3QI9A

Crystal structure of mouse cd1d-alpha-phosphotidylinositol with mouse valpha14-vbeta6 2a3-d nkt tcr
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
290
structure length
290
Chain Sequence
KNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title A molecular basis for NKT cell recognition of CD1d-self-antigen
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 80
structure length 290
sequence length 290
ec nomenclature
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qi9A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3qi9A01
1TTUA 1GRWA 2APBA 2ED8A 2IPKB 3O8XD 3AROA 3EZ8A 4O2CB 3MJ9L 1HQRA 3SY0B 3WXVL 2ZNXA 1ZT4B 2UUDK 4JM4H 4U33A 1DQML 1KLFA 4N0UA 1WT5A 2O5ZH 2WZPD 4J3SA 5IHZB 3RX8A 2CKBA 4KROC 1G9EA 4I0PD 1X5JA 4Y1AB 4YO0B 1T1YB 3WYRA 3PP4H 1E6OH 2MHAB 1YEJL 2CXGA 2I07B 3H9SA 4X5LA 3DNKA 3L3OB 2UVEA 4PJFA 1OTTD 5GGSY 3CMOH 4X7CC 2YA0A 2FJFA 3QUMB 2W92A 4PY7B 1JZ6A 5ISZB 4M5ZL 1P1ZB 4ZNEA 2GHWB 4FQXD 2DWEB 5JO5A 4W4OC 3LKNA 1AKJA 2P8PB 4GXUN 3SGKA 3ARED 1M7IA 2I9LB 1J1XL 5DD5H 1J05B 1I85C 2BRRH 5J6HA 3W9EB 1BZ9B 3N1FC 2F53A 5DDHB 5I1JL 4ZUSA 1CFVL 3IDIA 2YZ1A 2OI9C 5HGDA 4JZJB 4IRJC 3OAZH 3QO1A 4LLMA 2VITB 4M02A 1MCPL 1JNLL 4I48A 3D3VA 5EOCL 3C6LD 4HZLB 4LLAA 4UQ3B 5D7IE 4DN3H 3C5ZB 5DJ2B 1D9KB 4NKDB 5KG9A 1F4HA 3W2DH 2VQTA 1KJMB 4ZPVA 4MA7L 3JWOL 3WL9A 4NCC2 3QCUL 4Q6IC 4HAFA 2AJYH 4G8FB 4PBWD 5EA0H 2GJJA 5FYLE 4OLEA 2FL5A 1T4KB 2GTZB 4NHCL 3L7FA 2A9MH 43CAA 3KJ6H 1I9JL 4GKNB 3V95A 5DD3H 3LIZH 4FQ1L 2PW2B 5DQDH 5D6CB 4WEBH 1CGUA 3LKQA 2P8LB 1FVDB 4APQD 2VR5A 2ZSVA 5GHWH 2V2WB 3P0GB 3P4OA 5JQHC 3T3MF 3ISWA 2EH7L 2PYEA 1X5ZA 2HJFA 1TCRA 4P2RE 4F8QA 5ALCL 2Q3ZA 3ES6A 3KPNA 3MLXH 2AQ2A 4V2BA 1S7QA 2VLJE 2XZQL 4J3VA 4L4VE 2X42A 4LCCA 1RVFL 4LEOA 3C60B 1J8HA 1KTDB 3QUML 3QAZC 4N1HB 4KK6D 4CN1A 1T5WA 5JW4Q 3DO7B 1G7IB 3D85B 2NY5L 3GJFB 1JWSB 4ZS7L 3FFCD 2L7UA 3ESUF 2ARJB 3RU8H 3PL6B 3L6FB 3EOTH 3QFDB 4BQ8A 5DRWB 3WIFA 5KSVA 2BOCA 1NANH 1IQWL 4N0CC 4LBEB 1TMCB 1IC4L 4QHLA 3GHBL 3PWNA 1WZMA 1GAFH 1IGML 3IGAA 3FB8A 3RWJA 4WHTB 1MI5D 5CKGA 3GMQB 1NKOA 3LZFL 1BQUA 5K59F 2WQ8A 2X9YA 1CT8B 4KGLA 4V1DB 4WDIA 4HZAA 2XN9E 4WJ5A 3SKOA 3ILQC 4XNZC 2QKIB 3E2HB 3I50H 1NUNB 2YD3A 4O2EA 4JHWH 3RVXD 1FGNL 3JWNC 3VD7A 1CFQA 2VLRE 3UTQA 4MLIA 1UJ3B 2E7CA 4PJ9D 4PLKD 1XCQA 4XB8A 3DUUA 4QXTA 5C6PB 1RUKH 4IDLA 4KRMB 5E9DB 1CE6B 1U3HA 3L5HA 3ZDZF 4MA1B 1HOCA 2ZWLT 5TF1L 1ZLWH 1RK0A 4XWOD 2AQ3A 5D93C 3NA4A 3WD5H 4ZOCA 1LO2H 2XQBH 4OD1L 3EGSA 4GS7C 2C9AA 3T0BA 3DVFA 3UP1A 2WBJD 1YJDC 2Q76B 2HT2D 4XCFL 3GNML 4PJEB 3L1OL 1C1EL 3FQNA 5C0CD 4MQXC 3SHSA 4HIJB 4G8GA 1YEFH 5CEZH 5D2NC 5ERWA 4RSVA 4WW1A 3VI4F 2DMKA 3RWEA 2X10A 1BVKA 3OMZA 4M93C 5DZLA 5EU6B 5EU5B 1G0XA 4M6OH 2JELL 3RUGB 4GXUM 5I30L 3S88H 1U6AH 4OCWH 1FYHB 2JJUA 5J7CC 1RUMH 4I77L 5JQ6H 2NYYC 3KYAA 4TVSa 4U1NB 3RZCC 4Z6AT 4WENB 2HAZA 5L2KE 4LSSL 5EORL 1UWGL 2XWBA 2PO6B 1RURH 3V79C 2ZCLL 2QV2A 5F6IC 3B9AA 1OTSD 3MLSH 3I3BA 4UOW1 2P5EE 5L8LB 5ECJE 3MLTB 4LSUL 2VXVL 3KPOB 4TNWK 5E2WH 4JY5L 1MAML 1HI6A 1IE5A 5L7XL 2X2YA 5CP3A 2UZYB 4BH7A 4YXLL 1LEGA 4FFYL 4Y19B 3WO4C 2X1WL 2XT1B 3BGAA 4OCNC 1FCGA 4H0HB 3MCG1 4OZHA 4WGWB 5DEGB 3L3IB 3UCRA 4AZ8A 5F97E 4A6YL 4P9HC 1N6QH 3QEQA 2C1PA 4JZNB 4GRMA 1Y6NR 4G6JL 1O7SA 2CR3A 3GB7A 5DSCB 3ARFC 1CGYA 4WFFD 2A83B 1LK3L 4N5UA 4W6YB 5SWSE 4KGJA 1CLZH 3NCJL 3DBXB 4JFFB 3X13A 5DMYA 1KENH 2YSSA 4Q58C 1FFPB 2R56H 3WHXB 5T1MA 4UB0L 1KN2L 1PX3A 3DO3A 1L9NA 3H3BC 1UKTA 5EU4B 4DAGL 2QR0A 4YDJB 2VLKB 2QQLH 4P2OB 5HI3C 2GYSA 1AGDA 4KRLB 3MRJB 2JCCA 5DYOA 1W0WA 1YN6A 3DX7B 1NCWL 3A67L 1NLDL 3E8UL 3VXNA 3C5ZD 1S9VA 3STLB 2D9CA 1U8NB 4YK4B 3MX0A 2AEIT 3CFIC 1UB5A 3O9WC 4U1GC 2YWZA 2O5YL 4U1SA 4X9FA 5E2JA 1IAIH 2DQUH 3O3AA 1AC0A 4NQXB 1JUFA 1UCBL 4OF6A 3VXME 2IPTL 5T1DL 2ZCHL 3H7LA 4QHNB 3IJYA 3OX8A 1WAAF 1X6LA 4UDTA 3QSKB 4M7KL 5FCUL 1XF4A 2EE2A 4QTIL 3L5WA 4YGAB 4D9LL 1G7LB 5C0AB 1JGLH 3ALPA 3QUKB 3VXQB 1MELA 4YZFF 4FQ2L 5LGJA 2IGFL 5E99H 5GGRB 2Z8WC 3KPLA 2J8UE 3MUGB 4HXAL 2VABA 5EZJA 2EZ0D 4L29B 2BX5A 5KVEL 1VADA 3ZHLA 3C60D 1FQ9C 5IOPB 1M71A 5CSBA 3P77A 2FZ3A 1KEGL 3V5DA 1JYWA 1E4WH 5FYLL 4GAGH 5IHLB 5LQBH 1NGZB 2UZIH 3D85D 5FGCB 3HG1B 1QSEA 2PXYC 4FG6C 4LKCB 1RZFH 1WBXA 1HEZA 1RZ8A 3A6BH 4KMQA 4XNMB 4GAYB 1A3RH 3PL6D 3BP6A 5GRJL 5IW1A 4N5EC 1K8IB 4RFEB 3NTCH 4XWGH 5CD5C 2E7HA 4JPVH 3V8OA 3V5HA 4U7MA 4PRPE 5JDSA 4Y16B 2H1PL 4LU5L 5GISH 4IIQC 2YXFA 4JFHD 4KI5C 4K3DH 5DT1L 3MRPB 1TNMA 3DGGB 4OBRA 4YHYB 2VDQL 4YFDB 1ZGLA 4XPGH 1CL7I 3WIIH 3MODH 2HKHH 4OTXL 4TRPH 4L3EE 4V1DD 2X9WA 5DD1H 4ZPTB 3KPSE 32C2B 1SJVA 1G7QA 1WWCA 1WWAX 4MNQA 4AL8H 1FZMB 1ZV5A 1S8DB 4JKLA 3MV8B 5FYJH 5GGVL 3H7BA 2IH1A 3D39A 1T6VN 1BQHB 1RI8A 2BP3A 3QT2A 5D7JB 3IDNA 3RBSA 2W91A 2BZDA 3WJJC 4WI2A 4NKMA 1YMMB 1CS6A 3G04A 4FTVB 4Y2DB 3IFPA 3QEUA 1WBZB 1GXEA 3GFUA 3MV7A 4XTRC 4ESKA 2H26A 5EN2B 2E7LE 3ARSA 3GUTA 1GGIL 3CSYB 4LPWA 4NO3A 1RJYA 2WIIA 5HGHB 3VMPA 1E4KC 3V6OA 4K94C 2YC1A 3CPLA 2C4XA 2X40A 3ARUA 3Q5YA 3QR2A 2Q86A 3B5HA 4RQQA 1KPRA 2AV7A 4BFGA 3PGFL 1I9EA 1E6JH 3UPRA 4LSDA 