G3YH 4UQ3A 4KKBD 1MLBB 1J1XH 2IH3A 5FGBA 1JWUB 1HINH 3WEXB 3IXAA 2VL5A 2PCPB 1H15A 2XZCL 2ESVE 1BZ9B 3WO4C 4BQ9A 5IJVB 1RUKH 5L9DL 1MCWW 2G75A 4P3CL 2Q3AA 5I1HH 2DDQL 1DQQB 4A6YL 4UI2A 2WUBH 4NQDB 1DCLA 1VGEH 1DQLL 2NY6C 1VEMA 4N0CC 4B41A 1MWAA 3IDIA 2HVKB 3O8XB 5IF0A 1MRFL 1INQB 4JAMA 1OP3H 5A2JH 5E2WL 4KWUA 5FA3B 4NKMA 3SDXA 3ZE1E 1LHZA 2CKBL 3G5YB 5D7JB 4LK4A 5J1SC 3T4YB 3PHOA 3H9SB 4K7PX 1KJVA 4FXLA 4C83A 2VLKB 3TBTA 3VFSB 2IH1B 4ZSOB 5DHVB 4UDUA 4HKBB 3TA3A 5DJXA 3O9WA 4EIZC 4KK6C 4WHYG 3BE1L 5FGBC 4PV8B 5DURB 4D9LL 5DQJA 4J8RB 3BRDA 3IDGB 1MI5B 5E4EC 4NRYB 4OCRL 1KTDB 5CP7B 1SBSH 5JA9A 1NAMB 1KB9K 3KPPA 3QNXB 3WFDH 2I27N 5BZWB 3SCMB 3MZGB 2BVQA 1WAAA 1XGUA 3QIUD 5GRUH 4MS8A 5HGAB 3JZ7A 5CZXC 1JNHA 1UEMA 1FYTA 3LVEA 3UZVB 4QHNA 1QSEB 2O5XH 3FT4B 3MJ9A 4LRNH 1A4JA 4LASL 3A6BL 5IVOA 4LHUA 4R2GC 1Q9KB 1BFVL 2CLVB 3QUYC 1F42A 2BCKA 2DYPD 3MCKA 4KRMB 2X1QA 3VWJB 5CILL 1G0YR 3KR3H 1R5WB 5E2JA 3GSRB 3HE6C 4QT5B 4OQTA 1N64L 3KPSA 1RIVH 2PW2B 1TZIB 4LVEA 3EDEA 2H3NB 1O5DT 1YEEH 3QUXC 1AC6A 4LCCB 4XB7A 2P8MB 15C8L 5EO0A 5L2KA 1T21B 2VZSA 4G6KL 4JRXE 4EQ2A 1WBYA 4WO4D 1HYSC 4XPHL 4DKAA 2IAMA 1U3YA 1AGBA 1T5WA 3T0DA 2DQHH 2X41A 1MJJB 5D1ZB 3RWGA 2ICWB 5FKAA 3S97C 2OJEB 4ZFOA 3ULVD 5IFHL 2AKRB 1MH5A 4J3OC 3A6BH 4MA1B 3LD8C 5GGUB 5BV7B 4PUBL 1L0YA 1EUUA 1E0OB 1CD1B 1CLYL 4FNLL 4N90D 4MDJA 5DZLA 5GS0D 3H6JA 1LP9A 2ZUSA 4KJQC 2Y23A 5KAQG 2Y6SD 2ZP0T 1NAMH 3K8KA 3LCYA 2D4FA 3SDYH 2W65A 1BM3H 4LIQL 1WT5C 3LH2H 3QFJA 5TQ0H 2J12B 2EIZB 4K2UH 4BFEA 5C71A 3BIBX 3KPMB 1FZOA 4JFQB 5E5RB 1AC0A 1T1YB 3EO9H 3JWDC 1UA6H 3KYNA 4X4ZA 4ODBD 2AEQH 4FQ1L 4DEPB 4POUB 5T1DH 1S3KH 2BNRB 5C6PB 4JO4H 4XNZC 4PGEA 4G43A 2ZKHL 3HN3A 4JRYA 4HJ0D 5FO8A 1LO0H 1CICA 5ID1A 3GUTB 1UJ3A 2JK5B 2OM5A 4CN4A 3F7YA 4NP4L 5D7LE 5DSCB 1KB9J 2HFTA 4K94C 1PD6A 4FFZH 4OCSL 5I66B 1YEFL 1NLDH 1UZ6F 1NANH 1CWVA 2GTWB 3V0AC 4YHYB 4JREC 1JFQL 1UXSB 1AXSB 1DZBA 4NKIH 3O41B 1UYWL 1KXTB 2BVPB 1WSST 4GLRH 4XNXH 2IQAB 2WAHA 2PTTA 2E8ZA 1YDPB 3HRZA 2QBWA 3QJFA 3T0ED 3UP1A 2ZZUT 4LLQB 3QEHB 4KUZL 4ZXBA 5EU3B 4MD0B 4FFZL 3ALWA 1K6QL 4LLDA 4K3GA 1T6VN 2OX5A 2C1PA 3HPLB 2A6KB 4R7DA 4XNUH 1FCGA 3EO9L 3NFNA 4F33A 2QADC 1ZKAA 3SGJA 3R1GH 4NO5A 1WK0A 2YK1L 3QPQC 2BOBB 4U1GB 3MRJB 4OB5L 5L7XH 4YXLH 1S9WB 1BF8A 4K7PY 2Z31D 4L4VB 4YQXH 5D1ZD 4DQOH 3NA4A 4QWWD 4U6TA 5FYKL 1FRGL 2PXYD 1A1OA 3UTQA 4XAKD 3WIHL 4U6VL 2D7TL 1TPXB 3ARSA 2XZQH 5IW1A 3SBWC 4XPTH 4U05A 2NX5A 3R8QA 3PGCB 3OKDA 5CUSH 5C0JA 3MLZL 4PGJA 1SY6H 1W72B 3MRQA 4OB5H 4UOW0 3P0YL 3SJVE 3S34L 2A6JA 3FQUA 2XT1B 4G7YH 2VR9A 3K2MC 1VADB 5DTFA 2GJ6E 4KVCL 1B0RB 4M9OA 2CDGA 5J12B 2ADFL 1W72H 2HKHH 3HR6A 