3QI9C

Crystal structure of mouse cd1d-alpha-phosphotidylinositol with mouse valpha14-vbeta6 2a3-d nkt tcr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
201
structure length
196
Chain Sequence
b'TQVEQSPQSLVVRQGENSVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSACANAFNNSIIPEDTFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title A molecular basis for NKT cell recognition of CD1d-self-antigen
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 36
structure length 196
sequence length 201
ec nomenclature
pdb deposition date 2011-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qi9C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qi9C02
1AO7E 1RZGB 2A6DB 3KG5A 3JZ7A 2A83A 4NFDA 3MRKA 3CFCL 2YRLA 2VDNH 4X7FC 3U0PB 2NY0D 3QEUB 1T5WA 5C0DA 5L7XL 4OF7A 2B1AL 3QEGH 5ELIA 3U9PL 3O4LA 3O2DL 4KK8D 4HBCH 3ZT5A 5E99L 2EIDA 3D85B 4GG8A 5C09B 2BFVL 4P3DA 3HNSL 5F97E 1OD9A 2NY2B 4NNYB 3DI2B 2MMXA 1DEEA 3WIIL 5BJTB 3CUPB 3F62A 1R3IH 1PSKH 4W81A 3MA9H 3RWIB 4LPUA 1JRHH 4GLRI 1CBVL 4JB9H 4X4MA 3CPLA 2JCCF 4OB5H 5DD6A 1TNMA 4ZUUB 3QWOA 3GSQA 4FQJL 5IVZB 2A73B 1WAAE 5TE6H 5CINH 4JY5L 5EOTA 4PJCB 4PG2C 4UINL 3H8NA 2EDJA 3U6RB 5E2WL 1QSFA 2B1HH 3FN0L 1TVBB 1EVUA 2OP4L 2X4TB 4MJ4A 3C8HA 3G6JB 1X6NA 4P2OC 5BZDA 3MUGA 1ACYH 1EAPB 5BW7A 2A6KA 5IHZA 2P8LB 5CIPH 2QHLA 4AMKH 4OCWH 2AEPL 3WNNA 5D2LB 1JIBA 4JDZB 2HVJA 4YNYA 1YEJL 4LEOA 3F6IA 1R5IB 3MRCA 2GY7B 1IGTB 3BRDA 3O11B 4DW2H 5ISZA 1EO8L 4U1GC 2R1XA 3T0WA 1ORSB 5DJAB 5ESVB 4K7PY 1UXSA 3RVUD 5J4MA 3W2DL 3FJTA 1MI5A 3RWCA 3T0VA 3RWFB 3WLBB 4HUUB 5EO1A 5AEAA 2DQJH 4UB0H 3LVEA 4L8SB 2X4RB 2RIKA 3ARBA 1KN4L 1AE6L 3S3SA 3P9LB 2AS5M 1KC5H 1OGAB 2VO5A 4X6BA 4YHML 4JPWL 2GSIA 3VDBA 2BNQA 1TNNA 5KS9B 3GSOA 4UOW0 2UZYB 2CUIA 1JV5B 3MV8A 1UKQA 4LCWE 4PP2B 4PRHD 3IF1B 3RVWD 5F7DA 3U82B 4XB8A 2PW1B 2IG2H 4NC0B 3UPRA 2R8SL 4NQDD 4I18C 2DS4A 3DX7A 4RIRA 1S5HA 4JJHA 2VDOH 4OFDA 2H1PH 4NQCE 3TV3H 1NGPH 2C4XA 2CPCA 3GO1L 1F4HA 2P5WB 4HJJH 4NCDA 1HNGA 3STLB 3B3IB 3PV6A 4K7PL 5E2TH 3WNLA 3K2MC 2O5ZL 2A9NH 3VD5A 3TJHD 4S2SA 4NC1C 5DTFB 3RPIB 5F9JB 1E28A 3N06B 1DQDL 2QHRH 3T65B 2LU4A 3F7PC 1I8IB 2YZ8A 4Z7QE 1BJ1H 3KPSA 5EN2B 2F53A 5DMKA 3DIFB 5DJCB 1UC6A 5FYKL 1ZLSH 5IF0B 4ZSOA 4HIHB 5DMIL 1DSFL 4PLKC 3MRNB 1VGKA 3GMQB 1LEIA 4HH8A 3RWJB 5JOPE 5H8DA 2C26A 1RZJH 3X17A 2DLTA 2YK1H 4LLWB 1KFAH 4Y19A 1QSEB 1XMWA 3MRPB 1DQLH 3SBWC 3VFSB 2FLBT 1GOGA 3MO1A 1C5BL 4CJ1A 1MCRA 1ZANL 5F7YC 4QEGA 1J1PL 4KXZH 1DBAL 3K1KC 1UEMA 1UM4L 4I1NB 4JR9L 5F7EL 5F88B 4PRID 3QIBD 3BUTA 5IBTL 1QRNE 3TNMA 3WD5L 4W4NA 4Q9QH 3L6FA 5BXFA 3MV7D 4LLMB 5ICYB 5T1MB 1PLGH 3KHOA 3C2AL 4GO6B 2VLLA 4N90D 3GHBH 5AAMA 1IILE 1Q0YL 1K6QH 3K8KA 5D9SB 3H0TA 3KAAA 5IK3B 3QUXD 3DVNB 3QPXL 1R5WA 5F8QC 2B0SH 4PJGB 3OQ3B 4Y0GA 3VXPA 3JV4A 1OGTA 2BY3A 1GC1H 4H88L 3L3KB 3QXWA 4JPKH 2ZG1A 3OHXA 3TNNA 1CFBA 3A0OA 3MRHB 4QOKE 5DJXB 1SEQL 5FEBA 4HS3A 1C16B 5IHUL 2NY3C 3SGEH 3QYCA 2N1KA 1A5FL 5CSGA 4X8JA 4Q0XL 3AAZA 5BRZD 1UWEL 4HQQL 4QXUL 3C5SB 2R56L 4WFFE 1KULA 2APWA 5CJQH 4XCCL 5F7NC 4OZHF 1G9MC 2A83B 4HC1A 1T5WB 3X3FH 2VN7A 2ZUXA 3VFMA 5FFLA 3KHQA 5JW4M 5I75C 3ULVH 1NCTA 4O2EA 5F1IA 5KTEL 4L4VA 5MP6H 4GG8B 4WI8A 3QI9A 4P3DB 3VXRA 3ULUE 3WIHA 2A9MH 2H8PA 4PRPD 2HT2C 3SDCC 1TQBC 4XHJC 3U1SH 5K9OA 1DEEB 3OB0K 3GMPA 3GSNL 4PJ5E 5C0AD 2VLJA 2XY1A 1ZXQA 2VABB 1FDLL 3QUZD 1UM5H 3OPZL 5HHOE 3S3PA 3CPLB 4HK0A 5DD6B 3M8OL 3QWOB 3AMKA 3GSQB 2AABH 4NN5B 4J3VA 1WFOA 3KPTA 1DR9A 2A6IB 3HUJE 2I5YH 5E1AA 5EOTB 2IQAB 3KJ4C 4CVWA 2FHBA 1NCDL 2JB6A 2A2QT 1IAIL 2FLRT 3D9AH 1N4XL 1MCEA 5F1SA 1QSFB 2D4FA 4TUJA 5GISL 2BRRH 5FYLE 5IR1A 3O2VH 5D5MA 1FNAA 5BZDB 3MUGB 1QFWI 2A6KB 5IHZB 4HC1H 4OGXH 2MFNA 2HVJB 4YNYB 2XIDA 1AKJA 2OL3L 4LEOB 4OLUL 3MRCB 1V7ML 1U3YA 3HR6A 3CVHA 1AO7D 3WIHH 5ISZB 4NZRH 4LNVA 4HDIA 1R3HA 4K71B 4NHCL 4KH2A 4R97C 1QFPA 1DBJL 1T83A 4ZUSA 2NY4C 5I18H 2A74A 1MI5B 3CDGA 3BPCA 5LQBL 2M26A 3JTTA 1QR4A 4N9GA 5KBNC 2KDGA 4GW4A 4LKXA 3ARBB 3VI3E 4GMTH 1A3QA 3G5ZA 1OW0C 3FO0H 3UPCA 2GSIB 3PWPB 1LEGA 2BNQB 3LIZL 1JYWA 2Q3AA 1BMGA 3CX5K 4XBGA 1E4JA 5AG8A 5EU6D 4X9GA 1KF9B 1EDQA 4PJ8A 2I07A 5GGTH 1U8LA 4LKCB 2B2XL 2V2TB 3EFDH 3L1OL 4DFIA 3UPRB 4J3OC 3V0AC 3QBTB 4RIRB 3DX7B 3LEXB 5CLWA 1S5HB 4XP4H 4YWGL 2IPUK 4JQXC 2XACC 2DAVA 5J1AA 4P99A 4XP1H 3KYMA 1A6UH 3PV6B 4UT9H 3TA3D 4KROB 4M1GL 1E4XH 1M71A 3LHPH 4BH8A 1P6AB 2DD8H 3I3EA 3QIWC 4GW5A 4S2SB 4XNZB 4HKXA 5SWSD 4HWEL 1E28B 4LQFL 4M5ZH 3O3EB 1VESA 2PTTA 1T5XA 4IRJA 3UDWC 4YZFF 3CFCH 2IQ9L 3KPSB 4Z7VF 2F53B 3ARXA 3V6OE 3B9AA 3KPPA 5DMKB 5L7XH 4Y5VA 2B1AH 3U9PH 3DI3B 1TJHL 3O2DH 3WFZA 2EXWD 5E99H 4NWUL 4ZSOB 1LP9F 2BFVH 1NC4D 3HNSH 4H0IA 2BOBA 4PJ9C 2GSGB 4G8GD 4OZIF 1VGKB 3RZCD 1LEIB 3WIIH 4IIQA 2DN7A 1GL4B 3E1F1 4ELMB 4K94C 4WO4D 3C08L 1EERB 1FL5A 4Y19B 4E41D 4APQD 5FHAL 3RL1A 2JJSA 1CBVH 1I7ZA 4ONOA 2BP3A 3KLSA 5ALBL 5GS2D 4N0FA 5HDLA 4YHNA 2FJHA 4WWKA 1UACH 4UBDD 4EN3C 4JY5H 5DGRA 4UINH 1ZAGA 3TNMB 5JPNA 5E2WH 3L6FB 3RX5A 4LCIL 5HGBA 3FN0H 4B0MM 5DJ8A 1YZZA 2VLLB 2Z93A 4Z9KB 4I0PC 2ZP0T 3C5JB 4IMKC 3MRQA 1S9XA 1MHEA 2AEPH 4KKBC 