4M62L 4PLJC 3KLDA 5EU6D 1U8IB 2ICEB 1BZ7A 1HE7A 1SEQL 3LN4B 4YXKL 5C7XH 5DJ0B 2FBJH 4LP4A 3BH9A 1JPSL 4KUCD 1FPTH 5T3ZH 5DTFA 3DIFA 4F7TA 5J11B 3LEXB 3IAPA 3S37X 4LPVA 3BX7C 2EYSA 4D8PB 2EDRA 2NY4B 4KK5C 3GMOB 4DK3A 4LLYA 4XNYL 2PO6D 1IT9H 3C5SB 4P2CG 4JFEB 5GIRB 1FFOB 1U8QA 2F5BL 1TVHB 3RKDC 1F4XL 3UXFA 2AJSL 1G7MA 1U92A 2R2EA 2V5RA 4J3TA 4KJYA 4YLQT 3QUYC 3KXFE 2VXQL 2R69L 4EOWH 3HC0B 4F7EA 2J1KA 2DI9A 2BSED 4Y19D 3WLBB 5C0RH 1ZLSH 1KEMH 2DB8A 1HHKA 5DS8A 2FIKB 1UJTA 1IM3A 2YKLL 3HS0B 4NZRL 2R2HA 2ATPB 5ELIA 2C1OA 4HWBL 4L1HA 3MGOB 1I1AC 5EH1A 5F7DB 3I75B 2RHEA 4HAGA 1YYMH 1KCVL 1MHPH 1Y18B 1F3RB 4O9HL 4X7FC 5TE6L 1MCIA 3OKKA 4Z7WA 3U46B 4ELMA 3BSZH 1U42A 2ADIA 1RJZA 2NY2B 4V2CB 1LE5B 3DUHA 2OL3B 3WIHH 4NKOB 4NZDA 2Y5TB 3N06B 3MO1A 3FOMB 4DUXA 4L1DA 4L9DA 4DKFH 1HIML 1M05B 2DLGA 2JB5H 2JJTC 4K9EL 5D7LB 2J4WL 4FZEH 3UTSD 2AKRA 4TUKL 1DVFB 3RTQB 1JGEB 4GBXA 1ZVHA 2VLKD 4I3GA 4ODBD 1A6UL 4P2OD 3UTTB 2HWZL 4PGCA 2QQKH 3ZHDA 4LOUC 2GY7B 3V7AG 4ZOAA 3OG6B 3S4SB 5TPWH 1A1MA 4PGEA 4NM8H 1I8KB 1U91A 3PWVA 1MFEL 4IBLT 1UB6B 2C3VB 2XRAL 3RPIA 2WW8A 1A14H 3U79A 5GRYA 1AO7B 4UILL 3V4UH 3BEVA 3NCEB 2VZ1A 1JPST 1R5IA 3LD8B 2G9HA 3EFDH 4S1SH 4ZNCD 3DTXA 4E41A 2DAVA 4JFQA 1WZKA 3BEWA 3OJ2C 1WF5A 1BJ1H 4PV9A 4OGYH 3E0GA 4NWUL 4QY8A 3LS4H 2HA1A 4P23B 1S7VB 1JYXA 4N90D 1BIHA 3SO3C 1NMAH 2D0HA 3PWPA 3CUPB 3BDXA 5C0AD 5KVDL 3WS3B 3WN5B 4OV6F 5DFVD 1YEEH 1ZGLM 1JYNA 4LCIH 5CJOL 4C57C 1S78C 5IEHB 5IB2B 1I4FB 2GAZA 2FDBP 5ITFA 2R2BA 4YIQA 5KS9A 2ITCB 2YPLA 5C9JB 1MIMH 3A0OA 1FAIL 1KACB 4RMRA 3P3YA 4N8PA 1BD2A 1CDGA 3PG2A 4ZO8A 4HMCA 1OARL 3KPRE 4LKXA 2EH8L 1HILB 1S5HB 3V0WH 4LHJB 5DQJA 2J12B 3MNVA 3HG1D 2ED9A 1GPOH 2VXSH 3NA9L 4MXQA 3S5LB 5KVFL 5I1KL 5KZCD 4X6DF 1MRDL 2BVQB 3LSOB 4TVPD 3RWDA 2YUXA 3TN0A 1FL3A 4RDQF 1JNNH 3UMTA 1QFUH 5I8OH 5F7EL 4HKXB 4NNPL 5AD0A 4UIKH 4UTBH 3OKDA 5C6WH 3W0WA 3G5XB 4KTDL 2XZZA 5CZVH 5IFHH 2L4OA 4PGDA 3QIWB 3D6GA 4Y16D 1L6ZA 4GUPA 3NABH 2ADGB 3UJJL 3O11A 4JKPL 4JHBA 4WO4C 5CZKA 3QUXC 4G6FB 3MLVH 1C08B 3STBA 5FOJA 4CVUA 1N8ZB 4V3DB 2VO5A 3X12B 3S6CA 1T83A 3HE7A 4WFEE 4NN7C 2MSPA 4PRIA 4XAKD 3BYYA 3HZYB 3VDCA 5DRZA 3MCKB 3RY5A 4IHOB 3QXAB 1QFWL 5HHPB 3MV8D 4LHQB 2CSPA 3UJIH 4JDVA 4WW2C 1RUQH 2KBGA 3DRQA 4GG6A 4LLUA 1EBAA 2C3HA 2CIKA 2COQA 3GSVA 3HRZA 4CKVX 4OD3L 1YMMD 3UROR 4Z77A 4R0LA 1IARB 4Z8FH 4FTVD 4ZAKB 5GGTH 4ZODA 4Y2DD 1XZ0A 3VD4A 1J0YA 1FVEA 2R0KL 3JUYA 4QRSB 5E5UB 2P5WE 4MMXC 5ILTL 4HWZA 2B1AL 3MNWA 1OP9A 4OI7A 2QHRH 3SGJA 3D25B 3SDAC 3KPQA 3QULB 5D2NE 2DYPA 2R23A 5ACZA 3VFTA 1A7NL 3JV6A 4PP8C 2FATL 1QFHA 4PJIA 5DJ8A 3ULVC 3QUZA 3AAZB 4K7FB 4Q9RL 1P5UA 1ES0A 5IT2L 5ID0B 3VWJB 1EDQA 2X1OA 4KKAC 5D9SB 3AS3A 1SBSL 5HHVH 1FYTE 2NY4D 1BBJA 3LQZA 4HK0A 1BQSA 5A1AA 35C8H 1CD8A 3TGXA 5I1HH 4JFED 4F7CB 4PP1C 1NBVL 1JF5A 1AY1H 4WI9A 3ECBA 2X1XR 3AB0B 3TC9A 1OWRM 3HI6H 4MD5A 1I7RB 1U8LA 2ZKHL 2PW1A 3PHQB 1XIWC 2C4FT 2UWEE 4UT9H 1CR9L 3CXHK 4QRTB 1INDH 3T0EB 3UJTL 3MCLL 4OSUL 1BBDH 4PS4H 1UXSB 1ZHLB 1IAKA 4HWEL 1LP9E 4HEME 5BXFB 4DGIL 4OZGF 1G7JB 2OLDA 1KJ2B 1KTKE 4I9WD 4LLQA 2BNQA 4Q6IB 2E6QA 5JORB 5IG7B 3V52L 5DZNA 4YAQA 1CLOL 1B3JA 4QCIA 1KBGL 4JKMA 3GSUA 4OJFH 2P49B 5CHNB 3T8XA 3BQUA 2NY2D 2FBOJ 5CP7A 1F02I 5JW3L 3MRIA 4H20L 3DYPA 4KFZC 1A02N 3WDJA 3JUZA 5D72L 3AU1A 1PVHA 1KIRB 3MZGB 1I1YA 3FMGH 5L9DL 3OXRA 1OSZB 2EEDA 5D7LD 3V7MA 1DVFD 3RTQD 2XICA 3ZDYF 3EO1B 1TTGA 4PY8J 3ZKXC 4KKLC 3UTTD 2LE9A 3M07A 4F3FB 2Z0BA 1KNOB 3CAFA 5A43C 5ID1A 5F8RC 3P4NB 5A2FA 4BFBD 3VXRB 1M6OA 3MRKB 1TFHA 5C0EA 5H35B 4P9MH 3X11A 4YUEH 4OZFH 4R2GC 1J10A 2YD8A 1AO7D 4FQCH 2AXHA 2XNAB 2YUVA 4X6CA 1UQSA 1KTRL 1HK6A 1GOHA 4K2UH 1OPGH 5HGAA 1YEKH 3DXAA 1EFXA 1JFQH 3KYMA 1S7UA 2OSLB 1TZIA 4OCSH 3O3BA 3WE6B 5E94B 1CK0L 1K9TA 1HH6B 3GSWA 4FNLH 4P23D 3IKCB 1DBBL 3NPSB 1I1CA 4JO1L 1QVOA 2H3NB 4YDLC 4R7NA 5EIQA 2HTKD 3GRWA 1NFDF 5FO7B 5KVGH 1AE6H 1FBIH 2NPLX 3LEYH 3MXWH 1N7ML 2MCG1 1JTPA 4YDKH 3KJ4B 3PWUA 1W72H 4KK9C 4PREB 4Z7OE 3GJFK 5CILH 1NCBH 3HAEB 4EDXB 1B4JH 4OCYL 3QQNA 2X4NB 3PE9A 3FHAA 3MFFA 3SE3C 4YHMH 1K6QH 2GW5A 2O93L 4R97B 4KVNH 3TCXA 4FQIL 4KKBD 1N4XH 4M7ZB 2X44D 4UU9A 4LPUA 1C12A 4G6ML 3W11D 3ZDXF 4GMTH 1GGBL 4R7DB 3RVVC 4F58L 5E08H 3SDDA 1WLHA 3D2UB 5HGBA 3BPNC 3BUTA 4LSQL 3RWGB 4KRPB 2VJXA 1ZHNB 3NVQA 1JGVH 5EWIL 1AGEA 5GRVL 1RIUH 2GJZB 4AH2A 1ZHBA 5E7FA 4I13B 1YY8A 2B7DT 2FGWL 1T0NA 1T3FB 4PG9A 4YPGB 4D9QD 5C0JA 1JZ2A 1EHNA 3BJ91 3PHSA 3R4DA 4S1QH 3GMLB 2NZIA 2OP4H 3KHOA 5FA4A 3IFOA 2J88H 5INCB 3PP3K 4KI5E 5EZOH 1WQVT 4HIXH 1MWAA 3JTSA 1L7TL 4O00A 3QIWD 1TENA 4HC1H 5DUBB 4RGNB 2DF3A 4QXUL 5D96C 2YBRB 1MY5A 5HBBA 4H1LB 4X6DB 3OKNA 5HYSB 5DJZB 2F74B 4JFHE 2JJWA 5KN5B 1R3HA 5C08B 5E1HB 1FRGH 1KGCE 1RZKH 4BQ6A 2Z31C 1Q0YH 5LWYH 2VWEE 2P4AB 4OZ4B 2C4FU 2IQ9H 4M93B 3I6KA 2BY2A 1HYSD 5I16B 3REVA 4U6HB 3D0LB 3IDJB 2LVEA 4V1DE 4QTHB 3KPTA 3R8QA 1D5MA 3S34H 1IKFH 1F4AA 2BOBB 5I1GH 1U36A 2FNBA 2UV3A 5IFJB 1BGXH 2DTSA 2HLFC 1AD0B 4G5ZH 3RL2A 5C8JB 5I17A 3SBWC 4JAMB 2NR6D 3MZTA 3RDTA 4ZAKD 5E6IA 2DDQH 4B41A 4NKQB 4LRNL 5F1KC 4CU7A 3FRUA 2AGJH 