5DJCA 4NN5B 1S7TA 3TBYB 3REWB 5T1KB 5L7XL 3GHEH 2X7LB 4XCCL 3RY6A 4UNVA 3X3FL 4Z7QE 4HLZG 4XZUB 3UZEA 1FL3A 4PTTA 2VL4A 2R2BB 1KIPB 4QHUA 5D7SH 3TN0A 2X44D 5KTEH 5FA3A 5MEQA 3MJGX 3UBXA 3PHQB 4ODHH 2CK0L 1PYWB 3U7WH 4NHCL 2NX5D 5DA4A 3T2NL 3RGHA 3UTTB 1TPXC 4LQ1A 3W0WE 3GSWB 2FSEB 4OJFL 1P4IH 2V5RA 3R8BB 1FGNH 4V1DE 4U1KB 4ZFOB 2P5WD 5HI3C 1FE8L 5IB1B 3MFFA 4F2MB 3NPSB 1BFOA 1ULVA 2RJMA 5CFHA 5FDWB 4M7JL 4YBQC 1KXVC 5CD5C 1YEIH 1I1FB 3M17B 4DGVH 4K7PL 1WTGT 3RKPA 1VSCA 5I71C 4S1SL 3MLUH 2A1WH 4YH6A 1JP5A 2GUOA 3L5WA 1D5IL 3ROOA 4LCWE 3RJQB 5J56B 1L7TL 1HOCA 2FLBT 5IMOA 2XWBA 2V2XA 4ZDHB 1RZ7H 5DMYA 2UWEF 4C55A 4CU8A 5CZVL 5A16B 3N1MC 1KN2H 5FHAH 4JO3L 2CLVA 3GIVB 4HWZB 3ZYZA 3P73A 4L3EA 1UFUA 3VGDA 1A7RL 3BAEH 5L0QC 3QXDB 3H3BC 2ZSWA 3MMEA 3WS3B 2IPUK 5EOCL 3X13B 4UTBH 1LO5A 1ZHKA 4D0DB 4M7LL 1EPFA 3QUYB 4O51B 3RHWK 5KSAB 3PL6B 4E41E 4NQVA 1N59A 3TYGH 2NY4B 5GIRB 5CJ5A 5CHNB 1B4JL 4X5WA 1NMAH 3ZE0E 4NOBA 4DZBB 5GZOD 4JHBA 4S1SH 2FHCA 4BFGA 5T3ZD 3B9EA 4DTGL 2WLYA 3VFOB 4X4YB 2KKQA 4JFOB 1FNFA 1SEQH 1U3HB 4MMZC 4NUGL 4JKPH 1XR8B 5INCB 1SMOA 4M8QA 5H2BA 4LARH 5E7FA 3OAYK 4XVSH 5DHVA 5FUZL 2DQIH 1FFNA 25C8H 1R24A 2CLRB 4S1RH 4HAFA 5DZOA 5JHDE 4YBHA 3I6GB 1BECA 1KB5H 3D85A 1H5BA 2AABL 3KDMA 3OPZL 1SVZA 4ZPVB 3V95A 3WBDA 1ES0A 4BFIB 1SEQL 4NO0A 3JTSB 5EC2B 2C7UA 2OQJB 2HVKA 2YPKA 4YR6B 3V4PH 5JXAH 3E3QC 4K3EH 2I9LA 4OFYA 5ACLA 3EJZC 2R39A 3QRGH 4RQQA 5HGDA 1OAQL 3L3JA 2EE2A 4NYLA 1KCUH 1G84A 2FWOB 5FM5O 1BOGA 1VFAA 4JLRB 1OD9A 4ZTPL 1HH6B 1G9NL 3MV8B 1ZA6B 4HJJH 1KEML 1S5HA 2PW2A 3O2VL 3S35L 3UTTE 5GGRA 1GHFH 1KNOB 4MAUL 4YC2C 4ZYKA 4P9ML 3VGAC 3WV0A 1FZMA 3J7HA 1QQDB 1VGEL 3KPSD 4LRIA 3LKPA 4WW2C 1QHOA 3WL9B 2B1AL 3P4MB 1OGAE 4KI5D 4MX7B 1MQKH 2DYPA 4CN6A 1NC2A 1RIUL 1LE5B 5BS0E 2FJHA 2QHLA 3QCTL 1I1AC 5GRVK 3VGEA 1U92A 2YD4A 3CFCH 3ECBA 4G5ZL 4NSKA 1R3JA 2XWTB 4KDTA 4GXVL 4YFLF 1J0HA 1H8NA 1QOKA 1LD9B 2QKIA 3FFCE 1Z0MA 1FVCB 4PV9B 2EXYC 3GRWA 2DQEH 5LAXA 3MLTA 1UVQB 3B9DA 1J05B 3KPPB 4TYUA 5DA0B 3UPCA 2EO9A 2XA8L 2I60H 2JCCE 2R23A 5JR1H 4Y1AE 1FGVH 2HTKC 4E41A 4PJBB 5GJSH 2HJKB 4ZAKA 1NMAL 1HQ4B 3FFCA 1DEDA 3FO2B 1UKSA 5HHNB 1LO4H 2V7NB 3B8YA 1J0ZA 3P40A 5I17B 1U8HB 3T0EE 1RURL 4OV5A 3EJYC 2NXYD 3DSFH 4NKMB 1M7XA 4ZYKB 5CBAA 4JANB 3VFVA 4FXKA 1RULL 5C3TA 3AM8A 3L3OB 5D1XC 6CGTA 3EO1B 5EBWA 2DAVA 2X4OB 4UMGA 1FNSH 1WEJH 4XVSL 4P2YA 1IC4L 1OSZA 2EH7H 2WNGA 3Q6FB 3OKKA 3OB0K 1CGUA 4UIMA 5ANMA 4GSDL 3CSGA 1U8MA 3NA9H 2XQBH 3V5HA 1QNZL 3BP7B 4J3VA 5C7XH 1IFHH 5LCVH 2GYSA 1F6AB 1YEEL 1DBKH 4R4FH 4OI7A 4L3CB 3O3DA 1I1YA 3RWFA 2VXTH 5F7EL 4OIIL 2YA2A 1EHLL 1BVKA 3FCTA 1BPVA 3K81A 5C07D 1EJOH 