1FL6A 1BVZA 2KZ1B 1YEJH 1D5XA 3VXPB 5B21A 4PV8A 3QR2A 5B8CC 1OGTB 3BW9A 2VQTA 3TH4T 1A6VL 3OHXB 3TNNB 4MCZA 3PABB 2H9GB 1EO8H 3RWDA 1Z9OA 2H3NA 4HS3B 1EIBA 1EEUA 1RZKC 4YHPA 4X8JB 3AAZB 3W2DH 5C07A 5CGMA 4CU8A 5M7QA 2MWCA 3BKJL 4P46C 2NXYB 4M7JL 2J8OA 1WGOA 4U1JA 3VFMB 4OBSA 4P2RD 1S9WA 4O2EB 5F1IB 1KN4H 3TF7C 4YHMH 3QI9B 3VXRB 2H8PB 4Y4FB 5F96L 1XH3B 3EYUH 4FFVC 1E4KC 3P4MA 3KXFE 5K9OB 3GMPB 5T1KD 2VLJB 5EB9A 1FFPA 1FLRL 2R8SH 4EEEA 5SWZD 2P1YA 3CSGA 5HY9A 4HK0B 5E4IA 1AHWC 1B0RA 2W38A 4ODWA 3MC0A 3GO1H 5E1AB 1XIWA 3SOBL 1P7QA 2ICES 1XT5A 2JB6B 2R0WL 4LVHC 2IPUG 3ARWA 4TUJB 5DGQA 4OI8A 4F9PA 3FQNA 4PR5A 1CFNA 4HS6B 1GSMA 4G6FB 5D5MB 5IR1B 1DQDH 2JB5L 4DFHA 5FM5O 3RUGF 3MBXL 2EDHA 2P5EB 4KK9C 5JW4R 5D7LA 1AKJB 2YD2A 5FYKH 5C0GA 1LO5A 1KJ2A 2WWMD 4DKAA 3DUSA 3ZHLA 3CVHB 3RBSA 2BRQA 1DSFH 3WV0A 1IGFH 3ZO0A 5TE4L 4HDIB 1R3HB 2YS4A 4RAUA 3MBED 1VFBA 3NA9L 4F37K 4MHHG 5CEZH 5FM5M 4ZUSB 3QXAA 2YSSA 4LVOC 3CDGB 3MOAL 3TZVA 3BPCB 2UZXB 1C5BH 1ZANH 3D3VE 3JTTB 4N9GB 1DBAH 4GW4B 4LKXB 4JR9H 5F7EH 3RPKA 1VPOH 3G5ZB 1TZGL 4KFZC 5IBTH 4BELD 3WD5H 2IAMB 4U1NA 1LEGB 3T0ED 4XBGB 3NCMA 1FZMA 3C2AH 2DLHA 4EDWL 1CQYA 3BRGC 2I07B 5GGVY 1Q0YH 1U8LB 3PUCA 5IUSA 1JWUA 1OAZL 3QPXH 5TF1L 4JHAL 1I8KA 3JWDC 2VLMD 2WZPD 4D0CA 5CZVL 1X5LA 5ADOL 1KPRA 1E4WL 1V3JA 2R2EB 3QFDB 3UC0L 1SEQH 5J1AB 3KYMB 3FT2A 4QRRA 5IHUH 5D7IA 1M71B 4BH8B 1A5FH 1OTSD 2IC2A 4GW5B 2MNUA 3QCTL 4Q0XH 5IMLA 1RPQA 1UWEH 4HQQH 4QXUH 2R56H 2UYLA 1A47A 5EIVA 3PQYD 4XCCH 2PTTB 1T5XB 4EIGB 1AQKL 5BV7H 4IRJB 3N1FC 5LCVL 5JMOC 3KPPB 4LSRL 3LDBB 2Y06L 4Y5VB 3VI4F 1SMOA 4YXLL 1NGZA 1EJ6A 4XCNA 5KTEH 1QEWA 1I4FA 3WHE0 5EFIA 1OP5H 2BOBB 4XMPL 4Z7UE 3Q6FA 3MV11 2OTUA 1YPZE 3B2VL 5GZND 3T1FA 1JNLL 4JREB 4FTVE 5GGVL 3E6HA 3M07A 1FL5B 1FDLH 2AAVA 2XTJD 4GFTB 3OPZH 1I7ZB 3M8OH 3KLHC 4YHNB 2FJHB 4WWKB 3DBXA 2JJUA 3PG2A 4ONHA 3VWKC 2Y9RT 1XGPB 4P2YA 1NCDH 1IAIH 2X89D 1W2KT 5JPNB 1N4XH 5GISH 5HGBB 2HFEA 3G6AA 3JXAA 1CLCA 3O4LD 4FRWA 3VXTA 2Z93B 4RDQG 4BFIA 2QBWA 2LAGB 5DC0A 4JFFA 3GMOB 2EDQA 3MRQB 2R0KL 1S9XB 1K8DA 1FL6B 1ZMYA 1D5XB 4PV8B 3CVIL 4OLUH 1WZLA 1MCLA 1V7MH 1FVDA 4RMVA 5EIIB 5CZXD 1KCUL 4R4NC 3VMOA 4F57L 4DEPC 1KN2H 4MCZB 5I2IA 1KCKA 3RWDB 2H3NB 4NHCH 4AQOA 1CVRA 4YHPB 4S1QL 3MXVL 3QCUL 4BUGA 5K59F 4DGYL 3ZE1E 5JW4N 1UKTA 2NTSP 3PWLB 1R6VA 3BKML 1A6AA 5C07B 3RBGA 3ARGA 5LQBH 3IRPX 4YXKL 3OB8A 3S9DB 4U1JB 4HS8L 3UO1L 1S9WB 4MNQD 4QHMA 3WNOA 2NR6D 3W0WA 3DVIA 1NAKL 1SYSA 3OKEA 1IVLA 3Q3GA 4OFVA 3LIZH 3P4MB 3KDMA 4F15C 1PG7X 4DUXA 2CLZA 4JFZL 3U79A 2B2XH 1FFPB 2ERJC 2H45A 4WIQA 4GKZB 5E5UB 5HY9B 2ZJSH 3I84A 4TPRL 5L9DL 4RAVB 1NANH 3IFNH 4KRPB 4TVPD 3RU8L 4WHCA 4JZOA 2CDEA 5JA9A 4HMEA 1XIWB 4P23A 1MI5D 1RZFL 5BS0A 4XXCA 1Z9LA 5KSAD 1FJ1B 4M1GH 1T7YA 4PJDB 1P4LA 3FQNB 3D6GA 2HT4D 1CFNB 4HWEH 4LQFH 2E7CA 2DB8A 2Z0BA 1U8QA 2DMKA 2GYSA 4EOWL 1NLDL 2IQ9H 2AI0L 3WO3B 5D1XA 2HMIC 3V79C 1HN1A 5F7FA 2V9TA 3MV8D 5C0GB 1TJHH 1N0LA 5I0ZA 2X7LA 3VD9A 1LO5B 4NWUH 1KJ2B 3DUSB 3QZWG 4J3TA 3F65A 3CSYA 3SE3A 5DRXA 4U0RB 4TTDD 4RAUB 5IMOA 3MCLL 3HUJF 1VFBB 3C08H 3D39A 4K3GA 3P0VL 1G7MA 3NIFF 2AXFA 2X70A 3QXAB 2YSSB 5FHAH 3QQ4A 5HXMA 2JCCA 3TZVB 1DUYA 2EICA 5ALBH 5GSVA 5BV7B 1I3RA 2NY6D 2EDTA 4OAWB 3BWAA 1QG3A 4HFWB 3VMPA 1J0YA 4N8VB 2F53D 3C5ZD 1FZMB 3BMWA 3OG6B 4YK4B 1J88A 2PYFA 2AJSL 4LRIC 5DK2A 3AMLA 4UT6H 1JWUB 1ZK9A 1I8KB 3WN5C 4FFWD 4IOIA 1T7WA 4D0CB 1JNJA 1A6VH 4DVBA 2YC1A 4P57B 4MJIE 4D9QE 4QNPF 3ARSA 1QPXA 3FT2B 3MJ9L 1TZHA 2Q7YA 2EYSA 5D7IB 1UH2A 1R3KA 5IMLB 1QZ1A 43C9A 1A9BA 1OB1A 1UM6L 3BKJH 1BBDL 4WW2C 2KBGA 1WLHA 1NGZB 4CNIA 5HYJA 4YHKL 1I4FB 3OXRA 3NIGF 5EFIB 5ICZA 3Q6FB 3BZEA 2EEBA 5F96H 3K0WA 4MQSB 1F3DH 2OTUB 4KU1A 3T1FB 1MFDL 4HKJA 4FQHA 3PHOA 3E6HB 4ZAKC 1BFTA 1FLRH 4RGMC 2MQ3A 4FZ8L 2E7MA 4EDXA 1JNNL 2I9TA 1KEGL 3DBXB 2NCMA 2NY1D 4ONHB 5F8RC 4KWUA 3V6FB 4LLVB 3SOBH 5I71B 4W6YB 1F6AA 1DANT 1BECA 2R0WH 3LN4A 5EOCL 4O2FA 2W59A 3G6AB 3PWUA 2PYED 1BREA 5D7JC 4BSVA 3VXTB 4NZUL 4BFIB 2JB5H 4L4VD 2ADIA 4CRPA 4JFFB 5F7LB 4LHUB 2R0LH 3MBXH 1K8DB 5IP4A 3DMMA 4WDIA 2EKJA 2HFGL 2OI9B 5JW4Q 4OF0A 3G6DL 1WITA 1FVDB 1G0XA 2FGWL 5HVHC 4YHZL 1X5KA 5HDQL 1J05A 2NY0C 2P44B 2VZ1A 5I2IB 1A64A 2DQTH 4KK8C 1MCOH 5TE4H 3VRIA 3NA9H 3S37X 2F8VA 3PHSA 2V2WA 3O9WD 1QBLL 2R4RL 2X4OA 4M4PA 1A6AB 2F9BT 1SJXA 1WUNT 5B3NA 4LSQH 2DQHL 3KR3L 4QHMB 4G6FD 2HA1A 1YEFL 1KT2A 3W0WB 3OKEB 1SYSB 3UYPA 5HI5D 2N7BA 5IFJB 4MHHI 1L0YA 5J1TC 4LL9A 3RIAK 3BZ4B 5EDXA 3KDMB 1MJUL 4RMSA 4EDWH 5F9DC 2CLZB 1YECL 5ESAA 2QKIA 4AIXA 1DVFB 1QHOA 1G7QA 2VXQL 3JWOC 5J3HD 1OAZH 5TF1H 4JHAH 3UYRL 5CZVH 5HGDA 5DFTA 1G7LA 5ADOH 4JZOB 2CDEB 2D0FA 1E4WH 3DARA 5FYJD 4P23B 3UC0H 3PDGA 4QXWA 5BS0B 1BVLA 4FZEH 4MB5A 1P4LB 3QAZC 3QCTH 4GLRH 3QG6A 1CXHA 1U8QB 4OZHA 1AQKH 4JFDB 4OFPA 4DZ8B 1BVKA 3RVUC 4JN1L 2EIBA 3ARPA 1FORL 5D1XB 5LCVH 4LSRH 2Y06H 4YXLH 4P9HL 1JHTA 2X7LB 4Q6YA 2MQ0A 4XC1L 1M4KA 4PJ8D 4U1MB 1TQCB 2X4QA 1T89A 2GK0A 1X6LA 1S7QA 4XMPH 2UWEA 2VLRE 1LO3H 3CSYB 4S11A 3QFJA 3B2VH 3U2SA 4NM8L 5DRXB 1JNLH 1KIQA 4LEXL 5GGVH 3W39A 1U3HD 5IBUG 4QRQA 4RZCA 3DYOA 1G7MB 2AXFB 