4XCNA 3T65A 2EDHA 3T0AA 4AIZB 1MIEH 4PJ7F 1MCFA 5EBLA 2ZCKL 4JGMA 3JSSA 3S5LG 1AGCA 1KJ3L 1CBVH 2B1HL 2CDFA 5C3TA 4MDJB 2XKSA 2CGRL 5HPOA 2OXHA 1RPQA 4DZ8A 2AK1H 2EXWC 3HE6C 4WU5B 1UACH 2X4PA 3S3SA 3HNTH 1KTLB 3W5NA 1NEZA 3WO4B 5T3XE 3JZ7A 1HN1A 3TBTA 4EZMA 5GGRY 2X1PA 2OJEB 3ARGD 4LL9A 5IM7A 5A3ID 2P7TB 5HHNA 2PYFA 3HNSL 2BVPB 2Y07L 1FP5A 3QHTC 2Y72A 1Y0LB 4U6XA 3VWJD 5I2IA 3CIQA 3RUGE 4PRNA 5D7IA 5CD3A 4KU1A 2ZUSA 3O4LE 4JRXB 4L4TE 1KB5A 5DEFA 4J6RL 4GXVL 1ZS8B 1YJDL 5ICZA 4FQHA 1U8HA 1BX2A 5DVMA 4KZEL 3O2DH 5BV7C 2A2QT 4HUUA 3ULSB 3TH4T 3MJ7A 4TSCH 3GSNH 2V5TA 4KV5F 1IC7H 3V7AE 4LCWB 2R4SL 4R8WL 3T0ED 3RGVC 1TQBC 3G6AA 3TESA 5IEKA 3B2VL 1FNGB 1F4YL 2EICA 2D03L 4QOKE 3T4YB 3SOBL 3D18B 3GMNB 4MS8A 1YC8A 2H32H 2WLYA 4P2RA 4NQCB 1OM3L 5B3JE 1J0ZA 1OAUH 2X4QA 3KYKH 1A7PL 3L9RB 3KLAA 4U0RC 4YHNB 4LNRA 4PGBA 4RGOH 4GH7B 2QEJA 1DL7L 4F33B 4L4VA 2NQCA 4XPBH 4NQEB 1NGYA 3VRLE 3SDCC 1KELL 1I3RB 4I1NB 2VDNL 3ETBF 4HPYL 3BKYL 4LAQH 4HUXB 3U0PB 5BVPH 2X70A 1DUZA 4OKVB 3BHBB 3LKRB 5LKNA 4GJTB 2MNUA 1QP1A 3CVHA 4KTEH 1E28B 4OZGB 1IQDB 4Q9QH 1JIBA 4P9HL 4XVSH 4TPRH 1IILE 1UM6H 2G2RB 1PYWA 4MWFA 4ZXBC 1WT5C 1FVCB 4G6KL 1RV6X 5GXBB 1U41A 3ULUC 3ARQA 2Z91B 1A6VL 2MPAH 3UTSE 1LK2A 1QSFB 1ZTXL 1CGWA 4QRRE 1ACYH 5JOFB 1JTOA 3VXRD 3DSNA 4M6ML 4JB9L 4EBQH 5HHOB 1C5BL 1WBYB 4AK1A 4H0IA 3THML 4ISVB 1MRCH 3CCHB 3GHEH 5J3HD 3FQUB 4YC2C 2WINB 1X4XA 2CK0L 8CGTA 1PY4A 1S7SA 3TA3A 4K23H 3ILPB 3SGKC 5JHDA 3BP5A 4PB9L 5IROA 1PJ9A 4LEXL 5BS0B 1Q1JL 2WUBL 4IRSA 1IC5H 2Q7YB 1FO0A 1HYRC 2XN9A 3MGTA 1LVEA 3KDMB 3QI9A 5EBWB 4L9LA 5JPNA 1J5OH 3TBVA 3WFBL 4K8RH 3H0TB 4N0CD 4MDIB 2ICES 2A77L 2B20A 4H8WC 4JANA 2BCKB 5HYQB 1LDPL 1KIPB 4PBXA 4GAJL 4X8JA 5HDQL 1JBJA 3BAEL 4G43A 4BZ2H 4N90E 3EO9L 4Z7VF 4OLWH 3TIDB 4XNXH 4DQOL 1JHLH 3B9DA 3U36A 3LKOA 1P7QB 5BRZA 3O3DB 1RZIA 3RVTD 4OQTA 4YWGH 4X6BB 5T1KB 2DIBA 3V5KA 1NFDB 3VFSA 5IB5A 3D2UD 4G6AD 4DGVH 1VFBB 2KDGA 4ZG1A 2D0GA 3QNYA 4KRPD 3UZQA 4FA8A 5E2VL 2NXZC 5D1QB 1ADQH 3ZL4H 2X7LA 1MFBL 5LGKA 4I4WB 1RULL 3TH2T 2DLIA 3HCVB 5FGCE 1I7UA 4ZD3L 4FXKA 5IVOA 4D0CA 1ZANL 4KMTH 2JIXB 2VDKL 4MNGE 4CADA 5IW6A 2VERN 3WFDL 1S9YB 2AK4B 1XR9B 1YEHH 1CXIA 2XYCA 2RFXB 3DRTB 2A1WH 1G9MH 1ZAGA 4UZGA 2XA8H 4YHZL 1DBML 2Q3AA 1F8TL 3P9WB 4NRYB 4GW1A 4LCCC 4RGND 4HUVB 5EOQL 3B9KB 1OQOA 2V7NA 1TZGL 3BP4B 4N1CA 5L2KA 1KCKA 3QQ4A 5DWUL 4FABL 3T0DA 1JVKA 4E5XB 4MQXD 5DURB 3MJ6A 4NGHH 2P5EA 2GK0A 1A6ZA 1WSST 3BIBX 4I18C 2B4CC 3ZYZA 3ZKMC 2NW2B 3HAEG 5E00B 2EDBA 3EOBB 4DN4H 1NJ9B 1XR8A 5DD6B 2CRMA 5ANMB 3UC0L 4YHLL 1LEIA 5C0NC 1R3LA 3QZWB 3EYQC 3B2UC 3MMEA 4F7MA 5KAQF 5DO2D 4PJAE 4M1CC 3Q6GL 4PP2B 4EDWH 3HC3H 1QLRA 3Q3GB 4LGRB 2EE9A 3QDMB 2FLRT 4Y5XB 3MV9E 4OM1H 1YN7A 4EJ1C 5SWQB 3OKEA 2Z35A 3IFLH 5CEXB 5JDJA 2EYRB 1C7TA 1GZPA 4QRQA 5I8EB 1CFNA 1FL6B 2AEPL 4M4RA 3GMRB 1GGYA 1MFDL 4WUUB 1SVZA 4ZFOB 5INDA 1H3VA 3MBEC 5DHVH 3HKFA 5TH2B 2Z8RA 4JR9L 5SWSA 1T21B 5DLMH 2KH2B 2B2XH 4QF1B 4K7PL 5CGMA 4GLRI 1I9IL 3QISA 4XVUC 3FZUD 4Z76B 1EEZA 4FP8L 1PG7W 2KQMA 4PJ7B 1T5XB 1DN0B 1T2JA 5KOMC 4HSQA 1RZJC 4H1LG 1U3HC 3Q6FA 4OB5H 5HYSG 2W59A 2P46B 4JVWA 4MXWH 2F58H 3FB5B 4RDQG 1KCRL 1ORQA 1IEHA 3BGFB 3P30H 5IJVB 5GSVB 3ARDB 4GQPH 4QXGL 1R3KA 4MSWB 2YA1A 12E8H 2VDML 5E8PB 1AQDB 1EV2E 4M3JA 4JFPA 4JRXD 3BDYH 5A2JH 1UEYA 1AFVL 3KAAA 5HHME 3U7YH 5JXAL 4P3CH 1QFOA 3TVMB 5IB4B 2WLZA 2Y5EA 3ME0A 3TFKD 2D2OA 4OZIF 2R0WL 1N2RA 1IGYB 1KG0A 3VXMA 3SE8L 3TPUE 4XBEL 3OAYK 3TO2A 2VB5A 2ESVE 4JFEE 1OAZH 4RMSA 1ZA6A 4J12A 1GIGH 4NJ9H 2BY3A 1FV1B 5DR5H 4LCWD 5CJ5A 1RU9L 2ZUUA 1MCQA 1S7RA 1NGWB 4OF7A 4LSPL 2V2XB 4GRLA 3QNZA 1Z3GH 5ENWA 1UZ8B 2GSIA 2N7AA 3U82B 1UVQB 3D5OF 3O6ML 4HKJA 5LBSH 5T5FL 1F90H 4K71B 2AS5M 1ZT7B 1HHGA 4NQCD 4PJHA 3VFVA 1QR1B 5CCKL 1MJ7H 2J8UA 1EMTL 2AJZB 3FQWB 5GRXG 3GGWA 4NQED 2QADB 2HTLD 1CXEA 2AVGA 2CKNA 4BSJA 3WKML 2YMXL 3RWHA 3SDYH 2G5RA 2Y7QB 1U8OB 1A6WH 2DKUA 3TT1L 1CLYH 4HK3N 1D5ZA 3VFWA 4OLXH 4Y4FA 4F15C 5D2LF 2GJ6A 5CJBA 1RHHB 2W0FB 2B5IB 2OX5A 3KLHC 2MQ0A 5HSFA 4KHXL 5C86A 4EN3B 1H3XA 5D6DA 1MHEA 4P57B 4XZUB 3WFHB 1NCAL 2A0LC 5D1XA 1DBAH 4NUJA 2H32A 1QSFD 1G1CA 4PRPA 3UTTE 5I66A 3WXVH 5J1AB 4MMZC 5H2BA 1I3UA 2W9LA 4N0FA 5HHOD 1DQMH 4LARL 4CW1B 4O51A 5ESAB 4BH8B 4ETQB 1NBZA 1P6FA 1KF9B 5F7FA 3RY4A 3SE9L 3IDMA 3P0YL 2ADJA 3RNKB 1NAMA 3ORJA 2V17L 5FV1L 3AM8C 3O3EA 4FFWD 1YEJH 3EW3B 1A6TB 3DMMA 4P5KA 2NXYC 4MAYB 1WIUA 2VQ1A 4NN5C 3TNNB 5B39B 4P46B 1EEUA 5BMFH 2JJVA 2BJML 1DFBL 3QHZL 4M5ZH 2Q8AL 5EU3A 3EAKA 4FQPA 4PJCA 5H8DA 1J1XH 3VFPA 1A3QA 3Q5OA 5JR1L 4DW2L 4UBDD 4F9PA 1G84A 3FKUS 1P7QD 3QEGL 5I1JH 1CFVH 5IQ7L 4XVJL 4XNUL 3SQBA 2Z9TA 4KPHL 5HVWA 2E7LA 3U48A 3NCCB 4HK3J 4CJ1A 1ND0B 1MCPH 5EOCH 1NANI 3GIVB 4HQQL 1I9RL 4JY6A 1NLBL 2XTJC 3WS6A 1QBAA 1WAAE 2VXUH 5HI5C 3BPCA 9CGTA 2CH8A 1JZ3A 1Q38A 3EJYD 3VRIA 1AR1C 4Z7VB 4FFVC 3C8HA 4S0TD 2OM5A 2ZUQC 4U1HB 1K8DB 4MA7H 3VCLB 1MEXL 3JWOH 5D1QD 3ARBB 4CU6A 4KJQD 1PG7X 5IVXF 3BN9C 5DRNA 1K4DA 4JPKL 5FUZL 4DCQB 3V6BR 1W0VA 3CX2A 4EI5A 5C09B 2JIXD 3MRCA 3L5JA 4NHCH 2R1YA 4BSWA 2AK4D 4HIEB 3QNXA 1I9JH 3R1GL 