1A02N 2DQHL 1NSNH 5HGHA 5GS0L 2CR3A 1QFWM 3V7AE 1H3TA 2IANE 3WJJC 4P2OA 4GH7B 4S10A 5GSRA 2A74A 2QQKL 4Y19D 3RVTC 4P9HC 4QHKI 1P7KB 4IRSA 5KSBA 3DUSB 5C08E 3AS0A 1CGXA 1PQZA 1NFIB 4IRZL 5AYQA 1WGOA 4XMKH 3RVXC 2H32B 1AH1A 4PJIE 2IADB 3TBWB 1NSNL 3JUYA 3KR3L 1JGLL 3X13A 1UZ8A 1DDHA 4HS3A 4RGNC 5DGQA 1OAZH 1TZGH 4OT1H 3NZ8A 3LKSA 4MXWL 4M00A 4ZD3L 5JHDD 2BXZA 3D0VB 2BVEA 4LCWB 5IEKB 4HIIA 4O02H 1LEIA 1YPZA 1KCSH 3IKCB 5GS0H 2NY5H 3PWUB 4X7TB 2W38A 4ZS6C 3L3HB 2XG5A 5F1IB 3KLSA 1A64A 1U95B 4OFYD 4JO2L 1F3JA 1B6DA 3NAAH 3EGSA 4P2OC 3QI9C 4WO4C 1ZHLB 4Q6YA 4IRJB 1C7TA 5F1OB 4PGBA 3C6LC 1UKQA 4CU7A 1JPSL 4OCSH 1HH9A 5HDQL 4MJ5A 5LVEA 4I1NB 1RU9L 2ZSVB 4LU5L 5DEGB 5J8OA 2OXHA 1F00I 1N5AA 5JW5A 4PRIB 4LBEB 2GT9A 4ODXA 1Q0XH 2ITCB 5T1DL 3HI6L 4N0FB 1XIWA 4C59B 4Z7VE 1JPGB 4LNVA 5AUMB 3CLEH 3NGBB 3CXHJ 8FABB 3LS5L 5TDOA 4K2UL 2C3VA 2Z35B 3KDMB 2DQTL 2A2QT 4URTB 1ADQL 5FA4A 3MTRA 2I07A 2LU7A 2V9QA 5F93C 4JFFD 4U1JB 4F7EB 1C12A 5SX4H 4O58L 2A9NL 1BM3L 2L4OA 1NCDH 2D9QB 1FPTL 3BJLA 5EDXA 1FL3B 1GGYA 3T2PA 4JVPA 2C1OA 5BJTB 3IAPA 2QL1A 1YEJL 1CLZL 3CSYB 5D71L 5T1KA 1J8KA 4L3ED 1U8QA 1UACH 5DS8A 2WBJD 1UYWH 1U6AH 1ZVSB 4JRYE 4MNQB 3TV3H 5DC0A 4JHZA 4JY5H 1MHPH 4XPHH 5I18L 5I8KL 2Y4SA 5FAAA 2IPUG 1MY7A 1DLFL 3QQ4A 2UUDH 3TPKA 1OWWA 4N5EA 2H2SC 2Z8WC 1CLZH 5D71H 2G2RB 3RWCB 2OTWA 4XNXL 1R3JB 4DJMA 1CZ8L 3EYVA 4U3HA 4Y5XB 4Y4FA 2J6EL 1ZGLA 3SN6N 4ISVB 3OG4B 1X5KA 3ZHLA 4WU5B 2BSTA 4X9BA 4P59H 1YPZE 4HC1A 3D39B 3VH8A 4AEEA 5TDPA 3NFSH 5DI8A 3OKEB 4OZIE 2P5WA 3ERYA 3KYMB 4X9HA 1GC1L 4OIAA 3TN0C 2OTUA 4LEOB 4CDHA 3DX6A 3TM6A 3QO1A 2IFFL 4RZCB 3I84A 3DGGA 1RIHL 1AE6L 4OCLC 3MR9A 1MRCH 5JW3H 5IP4A 3P30H 5CWSA 2VXVL 2H8PB 2UZIH 1S9XA 2GITA 4U3XA 5H8DA 1N7MH 3R0MA 2DBJA 4NCC1 2JB6B 3WUZA 1QYGL 2JJTA 4ZXBC 1U8NB 5D2LE 5FIEA 1T3FA 1M71B 3RDTA 3C9NB 4NRZA 3UBXG 3V6OA 2IFFH 3BKJL 3SY0A 4GW4A 4I3SH 4KXZH 4C54A 1EV2E 4PJHB 4Y4FC 4JG0H 1E4XI 5EUOE 5F9WB 4V1DD 2EDOA 4K23H 3WIIH 3T0EB 2E7HA 1H8SA 3T4AA 2MQ3A 1C16B 5A2FA 3NCYP 4W6WB 1WWCA 3ULVF 3VXRA 4KTEH 4M8QB 2ORBH 5H2BB 2AV1A 1VHPA 4WWKC 1HHKB 2DJUA 3C6SA 3IDMA 5ETUB 1LILA 3Q48A 3RHWF 3E2HC 4KJPC 1GPOL 1LK2A 5MENB 4OTXH 1TJHL 1MUJB 1PKQB 4G8FA 4HIIB 1LEIB 5JXEC 2PXYA 2L7UA 4MDJB 4N8VG 4LCCC 2YR3A 3U6RA 4Y4KC 1UH3A 3IDUA 4DZ8A 4ZFGH 5F9JB 5CZVH 4HPOL 4XPBH 4LFHD 2GJ6D 3S3JA 4ZSOE 5I74C 5EO9B 4GUPA 2UWEE 3C6LA 3MRNB 2IADA 1K8DB 3MV9D 1IC7L 1MSPA 1U8JB 4HBCL 4ZXBD 3EDKA 5GSVA 1I3VA 4RGOH 2HMIC 5FUZH 4WGVB 3U0PA 3Q5YA 4XPFL 1IBGL 3MRDA 4XBEL 4YXLL 2XPGB 3BWAB 4O2EB 2BSED 2GAZB 3OBAA 2VQTA 4N0UB 3N1QC 1M7IB 1IGCL 3DX6B 3ZE0F 3HZMA 4P5MB 1U95A 1MY5A 3V0VA 3DPBA 4M7LH 4X4XB 