3QA3A 2X70B 5L2JA 3QQ4B 2APFA 2Z4QB 2JCCB 4O58H 5EU7E 3OL2A 2CRYA 1DUYB 1J8KA 3ZKXB 4L9DA 5GSVB 2NYYD 3RVWC 1RMFL 3KLAA 2QTEA 3RHWK 1RULL 4GG6F 2Z9TA 3QHZL 3PGFL 3BWAB 1J0JA 3PL6D 2G5BA 4M93B 4V1DA 3L3HA 5GRYA 1DBML 2Q86B 3D25A 2MKWA 5GS0C 1PEWA 3SKUD 3VDCA 4HSQA 5DK0A 3FO9A 5EBGA 3TESA 2CKBA 3V2AR 2PYFB 4LLDB 5GRWA 4KDWA 1NCNA 2R0KH 5ABDE 4FQ1H 4YHLL 2XZAL 4XVTL 4KUZL 1A3LL 2YUXA 1IGIL 3AY4A 3CVIH 4IOIB 2FIKA 2R1YA 4LHJB 1KCUH 4DVBB 2YC1B 4F57H 3WXWL 3S4SB 4QRPE 2EYSB 2XKNA 4KJQD 3SDAA 2VXSL 4S1QH 3MXVH 3QCUH 3FT3B 4P2QE 5EUKA 3V5DB 2X4UA 3BKMH 3UTSE 1VGEL 1A9BB 1OAKL 1OB1B 1GGYA 3LN9A 3SHSA 2OXGA 2DF3A 4NO0D 4YXKH 2YD3A 1UZ6E 4HS8H 3UO1H 3FONA 1NFDF 3X13A 5HYJB 1XGRA 2DIAA 4GMSL 3OXRB 1P7HL 1NAKH 1UENA 5ICZB 1FC1A 3TVMD 4L4TE 4Y4KA 3BZEB 3P2TA 5JQHC 4K07A 5IHLB 1P5UA 3QIBC 1ZLWK 4HKJB 4FQHB 2AJYL 3CLFL 3T3MF 1L9MA 5IVNA 4JFZH 5A2LH 3TPUA 3S88L 1PKQA 4WNQA 1U2CA 1BWWA 1IAOA 3ARUA 3IDUA 1R0AL 1GGBL 1KCVL 1RIUL 4JFEE 2OYPA 3V6BR 3P77A 5FGRA 5H35A 4JRXD 4TPRH 3FHAA 5AG9A 5L9DH 4EDXB 2I9TB 3RU8H 4JG0L 3QUXC 5FCSH 1VB9A 1RZFH 3J8F7 3KPLA 1MEXL 1F6AB 4U1HA 3VFPA 3LN4B 3AXLA 3AUVA 4P5MA 4O2FB 3PWUB 1JGLH 4BSVB 1NEZA 3U30C 2ADIB 5CAYB 4KI5D 3I6GB 4U33A 2VXVH 3O45A 4EOWH 4YXHL 3ORJA 4HWUA 1JPGA 2QR0A 5H94A 4MQ7A 1NLDH 3RZWA 2AI0H 4WDIB 4ZPTA 3MFFA 5FGCB 3ROLB 2ICCA 2EC9U 4YX2L 3NIDF 4NWTL 1MIEH 5ACMA 3WCYA 5E9DA 1J05B 5DHXB 4P2OA 3HNVL 5EPMB 4LSDA 4JPVL 5HYIA 2AJZA 3BO8A 1F3RB 3VRIB 3S35X 4KRPD 1LO0L 3TN0D 3P0VH 4RQQB 1INDL 2V2WB 4N0UB 1OLLA 1QHPA 2EO1A 1P7QD 4PFEA 2X4OB 2YPLE 3U4BL 4Z76A 3OJ2C 3QUZC 4NKDA 1T1ZA 2E9JA 3ZDYE 2DL9A 2I9LB 1YDPA 4MDIA 1KT2B 5C08D 1JZ6A 3VXSA 2DQIL 2UV3A 5C09E 2PCPA 3CZJA 4M00A 5C0JB 1SBSL 5D7LD 4X6EA 5T5FL 3WUWG 4KJWC 4WW2F 2AJSH 5ESAB 2QKIB 3NACH 5HGGS 1G7QB 2E9IA 4AT6A 2ZSVA 3BGFC 1XR8A 3TCXA 2NY5C 4QRUA 1ZHLA 2WQRA 4JFOA 3LPFA 1LWRA 4MA8L 5FO9A 4Z8FL 3RIFF 1G7LB 3CFEA 1KLGA 1EA9C 3MJ7A 4RDQF 4PJCE 3K4AA 1HH9A 3HZKB 1G6RL 1X5FA 2CDFA 4I18A 1EFXA 3G6JE 1DP0A 2NY7L 1KPUA 3F7VA 3ZDXE 3QG6B 3SJVD 1UM6H 4KK6D 4OZHB 1D5BA 3O41A 4ZOEA 1T7XA 1BBDH 5D2LE 2CLVA 1CICD 5DQJB 4N68A 2YD5A 1JHTB 3SGKC 4YHKH 2PO6D 3FRPG 3AB0B 2X4QB 3H3PL 3A6CL 4YE4L 3O3BA 3QFJB 4CMMA 5CJOL 3U2SB 1MFDH 2BX5A 3VGAB 1KIQB 3W39B 1FGNL 4RZCB 3FFCA 4PRBA 2VWEC 2X40A 1JI1A 4YHYC 4FZ8H 3BEWA 4QRRD 1MCWW 1JNNH 2RFXA 2BDNL 3QDHA 5K9JL 3BP7A 1KEGH 5T1LD 2DOCA 3GMRA 3NPSB 4M6AA 4PV9A 4EI5B 5LGHL 4G9FA 3ZMRA 1H5BB 5T5NF 1X5GA 5F70A 2C7UA 1F90H 1OGAE 1CDCA 3OZ9H 4V1DB 1CL7I 1QVOA 2BNRA 5EOCH 5IFHL 5KS9E 1QR1A 3SBWA 5EBLB 3D25B 2C1PA 2YUZA 2GTZA 3HMXL 5DK0B 4D9RE 1CN4A 1JL8A 4NZUH 2CKBB 1DDHA 3TA3C 2RBLA 5C0IA 1AFVL 4G8FA 4NCC1 2GJ6D 2JJVA 4ODHL 2HFGH 3Q5TA 4ZFGL 1OP3H 3G6DH 3SKNA 2FIKB 4PRAA 2FGWH 4NJAL 5HDQH 5FO7A 1S7RB 2P5WE 3BT2H 2EXWC 1UCBH 3PP3H 3DO7A 2XKNB 5E8DL 3SQBA 5C86A 3SDAB 1WT5A 1RK0A 1UXWA 1XCTA 1WZ1L 1YC7A 5EUKB 3RZCC 1I1FA 2X4UB 1QBLH 2R4RH 3OGCA 4P4KB 4WO4C 4Q9BA 4WEBL 4APQC 2DQHH 3KR3H 3FONB 2APXA 3I3DA 4CUCA 4GRLB 1YEFH 3X13B 2F19L 3X3GL 1RUKL 3IJYA 1RUQL 1MHCA 4LSTL 2VNCA 4M1CC 4PLJD 5J11B 4Y4KB 1KIUA 4UBDC 3DRQA 1ETZA 2V5YA 1MJUH 4G8EA 4EBQL 1PKQB 4WNQB 1QSEE 2VXQH 1IAOB 4L3ED 3P77B 4ZO6A 5H35B 4KPHL 4PGDB 1DE4A 4RFNC 3SDCA 4OD1H 4G6JL 3LN5A 4M48L 2IEPA 4X0KA 3WE6B 1U8NA 3KPLB 1IBGL 3ARGD 4U1HB 3VFPB 3L5WB 1T04A 3S97C 3AXLB 4P5MB 1A7PL 2D7TL 4R2GD 3PIQA 1XEDA 2GAZB 1IL1A 4FNLH 5IQ9B 2W9LA 1JPGB 2QR0B 5H94B 4MQ7B 4JN1H 4Z7VB 1FORH 4PJGE 4ZPTB 3MFFB 3CK0L 4P9HH 1HSAA 1J1XL 5E9DB 1FCCA 1YYMH 4P2OB 1DL7L 5ACZB 2AJZB 1TJGL 2VC2L 1G9MH 1J8HD 4NM8H 4LEXH 5DJZA 3GUTA 3FL7A 5CS7A 4P23D 5C0RL 5EUOF 4Z76B 1RMFH 4U1GB 1HH6A 5K9QG 1RULH 4NKDB 1T1ZB 1BAFL 1U93A 3QHZH 1IAMA 3PGFH 4MDIB 1YDPB 5T3ZL 5I1LA 4H26A 4X4YA 1CXLA 2CIIA 4JFED 2V5RA 4EI6A 1DBMH 2PCPB 2MJWA 1DN2A 4X6EB 1AXTL 3ZTNL 4GBXC 3L3IA 4PY8J 3VXUA 4AT6B 4QRSA 1OW0A 4OCLC 2EIZA 1XR8B 2XZAH 4YGVA 4XVTH 4KUZH 3OAUL 1ZHLB 4QRUB 3OKDA 1A3LH 4JFOB 5FO9B 1IGIH 1QLEL 5JHDD 5L2KD 4QTHA 5AZ2L 2XPGA 1A7QL 3D39D 1VENA 3UTTD 1CI5A 3CFEB 5IROA 3WXWH 1KLGB 3MJ7B 3WS3A 3RWGB 4H1LG 1HH9B 1ZE3C 1QSFE 2CDFB 2VXSH 4I18B 3B9KD 1EFXB 1SJEA 3LPGA 3DURA 3F7VB 3MOQA 4JQXA 1VGEH 8CGTA 4O02L 1D5BB 3O41B 3MBEC 5GRJH 5JUEL 4X6DA 4FOMA 2F54B 2CLVB 3GB7A 3QRGL 2R2HA 1PDKA 2JK5A 4GMSH 4WHDA 3BD5A 3QIWA 2DM4A 2AXGB 2JIXD 3O3BB 5ISZE 3TYGL 3FB5A 2R4SL 3FQXA 4CMMB 5F3HA 3UDWA 2AJYH 3CLFH 1KB9K 5KZCB 1CXKA 4TYUA 3S88H 1OOAA 4LAQL 3T0EC 3FFCB 3IDXL 4PRBB 4LLQA 1R0AH 1GGBH 1KCVH 1RIUH 4HH9A 3BEWB 4Z78A 4MDJA 4PJ9A 1K8IA 3VJ6A 2OSLA 3BP6A 4JY4A 5CWSB 5H37H 2RFXB 1ZWIA 3GMRB 2CK0L 4JG0H 2EXYD 4G9FB 3EHBD 4PJBF 1Y18A 4M7ZC 2C7UB 4MXVF 1MEXH 1II4E 4U0QB 3PWPE 2BNRB 1QVOB 2BNQE 1QR1B 1F2XK 1OSZA 3W5NA 1YYLL 4L9LC 4YGAB 3SE9L 2GTZB 3ZT6A 5LGJA 3MNVB 4YBQD 4X6FB 2EEAA 1DDHB 3JUYA 5B39G 4EN3A 5C0IB 1KTRL 1ZHBB 3LCYA 3LAFA 4G5ZL 4YX2H 4OV5A 3QPQC 1BF2A 3SKNB 4NWTH 4PRAB 2V7NA 3H9HB 5FO7B 4CAGA 3HNVH 4I0PA 4JPVH 1REIA 4IMKA 3GBLA 3DO7B 1B0GB 2DM2A 5JW5A 1Z2KA 4J3XA 1LO0H 2GK2A 3UTPE 5ANMA 2YR3A 1RK0B 5LXGL 1JGEA 1UXWB 1XCTB 1INDH 5B8CA 2ORBL 