4XNQA 3ZTJH 4FQJL 1AIFA 4FQ1H 1EK3A 1PGRB 1ZVYA 1UENA 1INQB 4X5XB 4IMKA 3FTGA 1GHFL 2PR4L 3B9KD 5F7UA 2ATKB 2N1KA 1G6RA 2EH7H 1XFPA 4S0SD 3WNOA 4LLWB 3O4OC 4PJBF 2OZ4A 1A47A 5ALCH 3PV6A 5DURD 5BVJA 4Z7UF 3W5MA 3MROB 2J6EL 1B6DA 2XZQH 1OL0A 1MCKA 3QUMH 2AV1A 1FNHA 4KQ4L 5C07E 3HR5A 4WTZG 3O6FA 2BHUA 1CE1L 3MSPA 3IJHB 3KYOB 1PDKA 3VGBA 2XWTA 1YEGL 3CH1A 4L8CB 3QDMD 1R3JA 3S3JA 5MEPB 5I6XB 3O8XA 3RVWC 2H8PA 3OHXA 2QJDA 1MH5A 3DX6B 4BKLB 4HMDA 4GRWE 4U1IA 3REWA 4D94A 2OR8A 3OSKA 3UO1L 5DVKA 2XXCB 3RKDD 1IC4H 2H2SC 4WUUD 3ARYA 3GHBH 3K81A 4I0PA 2EXYD 3VFNA 3CU1A 3DVNB 4MQSB 3LZFH 4XP9L 1HHIB 2YN3A 1YYLL 1YNTA 2CLRB 5HI4C 1A7RL 3MR9A 3VXPB 1U58B 4HG4K 4FQXA 2V9QA 4NO0B 4O2FB 4U1MB 2VIRB 2AXFA 5IMMA 4KK8D 1FNSL 4XCEB 3P73A 5I1AA 3L7EB 5GQBA 5HYIA 2RGSA 5CIPB 2YK1L 3ARDD 3FB7A 1FGNH 4HDIA 3HZVB 2WM0A 3ULUF 4MNHB 1P84J 1RMFL 3PWJA 4H26B 4UT6H 1IGJB 3C6LA 3INUL 3TVMD 2WV3A 3V6OC 5E0QA 4P99A 4CMMA 4G3YL 1QPXA 1FHGA 1KSRA 5DUML 4HT1L 3TZVB 3L3GA 4PJFF 4N0YL 2ARJQ 2LQRA 5TF1H 5D1ZC 3CFEB 2KUTA 4RZCB 3UBXI 4IJ3B 3LQAC 5JXED 1WCBB 3ZKXB 4OD1H 4HS6B 1QO3A 2D7MA 4J8RB 3ULVL 2H6PB 4XHJC 4QYOA 3FO0L 4BFEA 5IBTH 1X5AA 4XMPL 3T4AB 5EBMA 4XCFH 3GNMH 3G6JE 3QXUA 4XCYA 3L1OH 2CLVA 1IEAB 2V7HA 5B38B 5D5MA 3VJ6A 4LGPB 4R2GB 4Z0BL 3VH8B 4APQA 3BOVA 5A16B 5CEZD 5FM8A 1PKOA 2JELH 5K9QI 4QHUB 2XFXB 1AGBB 1CCZA 5EU7E 5I30H 4GW4B 3V6ZA 2QADD 5KBNC 4UINL 2XZCH 2OR9L 4I77H 3KPRA 1X6NA 2R2CA 4MJ2A 1VENA 2C3WA 5E5MB 1SBBA 2A9NL 4YDLB 3FQRB 1TPXC 4LSSH 1UWGH 1U93B 2ZCLH 1IAII 2IG2L 3L3JA 5AYUL 4PJXE 1MVFA 1XGPB 4EN3D 3ZYJA 2HLAA 4LSUH 2VXVH 3FFCA 4X0KA 3SJVB 4JY5H 1MAMH 4JKWA 2R39A 3H9SE 4NCDA 3F7RA 1Z0NA 5L7XH 1SY6H 4YXLH 4FFYH 4ZO6A 3MLUL 5IR1A 5D2LB 3WO3B 2X1QA 4ZNEE 4XP5L 2RIKA 1DLHB 2CLZB 3WFEL 3VXRE 2NNAB 1SJEA 5C9KA 1ZOXA 1MI5A 5F96L 4G6JH 5FF6A 3NACL 1ED3A 1JE6A 3QEHA 4LP5A 2UYLB 3OXSA 4ORGA 4TNVF 1DEEA 2YS4A 4MAYD 1R0AL 4P46D 5SWZB 4XBPA 2DQFB 3D3VE 1LK3H 4LLDB 4GBXC 5CGYD 5IMOA 4HUMB 5TE4L 3NCJH 5IMLB 3ZE2F 1ZSDB 4Q2ZB 4ZS6C 3V8CA 1O5DT 1YQVH 3L3HA 4JDTL 4PJ9A 3KPMB 5IHBA 5ESVB 3MRBA 2GSGA 3U30B 1QRNB 2VZOA 2E9BA 1SYSB 1AJ7L 4KRNA 3A67H 1NLDH 3E8UH 3DUSA 4XVTL 1N5YL 5HY9A 1UWXK 3QDJB 4XRCA 2O5YH 4PR5B 1N5AA 1RK1A 3CJJA 4AMKL 3ARBD 2OTPA 2WBJA 1UCBH 2IPTH 4P3DA 5GRZA 5T1DH 5BZDB 4X7TB 1L0QA 5CINL 2UUDH 2ZCHH 5LCVH 4ODWA 1OY3B 2W9DL 2FEDD 2EECA 3JV4A 4M7KH 2CMRL 4Y4KB 5FCUH 4OF3A 5BOZG 3RZCA 2R1WB 4QTIH 1ZWIB 3CZFB 4OLYL 1JGDA 5CJQL 1QEWB 5HDBE 1R24B 3DROB 1T20A 3VE0B 4D9LH 5F1IA 1T2QH 1FYTA 1HWGB 3PJSA 4LSRL 5JW4R 3UBXG 4MHHI 4FQ2H 5F3HA 5BOPA 3FO2A 3JTCA 2IGFH 5IVXB 3C9NA 4RGNE 4YDIL 4PRHB 1UG9A 4JDZA 1SYVB 4HXAH 1MJJB 5MEOA 4MXQC 5KVEH 4NFCA 4S11A 1M7DB 3TN0C 5CLWA 3KS0H 4NZTL 4M1DL 3H3PL 3TBYB 5C2BL 4RMQA 2UWEA 2R0LL 5FYLH 2JB6B 4MZ3A 5DJDB 5BJTA 3PIQB 5C0BB 4ZYKA 5CMAB 5F7HA 3C09B 5DJ6B 3MRFB 5K9QG 3U7WL 2A74B 4PJBB 2IPKA 4P49A 4O2CA 4Z7UB 5GRJH 5FHBL 4N8VB 1ZT4A 2P45B 1F3DH 2OQJB 1B0WA 5BV7B 2EDXA 2FH8A 3X3GH 5IHZA 5I9QB 4KJWD 5FGBA 1BOGA 1MOEA 1T1YA 2OMBA 4YO0A 1T83C 3RQ3A 4I2XE 3HE7C 3HTLX 4CN6A 5KSBF 5D7KD 2H1PH 2Q6WB 2I07A 1OQXA 5DT1H 3C2SA 3L3OA 1P5VA 3GKWL 3FT4A 3AY4A 2VDQH 1TQBB 5H94B 4PY7A 4GQ9L 3TBWB 4DEPC 2VUOA 5FOBB 1P1ZA 5TDOB 1ORSB 3MRQA 4OFPA 1E4JA 4OTXH 2DICA 3GIZL 2I9LA 4R0LC 2EO9A 1TITA 2EDLA 1J05A 3U4EB 1KPVB 3W9EA 1BZ9A 5DDHA 4NN6C 5GGVH 4BJLA 4JZJA 1A64A 3QQ3A 3UZEA 1KN4L 5FYJD 2YA2A 4POYA 3SGJC 1DDHB 3EYOA 1KB9K 4UQ3A 3HB3D 2GTWB 4F7PA 4AJ0A 4G8GE 2RBLA 2WNGA 3TZVD 2LVCA 5TDNB 2Z4QA 3O6KL 5CLTA 3QFJE 4LIQL 3SDXE 3GJEA 1GGIH 1KIQB 4N0UB 4KKLD 4PIRF 2FR4A 2ZP0T 4S1DC 1QKZH 2CKBB 3IAQA 5IBLC 1U3YA 3GBML 2F19L 2GITA 2GTZA 4RRPG 4G7YL 1J87A 3EFFA 3I6GB 3QUZC 1U9KA 4GKNA 4LCWE 2PW2A 5FHAL 2H41A 2BHZA 4TVPH 4PJFB 3PGFH 5DFTA 1FVDA 2X4TB 4M62H 4EQ2A 4OLVL 2DQJH 5BV7L 1P4BL 5E70A 1SEQH 4YXKH 1AKJB 3IB4A 4NQCE 1H3GA 2BSTB 3VFGL 2UY6A 4HX1B 1S7XA 5J6HB 2DTML 2BNUA 2F53B 4ZUSB 3IDIB 4YE4H 3WHE1 4NQEE 3CXHJ 3QO1B 1H3PL 4XNYH 2GT9B 4QT5B 4I48B 4OZHE 2F5BH 1JF6A 3DX9B 4LFHD 3ZKSD 3DO7A 5B21A 5GGQL 1F4XH 3D85A 3LDBC 3LKSB 5F8QC 4M7LT 3GJFA 2ARJA 3S97C 3SJVD 2EDWA 4KKCD 3WNPA 4LQ1A 1LQVA 4MHHG 3L6FA 2VXQH 2EDKA 4HGWA 2R69H 3QFDA 2VAAA 4ZSOB 4AEHL 3GK8L 1G6VK 2K3TA 4LBEA 3P4LA 2FL5B 1QSFE 4XMKL 3STZB 2AW2A 3BQUC 4ORZC 3H9YA 1WEJL 2YKLH 4NZRH 4G8IB 4HWBH 4JREC 4WHTA 3FRPG 2NXZB 5JOEA 2OMNA 2YRLA 1KCVH 4NNXB 3HMXH 4BQCA 3R06B 3LKQB 2CJUL 2VH5L 1YA5A 4O9HH 5HJ3B 5TE6H 2ZSVB 2G5BB 5B38G 3QPQD 1DQLL 5DEZA 4I3SL 3P4OB 1MFCL 3AXLB 5M94B 3VH8G 5SWZD 3ULUL 3UAJD 2CKBL 2D7TL 4V1DA 3ZKND 3BGMB 3ZTNL 1HH9A 2QKIA 3OAZK 1HSAB 1S7QB 5IV2B 1VKXB 1XF5A 1D6VL 3I9GL 4LCCB 4LEOB 1J8HB 1HIMH 1SY6A 4K9EH 5F21B 4GG8B 2J4WH 1CD1B 2DJ4A 4TUKH 1T5WB 4NO5B 1A6UH 1FE8H 3BVNA 1U8KA 2XTJE 4LFHG 1MPAL 5J9PB 4A2LA 1LGVA 4LVNC 1MFEH 3QDJD 3WIFB 4H8WL 5KSVB 4HKBB 2XRAH 2BOCB 2V6HA 4PJ8C 3JXAA 3T77A 2K1MA 4DOHE 4QHLB 1MCEA 4M8VA 1QR4A 4M9OA 4D9RD 3VGAC 4OZFB 2Q76A 2W65B 3FB8B 3RWJB 4PJEA 2VNCA 1CGXA 1MLCB 4HIJA 4Q0XH 4RMWA 3ZE0F 2IH3A 3VG9B 2LTQB 4Y5VB 4JFOA 4Y4KD 5GS0C 5EU6A 