2OR7A 2WLZA 3CGTA 1BX2B 4TVPD 3MROB 3EOTH 3V8OA 3IDIB 4LCWA 3JTTA 4MA8L 3RKDC 4ONGH 5E6ID 3WJLA 4GG6B 2HFFA 1Z6JT 3EOBA 2DD8H 4XVTL 3FQTA 3ZKSD 1YN7A 2V5YA 2B1HH 1I1AA 1NDGB 4MHHI 1R3IL 3L3GA 3SDCB 1KTKE 3DI3B 1BZ9A 4TULH 3X11B 4JZOA 5FGCE 1X5FA 4YDJA 3QFJD 1IGYB 4YBLB 1QSEA 2C3XA 2FO4A 1V7ML 4JN1H 4X6FA 1AD9A 3HC4L 3TT3L 4E0RB 4CJ1A 4X7SH 5DQJB 4X9IA 5ESQB 4RWHA 3S3SA 1MJ7L 1NAMA 4X99B 5F1NB 1E4KC 2VLKA 3TBTB 4QOKD 4Z77B 4R26L 2EDKA 1EEZB 2VR5A 3CDGA 4ZUWA 1FO0B 1MJUL 3L6FB 2DQIL 5DWUL 5C0CB 5FGSA 4Z7NF 1ETZB 2A1WL 2DQEL 2HT2D 3WN5A 3CCHB 4M5ZH 4QF1A 1VPOH 5GHWL 3S96B 2R0LH 5FA4B 1MQKL 4XPAL 2MPAH 1F6AA 3RZWA 3SKJH 3CU7A 1Y0LB 4ZO7A 4G5ZH 3WNLA 1FGVL 5E1AB 2D7PA 1U8MB 1U3HD 5DVOA 3L3DA 1D6EA 2ZNWA 3GJFB 1Q72L 1GHFL 4MAUH 3IETA 4JN1L 5DC9B 1MCWM 4RGMB 2AJYH 2N56A 3TH3T 3U4BH 4P3DA 3MUHL 4YHIB 3L7EB 4Z95L 2XFXA 3GI9H 1B0WA 1I3GL 2UYLA 4POZD 4TUKL 4RWYL 1T21A 2RCSH 4HGWA 1T0NA 5EORH 5I2IB 4LVHC 3CFCL 4JB9H 4Y88A 1XF3B 2UWEB 1I9EA 4APQD 2R2HA 1TENA 4P3CH 5I1HL 1K9TA 4GXVH 4WUUB 1LVEA 1HQRB 5B39B 5INDB 3TJHC 2X9YA 2YA1A 5KVDH 3PWPD 2X4UA 1QLRA 4XC1H 3HLAB 2C3GA 3U4AA 1J1XL 3P0VL 1IGFH 4FTVA 1MCSA 4PJAA 4ISVA 1F97A 5ECJE 1NEZG 4JFDA 3BGMB 3D39E 2EYSA 3A6CL 1R5IA 1P7QD 5IVXA 1NUDA 4L29B 4I5BB 2NY5C 1FO0H 2B0SH 4LPCA 3MRHA 1G7LA 1CDBA 1F4YH 1FG9C 4PG9B 4BH7A 1BJ8A 1DBBH 2HLAA 4FFYH 1RZIA 5HHMA 1FFNB 3VMOA 3RVTD 3WFDL 4G8IB 4JM2B 4QCIA 3T1WA 1FZOB 3WE6B 5T33L 4P46A 1WVZA 4CMMA 3O3AA 3FQWA 5MEND 1J88A 1IT9H 1JRHH 1UB5A 2NY0D 2HWZH 3HR5A 1J87A 4M61A 4JFEE 3QI9D 2G60H 1TJGL 5J6GB 3NCJH 1BVKB 4P9HH 4PJHE 5JQHC 2MNUA 3PE9A 2IF7A 5KSAA 1AD9B 3OMZA 1PG7L 4NGHL 3WDJA 1RAMA 1MFCH 5HD8C 2FRGP 3JV6B 5IJKC 5J9PB 2FL5B 4OZGF 1EJOL 3FL7A 5B21A 4NZTL 2J8OA 1RK0B 3BDXA 3QDHA 1IFHL 4PJ5A 2R2CA 1CL7L 3F58L 3CU1A 4G8GA 4APQB 4KTDH 4CAGA 2RAMA 4Q9CA 3VD5A 1I8MB 4U33A 1DTUA 5A2KH 3QIUC 2CMRH 4OD3L 4NJAL 3VXNB 3RUGA 4EN3C 4NWTH 2YC1A 3BDYL 1QP1A 4K94H 3U9UA 5LG1A 4OCXH 4PS4H 3RWJA 5AWNL 1RIVL 4WVRA 2IAND 3V4VH 4EI5D 5BMFL 1QR1B 3FO0H 4R0LB 3BQUD 1OPGL 3O6FA 4KXZI 3CX5J 4Y5YA 1UWGL 2NY2C 4MXWH 2DQTH 3ZT6A 3SE3A 2E7LE 2FSEA 4OCNC 1S7VB 3BDYH 2F5AL 2EXWD 3OZ9H 1X7QB 1RJZB 3WSQH 1JFMA 2E9BA 5C0GA 3QDGD 2Q8AL 3VXUB 4NO0B 1PYWA 1AY1L 3LDBB 2FATH 1FFQA 3JV4B 3MJ9L 4QRUA 1MCIA 5ITBH 5F7LB 4A6YH 3D3VE 2FB4H 3RTQC 4KTYA 1SYSB 5IT2L 2HH0H 5EUOF 3SKMA 2D31A 4PJXA 3DHJA 1FZJB 5C7XL 2DKSA 5IMLA 1TQCC 1YA5A 2CUHA 1ZHNA 1FNSL 2FEEL 4JO2H 3TYFB 1KTRL 3D25B 1OD7A 4L4VE 5FB8A 5KG9B 3X14A 2CDGB 4PLJD 5I8KH 5HHOD 1NCBL 2RB8A 1ED3B 2C4XA 3UTSB 2AV1B 3GMLB 3BT2H 3MJ7B 5FDWA 4XNQA 3G5YA 3W9EA 2IPKB 3QIBA 3VWJD 3F12A 2BJMH 4O51A 2JJSC 