1QKZL 4LFHD 5GZNC 1I1FB 3OGCB 5GS3A 1BWMA 2XTJC 3KPSE 4L3CA 2NY3B 4K94H 3ABZA 4H20L 1DBKL 2DQIH 3IJYB 4ZSOE 1MHCB 4HWBA 3CXHK 3NCCB 3BI9X 1EFQA 3O3AA 3DRQB 3DMMD 2NQCA 3SDYL 1ETZB 1SBSH 4P46A 4YDLC 4G8EB 1L4IA 5SX4H 4ELME 2HAZA 2R9HD 4Y19E 1PVHA 3LEYL 3UBXG 5SX5H 1AGDA 1HHHA 5HHMB 5IQ7L 1IARB 1DE4B 4Z8FH 3VXQB 3SDCB 3VXNA 1TQBB 1E4KA 1OWRM 3ZKSD 5SV4A 3LN5B 4X0KB 3QDAA 5JTWA 2OK0L 1PG7L 1T04B 4RSVA 5CZXC 1MHHA 3WEXA 5IKCA 3PIQB 1PJ9A 3HMXA 4QRTB 1IL1B 1PBYA 2IF7A 1CXIA 2O93L 1GZQA 1SVCP 4Y5XC 1IFHL 3KJ4B 4X9BA 3OJMB 4GUPA 5T3XD 4Y16D 2BMKA 1HSAB 4FQIL 5E4EC 5ITFA 3A6CH 1ROWA 4YE4H 1K3ZA 2AK4A 1KGCE 4AY0A 2NR6C 5CJOH 5ERWA 5TDOB 1IMHC 3NAAL 1FGNH 5DJZB 3GUTB 5FKPA 4JO1H 1A21A 2XWBA 3QHTC 2W9EL 3GJFA 4JRYE 4K7FA 1IM9D 2BDNH 1HH6B 5JORA 3MLPA 4NO2A 4RWHA 1U93B 5LGHH 2BY1A 5I1LB 4N0RA 4QHKI 4R97B 2ZG2A 5DSCB 1MLBA 2CIIB 4OF5A 3VXRE 2WMPA 2GW5A 2NY4B 4TUOA 3CZFB 5FCUL 4EI6B 4NQEA 5IFHH 3LQAC 4J3SA 2VZSA 3MRMA 1RIHL 5HVGB 3HMXH 1D5MB 1SYVB 4EQ2A 2VLJE 1KLFA 5KSAC 1MCQA 3L3IB 3W82A 3VXUB 2HT4C 4QRSB 2EIZB 4YGVB 5DC9B 4ODHH 4XPHL 3OKDB 4ZFGH 1EGJA 3ECBA 3MA7A 1BQSA 1S9YA 1U95A 4MD0A 4QTHB 2XPGB 4NJAH 5CMAA 1AGEA 2NXZD 4WV1C 3WS3B 1EZVY 4IBLT 2EDKA 5E8DH 2AEQL 5F7MC 2APBA 4YJZL 2OTPA 4G80A 1WZ1H 5D5ME 3DURB 3GJFH 1S7XA 4TTDC 2ED7A 3X14A 4V1DD 5I16A 3O0RL 2P5EE 1T2JA 4X6DB 4WEBH 3HCVA 5GGRY 3GB7B 2R2HB 2JK5B 1NDMA 1P69B 2AJXH 2F19H 5BO1L 3X3GH 1RUKH 2EDDA 3QIWB 4YUEL 3ZHDA 4HHAA 3FZUC 2NY6C 4LSTH 4L1HA 1X4YA 1CWVA 1MJJA 3D18B 3MXWL 4JRWA 5IFAL 3RAJL 3RJDA 3FB5B 3FQXB 5F3HB 1ZHKB 2F58L 4YFEA 1CDGA 1F4YL 1U91A 3ZDZE 5ID0B 5DYOA 4EBQH 4S1SL 1WCBA 4IDLA 3WFBL 1FO0A 4HK3J 3C5ZC 4HH9B 1J12A 2RHEA 1VFUA 3QXVA 5CSBA 3REVA 4Z78B 4MDJB 4PJ9B 1K8IB 1CDIA 1EGJH 3VJ6B 2OSLB 3BP6B 4GQ9L 4JY4B 1NBZA 3SDAD 1ZWIB 1EHAA 4G6JH 3HI1A 5KAQG 2VUYA 1HWHB 4M48H 1Y18B 3HG1D 4OF6A 2V7HA 2V6HA 1IBGH 1GGTA 4WFGE 2MCPL 3BH9A 1A7PH 3VRLF 1BZ9A 4ODTL 2D7TH 4HXAL 5LGJB 3RWEA 3T0AA 4YO0A 5DJ0A 4HZLA 2EDRA 4EN3B 3VWKA 5TH2A 1P6FA 4I9WD 1E6OL 3EYQD 1CYGA 3CK0H 5I15H 1Y0LA 4OV5B 1J1XH 4OI9A 4GAYA 2V7NB 4E42A 5D6CA 3KGRA 1T2XA 1CT8A 3E6FA 3VE0A 1DL7H 4I0PB 1OHQA 2VC2H 4GRMA 2NPLX 5JW5B 3F8UB 5HDBE 5JXAL 5ANMB 9CGTA 5KN5B 1JGEB 4KAQH 3NCYS 5B8CB 3T08A 5C0RH 3P9MA 3GSWA 3RNKA 4F7EA 1S78D 3STZA 3GIVB 4WCYL 1ZSDA 4Q97A 4GG6A 1NAML 2MPAH 4L3CB 5HPMA 2K1MA 1GVIA 1ADQA 5T3ZH 2DQUL 1NBYA 3U4AA 4G8IA 3I75A 5F1NA 4GS7C 2V17L 3UYOD 4ZTOL 1LQSR 1A8JH 4O4YL 2NY1C 3O3AB 5HGHA 4P46B 3VFOA 1AXTH 1JP5A 3SGDH 3ZTNH 2Q76A 5E9DD 1DFBL 4MXWL 4LRNL 1AGDB 1HHHB 3ZYIA 2PXYA 1MUJA 3OAUH 1NMAL 3UTZA 1ZVHA 1QLEH 1Q72L 2HLAA 5AZ2H 3VXNB 1A7QH 5EO0A 3DNKA 4ISVA 4PGBA 1S5IL 3BYTA 5HHVL 4FQCL 4EUPG 5IW3A 3RVXD 1MHHB 3WEXB 1NCAL 1AHWB 5IKCB 5JDSA 3BD3A 3VXSD 3MUHL 2X1WL 4O02H 1GZQB 5JUEH 5FOBA 1JWMA 3W9DA 3PF2A 1URLA 5A2IH 3O9WC 4LVHB 2BMKB 3W81A 3OMZA 5ITFB 5E5RB 4NYLB 2IPTL 1CL7L 4U6HA 5C0BA 2AK4B 4C56D 3TYGH 2R4SH 4MAYD 1JPST 1I9IL 2J5LC 3IDXH 5FKPB 1LO2L 1HEZA 2XWBB 3ALPA 5FAAA 1IQWL 4CVUA 3GJFB 2F15A 4K7FB 4HWZA 5C07E 3ZE0F 1J11A 3QQ3A 1FNHA 2D0HA 2GY5A 3M1BA 2XXCB 4OBRA 4NO2B 2CK0H 5J3HC 5CBEA 4R26L 5A43C 4KDTC 1F5WA 4TNWF 1YMMD 2EKSA 1MCFA 4W4OC 1MLBB 4NBYB 1UB5B 4TUOB 4LVOB 5DK3A 3LRSA 3MRMB 1TMCB 5K33A 1YYLH 3SE9H 5D93C 3LQZA 4CBPA 1HNFA 5IVOA 3UJTL 4YAQA 2FYYA 2KUTA 3ULVD 1CD0A 4XPTL 5CEZE 5I1IH 4BSJA 4UTAL 3FO1A 3OG4B 4PJFF 4G5ZH 3ECBB 3MA7B 1U95B 4GXUM 5F7HA 4Y8DC 2CIKA 3IGAB 4LPVA 4XVUC 3C87A 4L29A 1Q9LA 1HIML 1JFQL 1GJIA 2WBJD 2CO7B 1RK1B 7CGTA 1RJZA 1QBBA 2DI8A 1KYOK 2HKFL 4PJ8C 1YY9D 5E00A 4ODUA 2EZ0D 2R23A 2WUBL 4PJDE 5LXGH 3FAXA 3Q0HA 4AM0A 3WN5A 1QKZH 1RU9L 3OR6A 1NLBH 1S7XB 2C4FT 5TFSL 3X14B 5HHXL 3HFML 1U3HC 3TT1L 5I16B 5TDNA 3HCVB 1KIRA 2YEZA 1G84A 1GGUA 3QDGD 1NDMB 4H20H 3VXMD 3AS2A 2NYYC 4HHAB 2IH1A 5MERA 4M6ML 4NO3A 1MJJB 5GRXG 2YD1A 2I25N 3RWHA 3SDYH 5DR5H 3PL6C 4WW2A 1U91B 2MHAA 5DYOB 1PY4A 1WCBB 5IG7A 1FO0B 3LEYH 4KV5F 5DZLA 4QF1A 3REVB 4X4ZA 5IQ7H 1NBZB 1FFOB 1TZIA 1A1OB 2D2OA 4M9OA 3HI1B 1Y6KR 1RHFA 3O2WL 3T2OA 2XZQL 4PJXF 1MIMH 3HE6C 2V7HB 4ZAKA 5I1CL 2OK0H 1PG7H 4OLZL 1BD2A 3BH9B 4H0GA 4X9HA 2Q8AL 3RWEB 5DJ0B 2OXHA 4MJ2A 4HZLB 3P40A 4KJQC 5KOMC 3QP3A 3VWKB 5TH2B 5I6XC 2FHFA 1IFHH 4LSVL 5FV1L 1AP2A 1IC4L 1Y0LB 1NL0H 4FQIH 4XNQA 5HI4D 4GAYB 4BZYA 5C6TL 2ZSWA 4E42B 1CT8B 3E6FB 5DZOA 3VE0B 1EPFA 1K5NA 5I1AA 3QDJD 4HG4J 4XP9L 4GRMB 4ODXA 4OQTL 4LK4A 2KQMA 3ME0A 3NAAH 5D7IE 5ILTH 3TVMC 4NQVB 1ACZA 1X4XA 5CGTA 5KSBF 1X5YA 3P9MB 5I8EA 3VCLA 3GSWB 2W9EH 3RNKB 3EJZD 1XFPA 4DEPB 1FCGA 3K46A 1AH1A 2FEDD 4X5WA 2P24A 1OP9A 1ZSDB 4GG6B 4CU7A 2XICA 4UUJB 5HPMB 5J13C 1G7PB 3FCTA 2ICWJ 3BEVA 1C1EL 4R0LC 4G8IB 3I75B 5F1NB 4Y1AD 1N59A 4Q7DA 2W9DL 3C6SA 5FCUH 4IDJL 3TWCL 3ARED 3G04A 1RIHH 5HGHB 2EE3A 4DKFL 5CEXA 5C3LD 1I8LC 4KKAD 2Q76B 1F11B 4LGRB 2R2BA 5J89A 2EC8A 4GRWF 4MD5A 1GPOL 1EO7A 1MUJB 3UTZB 3TBTA 4KI5C 4X98A 4UT7L 2HLAB 3EDDA 5FKAA 5EO0B 4F15B 4ISVB 5JNYA 4PGBB 1LDPH 2ERJB 1DUZA 2ZWLT 3UAJD 2AEQH 2HP4A 4J1UA 2E9BA 1ZV5A 4FABL 4F2MA 3M17B 3KS0J 5F9OL 3GJEA 2XWTA 4JFFE 3TN0C 3QZWA 2NY4D 3MACL 2AV7B 