4NPYA 5EU5A 1KCLA 5CJ8A 4OCXL 3RUGA 5KVDH 1JMZA 1IGTB 2D31B 3O4LA 2PNDA 3MRGA 5CEYA 1F58L 4N8CL 4QNPF 5CJOH 1JWMA 5FUCC 4YHPB 5GZNC 3U6RB 1FNAA 3D48R 1YY9C 4U1NA 5FIEA 4PRHD 1ZA3B 1PZUB 1NGQL 1FZJB 2EDOA 4YJZL 1FIEA 3DUUB 3BWAB 1FAIH 1V3MA 1U8JA 1OARH 3JWDC 1FGVL 2FO4B 2FHFA 2EH8H 2OL3H 4X9BA 3WSQL 3GI8L 1HXYB 3TF7C 5C0BD 3IYLW 2HFGL 3BZDA 4NRZB 3NA9H 5ANME 1I1AA 5KVFH 5I1KH 1MRDH 1T66C 4QOKA 1TETL 3F58L 1DQQA 5HDLA 4WFHD 5J4MA 5DEGA 2HP4A 5F7EH 4NNPH 4LCUB 3FQNB 3CSBA 3P40A 2IANB 1X3DA 2B4CL 4RNRB 4UNUA 4KTDH 1FCCA 3Q1SL 5J1SC 4WW1B 3ROLA 1HXMA 3RWEB 5DSCA 1BVKB 1PKQB 3UJJH 4E42A 1XF3B 4TYUA 4WUUE 3QG7L 8FABB 4JKPH 5F9WB 2RCSL 5IVZB 2A83A 5EC1A 1XH3B 3DBXA 4P5MB 1C8PA 1U95A 3MV7E 1ZLVH 3M45A 4WFGE 3RDTC 1R5VB 4WHCA 5E6IC 5B4MD 1A5FL 5KSBB 3UTSA 4QRRA 4O58L 1LO4L 1LO0L 2DQTH 2VLKA 3FO9B 3V6OE 3KR3H 1ZLWK 4F37F 1NBYA 3MRJA 3RX7A 1MCDA 4DZBA 3QA3B 3OKLB 2VDPH 5DMKA 1HI6B 2I26N 3MYJA 5FYKL 3QCVL 4F15B 4Z7WF 3U83A 5E8DL 3OJDA 4ELMF 4CMHB 4BH7B 1PG7L 4ZUUA 2E9JA 1ZLUK 1MF2H 1NQBA 5ILTH 2B1AH 2FHCA 3B6SA 1HINL 5IF0B 4N8VG 2C1PB 1BHGA 4GRMB 4Y5YB 1Z9LA 4YBLB 3GB7B 3L3KA 4PJGE 1VFAA 1X7QA 1A7NH 3RWCA 3TBSA 1SMAA 2BC4B 4LVOC 1IGCL 3F5WA 5FK9A 1RIVL 3QUKA 4BELD 1CXHA 4JN1L 4XP1H 5GGRA 1AKJD 1JI2A 3AMLA 3RI5K 4Q9RH 1UGNA 3X13B 2MWCA 2YSSB 2NY0B 4JRYB 5DJXA 5CEZE 5FO9B 4TUOB 4L29A 1SBSH 5J12B 2F53D 1KLUA 4EI6B 1I1RA 2QR0B 5JPMA 1D5IL 2VN4A 4AT6B 1T04A 1BLNB 3T09A 4CVZA 1YN6B 1I8LA 1D5BA 5GZOC 3MC0A 1S9VB 1KUMA 4LKCA 4LVHB 4XNMA 3EJJX 2ZKHH 4GAYA 4MS8C 4U1SB 3O3AB 5DZOA 1CR9H 1K8IA 2IAMC 3KGRA 4PJDE 4PYGA 3UJTH 4UUJB 3MCLH 4KXZI 4WO4A 4OSUH 3WFCL 3G9VA 5I73C 4R96B 3MRHB 4WY7L 4KHTH 2MCPL 3GBLA 4HWEH 3PGDA 3EHBC 2E27L 1VGEL 4Y16A 4YHKL 4UDTB 3LQMA 4OAWB 4OF5A 4DGIH 2M26A 3MTRA 1MCWM 3S96B 3V52H 2UVFA 1CLOH 1MFNA 1KBGH 1TIUA 4JJHA 2FJGA 4ODHL 4X6FB 4A2MA 3L95A 1A1NB 4CGTA 1H5BB 4FMKA 1MCHA 4L8DB 4HBQA 4WW2A 2BSSB 2Y36L 4RFNB 5KOVC 4LASH 5JW3H 4ZPTA 32C2A 4H20H 1ZGLP 4Z7QE 1Q94A 5D72H 1VADB 5DK3A 4PJAA 4EUPB 1FZMA 3MPCA 1S8DA 3MV8A 3PF2A 1J8HD 1M71B 5L9DH 3P77B 1ETZB 1EZVX 4ONOA 4TTDC 3V5DB 2HT4C 1UWEL 3RNQA 3P2TA 5JIIA 1IC1A 1QSEB 2DOCA 4FTVA 1WBXB 4DJMA 4Y2DA 1HEZB 1RZ8B 4WUKL 3ZSTA 5IROC 3BP6B 2E8ZA 2ZSWA 3HMXA 4WI7A 2O5XL 4IRSC 3WNKA 1FNLA 2X4OA 2ZPKL 4XMLL 3QI9C 4K3HA 2FX9L 3CSYA 4BUGA 2NY3C 3BKJL 3V2AR 4PB0H 2O5ZL 4DUVA 3V5HB 4WTWA 4G80A 1B4RA 1Q9LA 3BP7A 2BNRB 2NTFA 1QFPA 3NH7L 2DWDB 5KS9E 1U8PB 5LAXA 5I1LA 2BXYA 5JZ7C 1CK0H 4DKDC 4WI8A 1DBBH 3WEXA 1VGKB 5FEBA 1U8IA 2ICEA 4JPIB 1S9WB 3DSFL 1DP0A 3LN4A 4HH9B 5DJ0A 1N7MH 4WI6A 3LEXA 3CFJB 2VL5B 3HUJE 1QUNA 5TQ2L 4D8PA 1KJ2H 5FYKD 2K7QA 4HIHB 2IH1B 3VD5A 3CVIH 3TO4A 3TPUA 4W6WB 4FQIH 4LPTA 1FFQA 4JFEA 2ESVA 5GIRA 1FFOA 3G08A 4C58B 4TUJA 4L8SA 5F1NB 5FXCH 5E2UL 3AS1A 3IU3B 4YDVB 4BK4A 5ICYA 1GGBH 4F58H 3QEUB 5HPMA 1OWWA 4LSQH 5DVOA 2HVJA 3FL7A 3LS5L 1BPVA 1BFOA 5EWIH 3GUTB 4PJIF 2R4RL 3HC0A 2WIIB 1MJ8H 5AWNL 3SCMB 3B3IB 3WLBA 2Y06H 4ODXA 2FGWH 2YC1B 1OGTB 2ERJB 3ZT5A 2FIKA 3HS0A 2Q86B 3ZT7A 2VTFA 2IAND 4PRIE 4OZFG 5F7DA 3I75A 1KPRB 1L7TH 3UPRB 5H37H 3V4VL 1XGRA 4QXUH 4NO2A 3NIGE 5F6HI 5EIIA 4GG6E 3DETD 5KANI 3VXOA 3BH9B 3HN3A 4XB7A 3KPPB 2OL3A 3IU4L 1C5DB 2CDEB 4XPHL 1BF2A 2CDGA 5CZXC 4NWTL 4P4RA 4U31A 4XI5C 4R26L 1RFDL 4MQ7A 4OCRL 5JOPD 5D7LA 4NYLA 4P4KB 3VGDA 1DVFA 3RTQA 1OP3H 3UTTA 1G7MB 3MXVL 3DI2B 3S35X 5SV4A 4KJYB 2HMID 5I75B 3EDDA 3E6FB 3CX5K 4LRNH 1ONQB 1UB6A 5FYJE 2X4UB 4F7EB 3G5ZA 1INEL 2ZCKH 1HHKB 1KJ3H 1KCUL 2B1HH 1IM3B 4FXGA 2CGRH 2C1OB 4PRAA 5EO9B 4FS0A 1BEYL 5F93C 2HJLB 2P44B 4FZ8L 3OQ3B 1G7HB 4XPAL 2GEEA 5DHVB 4U6TA 5DRXA 1S7VA 1OAYL 4Z7WB 4ELMB 3U0TB 1RJZB 3SEPA 43C9B 1B0RA 3MUY1 3WN5A 3HPJB 1TJGL 2Y07H 3MO1B 1BP3B 5IB2A 4JHWL 4JQIL 2NY0D 4JRYD 3LQAL 3OB8A 3RIAK 3H8NA 1WAAA 4X6CF 3T2PA 1X5XA 4GXVH 4J6RH 1YJDH 2C5DC 1EPFA 5IK3B 4JE4B 3NGBB 4PGCB 2H9GA 3O81A 4KZEH 1C16B 4GRLC 5AZEH 3U4AA 1EEYB 3WCYA 5T3ZE 1YDPB 3N1QC 4PGEB 1A1MB 3I6LD 4XT1C 1BMGA 4UI2A 5CBAB 3U0WL 3S5LA 3RPIB 3LSOA 1AQKL 1GGCL 3BEVB 4LLVB 4N9GA 3PXJA 4HKZA 3G5VB 1SHMA 4R8WH 1VHPA 3SJVE 2YPKA 4LF3A 4Y88A 3C08L 5HHXL 2EEBA 2LV4A 2VE6B 3BEWB 5DVLA 3HMWL 1F4YH 2D03H 1AR1D 4PV9B 5DHXB 4QY8B 4WCYL 3SOBH 3VXSB 2Z31A 1OM3H 2X4RA 3LV3A 2ADGA 5D2LE 2XQYG 1EO8L 4WEUD 2DMBA 1A7PH 1ZT1B 3PWPB 5K93A 2CIIA 3BKML 2FJHB 4TSAL 1DL7H 2YOCA 4KJPC 3S88L 5I71C 4POZC 1KELH 2L7JA 5JQ6L 2VDNH 5D6DC 3X12A 4HPYH 2R2BB 3BKYH 1YECH 4YIQB 1J0HA 3RP1A 5D1XC 5C07A 5KSAD 2VXTL 1QLFA 5SWZE 4JO2L 1F6LL 3B9VA 4NBZB 2HFFA 4XCCL 1EAPA 2KQNA 4MJ6B 1BD2B 2DIJA 2LU7A 1A4KA 4P9HH 2FD6L 5MI0B 1XF2B 4JZOA 3MNVB 2FWOA 3LHPL 4MLSA 1QSED 3DXAE 1A6VH 5CBEB 4LHUB 5KANG 4RISL 2YD5A 1ZTXH 3V6FA 3LKPB 5DUPL 4R4ND 3RWDB 1FL3B 5MENE 4PUBL 2ADFH 3DMMC 4OFKA 1NDMA 4JB9H 2XG4A 5GS3A 1C5BH 1NC2B 3THMH 1YPZF 4QEGA 4B0MM 3OWEA 4WI4A 5J89A 3OKDB 3W0WB 5EBGA 3D25A 2EDYA 2BNRD 4PB9H 5F89B 4LEXH 1Q1JH 2WUBH 4D9RE 4F9PC 4AEIL 3WFBH 3EKCA 4YNYB 3JV5A 1T80A 2NX5E 3ARGA 2A77H 3D9AL 1LDPH 3EYVB 4GAJH 3PHOA 5FUCE 5HDQH 1Q9OB 3S37H 3HE7B 3BAEH 3AAZA 4K7FA 4TTGA 3EO9H 4UIMA 5ID0A 