2ZUXA 4LLUB 1RVFL 2DICA 3TWCH 4X6CB 5EU4A 2JIXA 1CGYA 3P73B 2OSLA 2NW2B 4F58L 1RSFA 1YEJH 4YZFF 3DXAB 3LSOB 1J8HA 4EUPH 1H5BB 1CBVH 4JM2F 4G80B 2QQKH 1A6UL 2ZUVA 5HHQB 3O11A 4PJ9A 1MCLA 2OYPA 3RZCD 3WN5B 4JM4L 1FPTH 3Q2CA 3LN5A 3L6FA 4NKOB 1IGTB 2VZTA 5DUML 2WWMD 1T2QL 1NGWA 4X4YA 3O2WL 4R4ND 1JNNL 3LRHA 5SWSD 4JR9L 5I2IA 1MPAH 2J5LB 1PX4A 4P46B 4FQQA 4PREA 1FC2D 1RUQH 1UXWA 2W0FB 4W6YB 3LQAC 3RKDD 1MREH 4G8IA 4Z5RA 1N0XH 3BH9B 5ISZD 5BXFA 3H9SE 1ZGLM 4IS6A 2NX5B 1GC1H 4MAYA 4HX1B 1BQHA 2QR0B 4EDXA 1W72L 3F62A 3RL2B 1S7QA 1MPAL 1OB1A 1U8KA 3PDOA 3F5WA 4UV7L 2YS4A 4KFZC 3MJ9H 4P2RD 3SE4A 5MEPB 5GRXG 1S7UB 2W0LA 4X7CC 3HZKA 3HPJA 3AXLA 3VRIB 3MACH 1S7VA 5F7WC 5BS0B 1QHPA 3LKPB 4XCNA 1A9BB 3BWUC 5DK3A 4U1IA 3EDFA 4LKXA 1D7FA 3EAKA 4JQVA 2K7QA 1CFNB 5DEFB 1S5HB 4OM1H 4PLKC 4YBQD 2YSSB 2GJZA 3MJ8A 2NY7L 3U9UB 4OJFH 3P2TA 4TQEL 3RY6C 1G7PB 4Z7NE 3QNYB 1LE9A 1KFAH 4Y16C 4HIEA 5IG7A 4Q9RH 1F3DH 3KPRB 5KVEL 4NQEA 2ED9A 3MA9L 1D5ZA 3U9PL 3B6SB 2ZG3A 2I26N 4HPOH 2SEBA 1NDGA 4K8RH 3KWWB 4PB9H 2JIXB 1I8KB 3L3DB 5C2BH 3B9KB 3SO3C 3WD5H 1G9NC 3P9LB 2Z31B 5FO8B 1YY9D 1ZA3B 2R9HC 4NKIL 5D7JC 2LVEA 1N5AB 3TO2A 1OARL 5EC1A 1RZ7L 4P5KA 1Y6KR 4NNPL 2VE6A 5HSFA 3IRPX 5EA0L 1F6LL 4RDQG 2PETA 3VDBA 1B2WL 1YC7A 3ZDYE 5LGJB 2BCKB 4IDJH 1JPTH 4KGJA 4JFDE 2A6DB 3H7BB 3JSSA 4HSQA 2YPVH 2ZUTA 5BO1H 1YJDC 5C0BD 4NNPH 4N68A 3O41A 2AQ3A 4Y16B 3RNKA 3TIDB 4EIGB 1QTYT 2CKBA 4MHHG 3S34H 2R0KH 3FMGL 5LAXB 5FHAL 1BLNB 1N6VA 4CRPA 1OP9A 5JA8B 1TVDA 5I66A 5GGUA 3LQAL 1BQHB 2WQRA 3KS0J 3MV8E 2DLFL 4LCYB 3O4OC 2UY6A 4U1SA 5CUSL 3IVKA 1A7NL 1P7KA 2FEDC 4ODUB 1YYML 4QNPE 3BXNA 5E9DB 3OKYA 2CO7B 3L5IA 2HT2C 3ARXA 3ZTJH 2BNQE 5D7LB 5FEBA 4U2YA 4KVCH 5DJ2B 5D2LA 5LGHH 5BRZE 3I02A 5D5ME 3RPIA 1BZ7A 3I50H 3SDXB 1ZA6A 3HI5L 3V6FA 1LP9B 3QT2A 1GVIA 4HH9B 2MHAA 2DLIA 3ARTA 3HMXH 1XF2B 4PJ9C 2M2DA 3ULUC 3ROLA 4UBDC 4LSVH 5CBEA 2DD8L 4XVTH 4LNRB 2IQAA 1KUMA 2XA3A 3MA7A 5ERWA 4Q9RL 4JVWA 3T1FB 1U0QA 3BRFA 1G9NH 2G9HA 2PR4H 2EC8A 3CFBB 3RIFF 4PTUB 4P23D 1QLEL 1BF2A 2VLMD 3VFWA 3H8NA 5IJVA 3M07A 2ZCLL 3OKKB 3EYFA 4NBXB 1A6TB 1MJUH 1ZWIA 4MZ3A 4NKDB 5IMKB 4FZ8H 2IPTH 4HIHB 4G43B 3PGFL 4NC2B 2X4OA 5DQ9A 5E6IB 3O6ML 3GB7B 4FQLL 2Q86B 3QULA 2GKIA 2VLLA 3MJ7A 3PF2A 1G7HA 4RZCA 2R8SL 2EDBA 4PGZA 1ORQB 3QJHB 2ED8A 2YEZB 5KN5A 5HHPB 2F54A 5JDSB 1UM5H 3NZHH 5SX5H 1WBZB 3DIFB 3NFPB 1HHHA 3PWVA 5IQ9B 1HCFX 4R2GD 4U6YA 5DJAA 4IEFB 4YGVA 3QEGL 3QEQB 1NCCH 1INQA 2BVTA 4H8WL 3VFNA 3LKSB 2W60B 2CKBH 3WHE1 5F7YC 3O6LL 2DLTA 3ARFA 4JB9L 5IWLC 5DRNA 5IR1B 3UX9B 4X98B 5D7LD 1A7BA 2ZUYA 3FT2B 4IRJC 4WFFE 3VXUA 3QFDA 5AUMA 1QNZH 3WN5C 4Z95H 5A16A 1D5ZB 4XP4L 1KTDA 