3SQOL 3NZ8A 1HKFA 3O0RH 5FOBB 1JWMB 4W68A 4Z7NE 3W9DB 4DWHA 1B88A 4MD4A 3KPRB 1E4XI 2E9WA 2Y7QA 1UT9A 1NFDB 1F45A 3EFFA 1F13A 5BO1H 3VGHA 1LEKA 2L7JA 4R96A 4YUEH 5J6GA 3CH1A 3GI8L 4U6HB 5C0BB 3MXWH 5IFAH 3RAJH 1AR1D 2VZ3A 3GBNL 4ORZC 2F58H 2W92A 1F4YH 3D2UD 1I8MA 4GW1A 4S1SH 4J12A 4TSBL 3WFBH 3H9SA 1HEZB 1S7UA 4DTGL 3C8KA 3TO4D 4HWZB 4GQ9H 3ZSTA 1PYWA 3QQ3B 4UIMA 2FHCA 5A2KH 3M1BB 4MAUL 5CBEB 4Z95L 3BKCL 4JG1L 1GAFL 2UZIL 2CUHA 1OT1A 2EKSB 1BIIA 1BJ1J 1DQQB 3BDYL 3W0WE 2BOCB 4LQ1A 2MCPH 1AGBB 3T2PA 3WDIA 3LRSB 4PRHA 4ODTH 4LCUA 4HXAH 1FN4B 3LQZB 4YAQB 5EC1B 3FQRB 2FYYB 3QUKA 3STBA 4YDKL 4UTBL 1AI1L 3H3BC 5D6DC 4NUJA 3FO1B 4UZGA 5E8OB 1ZLUK 1E6OH 2C9AA 2D31A 1T22A 4KK6C 2DKUA 2CIKB 2IJ0C 1OL0A 4L29B 3NFNA 1Q9LB 3B5HA 1KJMA 2GKIA 1CICC 5A2FA 1RJZB 4IMLB 3PWNA 5BS0E 2PO6C 5E00B 4ODUB 5JXAH 2R23B 4AM0B 4LARL 3LS5L 4MWFA 3WN5B 1P7KA 4X9FA 3OR6B 4PUBH 5EUOA 4MVBD 3OR7A 2X09A 2XN9D 4Y89A 3WL9A 5I1EL 1CS6A 4JFDE 3WS6C 4F7PA 4JFHD 4WCYH 5TDNB 1KOAA 2D9CA 1OTTC 1KIRB 1NAMH 2YEZB 4FA8A 1S7SA 3HB3D 3NFSL 5TE7L 5GJSH 3QH3A 2HFTA 2H32A 2DQUH 4DN4L 2V17H 4ZTOH 2RAMA 2IH1B 3K81A 5MERB 4NO3B 1M7XA 4O4YH 3OAZK 1Z0NA 1BP3B 3RWHB 4H5SA 2DTML 2FATH 2J7LA 2FEEL 4K8RL 1ZOXA 3G9AB 4WW2B 5FYKD 2MHAB 4QYOB 5IG7B 5I8KL 1QBAA 5DXWA 3B9DA 1DFBH 4MXWH 4LRNH 4QF1B 2JCCE 5D1ZD 2P43B 1NMAH 2N7AA 1I9EA 1Q72H 2LAAA 5ADPL 1TZIB 4QLRA 5D5MF 2DM3A 5KVFL 1A1NB 1U8OA 3BHBA 4BQBA 1S5IH 3FHQA 4ZAKB 5HHVH 1NFIA 3H7BA 4FQCH 2FB4L 3EDKA 1BD2B 4RGMB 1R24A 1S8DA 1KJ3L 1NCAH 3O6KL 4D0BA 3QNYA 2ZUWA 4WEMB 4RA3A 3VD3A 4J3WA 3QUXA 4OLYL 1HDMA 4HLZH 1HHGA 4CN4A 5I1DB 4PTTA 1UGNA 3O8XD 4P46D 2DKSA 1UFUA 2H32H 4LCYA 1XGQA 4XNQB 3MUZ1 4X6CA 5IV2A 5D7JB 4ZS7L 2ZSWB 1I1AD 2IPTH 2GUOA 1K5NB 5I1AB 1KELH 4NM4H 4ODXB 3K1DA 1MHPL 1OAXL 3EDFA 4HG4K 2CJUL 2DI7A 5BRZA 5BZWA 3VGEA 4PLJC 4ZFOA 1LO2H 3ZKQD 5I8EB 3VCLB 1W72A 1IQWH 2FR4A 5HVHB 2NY0B 4X5WB 4LFHG 4R26H 4XB7A 3MMEA 4DOHB 4PJBA 5IT2L 3FCTB 5HYJE 1NKOA 3BEVB 2ZCKL 4PRPA 4M6OL 2BJML 2WK2A 1N59B 3C6SB 2VDML 1FE8L 3G04B 4DZBA 2BC4A 2B7DT 5C0AA 4OLWL 1FH5L 5CEXB 2X6MA 4XNMB 3UJTH 3ARGC 4XPBL 3V4PL 5DFWH 4HF5L 1QA9A 5KAQF 2R2BB 4UTAH 1BX2A 4MD5B 4R2GC 1Q1JL 2L7UA 2QADD 5ECJE 1YEHL 4HUWA 5FKAB 1K2DA 5TPWL 4LNRB 3GDBA 4R4BA 3Q2CA 2HKFH 3VWJD 1T1WA 4HAFA 1DUZB 4QT5A 3MRRA 4J1UB 2WUBH 4XXDA 5IGXL 1W72H 1NGWA 3GJEB 2XWTB 5TFSH 5DA0B 5HHXH 4P49A 3QZWB 4JJ5A 3HFMH 4WJ5A 3MV9D 4NQED 3TT1H 3NZ8B 5DHYA 4XRCA 3ZL4L 1R3IL 4MD4B 2MKLC 5FGCE 2Y7QB 1PSKL 3DSNA 3EFFB 4UOW1 5GRUL 1AO7A 1H3PL 4Y5YC 1LEKB 4R96B 3QAZB 5J6GB 3CH1B 2DIJA 4M6MH 1GYAA 4GAFB 5JDJA 1I8MB 4GW1B 4KRLB 1MH5A 3PDOB 4OLXL 3L3GA 1JHLL 2DQDL 5E08L 5HGAA 3C9NA 3H9SB 4N0UE 5KOVC 1S7UB 3SGKA 3C8KB 2VDPL 1LDSA 1X5ZA 4FQ2L 1BQLL 4DUWA 1PYWB 4UIMB 3IDGA 1NAMB 4ODSL 2XZQH 1OARL 1KENL 1W0VB 2H2PD 5I1CH 4CKVX 1XF5B 4OLZH 5CJXC 1HE7A 2P48B 5EU6A 3UXFA 1WICA 4PRHB 4KY1L 3E3QE 2M1KA 4LCUB 3SE8L 4BZ1L 5CD5D 4UQ2A 2QSTA 3QUKB 4GXUN 3V0WL 1FNEA 4NUJB 2FO4B 3B9KC 4LSVH 3S5LG 4M3JA 5AYQA 3MLTA 2WWKO 25C8L 2NZ9C 4R90L 4NN7C 4O00A 5E03A 4DAGL 1MLCA 1KJMB 4U2ZA 4XP9H 3TA3A 3PWNB 4OQTH 4YH6A 3HTLX 1H3TA 5SWSA 4R8WL 3BAEL 4L3AA 1KC5L 4KI5F 4MWFB 1P7KB 4WI7A 2SEBA 2X41A 3EKCA 5EUOB 4LPTA 3OR7B 3MREB 1MQ8A 4OZHE 4RX4D 3WL9B 4F7PB 1YEEL 1R3JA 1WWAX 2UVFA 3QO1A 2H32B 1C1EH 4G8GA 3V4VL 2VSCA 2W9DH 4IDJH 3TWCH 1CLOL 3RZCA 4OM0L 3QFJE 5C0FA 2EXYC 3EHBC 3H7LA 3IDIA 4H5SB 4WO4A 4MNGA 1EV2E 4DKFH 4E41A 3J7HA 4APQA 3BKYL 3T8XA 4CMHC 5F89B 1INQA 1XZ0A 3BIBX 4QTIL 4ORGA 5DMJB 4TVPL 4YBQC 3LQAL 4UT7H 2LABA 1WTLA 3QIBB 1U8OB 5BOPA 5HYSG 1YNLL 2WLZA 2A77L 1NFIB 3MV7B 3H7BB 4NQTA 4O51A 4NQCA 1R24B 1ZLVH 1S8DB 1OT2A 1NANI 4V2BA 4AK1A 4D0BB 3BDBA 1F6LL 2ATPB 4FABH 2XG4A 2WIIB 5AD0A 5F9OH 3QUXB 4TOYL 1HDMB 1HHGB 3MACH 3SQOH 4PGCA 3LY6A 4NRXA 4KTYA 1V7NL 4Z6AT 4WI3A 1ZT7A 4LCYB 1XGQB 3WJJC 1DQLL 4X6CB 5IV2B 4HIEA 3GI8H 2GUOB 3U30B 2PXYD 4ENED 5DMGD 3GBNH 4NP4L 2CK2A 5BRZB 4ZFOB 4TSBH 4XBPA 4N0YL 3L95A 3BZFA 4DTGH 3DMMC 5GS2H 3RY4A 1W72B 3TEUA 4IHOB 2FR4B 2R9HC 3VRJA 1SJHA 2HJLA 4MAUH 4Z95H 3MMEB 4JG1H 1GAFH 1K6QL 2UZIH 4MXQD 4PJBB 5I76A 1BOYA 2NX5D 3BDYH 3WUWA 1GRWA 2DMBA 4PRPB 4L8DA 1K4DA 1NEZG 4UQ3B 2GFBA 4DZBB 1FNGA 2BC4B 5C0AB 5T1KA 5GGSA 2VLKD 3QUZB 3ARRA 4BYHA 4YDKH 1PKQE 5SWZA 4UTBH 1AI1H 1QA9B 5C0BD 3BFOA 1BX2B 1RY7B 5I8OL 3WSQL 4QWWD 5I74C 2WM0A 3RX7A 3QT2A 4FFYL 4HUWB 2EYRB 1K2DB 1D9KD 3LKNA 5IJVB 1JTPA 4HV8A 4Y16C 4R4BB 4GBXA 1T1WB 4LGPB 4K9EL 4HULB 4QT5B 5DEZA 1FVCB 3MRRB 3ET9F 3BGFB 5MEND 3EYVA 4XXDB 3VFNA 4LARH 3LS5H 4QOKA 4JQVC 1NGWB 3FRPA 5I1EH 1CR9L 4JJ5B 4YZFE 3SGJA 5L8JB 5DHYB 4Z7VE 4XRCB 1B0WA 5D1QD 2BSTA 3NFSH 5TE7H 1UB6A 1QFOA 1AO7B 4DN4H 1EK3A 4A6YA 5IBUB 1H8NA 4YHOL 2KH2B 4X7DC 4OZIE 1HYSC 2DTMH 2AABL 1WBZA 4K8RH 4Z7WF 3HLAA 2ZOLA 3LH2H 1MH5B 5E8PA 5I8KH 4MZ3A 5HGAB 5LWYL 3C9NB 4HX1A 4N1CA 4NZTH 3ILPB 4BFBD 1T89C 1KXQE 3IDGB 4MSWB 3VMNA 5KVFH 1D6EA 3QJHA 4HC1L 2H26A 1MCDA 1UJTA 5FA4A 2FB4H 2VXUL 1RHHA 5FM8A 5EU6B 5F6HI 4YHYB 1V3MA 3SY0A 1T03L 1KJ3H 3O6KH 2VQ1A 5EA0L 2NXZC 4PRDB 5CKGA 1HHIA 4OGYL 4UQ2B 3BE1L 4C4KO 1MJ8L 