4HLJA 4M4PA 3VWJA 1GGTA 1L7IL 3N0PB 3WS6C 4DQOH 4YBQD 2OTWA 4HJ0C 5F88A 3LOWA 3FB6B 4LSVL 3LMJL 5GS2D 1P7KB 4EUPG 3RRQA 4RWYL 4F7CA 5IBUB 3ZE1F 3WLWD 3GSVB 2FYYA 3RFZC 5I0DA 5GRWA 1JPGB 4EI5C 2XACC 1XZ0B 1QACA 5IHUL 1IFHL 4JLRA 5T1LA 4OIIL 2QSQA 3G6JA 4YHOL 3I3DA 3MOAL 3PHQA 2DQUL 5E2VH 4U1KA 1MFBH 4HWZB 4ZFFA 2CPCA 5C0BE 1RULH 4IMKC 3SCMD 4ZD3H 5DJYA 4OLUH 1D3CA 2F5AL 1CG9B 3K74B 1B6UA 1UXSA 2VDKH 1ZHLA 4MJID 5DJCB 3DX8A 2DYPB 5D7IF 3TV3L 3MNZA 5IW3A 2R23B 3WFDH 5MHSE 5E6ZA 4HLZG 3EJZD 3NFSL 3VFTB 1N6UA 1G7JA 1KJ2A 1RY7B 1BWMA 4YHZH 1DBMH 2VISB 5JORA 5IG7A 3KLSA 2EIBA 4UV4L 3K1KC 3VXUE 4HCRA 1TZGH 1NFKA 1FSKC 1F2XK 3D1MC 5EFIA 1LD9B 4PJIB 3HI5L 5EUKB 5DWUH 4FABH 4MAUL 5CUSL 3O6FC 1LO3L 2DQDL 4ZXBA 3P0VL 3DOSA 4PJXA 5KSUB 2DBLL 3RX5A 1IRAY 4JY4B 1G9MC 1TJHL 1KIRA 3O8XC 4HK0B 1OSZA 5JIKA 1YNKL 2NZ9D 1N3NB 1XGTB 4P4KD 3CDCA 3UC0H 2QLVB 3C6SA 1WTGT 3EO1A 2AXGB 4YHLH 1DE4B 3F7PC 3ECBB 4MD5B 4I0PC 1JTTA 3Q6GH 2PW1B 1A3RL 3P4NA 1UEMA 3VXRA 1W8OA 3VI3E 1J86A 2J5LC 5H35A 3U2SB 4P48A 1OTTC 2AEPH 3K2MC 4UDUB 4HG4J 3LDBB 2XNAA 1MFDH 3Q0HA 1CDJA 4FQXC 2WBKA 3AGVA 4OUOA 1JK8B 2D3VA 3AREC 2SEBB 1KFAL 3RJDA 1UADC 2NY6B 1FC1A 4YXHL 4JR9H 2OSLA 3IDYB 4DWHA 1UCTA 3WE6A 1FFNA 1HH6A 1A7OL 1I9IH 2H3NA 3GSUB 2DJSA 3T2NH 1CTOA 5E8OB 4FP8H 4KWUA 5FO7A 3RKPA 2HKHL 4C56B 3C6LC 1JPFB 3MRIB 3VWKD 4U6VL 1QA9B 4NC2B 2IPUG 1EVUA 3HZKB 4AL8L 1KCRH 1VB9A 3AU1B 2CRZA 3PQYE 3HAEA 4EDXA 4QXGH 3OR6A 1I1YB 2NLJB 2X4NA 3OXRB 1FH5L 1X9QA 4DTGL 3EDFA 2XTLA 2NW3A 1JRHL 3IDXL 1AFVH 2FGZA 1MQ8A 5JXAH 4IOSD 3BESR 4R7DA 2R0WH 3D2UA 5ID1B 3T1FA 2P24A 1V3JA 1R3IL 3SE8H 4XBEH 3X11B 5E4EB 2GJZA 1KC5H 4PTTA 4DGYL 2R8SL 2Z93B 2ZOLB 1T0MB 4APQC 3TH3T 3O41B 1RU9H 3GSXB 1UQSB 4X6CB 4YPGA 1UXWA 4LSPH 2EIZA 3RL1A 3T1WA 1EUUA 2AP2A 5HGAB 1UH2A 1KCGC 1EFXB 5INCA 3IFNL 5T5FH 4HD9A 5IJKA 5C70A 3VXSD 3GSWB 2F15A 4RGMC 4YEFA 1QVOB 4QWWD 1KLGB 5DUBA 4I18A 1IKNC 5CCKH 2CO6B 1EMTH 3PWPD 4H1LA 5EIVA 4X6DA 2XIDA 5DJZA 4KK6C 4R90L 2XG5A 4B7IA 1FG2B 2JF1A 4XBGB 3NFPB 1J0IA 3PWUB 5T3ZL 2N56A 1UKQA 2QTEA 3TT1H 4OZ4A 1ITBB 4JN2A 5HD8D 5IIEB 5I16A 2DLEA 1IT9L 3FCTB 2NMSA 4U6HA 25C8L 3IDJA 1OP5H 4QTHA 4UU9B 3L5IA 2PCPA 1VSCA 4TN9A 2VZTA 1BD2D 5JW5B 4KHXH 2BOBA 5AZ2H 3SDDB 1AD0A 5C8JA 1I8MB 4JAMA 5JHDE 1EXUA 4P2QE 4YHIA 4RA3A 2Z8VC 4LHUD 3MBEA 3LRGA 4EOWL 1NSNH 1ZHBB 1HSBB 3P11L 5J6GB 1R5WB 1OTUD 1QBML 4I2XA 1YY8B 2F8XC 5C0RL 4PG9B 1NC2D 4D0DB 4MDJA 4LARH 2DQHL 3IFOB 4OGAD 4KH2A 4NDMA 4WU5A 4U2YA 3SE9H 3P0YH 5FECA 1MWAB 1HDMA 3JTSB 1MRFL 4WHYH 4RA0C 2V17H 4A6YB 2EDNA 3IJSB 5BRZE 1KTLA 4E0RB 1TZHA 5SX5H 4F80A 1LO5A 1IAMA 2MQCA 3OKNB 4G9FE 4PJ9C 4PLKC 2YD2A 4JG1L 4X4YA 3ARPA 1VA9A 1DFBH 2BJMH 1R3HB 3QHZH 2BRQA 4CVXB 3OV6A 1X5YA 1YPZB 2H2PD 3GBNL 3HE7D 5I1EL 5F9DC 1YQ2A 5HVHB 4I0CC 3I6KB 1CVSC 2WMPA 5JR1H 4DW2H 4XWOC 4FZEL 1D5XB 4MCYA 3QEGH 1GSMA 1D5MB 4TNWF 5IQ7H 3GRWL 4XVJH 1ZS8A 3QFJA 4E9LA 3TYGL 4KPHH 3SDXA 2WBJC 1LE9B 5I17B 2HT2C 4HQQH 1I9RH 1NLBH 5CJXC 2LAGB 4JPWL 3UDWA 3FRUB 4XCNB 3T65B 5GS0L 2ZUXA 3BPLC 5EBLB 4LHUG 4DUWA 1MEXH 4LCWA 4OV5A 3RHWF 4M61B 4S1SL 4JPKH 3SPVA 4FQLL 4BYHA 4DZ8B 4OGXL 3NZ8A 4J4PD 4PRBA 4DFHA 4JM2D 4OGYL 3GKZA 3R1GH 4FQJH 4NQCA 2PTTA 5HYJD 4XAWL 4XX1G 4AM0B 3F12A 3PDOB 3KWWB 3QIUB 3JWDL 4ONHA 3EDEA 4YHNA 1FORL 5IM7B 2ZUYA 1GHFH 2PR4H 3ELAT 4F33A 5HHNB 2XPGB 2PYFB 4NQEA 1OTSC 2Q7NA 1I3RA 3M1BA 2ICWB 1BF8A 2H45A 3IT8D 4HUXA 1MWAL 4U6XB 1MNUL 3U0PA 4OKVA 4JQVA 4PRNB 5D7IB 5CD3B 2J6EH 1Q8MA 1MIML 1G9NC 5J8OA 1KB5B 5DEFB 4Y1AD 3FJTA 1E28A 4OZGA 1IQDA 4FQHB 1BX2B 4OI8A 4X6EB 5ALBL 4KQ4H 3ZO0A 2HFEA 1FVCA 4YH6A 5JOPE 2BMKA 3MJ7B 5KSBE 3CFDB 2VXSL 4MB5A 5ISZD 2J8UF 1MHCA 4HS3B 2RR3A 5FGBC 1QSFA 1YEGH 5C0DB 4BFIB 4JHAL 1M7XA 1WJ3A 3AM8A 3CSPA 4S2SB 3H42L 3AY4C 4WI3A 1DANT 3UO1H 4ISVA 3I02B 4MVBD 3CCHA 2HG5B 5IEKB 1OT2A 4D3CL 1A22B 2DQCL 1JN6B 2FX7L 2ITDB 1OAQL 4P2RB 4I3RL 2NY6D 4XP9H 4JQXA 2JLLA 3E3QE 1YYLH 1PQZB 1A7RH 4LNRB 2VLJB 1D9KD 4PGBB 4ENED 5C0IA 5I73B 4L4VB 4MDIA 4JZJC 1NGYB 3S9DB 2BCKA 5BW7A 5HYQA 3ZTJG 1ZVSB 4MA8L 4MD0B 4OD2B 5GPRA 4C56D 1KB9J 5E6YA 1I8IA 1FNSH 5ICXB 1DUZB 4XP6L 3C5ZC 3QRGL 4QLRA 5DHYA 3CVHB 2FEEL 1P7QA 3QWRD 1EVTC 4J23A 2YK1H 3SKUD 3TWCL 1N59B 3RWFB 4OFYD 1NFIA 4WTZA 1G7PA 1RMFH 5FYJU 4NZJA 4JRYE 2IQAB 3INUH 3NN8B 1X5GA 4G3YH 1NFDA 3AUVA 1NKRA 5FAAA 5DUMH 4HT1H 4Z95L 4N0YH 2HRLA 4XXDB 4PJHE 5IKCA 1KB5L 1GOGA 4GKZA 3HCVA 1CD0A 4KQ3L 3ULVH 1UC6A 3I6LE 6CGTA 2E6JA 4YEEA 1EX0A 1S7SB 4XMPH 3TA3B 4HS8L 1TQCB 3BP5B 1S9YA 2DQGL 2RFXA 3TT3L 3VA6A 5HVGB 2XN9B 2D4FA 5FB8B 5JPNB 2EZ0C 4L9LB 2PTVA 2NY3B 5JNYA 2GJ6E 3DWTA 5FKPA 4U1LA 4BQ9A 1DBJL 4HUVA 3B9KA 4JANB 3BP4A 2VLRB 4AQOA 3OGCA 4HUWA 4OLZL 2DM3A 5HGGS 4E5XA 1Q9WA 3D69A 2O61B 2OR9H 4X4XA 1IGFL 5DVNA 5FM4A 4HHAB 1RZIB 3PL6C 1MCCA 2A9NH 2NW2A 5E00A 4AEFA 3S35L 1NJ9A 4M48L 5ANMA 2HKFL 3SKJL 5ADPH 3OB0H 2IG2H 5AYUH 2IC2A 3V5KB 1NUDA 3QXVA 4NBYB 5IB5B 5T33L 1Y6KR 3SDDD 1MCRA 3Q3GA 1UZ6F 3W9DA 4J3OC 5F9AC 4Y5XA 2OCFD 3FHQA 1WZ1L 4L8BB 5CIPH 3CVHL 4CDGC 5SWQA 2X7LB 3GSQA 4CNIA 1OGAB 4M43L 5DC4B 2R9HD 4Y4HA 2VWEC 