4WY7L 5EZJA 3LS4L 1CCZA 4L4VA 4JKPL 3BKCH 1G1CA 3KPRA 4LPVA 2V5TA 1MLBA 4N0YL 4PJAF 1TETL 1FN4A 4GQ9H 4BA8A 3H3PL 1X5AA 4U1NB 4MJ5B 1MFCL 3SDCD 1A6VH 5KW9H 4P4RB 1KN2L 3QUMB 1IKNA 5B8CA 3QDMD 4U1GC 4PJDF 2DLEA 4M62L 3NVQA 5F9OH 3CFDB 2C3WA 3TJHA 2LU3A 2GAZA 5F7KC 3DSFL 3GMQB 4OAWA 3U30C 5EC1B 1QRKA 4KJQD 4N1HB 3AFLA 1YQ2A 5FOBA 3FQNB 1S78D 4TSAH 1IQWL 3HPJB 1G7JB 5TFSL 3MRGA 5EU6A 1Q94A 4WW2F 4RGNB 4X7SL 4M5ZL 4WW2A 2VR4A 3S37H 2W92A 2CIIA 3RRQA 1JGLH 3MV01 2YWYA 1HHJA 1T4KB 2GFBB 4ZTOH 4X8JA 3ZO0A 3RI5K 1DDHB 4CMHC 4PRHB 4S2SA 1YPZF 5T3XE 1OCWL 2XTLA 3Q5OA 3LEXB 5EN2B 2APFA 15C8H 4LBEA 4FZ8L 3ES6A 4W70A 2OLDA 1A1MB 1MI5A 4XCFL 4HPYL 1CQYA 1XR8A 1EHLH 1FFRA 2CRZA 2HJLB 4MQ7B 4XNQB 5DD1H 4LKCA 3AS3A 3O6MH 3SDXF 3VDAA 5E00B 4Y8AA 1J5OH 1WWWX 3HE7C 4WEMB 4PY8I 3QCTH 3FHQA 5I6XC 4FQHA 1Y6NR 3OKNB 1OP3K 5IIEA 3RWEA 1G6VK 4OSUH 5I1CL 5EUOB 5HYFA 5KAQF 4PJ5E 3B2UC 5ITBL 4I4WA 4M6OH 4L4TA 3GSVB 4MNQD 3UTPE 1C12B 4XCFH 4OM0H 3E6FB 5F8RC 5ACMA 5C0RL 1T0MB 3QUYA 3QDJA 1SHMA 4KV5F 2EDFA 1AKJA 5T3XH 3SQBA 2MQ0A 2Q7NA 1N64H 5JR1L 4H8WH 2ZWLT 1WIOA 3I6KA 3DXAD 4EDXB 4HWZA 1MQ8A 5FUCE 2D7OA 4F7TB 1N26A 1M71A 3RDTB 4LF3B 1GGCL 4ZODA 2DF3A 5ILTH 2QSVA 5I1GH 4F9LA 3HLAA 4A2MA 2AEQL 2J3SA 5GGTL 4LSSL 3Q3GA 1VGKB 2F5AH 4Y4HB 4XP6L 3T65B 3SGDI 4J7RA 5T5FH 2KDGA 4H25A 5FYLH 1T22A 4ZOCA 1FDLL 5GJSL 2R69L 1JK8B 1MWAH 5E8DH 4MJIB 4UOJA 4PUBH 4KMQA 5HI4C 1HWGB 4U31A 4LRIC 3TYFA 1T7ZA 5FKPB 3IFLH 3VW3H 1MFBL 4TSCL 5E2WH 2GW5A 1DP0A 1S7UA 1H3UA 1YEGH 4KKNA 1OLLA 4N0UE 5I75C 1MVUA 2D3VA 4ELKB 1T7VA 3E2HB 3VXMB 5GGVL 1OP5H 4A6YA 1B9ZA 5C0DA 1RZKL 3QXTA 3I6GA 4ZMAT 4LLUA 1ZT7A 3BO8A 1LP9E 3SGJC 5BXFB 1G0XA 4XBGB 4ZNEA 4RRPA 4DKEL 1YEGL 4O58H 5D6DA 1U8QB 2JCCA 5CILH 5E94A 5HPOA 3C6SB 1RZJH 5ETUA 5FCUL 5IW6A 5FGCB 2P5EE 5AYUH 3ARDC 1Q9WA 3GSQA 4HC1H 2H1PH 3MSPA 1BOGB 1CFTB 3W11D 4Y1AB 2ATKA 2HJFA 1KGCE 4PJBE 5HDBE 1G7LB 4J1UA 1GC1C 1PSKH 5ITFB 5DMKA 4NQDD 3V5HB 4BQBA 4BFIA 1AJ7L 4OCXL 4PS4L 4UB0H 4B7LA 3HC0A 1AE6H 1T04B 1P84J 1WTLA 4UV7H 3MA7B 1CFQA 4JKWA 4Q6IA 2FZ3A 4EBQH 2HFGL 4JGMA 3G9AB 4XMLH 1EFXB 4DKEH 1FVDA 1K8IB 3G08A 5ILTL 1R3KA 1PVHA 1N0XL 3F7RA 1QVOB 2QSQA 2N7AA 1OTSC 4XHJC 1U8HA 1UKTA 1NAML 4FFWC 4M61B 1LEKA 5D2NA 5GRJL 2R2HB 3OR7B 3MV8A 1WV7T 4C56D 3SBWA 3MRRB 1XGRB 1FFPB 3UMTA 5L6YL 3O3EA 4QTHB 1MREL 3ZDZF 3VA2C 4EJ1C 4P3DB 2XYCA 2Z91A 2I9LB 5HYQA 5F96H 1Q0XL 1RZIB 5MI0B 4YR6A 4HG4J 3BPNC 4TSCH 2DM4A 3ZYJA 4ZFFA 1CYGA 4ZPTB 3E6FA 3MCG1 3OXSB 4PDCE 1SBBA 3MLUL 3GIVA 2HRPL 1CFSA 4JKLA 3RIFK 3K74B 4PYGA 1NL0H 1DSFH 1MIML 4OLVL 4FQJH 1NMBL 2NY3D 3RY5A 3P4NB 4GG6E 1FZMB 4RISH 5I19H 1CI5A 1AQDA 1P9MC 1K4CB 4PJDE 