2CKNA 3WIHL 4PJEF 4OLYH 2YKLL 1FNEB 1XF1A 2QQQA 2G75B 3CCHA 4IRSA 1C12A 3MLTB 3O3UN 5C70A 4HWNA 1K9TA 3RGVD 4WFHE 4L9LA 1M1SA 3IYLW 1N5YL 1MLCB 3IU3A 1LK2A 3TA3B 2EDFA 1OAXH 3CFDA 1MCNA 2CJUH 5SWSB 1SHMA 4LLUA 5JIKA 3FOLA 3PQYA 5L88L 3EYFB 1EEQA 2SEBB 4P59L 3V95A 3NCJL 4ZAKD 4TRPL 5HJ3A 3BQUA 5C0CD 3GMNB 4KK5D 1G9NL 5DC4B 3QDMD 2F54E 3P3YA 4NT6A 4I3GA 3U46A 1IRAY 1R3JB 1XGTA 5IT2H 4OCRL 2ZCKH 2YPKA 4NC1E 3FN3A 4M6OH 4G8GB 2VDMH 4LVNC 3RZCB 5C0FB 1FE8H 3CMGA 1N6UA 4AJ0A 3IDIB 4LP4A 4OFKA 2HTKD 4WO4B 4OLWH 4MNGB 3EAKA 1FH5H 3CVHL 3INUL 2OJZL 4E41B 3V4PH 5MHSD 4APQB 1MFAL 3FFCE 3T8XB 4HF5H 1INQB 3SPVA 2D03H 3U7YL 1Q1JH 4PJFA 2W60A 1BPVA 3GSRA 5FYJL 4F9LC 2R2CA 4BFEA 3V5HA 4YDJA 4G9FE 5TPWH 3EYQC 2MOVA 4RGOL 2X89A 3SCMD 3B5GA 4LU5L 1OPGL 2CGRL 2BNRE 4O51B 5E56A 4NQCB 2CO6B 3P0GB 2AXJA 1FNFA 3A67H 4O5LH 5MEPA 4RFNB 2G60L 4RGND 5AD0B 5IGXH 1LE5B 3RUGE 2DWDA 2EYTA 4PGCB 1BBJA 4NRXB 3ZL4H 4JDTL 1AD0A 5FV2A 1ZT7B 2XNAA 5GRUH 1H3PH 1S78C 4HIEB 5AWNL 3L3JA 2K9UA 1CTOA 3HPLA 4POUB 4Y5XA 5DHVA 1YJDC 1UACL 4OLXH 4XBPB 1JHLH 2DQDH 5E08H 3L95B 3BZFB 5I8CA 5I1GH 3ZE2F 3F6LA 4MJ5A 2VDPH 4FQ2H 4JM2D 5CP3A 4UILL 2IAND 1BQLH 4P2RB 4MNQA 3VRJB 1SJHB 4MA1C 2HJLB 1YUHA 4ODSH 5I76B 4PJXA 4X7CC 2OR9H 1OARH 2LTQC 2BZDA 3WUWB 1KENH 4L8DB 1K4DB 3WNKA 2GFBB 3UZEA 4KY1H 4BZ1H 1P84K 5T1KB 3SE8H 5GGSB 3V0WH 2ESVD 5SWZB 3RVXC 5C92A 5HHME 1P5VA 25C8H 5F1OB 4H1LA 2YXFA 4R90H 2J2ZA 4M62L 3GBMH 4DAGH 3LKNB 3H9SD 4HV8B 3TBYA 5J56B 3DXAD 1IAKA 5KSAA 4GBXB 4KGJA 5DHVH 3GNML 2D7PA 4R8WH 2LVCA 3BAEH 1TPXC 3EYVB 2W0FA 3VFNB 5KSBA 3CX5J 2E7LC 4OUUA 4NHUA 5MEOA 3MLXL 1PX4A 4MAYC 2V9RA 1MWAL 3QWQB 3EYUL 2XTLA 3P73A 3ZSSA 1JPSL 4WV1A 1T1XA 1TCMA 4NZJA 2BCKA 1YEEH 1AGCA 3VI4E 5HYQA 1C08B 2BSTB 5CBAA 4PGEA 1A02N 4J8RA 4OIIL 3UEZA 3S36X 4A6YB 2G9HA 3V4VH 1G7JA 1CLOH 1B6UA 2YUVA 4OM0H 4Z5RA 3MBEB 1WBZB 3JV6A 3HLAB 2ZOLB 5E8PB 3TIEA 3MNZB 5GS0D 3BKYH 2XWJA 2ZNXA 1D7FA 1NEUA 4HX1B 4QTIH 4I8DA 2B5IC 4TVPH 3ULVC 4H1LH 5IMMA 1A4KA 3FB6A 4POZC 3LQAH 1D6VL 4TULL 3UTQA 1WIOA 3K3QA 2X10A 1D6EB 3ESUF 3QJHB 1YNLH 3S8WA 2H26B 2A77H 3T0EB 2WAHA 5FA4B 3C5ZA 1RHHB 1U8JB 5B39A 3L7EA 1X3DA 5LJYH 2WBJC 3SY0B 5E8EA 2VQ1B 3MUY1 2ITDA 3B9VA 1NGQL 1HHIB 1OP5K 1F3DJ 1YY9C 1IGFL 4TOYH 4CGTA 3WHE1 2EZ0C 3CCHB 1V5JA 4H0HB 1C12B 3VXUE 3EGSA 4M7ZB 2VZTA 2WP3O 3MRFA 1V7NH 1J0IA 4NGHH 4LAJH 5CEZL 4M5YL 1JNHA 1MCCA 4L9LB 4HGKC 1FAKT 3IU3B 1LK2B 3QQNA 4NSKA 5GS1C 4NP4H 1JK8A 1VSCA 3CFDB 1RFDL 2FNBA 3P4LA 5K59E 2DICA 4LLUB 1MVFA 1VPOL 3QIUD 2E5EA 3FOLB 4N0YH 3PQYB 4GRWH 4TNVF 1HCFX 5HJ3B 1IZKA 1EHXA 4PS4L 2IADA 4X6DE 2XQYK 4HCRA 1HOCA 4NT6B 1WBYA 3JVGC 3U46B 1XGTB 4WUUE 4BM7A 4FXKA 4WTZG 1KEML 3N1PC 2YPKB 4R7NA 4HD9A 5I30L 1WT5C 3D3VA 1NC2D 2HG5A 3E2HC 4IJ3C 2C3HA 4N8PA 3UBXA 1KJ2L 1HILA 5IEKA 2XTJB 3FO2B 4OKVA 3TJEH 3C09C 5EZJA 3W9EA 1W0WA 3SPVB 5I8OH 3WSQH 4PJFB 4HW6A 4FFYH 3GSRB 3I6LD 4JY6A 3V5HB 4YDJB 1EUUA 5CCKL 3HPJA 4YDLB 4W6XB 5BV7L 1PGRB 3MRKB 1YN6A 1F4XL 1A7BA 4K9EH 2PYEA 5HI4C 5C0DB 3O4LB 5CGYD 2PUQT 1OQOA 3LKQA 4KKCD 5MEPB 4QY8A 4ZOAA 4E9LA 4S1DD 3EYOA 4KKNA 2UWEF 2AJ3A 3OTTA 1CR9H 1CZ8L 1PZ5A 2DWDB 2EYTB 5C6WH 3T77A 1BBJB 3GIZL 1GOFA 2WINA 3BZDA 3EJZC 1AD0B 2P8MA 2XNAB 5F9AC 1JF5A 2GITA 1FAIL 2FEDC 5E24E 4YHOH 1A1MA 2W65A 3HPLB 3VGDA 4Y5XB 4FXGA 5DHVB 1L0XA 1PX3A 3FN9A 3CSPA 1MRDL 3AREC 3O9WA 4ELKA 3NIFE 1UEYA 5GSRA 5LWYH 2FX9L 4KJWD 5I8CB 2VDRL 4GKOA 4MJ5B 5E4EB 1N7ML 3FTGA 1ZVSA 1I1CA 1WC7A 4KKAC 4WI9A 1CU4L 4MNQB 3TH2T 1YUHB 3LEVL 4PJXB 2OTWA 1UCTA 4Y8AA 2H6PA 2VXUH 5CJ8A 3CH8A 5JXED 1T03H 1MOEA 1V8HA 5EA0H 4F80A 4OGYH 3BE1H 1KG0A 1MJ8H 1KN2L 3UAJC 2YKLH 3FOMA 2R1XB 4KDTA 4WFEE 5AUMA 4WW1A 4W4OA 4J23A 1NDGA 2EDYA 1UXSB 3BOVA 4H1LB 4K7PX 3NCFB 4NOFA 3VH8G 1QACA 3RWCB 3ZTJH 2Q7NA 1N5YH 4LCCC 3TBYB 2Z31D 1CDHA 1FBIL 4NRZA 4UMGA 4OQ1A 4QNPE 3ILQD 1IAKB 2E8YA 5EO1B 5KSAB 4EZMA 3KYNA 3RI5K 3TT3L 1TLKA 2CR3A 2XFXA 4KQ3L 3K8LA 5KSBB 2KKQA 5L88H 4X6BB 1AR1C 2BSED 4OUUB 4NHUB 4P59H 5MEOB 3NCJH 4TRPH 4AL8L 3GSOB 4OI7A 1MY7A 5DVOA 4WV1B 3MV8B 1T1XB 2GCYA 1G9NH 3D69A 2BCKB 2Z8SA 3V7AG 1AGCB 5HYQB 5IROC 3R8QA 5CBAB 4PGEB 1N5AA 3TO4C 5FGBA 5F7DB 2C5DC 3NIGE 4J8RB 4OCRH 4BUHA 2ZJSL 1G7JB 1GHFL 2AK4E 3CFBA 3IFNL 4I3SL 4Z5RB 4RWYL 1U3HA 3CVHH 4KC3B 3INUH 3JV6B 2YD9A 2OJZH 2IFFL 1MFAH 3TIEB 2BSSA 2XWJB 4GRWB 1Z9MA 1T7VA 3U7YH 2CRIA 2ZUUA 3IXAA 2NY6B 5ALCH 5IMMB 1A4KB 3FB6B 4CN1A 4X5LA 3UTQB 5FYJH 3H9ZA 3PL6A 4LBEA 3BGMA 4RMTA 4RGOH 2WBWB 4FP8L 3HZMA 4LDEB 4DKDC 4LU5H 3C5ZB 1OPGH 2CGRH 5B39B 3L7EB 5E8EB 2ITDB 2G60H 3C60A 5C2UB 4OTXH 1DCLA 5GRVL 3EGSB 3HE6A 3U9UA 1C5DA 4JDTH 1CK0L 1FFRA 4MVBC 4TVSa 2FSEA 1UVQA 4U4BA 5AWNH 1A22B 4RMRA 3MO1B 3HB3C 3BESR 4ZUTA 3RY5A 4LCWD 4M1CD 2D7NA 1RZ8A 5J12C 2GI7A 1CFVL 1SQ2N 1QD0A 5B22A 2VE6A 5HVFB 4TTGA 1A6TA 5BXFB 5DD0L 4NO0A 4QXTA 1MWAA 4M8VA 4UILH 2M2DA 4NQCD 2IADB 1AGFA 1HOCB 1YEDA 5D7KE 3H0TB 1KIPA 5D1ZC 3VGGA 4UT6L 4FXKB 5HBBA 3TVMA 4R7NB 1R5WB 5J1SC 2BHUA 2HG5B 1UWXH 3JV4B 1C7TA 3IDMA 5DQDL 5GZOD 3UBXB 1BZ7A 3SO5A 2EDOA 1HILB 2WW8A 3ZZ1A 4MQXC 5JMRA 4OKVB 5GIRA 2GJZA 3W9EB 1L6ZA 2AJUL 