3MLUH 1FL6A 1CU4L 4PS4L 4D0CB 4YR6B 3GMRA 4NKIL 5IMKB 3SE4C 3BMVA 1UT9A 2ICWI 4WUUA 4XP5H 2C26A 3A6OA 1IVLA 1XCTB 4ZFOA 1U2HA 3TCLB 3WFEH 4PJCE 2E6PA 4HEPG 4G7VL 2V5MA 5TH2A 3E2HC 5E9DD 1F6FB 3QO0A 4WV1B 3NACH 4NC1C 5DFWH 1DTUA 5I74B 2V7NB 4AIOA 4OF0A 5JW4N 5L2KB 1UJ3C 1R0AH 3TP4A 4O4YL 1T5XA 3QJHA 1KPUB 4FOMA 3X3FL 1CGVA 5TE4H 3KG5A 1P84K 4J3UA 5ABDE 4G42B 4MA1C 2AABL 2P5EB 2GK0B 1A6ZB 5IJVA 2FHBA 1FO0L 2O26U 3QQ9D 3ARDA 3TNMA 1A2YB 3RVUD 1DANU 4CJ0A 5C0GB 3CD4A 1AQDA 5D1ZA 4JFDE 4JDTH 1QTYT 3G5YA 2WBWB 1LEIB 1SQ2N 4DVBA 2BDNH 1SJHB 3TVMA 3SGEI 4F7MB 1Q72H 1D6EA 5GS1A 5CSZB 1IGYA 5I15L 5EUOF 1AJ7H 4OFIA 1YN7B 2Z35B 4XVTH 1N5YH 2RAMA 1AI1L 4YUEL 4EVNA 5JXEA 3VA2C 4OQTL 1FV1A 4AMKH 4PJGA 4CVWA 1GH7A 1U0QA 1IM9A 1NGWA 3EYSL 5INDB 2XOTA 5CINH 3CFCL 2UY7A 3G6DL 1KXVC 5SWSB 1YMHB 1HKFA 1B0GA 4JFXA 2W9DH 3RJQB 2NY7L 2XY1A 4FNLL 3C5JA 3UTPE 2CMRH 1HHHA 4MJIE 4JJ5A 2DLFL 1CZ8L 4B53A 3I85A 4UAOB 4OLYH 5EZLB 2PO6C 5CJQH 4JFYB 3QIUD 2AJZA 5KVGL 2PKDA 3FQWA 1FBIL 5L0QB 4OFVA 4YDKL 3Q6FB 4ZUTB 4LSRH 3BZFA 1DQTA 1ORQB 1JMXA 1I3GL 5E5RB 4YDIH 4ELKA 5I8CA 1T7ZA 2D0FA 3HR6A 5FA3A 1CFTA 1N4XL 1RHHA 2W0FA 1KT2B 1PD6A 4P5TB 3KNBB 1AXSB 3MRDB 4M1DH 4EN3A 1T7XA 3H3PH 5C2BH 3OPZL 2R0LH 4PJDA 4P57A 4XZUA 2MTPA 2F54B 2FECL 5IB1B 5FYLD 3FAWA 1ZA6B 2NTSP 3NPZB 3BKCL 2VDLL 4QHMA 4JFFD 5J1AA 2ZOKB 4QRUA 5FHBH 3IXTB 4WIQA 4L5FL 3EUUA 5CWSA 4RIRB 2XA3A 2E9WA 3V9FA 2P47B 5ENWB 2PETA 4BH8A 1DUYA 1BJ8A 2VSDA 3NIDE 5D71L 4C83B 4HKJB 4HIXL 2OBGA 3RIFK 3OKMA 2DD8H 2AAVA 4MS8D 1A4JB 4P2RD 3K0WA 3R0NA 1DBKL 1A6TA 2J8UB 1AGFA 1IEBA 3GKWH 4MAYA 1J1OL 4XXCA 4P46A 2VLJD 3UBXA 1FC2D 5B8CA 3GGWB 4L4VD 5I18L 3MRRA 3OJMB 4GQ9H 4WNQA 3S36X 1EGJH 2IMMA 1FRGL 4P2OC 5I76A 3D87B 3MJGX 4M7JL 1JI1A 3RWHB 4PG2A 3GIZH 1D5ZB 3VFWB 1JP5A 5M7QA 3GSOA 4JVPA 4Y4FB 2MFNA 1G0DA 4YK4C 4ALAL 5L8KB 3O2WL 2RJMA 5IQ9B 5I1GL 4AENA 5I71B 1MHEB 1T1ZB 1KN4H 3WUZA 4K7PX 3BMWA 2NY1B 4OT1L 5DMIL 5D5ME 1MIEL 3O6KH 4LIQH 5I66B 4U1HA 3OJVC 3VCLA 2YWYA 3ARBA 4N0FB 1CBVL 1XAUA 4B50A 1NMBH 1NBZB 4DCQA 2X89A 3GBMH 2F19H 5DFVC 3IDMB 1UACL 3CZJA 2XZAL 4YBHA 3TA3D 1NAMB 4G7YH 3HNTL 2J8OA 4HIEA 1FLRL 4L3EB 3KPSB 5JW4M 4P5KB 5K9KB 5FHAH 4R4FL 3H6JA 3NZHH 3LCYA 4CAGA 1INQA 4X5XA 2J3SA 4QRPB 3HUJA 2ATKA 7FABL 4OLVH 2VLRD 5BV7H 1N6VA 3VXSE 1S9KC 1AHWB 3CMGA 3FFCE 4LLWA 2C3XA 1I8LC 3VFPB 3QBTB 1T2XA 4OM0L 4C55A 5D70L 4MX7A 3MROA 2DTMH 4P59L 3MLRL 5JMRA 2W60A 1VCAA 3VD9A 1T03L 4I0KA 4UOJA 5GRUH 1TJIL 1DLFH 4PGZA 1MI5E 4ODVL 5E4IA 1NCCL 4Q9BA 3UYRL 1TCMA 3BPCB 3IJHA 3KYOA 1RJLB 3VRIB 2EKJA 2DQEL 4Y8DC 5DMGD 1CIUA 4G9DB 4L8CA 4Y16C 1BVLB 5MEPA 3DX6A 3X14A 4BKLA 5E8NA 3FO1B 5DK2B 1RIHL 1NDGB 1OGAD 3BH8A 4AEHH 1TXKA 1K4DB 4RRPA 5C1MB 2WANA 1W0VB 3OGOE 4XMKH 2GUOB 5K9OB 4NHUB 2HJKB 1WEJH 2R1YB 4BSWB 4DFIA 5D7JD 4K55A 4XNQB 2QSVA 5DGRA 4I5BB 4JRWA 4X99A 1HHIA 2CLRA 1RUAH 2KL6A 2CJUH 2VH5H 4BZ1L 1U58A 2F8VA 1DQLH 1JF1A 1T0PB 4I3SH 5L2KD 1MFCH 1G6RB 1E4XL 3FQXB 2BVOB 3ULUH 1IGIL 2CKBH 4XX1E 2VZUA 2D7TH 2V2TB 2VIRA 3VG0L 5DJAB 1NAML 5CS7A 3ZTNH 2Q87A 4HJJL 4XCEA 5BVJB 3DPBA 3MA7B 3L7EA 4RFOL 1Z5LA 4Y2DC 2P5ED 1PSKL 1IAOB 1LP9F 4WWKB 5CIPA 1QQDB 2E8YA 3LB6D 1D6VH 3I9GH 1DQDH 2P8MA 2XWJB 1F4WL 3KXFB 3LH2L 2Y6SD 4TPRL 3UZVB 1UM6L 4HFWA 1VFUA 4M1GH 1S7WA 2EDTA 2XV6B 3M8OL 5C0CE 2E7BA 4M8QB 1MPAH 2XWTB 3CH1B 4KROB 5F44A 3TZVA 1V5JA 3O8XB 1Z9OA 3NIFF 1BREA 3ZLQC 3CFEA 1NMCC 1CN4A 1C7SA 1P4IH 3OF6D 4H8WH 2AJUH 4K9EC 1WCBA 4ERSH 1MFAL 1A3LL 1H3TA 4HW6A 3ARVA 3FRPA 1MHHA 3T4AA 1ACZA 1BQHG 2R0ZL 2ID5A 4DKAA 1W8NA 5J11C 2JKXA 1YNTB 5EUOB 4NFBA 2NY4C 3VH8A 3LPGA 3QXDA 3TO4C 3OKOA 5A16A 5L88L 1QFWI 4OCXH 2OI9B 4M5YL 2BSRB 4NJAL 4IRJB 4QHUA 3VRJB 3BPOC 4L8SC 1F58H 4N8CH 4C59B 5MERA 5HYJE 3P4MA 5GSRB 5I1AB 1JHLL 3FB7B 4HDIB 3LPWA 3OR7B 3FQRA 3FOLA 1NGQH 1VFMA 2Y25A 5C6TL 1QBLL 3DLQR 1U93A 5HYFA 3PWJB 4YWGL 1CIDA 4IRZH 4ZDHB 4P5TD 3BXNB 4AG4L 1J0KA 1G6RL 4IOFD 4CMMB 3DHJA 5DF0A 1FGVH 1LHZA 2OZ4L 5EDXA 2GFBA 3R8BB 3WSQH 3GI8H 4Y1AE 4RX4D 3SJVA 2HFGH 4Z78A 2F54D 4HV8A 1Q9KA 4GSDL 5F3BB 1J18A 3F58H 1P69B 1QO3B 4WFFE 2VL4A 3B43A 5ISZE 3F6LA 3HLAA 5D2LA 4FMFA 3P9LA 5EBMB 1L0YA 2NY2C 2CLZA 3F7VA 3TYFA 1YEHL 2CLVB 2B4CH 1IAIM 2V7HB 4JG0H 3Q1SH 1F3JA 1HHJA 3EYUL 5HVFB 5EO1A 1QRKA 3K2UL 4C54A 3QG7H 2UYLA 2FB4L 5SWZA 1RQ5A 1TLKA 2RCSH 4KDTA 1DVFC 2DQFA 3RTQC 3QAZB 3QPXL 4LLDA 5LGHL 3K1DA 4NT6A 2BVTA 4KDVA 2Z8SA 5FDWB 4OCMC 3KPRB 4KI5F 4OCLC 4PDCE 4NZUL 3WIHA 3FT2B 3CX5J 5EG6C 4Y4FD 1A5FH 2VZ3A 1RSFA 3WNNA 3QIBA 1FN4B 4C56E 3VD3A 3KPMA 1LO4H 1LO0H 3M17B 15C8L 4PJ8A 2ZJSL 5MENA 3S7GA 4KXZH 3EYFB 3LD8C 3SKNB 4K3EL 1SYSA 2QQQA 1CICA 4GKSA 2X09A 2I27N 1LNUA 2NY1D 5F7NC 5FYKH 3RZWA 1B2WL 1L0XA 3C2AH 3IFLL 4HUKB 3QDJA 1PG7H 2E3VA 4PR5A 2HTKC 2QHLA 1HINH 1EGJA 1EHLL 3CFKB 5ADOL 4X7TA 1UM4H 3WN5C 2NX5A 4DK6A 5GJSL 1SM3L 1BIIB 5FF6B 4ZQKB 4XNZB 1YNLL 5TFSH 4WGVB 1YUHB 1ED3B 4L3ED 1S3KL 1NBQA 3KPSD 1JWUA 4Y4KA 1OLLA 6FABL 3OXSB 1P2CA 2EDJA 1DQJA 3ARTA 3CZFA 5EZIH 1IGCH 4KKBC 3VE0A 1RIVH 4QRPD 1IZJA 5IMOB 3S4SG 4JN1H 3W11C 3FN3A 3MUJA 4FXLA 1BFTA 3CH8A 3WXWL 