5KS9A 3ARGC 4OQ1A 1AI1H 4WENB 4XGZB 2NY7H 2W91A 3BKML 1A47A 5HVGB 1NJ9A 1HH6A 1T22B 4E0RA 2B2XH 4N5UA 2DB8A 2FWOA 2H1PL 3FOLB 1OARH 1T4KA 2GFBA 4K3JL 4AM0A 3MYJA 4GRWB 5IW3A 3EFFA 3TYGL 4N8PA 5IVNA 2F54D 1BREA 4OLZL 2XY2A 1YY9C 3ILPB 3TVMA 3ARRA 1ZLWK 2IJ0C 3V4UL 3VFGL 4X5XB 4I5BA 3GJFA 3QIWB 1NFDB 5KSBF 1IM9D 2EYSB 4ZPVA 3MBEA 4HD9A 4GG6A 3ETBF 4HXBL 5IMMB 2R29H 1GYAA 5IMOB 1HCVA 3B2VL 1HWHB 3CPLB 5L88L 1NCWH 4RISL 1IBGH 4OLZH 1FL6B 4P5MA 1V3KA 4KI5F 1OF2A 1FN4B 4WGWB 3KGRA 3O45B 4H1LH 4XNYH 5BVJB 5KANI 2MMXA 1GGIL 2UVEA 4NN7C 5A43C 3EZ8A 4Q2ZA 4V2BA 1A1NB 4X99A 4FABH 1UCBL 2QHRL 3MLZH 4WWID 4PFEA 1FAKT 3DVIA 2G5RA 1KJMB 4HIXL 4ENEC 2NPLX 4ZUUA 4UUJB 1BZQK 2R0KL 4G6MH 3MBXL 1CGVA 5AD0B 3NFSL 1FYTB 2XKNB 1KYOK 3FN0H 4JN2B 2VISB 1HSAA 2VLME 1A6WL 1T1WA 4QHLB 2Y36H 4LDEB 2VIRA 4YHLL 3O6KL 5L8LB 1N8ZA 5J13C 1J10A 3BX7C 2MWCA 3K1DA 3OKMA 4I2XB 2VZ1A 3WL9A 3IDYC 2BY0A 2EIZA 3NCFB 5BCAA 1Z9LA 2AXJA 1QR4A 5D5MF 4WEBL 3PWPB 5JXAL 2P44B 5DDHA 3OB8A 2FDBP 5JXED 4L8BA 1H3GA 3VCLB 1H3WM 3BP6A 4HGWB 3LPGA 3QWRA 1P6AB 3WDIA 5DYOA 3O8XA 3ZKNC 1EO8H 4PJGF 1NBYB 1P69B 3LKNB 3OAYH 1E4KA 4PJDB 2AJZA 3SY0B 2CLZB 4HXAL 1J0KA 4YEEA 3UTSE 5C0AB 3TNMB 5E8PB 3U46B 3GBNL 2NYYD 1MCPL 4ENED 3RBGA 1QO3B 4J6RL 2DTSA 3U4BL 2AJVL 2IAMB 2W60A 4FQLH 4JM2C 3FOLA 4M48L 4OD1H 3RVXD 2WIMA 4JANA 2P1YA 3MV7B 3F12B 3I9GH 5IV2A 3HI1A 2R2EB 4NUJA 1IQWH 3VA6A 1S9VA 3CIQA 1NFDE 4EI5B 3W2DL 2XN9D 1YEKL 3P11L 2B7DT 2HT4D 2JJVA 2NY2D 4H8WC 3MO1B 1D5XA 4O2EA 5D1QC 4NNXA 4GS7C 1MHCA 2EECA 2XIDA 1NDMA 1JV5B 5F97E 2HMID 4GAFB 4AL8H 4KHTH 3IVKB 3E3QA 2AW2A 4TTDD 2CUIA 3MNVA 1NFDF 4AMKH 4ELMB 5IBTL 4QRQB 5KS9F 3P9WB 4ZFOL 5K9KB 2GCYB 5KW9L 4RMQA 1P1ZB 4LPXA 4J6RH 4JFXA 5LGHL 1NEZB 4JFPB 4TULL 4PGEB 1MRFH 3RX8A 1RFDL 3BKCL 4JPVL 3SO3B 3HE6B 3BH8A 2A77L 4GBXC 2DTML 1F90L 1E4JA 1E4WL 3MV8D 4ONGL 1KCUL 2DI7A 3TZVA 4HV8A 5GS1B 5HHXH 3OPZH 1JGEB 3DTXA 2A9MH 1CTNA 3SKJL 1QKZL 1IGMH 1TVBB 3ULVL 1DBJH 1I1FA 3ESUF 3LN5B 4P2QE 3BZ4A 3FO1A 4F7EA 4LLVA 3EJJX 3MLWL 2VTFA 5A1AA 4L3CA 3HRZB 3KPNB 4BZ1H 5I1GL 4G80A 5HYEA 3S37L 3TNNB 5DD1L 1W0WB 1FG2B 1NBZB 4UT7H 1Z5LB 1OP5K 3EYVB 1YN6B 1Q8MA 3VFUB 3QBTB 3N9GH 4WHYH 5DLMH 4AM0B 1HKLL 1KV3A 4NFBA 4EUPA 1NCTA 4BFBD 4NN6B 4QRPD 4RMSA 3RWDB 4DVBB 3GUTA 5DMIL 1I9IH 1OAKH 4ODXB 1RHFA 4DOHB 1RU9H 1Z0NA 1BQLH 2DQUH 4BZ1L 4P0DA 1JN6A 2JJUA 2R2BA 1ZANH 4W6XB 1JYVA 1TZHA 4ZUTB 1A9BA 4KMTL 5GS2H 4HEME 4E9LA 3REWA 4ZO9A 2X09A 2DWEB 3B4NA 2VWEC 1XGYL 2GSGA 2Y5EA 2IBZY 3GKWH 3T8XB 1GXEA 3IDMB 4L4TE 3FQXB 4U1IB 5DMIH 4LLMA 4P9MH 2P24B 4KK9D 1D9KA 4XXCA 4EZMA 5DTFB 3L5HA 1ZHNB 5DJDA 3PDOB 5F44A 2BSTB 1KTLA 5EFIA 5LXGH 