5KW9L 1W0WB 5EULV 4JRXA 4GJTB 1WF5A 2R15A 4R0LA 4X99A 4GS7B 1JMZA 2NY1B 2FBOJ 4EUPA 4M62H 4WVRA 3FB7A 4LHQB 3HPJB 5T3ZE 4UU9A 1I8LA 3O8XC 4M1DL 3PGCA 5JOPD 2PYEB 4F7TA 2HKHL 3OWEA 3GNMH 1I1AC 4QHLA 4ALAL 4L4VB 2J3SA 5KG9A 1JF6A 4QY8B 1ODAA 3BPNC 3EYOB 4MLSA 3MLXH 2AJ3B 1SY6L 1MWAH 4PG9A 3MODL 2FJGA 2FH6A 1PZ5B 1JPSH 3ES6A 4JEGB 2WINB 3LQMA 3RDTD 2P8MB 1EXUA 1QRND 2GITB 5KANG 5CFHA 4M7LL 4OIIH 5E2VL 5TQ2H 1X7QA 3IAGC 4XVSH 3EDEA 5E7FA 2LQRA 3LKRA 1A1MB 1T66D 1UH3A 1JYXA 3TN0A 4UI2A 3HE7D 4FXGB 2CUMA 3O9WB 4C57C 4ELKB 2CXGA 4HK3N 4HLJA 5BQ7A 1WC7B 1V3LA 4GBXD 4EUPH 1DN0A 1D6VH 4IRZL 4TULH 4C83A 3BN3B 4GG6E 1CD9B 5C08A 3L3DA 4QOKD 1FPTL 1JGVH 2R0LL 3DX9A 4PD4K 4PJHF 2QADC 3LKOA 2J5LB 2OTWB 5ACLA 2H6PB 4AENA 4NKIH 4XPFL 4I2XA 1O5DT 1KCLA 1NGQH 2F8OA 1CD1A 4WFFD 3GRWA 4DUVA 3VWJC 1NMCC 2CRMA 2OZ4L 2DQTL 3QQ9D 3HZVA 5CHNA 3U48A 1MCOL 2Q6WA 4K3EL 5AUMB 4G7YL 5C71A 4I3RH 1NDGB 2XOTA 3OKLA 4HUKB 4M5YH 1G6VK 4Y4HD 3ULUD 2A74B 4KVNL 5D93B 4MCYA 1FZJA 5IIEA 4NRZB 1C8PA 5HVWA 1P2CA 5D6DA 1IC1A 5DUML 4PJ5D 3KYNB 4N8CL 4LSQL 1RFDH 3QUML 3THML 2XFXB 4XMLH 3SJVA 5HHOD 5I17A 4FMFA 1FC2D 3X11A 1BZQK 1FFNA 2XYCA 4PS4H 1CICA 4WHYG 2GCYB 3D69B 3UJIL 3T3PF 1ITBB 4PJ8B 2X4NA 2PO6A 3KPRE 3SO3C 1N5AB 3NA4A 4LIQL 4WWID 1NFDE 2DIBA 1KEMH 3QEQE 1M6OA 1WQVT 5I30H 3BH8A 4IRSD 5FYLD 1LVEA 2BVOA 4P5KA 5L0QC 1I85C 3CFBB 1KJ2H 1U3HB 2JLLA 3WS6A 1NKRA 3VD7A 3T3ME 3ZKND 2H2PC 2KQNA 2OS7A 1WZMA 4NPYA 2BSSB 4P3WA 1YMHA 4ONGL 1JWSA 4FZEL 1ZA6A 5CD5C 3IXAB 1T6WA 1FZOA 5T1LA 3TBWA 4FXLA 2IBGA 4HKXB 4FMKA 3NMEA 3BPOC 1AQDA 5SX4I 5CCKH 2FH8A 3PL6B 3G5VA 4JGMA 3C6LD 3QPQD 3QWRD 4CJ0A 3GKWL 3HZMB 1F4XH 4B41A 3BQUD 3E8UL 5B3JF 1I9JL 4MMZC 1DQJA 2HLFD 1LO3L 2GJ6A 1CZ8H 5DURD 2XY2A 1MFCL 3HE6B 3U9UB 4LF3A 3GIZH 4IIQB 2OCFD 4MA3A 1C5DB 1S7VA 3EJYD 2FSEB 3NIDE 5M95B 1FAIH 3RL1B 3MJ8A 1UVQB 4O58L 4ZUTB 4N0FB 2HWZL 3MGOA 1RZ8B 5J9PA 5I6XB 4M8QA 4Z7WA 1MRDH 2D9QB 2VE6B 1WTGT 2FX9H 1H15A 4L8BA 1P1ZA 1A6TB 2VDRH 1N7MH 4WU5A 5J6HA 4NO0B 4QXTB 1MWAB 4LPWA 1JZ3A 1YA5A 5DJ8B 5JZ7C 1CU4H 1MCPL 4U31A 1AGFB 1YEDB 4K3JL 3LEVH 1KIPB 1H3WM 3TVMB 1MHEB 4JN2A 4FQ1L 1NCBH 2UVEA 2ZUVA 3IDMB 1KTKE 4RMWA 1BZ7B 3V52H 1B2WL 3BW9B 2DL2A 1QBML 4PJEA 5GIRB 4N9OB 4L3EA 2JELL 2GJZB 3VU2A 4PLNC 3NPZB 4JRXB 4GOSA 4R0LB 4X99B 4NJ9L 4ZPVA 1HHKA 1TETH 5GQBA 4EUPB 3NN8A 4GH7B 3FB7B 2CMRH 1GGCL 2I60L 2HH0L 3AM8C 1INEL 4UU9B 1FBIH 1U6AL 4KVCL 4XAKE 1KB5A 4X6DF 3PGCB 1Q8MA 4F7TB 4HEME 1BD2E 2EDWA 3DJ9A 2X1QA 3TT3H 2M8XA 3QNXA 4KQ3H 3RKDD 5C8JA 5KG9B 2PXYC 2CH8A 4ENEC 5DMGC 2JJWA 4PG9B 4AL8H 2FJGB 2ZZUT 4QO1A 3ES6B 1BOGA 2CKBL 2VRAA 1T0PB 5JA8B 1X4ZA 4URTB 1EXUB 1U8KA 3O6ML 2EE9A 1KXVC 3QNZA 2AXHA 1GHFH 1X7QB 1B0RB 5DS8A 1J8HA 4ODWB 4MXQC 4XCFL 3LKRB 4I3SH 3TN0B 4RWYH 2D7MA 1CIDA 1FYTE 3MCG1 2BHYA 2IFFH 2I26N 4PJ7F 1P7QB 4XWOC 4Y5YA 5BQ7B 2HJKA 3QO0A 1OD7A 1DN0B 1JGLL 4PR5B 4C83B 5C08B 3RGHA 1B4JL 4DOHE 4Z7OF 4JFEA 2VXVL 4QWWC 4JVUA 3DX9B 3MRLA 1JYNA 2HN7A 3LKOB 1KB5H 4FP8H 3VFWA 5E95B 1D9KC 2Z35A 4AENB 5D7LB 1ERNA 4K3DL 1EEYA 4I2XB 1CGTA 1MIEL 4OLVH 5K9KA 2VERN 1F2QA 5F3BA 3WHXA 3HZVB 5CHNB 2Q6WB 2Q1EA 4C59B 4QGTA 5JHDA 5L2KA 3UTTA 5CJXA 1CK0H 3MOBL 5BMFL 3PV7A 4MCYB 1FZJB 3VFVA 5D1QC 5IIEB 1UA6L 4XNXL 3KXFD 4BKLA 3FZUD 4PBXA 3W11D 2ZOKA 3EW3B 1F42A 3B9KA 4FQXD 3CFIC 3OAYH 1CFVH 2CLRA 3SJVB 4BH7A 5I17B 4U1NB 5DD0H 5E1HB 3X11B 1QO3A 1SY6A 2OQJA 4JKWA 4NNXA 2C1OA 1FFNB 1CICB 3DUUA 2X4NB 2PO6B 1WV7T 4I48A 1WWWX 1YJDL 3PGDA 3NACL 2YPLA 1M6OB 2JIXA 2QSVA 3BH8B 3QEUA 5DQDH 5CJ5A 2BVOB 3I3BA 1OP3K 3TM6A 2XZZA 5FO8A 4ESKA 1KPRB 4NPYB 5DVMA 4RMQA 2AJUH 2QQKL 5C9KA 3LSOA 1YMHB 15C8L 1IKFL 4N5UA 4NNYA 5KW9H 4QRRB 1JWSB 3PHQA 1TENA 1ZA6B 1P9MA 3PP3K 3FKUS 3PWJA 3CUPA 5T1LB 1QUNA 4ZS6D 3TBWB 5IB2A 2RGSA 3F7YA 3SGDI 2UYLB 1AQDB 3G08A 3G5VB 4BSWA 3RGVC 4M1DH 2HKHH 5IVZA 6FABL 1W0YT 4ALAH 4XCNB 4PRHE 5E6ID 1QEWB 2AQ3A 3CJJA 1DQJB 5B4MD 3C8DA 5IVXF 2LFGA 2OZ4A 1SY6H 4NQDE 2GJ6B 3D3VD 3MODH 4XWGL 2X4TA 4LF3B 4MA3B 3ARDD 1S7VB 2ED9A 4MA7H 1I3UA 4M6NL 1PY9A 1YEKL 3F12A 1JF1A 3MJ8B 1MJ7L 3B83A 3MX0A 4KK5C 4M7LH 5E2VH 4RMUA 5D2LA 4KJPD 3VG9C 1Z9SA 3MROA 3MGOB 3CDCA 1IGML 5J9PB 4BK4A 4Z7WB 3QUMA 3O11A 1CGSL 1NBQA 3MRIA 5DFVD 1F90L 1DQTA 4L8BB 2J88L 2HTKC 3OZ9L 4CN6A 2D7QA 3WJJA 4WU5B 5EUOE 5J6HB 2HFEB 5ESVA 3JWNC 4IRZH 5DRWA 3SDXF 2DYPD 3OXSA 2RR3A 4XX1G 4U3HA 5EU4A 1C5CL 1J7VR 1FPTH 3HA0A 1I7TA 5DDHA 3WFHA 3OV6A 3EOBA 4JN2B 2Y72A 4K55A 4YBHA 5INCA 1NBVL 4PYGA 3NZHL 4XPFH 1HXYA 3SCMC 3GKZA 1OGAA 5F21B 4PJEB 2AEWA 4ZYKA 2OZ4H 2HVKA 4L3EB 3BT2L 3D87B 4K3EH 1UCBL 4G7YH 3SDDC 4RGNC 5FDYA 4I4WA 4ZPVB 1HHKB 3NN8B 3AFLA 1YN7A 1DQML 5IBLD 3OF6D 3O4OB 4KVNH 4PRIE 3NCEB 2PW1A 4YFDB 3ARGB 1KB5B 5FXCH 3MV7E 1ITCA 2RCSL 3UZVB 5DUMH 2YWYA 4FTVD 4N8CH 4R2GB 3QUMH 3THMH 1FQ9C 3QNXB 4N90E 4KJYA 1ZEAL 1CE1L 5D2NC 1MREL 1J1OL 1WCQA 1MCHA 3Q3GB 1NUGA 1U42A 1H3UA 3AB0C 4Y16A 3UJIH 1BOGB 4OFYA 4XHQA 5FUOL 3T65A 4LIQH 5FYJU 2V5MA 1T21A 3LB6D 4JM2C 3IB4A 1U8KB 4FQLL 4X6CE 1XAUA 3QNZB 5D8JL 4F7MA 2DLFL 1EBAA 1T0NA 4JQVA 1J8HB 5DS8B 3DIFA 5JPMA 1SM3L 3GMLA 4OD1L 5F72S 4B53A 5BRZE 