1QD0A 5IVXA 3ESVF 3VFMB 3TF7A 1MJJA 5CSGA 3KYNA 4PTUA 2YXMA 3EO0B 1MCNA 5D93B 4YX2L 1D5IH 1IL1A 2GSGB 3RGHA 3CDGA 2VDOL 5TE7L 4GS7B 2P5WB 3BRFA 2JB6A 4RAVA 5DJDA 1AP2A 5C0BA 1KJVA 4LSTL 3QHFL 3DUSB 3MRFA 5F7MC 4G6FD 1OAZL 1DSFL 2HN7B 4ZTOL 5JLZB 4MXVE 1GIGL 3QIWC 1JGUL 2A74A 4XRCB 5D2NB 3C8KA 1N5AB 1RK1B 3BO8B 5IGXL 2I25N 3O0RL 4Z7UA 3ZKQD 4N8VA 1A0QL 2MKWA 4P3DB 2OQJA 4FFZL 5DQ9A 5FGSA 3WFCH 4OI9A 3VXUA 4WY7H 3WMSA 2MCPH 3S8WA 2E27H 5TF0A 1VGEH 4YHKH 4NC1E 2Q6WA 1KOAA 3RZCB 5CP3H 1HYSC 4TSBL 1JGDB 1T20B 5F1IB 5H94A 3NFNA 1FYTB 4ODHH 3TBWA 2PTUA 5E9DE 1E27A 3B8SA 5F3HB 5F6IB 1ORSA 4ZFZA 5ETUB 4J1UB 4U2ZA 2Y36H 3C9NB 2WWMC 3IRPX 2NR6C 1FFRA 5MEOB 4ZAKC 4WWKD 5IFAL 1J8KA 5B3JF 1KPVA 5ITBL 4XGZB 1CDUA 1I1FB 5GGVY 1BJ1J 3KXFD 1TNNA 1XGYH 1UWEH 3VRLF 4OUUA 5BJTB 4ZYKB 4PJEE 3QDGB 2CUMA 5IVNA 5F1OB 3VXTA 3CC5B 4KROD 4WUKH 4Y0GA 5TDNA 3U9UA 1PZ5B 5AEAA 2O5XH 5GGTA 3V0AC 1LP9B 2ZPKH 4XMLH 5EU6E 1FIGL 1AXTL 2FX9H 4M00A 3ARFB 1KIQA 3BKJH 3ARGC 5A3IC 3A6CH 3H9HA 3CLEL 5T5NF 1V3LA 3QJFA 1BOGB 5C3LD 3I6GA 1EUTA 4KC3B 4XP4L 3NH7H 3VWJC 5MP6L 3FT4B 5F7LB 4JO4L 3PQYA 5BMFL 2X4TA 3HHRB 3ZE1E 3MRQB 3DSFH 1MREL 4IRJD 5TQ0L 2BSTA 2DM4A 5KJRL 2JK5B 1IBGL 3TJHA 3AB0C 4HX1A 4IS6B 5TQ2H 1W0YT 4WU7A 4L3CA 3O9WB 5EO0A 4U1GB 4RBPH 4Y19E 3CGTA 3QQ3B 2GT9A 4QT5A 3T0EC 3DVIA 3RA7L 2A6DA 2IAMA 4ZFGL 3DX9A 1B88A 5E2UH 3EYOB 1Z9MA 4PRDA 1A6PA 1QSVA 5BQ7B 3LKSA 2VXUL 4F7PB 2CUIA 1N26A 1T89A 1I75A 1FNEA 2Z4QB 3BD3A 2B8OT 3LS5H 5EU7C 3GJEB 4EUPH 5KTEH 3QRFM 5BCAA 1CDBA 2XKNB 3CLFL 2R4RH 3LRSA 3BT2L 4ZSOA 1QYGL 1N0XL 5AWNH 2FR4B 3ARXA 1GZQB 2EDFA 4XC3L 2GITB 4S10A 3STZA 5FUOL 3EFFB 4RAUB 4G8IA 4JFFE 4EKXA 1CGSH 2G75A 1G9NL 2YPVL 1CYGA 4NNXA 3R06A 5HJ3A 1HQ4B 1A1OB 3V4VH 2G5BA 2YUWA 1HNFA 2VLKE 3AXLA 4NQSA 2VR4A 4HLZH 4U1JA 3IU4H 3BGMA 1FZOA 4XPHH 1S7XB 3KPRD 1HSAA 4NWTH 5IV2A 2PXYB 3LN5B 1VKXA 5I1DA 2BNUB 1O7VA 4R26H 1RFDH 4OCRH 4P2QA 1WISA 4GG8A 3T0XA 1NGXB 1FL5B 1CD1A 5E1AB 1NCTA 5FFLA 2ORBH 2ENSA 4NO5A 5J3HC 3MXVH 2YUZA 3MFGB 5J9PA 2HRPH 5GGSA 5FKAB 3LPFA 4HGWB 4IIQB 2VAAB 3SKMB 5GS2H 4WW2F 4HKBA 3DURA 4XPFL 1INEH 5C0AE 3NPSC 1R6VA 2MJWA 2MQ3A 4ODTL 4LDOB 3ARZA 1KCUH 4OZFA 1OAKL 3DV4B 2W65A 4LDLB 1XGQA 4G9FA 1V7ML 4PJAF 1BEYH 1FZKA 3KJ4C 4FZ8H 4KKNA 1MLCA 4S1RL 5F9JA 3ILQD 4XPAH 4WFED 4Y5VA 1OAYH 3RVTC 3F7YA 3P9MA 4R97C 5E7BA 2KKQA 5AYQA 3FN9A 1OHQA 1QBBA 4M7ZC 1IGTA 3FT3A 2D31A 4XH2A 1UM5L 1L8JA 1TJGH 3HG1E 1HH9B 4X4ZA 5H37G 4LGSB 3T3ME 4YHPA 3VFOA 3GZKA 4G6AC 3U6RA 1XF5B 1VACB 4NSKB 4JQIH 4KRPC 1JNJA 1ZA3A 4TVPE 3LQAH 1W72A 2AI0H 1QNZL 1FZJA 4Z0XA 1T1XB 3BWAA 2IALB 4UT6L 1WC7B 2A6IB 3BDBA 3BVNB 1U8KB 3U4BL 3ULVF 3QDHA 1KCSL 2FO4A 1BFVH 2P5WD 1NC4B 1HXYA 4KZDL 4YGVB 1JV5A 3BW9B 3B5GA 4NRZA 2WSKA 5C08D 1ROWA 5IJKC 1MLBB 3U0WH 3MRLA 1MVUB 3T77B 1AQKH 1GGCH 4UTAH 4RGNC 1U8MA 1KULA 5IBTL 5E24E 3QXWA 4LCUA 1ZHKA 5HHXH 3C08H 3JBG7 2IANA 4XAKE 1ZLUH 3VFUB 4RNRA 1FJ1B 3HMWH 1OGAE 4NQVA 3B83A 2W38A 2IH3B 4KAQL 4WCYH 2NYYD 2Q1EA 4JFOB 3RZCD 2IEPA 1PKQA 3MV8E 1XF3A 3S36L 8FABA 4NPYB 3PGCA 1EO8H 4F57H 5K59E 3QB7C 4HC1A 3BKMH 1BQLL 4TSAH 3O4LB 1FYTD 3MRGB 4GW5B 5IVZA 5CEYB 4L4TB 5JIPA 3HI1A 1NGPH 1YMME 1JWMB 5DO2C 1S7TB 2XZCL 2OK0H 4FTVE 1XH3A 5J56B 4MGXA 4P5MA 3I3EA 5E03A 1R5VA 2VXTH 3QH3B 4NC0B 3QUYB 4JO2H 4U6YA 3PNWB 5KSBA 1T7YA 4XCCH 3HPLB 2D7OA 1JHTA 1U8JB 2HFTA 5BZWB 3BFOA 3FO9A 3FQTB 3QG6B 3QYCA 5I8KL 2FD6H 5IWLC 4WRLA 3ABZA 4HPOL 4D0BA 4D2NA 2GCYB 3QA3A 3LHPH 3QDGD 3OKLA 3ZDZE 2A6KB 4NCC1 4RISH 1I1AB 3MRNA 5DUPH 1SY6L 2VLMD 5L8JB 3TIEA 4QOKB 4U3CA 4HH8A 3EOAB 1V8HA 3MACL 4PUBH 1DQQB 3QWQB 3FZUC 3ROOB 3ARFD 2A6JA 3E3QA 3IDGA 5IF0A 1A7QL 3MJ8B 2QQNH 4K94L 1MUJB 2D7PA 2VLLA 1UFUA 3RHWK 5L2JA 4Y5YA 5K9JH 3FONB 3PABA 3ROLB 1HXMB 2BVUA 4E42B 2EE6A 4AEIH 2BC4A 5BO1L 4G8EB 1CFSA 3VI4E 5DGQA 4LNVA 1EHAA 5T3XL 5EC1B 5TDPA 3D9AH 5D7SL 3TFKC 4ZTPL 5HI3D 5A2KH 2JE8A 3DV6B 3GEWB 5SV3A 4MJ5B 1U95B 4JRYA 1L7IH 5FO9A 2EYTA 3UDWC 4TUOA 1SEBA 3UTSB 1YQVL 3BUYB 1E0OB 1K4CB 4EI6A 4QRRB 1CTNA 3UYPA 5DC9B 3O9WD 4LSVH 3LMJH 1F6AB 5C0FB 1NBYB 4AT6A 2DQIL 1X5HA 4RWYH 1BLNA 4ZUVA 4DZBB 4U7KA 3EOYG 2GIYA 3MLYL 4F8TA 4H5SB 4X4ME 5DMKB 4XPTH 1K5NA 2BY0A 1CF8L 3MYJB 3OJDB 4I9WE 1GC1C 2WUCL 3O2DA 5IHUH 1IFHH 1OB1B 2IBGA 4OIIH 4YHOH 2ENYA 2AJVL 3MOAH 4ZUUB 1VEPA 3GSNA 2J8HA 1HKLL 4PJ5B 3B6SB 1GJIA 4UUJA 3TJEL 3BZ4A 1CL7L 3SO3B 1CXLA 3U1SH 2F54E 2F5AH 3TLRA 4R96A 2HTLC 3MRHA 4LCYB 5LCVL 1VPOL 2DL2A 1MAJA 3TV3H 3Q48A 3L3KB 3NFSH 1VFAB 1X7QB 1CGTA 1UH3A 4OAWA 3RWCB 4JQVC 3TBSB 4YFEA 5D7LE 3F5WB 5FK9B 3S96A 4HIIB 2ED7A 1T2QL 4UV4H 2ZUTA 1ZLVK 4X6FA 1MAKA 1A1NA 4NRXB 5LJYH 3MJ9H 4B7LA 1H5BA 4L8DA 3HI5H 2BSSA 4MAUH 2VC2L 4NNYA 3KHQA 5CUSH 5DJXB 4Z5RA 1JZ4A 1LO3H 2DQDH 3P0VH 5KSAA 1TVBB 2DBLH 1QLEL 2QSCL 3HNVL 1T22A 2PXYD 3GMPB 4FG6D 3AFLA 1KLUB 4EUPA 1TJHH 5JPMB 5FM5M 1AO7E 4MD4A 3MREB 1ETZA 1YNKH 5BS0D 2ARWA 1T04B 4N5ED 4CVZB 4Z18A 5GGUA 4JFZL 1D5BB 3K8KA 5CD5D 4NP4L 2V9RA 3RWIB 2IADB 2AEQL 4JEGB 2EIEA 1K85A 4MNGB 1H0DB 5KZCB 4LQFL 4FFWC 5EPMB 2EC8A 4JQXC 4KI5D 2PN5A 3IVKB 1J7VR 5TGBA 4WO4B 1J88A