1JZ5A 5IB5A 1CD1A 1RQ5A 1RZJC 5CLWA 1OGAD 4KI5E 1REIA 3T4AB 1QRND 5SWSB 2I9TA 3KPSE 3U4EB 2EH8L 5J12C 3PDGA 4UUJA 1L0QA 4OFIA 1I8KA 4PRDB 2DL2A 1F13A 4JFDB 3HG1A 1UWXH 4D9LH 4Z5RB 2V2XB 4Z0BH 4HK0B 4I9WE 1BGXH 5F89A 3BIKA 1GOFA 2VO5A 1SBSL 3QNYA 4DGIL 3B3IB 5EIIA 1T6WA 1GJIA 1F90H 2GQHA 5F1SA 3NH7H 1T7WA 3U0TA 1JVKA 5K9JL 3AGVA 4HUVA 1BWWA 4OUUB 1R3KB 3OKEA 3HS0A 3T04D 4HUMB 5SV3A 2DQCL 3HTLX 1EAPB 3ALPA 4KK5D 5FV2A 2ZKHH 1N5YL 5I8OH 1AGCA 2HP4A 3DXAA 1U8IB 3BN9C 3QDME 4C56B 2E9IA 4Y7MA 4QRPE 5GGVH 1K3IA 4OGAC 2NTFB 3MRPA 1CFTA 2WWKT 4BJLA 3O9WC 5DR5H 4I48B 3TA3C 3QIBC 2QR0A 3CD4A 1WCBB 3LKQB 1T1XB 1JTPA 5BS0D 4FS0A 5DO2C 2ZUWA 1RZFH 1NUNB 3NCJL 4L9LB 3AMLA 2DKMA 1F4XH 4HF5L 4YDVB 4NQCE 4G8GD 1I7UB 4H88H 1INEH 4LSRL 5CGYD 2FR4B 4N5EC 3UTTD 4LP4A 1NCAL 1QRNA 4HFUH 3MRLB 1U93B 2ADIA 1OGAA 1FV1B 4OT1L 4X5WB 1G7MB 4OM1L 2M8XA 4NQVB 5KSAD 2KZWA 1S7WA 3IFNH 3Q5TA 1W72A 2QEJA 3MRQB 5AZEL 1HILA 5E03A 4LVOC 3WS3A 4WI3A 5I15L 3KHQA 4OI8A 5DVLA 1J12A 3HUJE 4QXTA 4M43H 1FFOA 5AWNH 4MNGE 4P4KC 4UIMB 4Q9QH 4YXHL 1EEQA 1JPSH 5EH1A 1WIUA 4GOSA 3TESA 4L3AA 3TBVA 4LVHB 5CJBA 3I3BA 4GRWF 4EVNA 4OLXL 4UILL 3ARBB 4QRPA 2Y72A 4MXQD 3QDMA 3WSQL 2ZSVA 3THML 2EDWA 5EOQL 3VXMD 3KJ4C 1Y18A 5L6YH 2D0GA 4X6DA 1WBXA 3QP3A 2UWEA 1CDGA 5HHNA 1P4BH 3SDAD 3OX8B 3JV5A 4D8PA 2EDHA 3DX9B 3FB8A 2YMXH 3DX8B 1RZKH 5KBNC 1VEOA 4EN3A 3L3JB 3LIZH 1S5IH 3NCMA 4IHOA 1U41A 4YHKH 2NY6B 2ORBL 5FGRA 2PKDA 2H6PA 3BGFC 3BW9A 4PJEA 4XBEH 4CADB 3X17A 3G5ZA 2E3VA 2QQNH 4APQA 4LSUH 4LSQH 2YHGA 4F8QA 4FQCL 2EZ0D 1CFVH 1OAUH 2EIBA 3DHMA 1CFBA 5CEXA 2M26A 5DRNB 5ELIA 4XX1G 3SGKC 4RBPH 3ECBB 4LQFH 2RFXA 5IB5B 4Y4KA 4FQJL 4XPTL 3D3VA 4NRYA 4AT6B 4MVBA 3VXUE 3QUZB 3AU1B 4U6YB 4CNIB 4YQXL 1U3HA 5B39G 2FECL 4MGXA 5FYKH 4Y4HC 1AI1L 1CGSL 2YEZA 1JUFB 3ES6B 4PRHE 5HTSA 2E7LA 5AG8A 4BH7B 5C0EA 2Y1VA 3LV3A 3U1SH 3N1FC 4DVBA 4OZHF 1CD8A 2HKHL 5JOPD 3NOIA 4K71C 3GB7A 3QYCA 5TE6H 3EYUH 5EBLA 3TFKC 3LEVH 5AG9A 3JWOH 3MUGA 2C3HA 4RQQB 5HGDB 4APQC 3UYPA 4JY5L 5EZLB 1GL4B 1FVCA 2OZ4H 3C2SA 2XN9A 5JOFA 1C1EH 3N0PB 2VLJD 4PJ5B 2X9WA 4OUUA 1IC1A 5I1DA 3R0NA 1FG2A 1NBZA 1X9QA 1BMGA 3VMPA 4PGDB 1WBYB 3JWOL 1NGZB 3JV6A 1BX2A 3DRTB 2CO6B 1NC4B 1PLGH 1YQVL 4DQOL 3QEQE 2XY1A 1I1AD 3QO0A 5JPMB 1RY7B 3HUJB 3QUZC 4L5FH 2W59A 4RX4D 1OAXH 1KLUB 4YK4B 4H1LA 5I16B 5IK3B 3QEHA 5TDNB 2PYFB 4AH2B 2LE9A 4BQ6A 4CMMB 1YMMB 3C60A 3IJHB 5C1MB 1FNGB 5I9QB 4GW1A 2D2OA 4WFHE 5DMJB 4Y5XA 4M93C 1QYGH 1F2QA 2UY7A 3VD3A 4FQ2H 4XCYB 1KJ2H 3BMVA 4JFXB 1IAOA 5ICYB 5GPRA 2ZSWB 3MMEB 5EFIB 1WAAF 2JK5A 1KG0B 3QQ3A 4JY4B 4I0KA 3SCMA 5TQ2L 4WTZG 4TOYL 3C60D 4LLMB 2W9DH 3D2UA 1OTTC 3JWOC 4P5TA 1WZ1H