4HIHA 3ZYJA 2ZUSA 3MRNA 4ONGH 4OM1L 1QSVA 4Y5YB 2HJKB 3GMQA 1IM9A 2K7PA 2EECA 1CGVA 4S0TD 2ILLA 2Y1VA 4FNLL 4JFEB 4PJBE 1HXMA 3MRLB 4MXVE 4XVUD 2HN7B 3GKWH 4PRPE 5GJTL 3CGTA 3VFWB 4HGWA 1BF8A 3I2CH 3RTQD 3E8UH 4KRMB 3S5LA 1EEYB 1I9JH 5C0AE 4NKQB 4ZOCA 4AEHL 1YYML 4HIJA 3MUJA 5F3BB 3WHXB 2PF6A 5T3XH 2DQFA 2YRZA 5JLZA 1G9ML 2PETA 4HJ0D 1MFCH 5AZEL 5IMOB 5JHDB 5L2KB 2CRZA 1A4JA 3D39B 1ND0A 3UTTB 4XBEL 3ARFD 1WEJL 3BN9D 5IK3A 3DVNA 3VD4A 1SVZA 4MLIA 3VFVB 1X5IA 1I1RA 4BK5A 4BKLB 3AVEA 2HWZH 1I3RB 2ZOKB 4EXPX 3B9KB 3MLVL 5IW1A 2P46B 1FG9C 2CLRB 3VXOA 4BH7B 4HPOL 4LMQI 4NQSA 4LPXA 4NN7B 1QO3B 5E8NA 2OQJB 3PDDA 2C1OB 4NNXB 1MCPH 4JM4L 4I48B 2A38A 4K3JH 3MCKA 3PGDB 3C60D 5DK2B 1KNOA 5F7UA 3FRUA 2YPLB 2JIXB 5CIPA 2ICWA 1QFUL 5GRZA 3HE6D 4PJIF 4POYA 3DHJA 3PJSA 1B2WH 5FO8B 3L5IA 1QBMH 5GXBB 1QNZL 1DEDA 4YPGA 2JELH 4QHNA 3LSOB 1TZHB 3PHQB 2Q7YB 5HYSA 2HTLD 2VMFA 3PWJB 4NJ9H 5IB2B 1R3KB 3BXNA 3PXJA 1JZ7A 4HGMA 2VABA 4XP5L 3F7YB 1GGCH 2I60H 3HG1A 2VDLL 2HH0H 2VSDA 3EOAA 3G08B 5FUCC 43C9B 1INEH 1UADC 4BSWB 1U6AH 5GRJL 4KVCH 1EVTC 4EVNA 4OSUL 4CMHB 2VWEE 5EU6E 4CNIB 3A6BL 2A6IA 3WFDL 2IQAA 1CLZL 3HMWL 4PGZA 1JI2A 3CU1A 4F9LA 3O6FD 5M94B 3IT8D 1X5AA 3QIUC 1TTFA 2Y07H 2CKBH 4YDIL 3PHOB 1BHGA 3TP4A 1CFTA 1QP1A 3O6MH 3F12B 4NUGH 1JF1B 4L4JA 4JZNA 5JQ6L 5SX5K 1EHLL 4P0DA 5DVLA 4XCFH 3MROB 4FG6D 2R39A 3O81A 5SWSE 3QUMB 5IW6A 1AD9A 1EBPA 1W8NA 3MRIB 1J0HA 4BQ9A 5FA3A 5CKAA 1KCRL 5DRWB 2K3TA 3OXSB 4MJID 4W70A 3MLYH 4D9QD 1B4JH 4ETYA 5EU4B 2C4FU 2O61A 1CVSC 3TC9A 1I7TB 5DDHB 3WFHB 3EOBB 5A3ID 4OFIA 1N64L 4G8GE 3B8SA 5INCB 3DMMB 4K3DH 1HXYB 4MNGE 2Y4SA 4LPCA 4E41E 5JIIA 1O7VA 4ZYKB 3BRFA 2HVKB 3PWPA 5CGYC 3KS0H 3IETA 2DM7A 4KKCC 2DLGA 1ZTXL 1B6DA 2DLIA 4I4WB 4S1DC 1CTNA 3MOBH 4LKCA 4G6AD 1YN7B 5BMFH 2V2TA 3MYJA 1UA6H 4XNXH 1L9NA 2LU7A 1VEMA 3LEXA 5DEGA 1B9ZA 1DTUA 1AR2A 2Q8BL 5TDPA 2EE6A 5HYFA 1HSBA 4K94L 4KJYB 5I74B 3TBVA 3WNPA 3ZYZA 4JZJC 1G1CA 3HAEG 2BVTA 3MV01 3BWUC 2UUDH 5H37G 3BJLA 5KVDL 5JIPA 4Y16B 3P0YL 5MI0C 3O3EA 1YJDH 2BVEA 1T21B 3ARYA 4NN6C 1CIUA 5E2UL 2WUCL 4C56A 1MQKL 3HRPA 4F7MB 1T0NB 2E7LA 3DVGA 5JPMB 4MAYA 3GMLB 3WKNA 4I5BA 5HGDB 4ZD3L 1AC6A 5JOEA 4B5EA 1RUPL 5JXEC 2EDLA 2QQKH 3MLWL 15C8H 1IKFH 2GSGA 3BSZL 5CZKA 1BVLB 2MCG1 1JVKA 1IM9B 1JZ5A 4G3YL 3WDJA 4ELMA 5AAWA 4CADA 4P2RE 4HXBL 5BOZG 1YMMA 5LKNA 1LGVA 4XNUL 4UNVA 3GJFK 1HXMB 3UZQA 1EJOL 1BVKB 4BZ2H 1JZ8A 4HGWB 5AYUL 3U7WL 4J7RA 1RZKL 4F3FA 6FABH 2ENYA 1EH9A 3VRLE 4A2LA 2Z31C 3S5LB 3KLDA 3ILQC 2GK0B 4HWBL 4HIJB 1S7QB 3JTSA 2UWEB 2MQCA 5SWZE 3Q5YA 1RZ7L 1WFNA 5IWLC 2DQFB 4XWGH 5JLZB 1KB9J 1WZKA 4U6VL 1A4JB 1ND0B 4RRPA 4C54A 4QRQB 4JO1L 2BSRA 3QA3B 4F37F 2WBJA 3C5JA 1OTTD 5L2JB 4M6NH 1YEKH 3UX9B 2NXZB 1MJ7H 2YOCA 3OJVC 1Z0MA 3L5JA 1QRKA 3KLAB 5T1DL 4PBWD 4DGIL 1IGMH 1MFNA 2YD7A 3R8BB 3R4DA 5IW1B 4ZXBD 4ZOBA 1HI6A 3NABL 5DD1L 1CGSH 3KNBA 3VXOB 1CDYA 3PABA 2H9GA 4NQSB 2G5BB 2J88H 3L3HB 3FMGH 3R06A 5E8NB 4P9HC 3VG0L 3FO9B 3QDGA 4M43L 3VXMA 5GS1A 3MCKB 1C5CH 1GH7A 3P30L 1KNOB 4JRYA 4PJHA 2BY2A 3FRUB 3FQTA 4U1IA 1A6ZA 5CIPB 2ICWB 1CE6A 4WUKL 4M03A 3U36A 4ONFL 1NBVH 2GIYA 3PJSB 3NZHH 2NTFA 3V0VA 1TIUA 2R1YB 1X44A 4J3UA 3IS1X 4YPGB 3JVGA 4QHNB 4Y4FA 2AERT 1XH3A 1CGYA 4JM2F 5HYSB 4FHBD 1Q94A 2VDKH 3BXNB 4LVNB 4I77H 1JZ4A 1VHPA 3D0LA 1DQMH 1CQKA 3HG1B 4YR6A 3EOAB 2VLRD 1X5XA 1RJYA 2X44D 3IDNA 4YQXL 3T0EE 2RCSH 3AC0A 4EVNB 4AEIL 3DHMA 1XGRB 1BQUA 2AJXL 1ZEAH 2BNUA 3CXHJ 1CE1H 4HAGA 1MREH 1NUNB 1J1OH 1SJVA 2HFFA 5T33L 1OTUD 4ZO9A 1Y6NR 4WTXA 4HS6A 2VLME 3N50A 4JKLA 3TPUB 2QSQA 5FUOH 4D3CL 3TGXA 5GGTA 4AIOA 1CFTB 4FQLH 1VERA 3L3OA 3QDJA 4JZNB 4PP1D 5D8JH 1YNTA 2DLFH 2P5EA 3DTXA 4HKZA 4P5TD 5EH1A 1ZGLA 1EGJL 1KUMA 3NOIA 2FO1A 4OD3L 4ZNEA 1SM3H 2C3WA 1HZHH 1JGDA 2EO9A 3MR9A 5IW6B 1AD9B 4QHUA 2Y36L 3PQYE 5GZOC 4ZODA 5FK9A 3EYSL 4OM1H 1VFAA 4JHBA 3I50L 3ZE0E 5FA3B 1C7SA 3JWDL 3MRGA 1NEZB 4ZO8A 2J8HA 1GGIL 1BLNA 4KHXL 3S36H 2ZPKL 3O45B 2O61B 4Y1AA 4QRPD 3AREA 3VFGL 5GJTH 3BIAX 5I15L 4P2QD 2NW3A 2ZUQC 3O2DA 4KTEL 3UTSD 2XTJE 4AEHH 3DECA 4MA1B 2IAMA 1J0KA 5HDOA 3T4YA 3BO8B 3IETB 2LTQB 4E0RA 4JO3L 5AZEH 2VXTL 3F5WA 5EC2A 4PJFE 1FO0L 4KAQL 4MGXA 4B50A 3QUYD 4XBEH 1UYWL 1WEJH 4L4TD 3MYJB 3DYPA 5DEGB 3RDTC 4Y2DC 3EO9L 4G6KL 2MPAL 3MLVH 5TDPB 3O4LE 4U3CA 1HSBB 3TBVB 4OCXL 3TCLA 5EOQL 1MCWM 3VXSB 1TDQA 2R2EA 3QFDA 4HPOH 1T66C 5KVEL 4U7SA 3HE7C 3GM8A 4LCCA 5EZLA 4RBPH 1TVHA 3QRFM 4JM4H 1VKXA 3VW3H 4LLYA 5C0EA 4U6YA 1TPXB 4C56B 4TN9A 3OSKA 5D71L 2ZSVB 3WKML 4X4ME 5C6PB 1QFUH 4QKXB 1ZS8A 4AH2A 3GFUA 3DVGB 4MAYB 3HI6L 3D2UA 4I5BB 1T2QL 2B8OT 1AJ7L 2AEIT 4HKBA 1JUFA 3LRHA 1QNZH 3SGJC 3VFRA 5HHQA 3TO4A 1OAQL 4KV5E 1F00I 3T1WA 2A1WL 3K2UL 4CADB 3QQ9C 4MNQE 1D5IL 1KPUB 4XP5H 1YMMB 1KACB 2J4WL 2LV4A 2VDLH 4XC3L 5IB5A 5DI8A 2NZ9D 4PJXE 5GGUA 3MLZL 5A1AA 4OSUH 4Y4HC 4FQJH 3ULUC 1ZGLP 4F3FB 1JBJA 1ADQL 2I24N 2B5IB 3A6BH 3WFDH 5E7BA 1XGPA 1CLZH 4X6CF 4CW1A 5SV3A 3HMWH 4OCNC 1SEBA 3JTSB 2YPLD 4RFEA 4PJAF 4BFGA 5EIQA 3F7RA 2OX5A 1A3RL 2OP4H 2YN5A 2YUWA 3ZT7A 4YDIH 1VEOA 2D0GA 5ETUA 4TVPE 4LSSL 3D85D 2BSRB 5C09D 2WBJB 2Z8RA 3GMOA 1MI5E