3QI9C

Crystal structure of mouse cd1d-alpha-phosphotidylinositol with mouse valpha14-vbeta6 2a3-d nkt tcr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
201
structure length
196
Chain Sequence
TQVEQSPQSLVVRQGENSVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSACANAFNNSIIPEDTFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular basis for NKT cell recognition of CD1d-self-antigen
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 36
structure length 196
sequence length 201
ec nomenclature
pdb deposition date 2011-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qi9C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qi9C02
4YBQD 2AJVH 4Y0GA 2R0LL 1PG7X 3V0WL 1KN4H 3RJQB 4JHWH 1A64A 3CDCA 4Z0BH 1MIMH 1PG7L 1T03L 4GAJL 4J1UB 1NDMA 1INDH 4QRRA 4HH9A 2E27H 3VXSE 3O6KL 2ESVE 3SDAA 3DUUB 3SBWC 4R26L 3QWOB 3SCMD 5EO1B 4WW2B 3WSQH 1I1FA 3ARTA 3BUTA 4L8SA 3IU3B 3QPXL 4Z0BL 4HDIA 1KXQE 4JAMB 1C7SA 3MCKA 4EI5A 2L4OA 1BVKB 5EBWB 1DCLA 2D3VA 5KOVC 4FQLL 5DK0B 1A3RL 3F7YB 1BQSA 3QI9C 4PJAA 2I9LA 4C56E 3D18A 1G7QA 4ZYKB 3SGDH 5HTSA 2F5AL 5GGQL 4JFHD 3HCVB 1MEXL 5HDBE 1G6RB 3MTRA 4Z7UF 3ULUF 4MVBC 4PJGB 3FOLA 4KUCD 2E9WA 2AJSL 3IU3A 3GRWL 3WN5C 5HHMD 1TQBC 1G1YA 1KJVA 5I1GL 4JY5H 8FABB 2Y6SC 1EZVY 4EBQL 3NGBC 3OR7A 4NKQB 1P7KB 4N1HB 3QZWG 4F7TA 3VD5A 5JOEA 1JUFB 2VUYA 1FL6B 3LKPA 1EV2E 2GEEA 5FIEA 3D0LB 2N7BA 3FOLB 3L3KB 1IGCH 3QDGD 4NN5B 1IL1B 5F3BA 5C3LD 2OM5A 3H0TA 2J3SA 2B39A 2G2RB 5D7JB 4PV9B 5I15H 3GJEB 3PWVB 3DIFA 1HHJB 4PV8A 1SJHA 4L29B 4HX1B 1CFSA 3GSUB 4HK3N 5HJ3B 4M6NH 5IQ7L 4NO5A 4BZ2L 1X4YA 4OI9A 2VZTA 3HZYA 3KPSB 3K81A 3ZHLA 3MRBB 3VXTA 2VLJA 4K9EC 2DYPD 4R3SA 5AUMB 1AIFB 4LVOB 4JVUA 4I5BB 1CCZA 4P2OB 4X4MA 1OGTB 1CG9B 5HYSA 3E8UH 4APQD 3E0GA 3G9VA 3C6LD 3KLAB 1RAMA 2CXGA 3M07A 2ESVA 5DT1L 3AB0C 3ULUE 5CSZA 3V4VH 3VFUB 3QISA 1YMHA 1YNLL 4L8DB 2FBJH 3QI9B 5DC0A 1EEYA 2XN9B 4LSTL 4EUPA 4LU5H 1C7TA 4LGSB 1J1OL 1NLBL 4R8WL 1GJIA 4B50A 3AM8A 4HKXB 4NM8H 4ZSOE 3LKOA 1ZMYA 1RZFH 2VIRB 5F7LB 2VTFA 5SV4A 2R2EB 4ZD3H 3ZE0E 4HMCA 1E4XH 4RZCB 2PXYC 2DIBA 4G8GA 3BRDA 1GIGL 3OJMB 3H9ZA 3NGBB 3NTCL 2O5YL 3VFSA 5DUMH 4ONFL 1JVKA 4RA3A 1S7SA 4WU7A 4BQCA 3BSZL 1KIPB 2EE3A 3IETA 3PGCA 1WV7T 3QDMB 3CVIL 3KPRB 1FBIH 5B39B 1S7QB 4LSDA 5HGBB 4ZOCA 2R9HC 2YR3A 5EBMA 5FYKD 2X4TB 1BGXL 1T0MA 3ZDXF 4YNYB 4MNQA 4PJDE 2BY3A 5DVNA 4MQ7A 4PRBA 3D9AL 4JFEA 1FCCA 5IGXH 2CIIB 1GGBL 2V2XB 1U3HA 1U41A 5T3ZD 5ACLA 4L4VD 2IH1B 3NCBB 5L0QB 5EIQA 3UCRA 1L0YA 5HHNB 5E8EA 4P2OA 5CKAA 4NZRH 4K94L 5IROA 3I50L 5DHVA 3ARGB 4XBPB 4FN0A 4P3WA 4J3OC 5DJYB 4RAVA 1IQWH 1K9TA 6CGTA 1I9JH 4QRPD 4Z7QE 4MNHB 1EERB 3ZHDA 1UM4L 4NPYA 1S9KC 4PV9A 4LRNL 1CK0H 3O2VL 4PJ9D 1O0VA 4NFCA 2VJXA 2R1XA 5TQ2H 4HG4J 5GQBA 3MMEB 1U8NA 5HI4C 1MCRA 4PGJA 4NZJA 1NAMH 2DJSA 1FYTD 3PQYB 1Y0LA 5CS7A 4R9HA 2GCYB 1T89C 2ENYA 7FABL 5HPMA 2P8MA 1HHIA 5K9JH 3ZKND 4OZFG 5ICYA 5AZ2H 1JNHB 4G42B 1FZJB 4J3SA 4OGZA 1YNKL 2B2XL 1P69B 3JV6A 1KTLB 3QXDB 1A9BA 2BFVH 2XN9A 2ERJB 1MUJA 1P9MA 4CU7A 1MLBA 2CIKA 4ZAKD 4KWUA 5CGTA 4XHQA 3QAZC 3U4EA 1D5ZB 1OSZB 1ACZA 2Z92B 2NXYB 2IADA 5I17B 4GRLC 4P57A 3RUGA 1YDPA 1VKXA 1FFNA 1D5BA 1UC6A 2WK2A 1JF6A 3QJFA 3TBTB 3BFOA 1G7IB 1MVUB 5DHYA 1ZAGA 5D93C 4GKNB 4UNVA 3FONA 3NTCH 3EJZC 4M5ZL 3EGSA 2FYYA 3K8KA 4OZFB 4HX1A 3DHMA 5GS3A 3U4EB 5ESVB 5TDPB 4HIIA 2R0KH 3OG4B 1KTKE 1R5WA 4XXDB 3I75B 3OKDB 3T4YB 4C4KT 3MV7A 1H3VA 3C6SA 3OXSA 3PWUB 3EDKA 3ULVE 1H9VA 4UT9H 1NC2B 3FQXA 3MA7A 1J8HB 4RNRB 2VLKE 5T5FL 1WICA 4GW5A 2CDFB 5F7EH 3FO2A 4YK4C 4NGHL 4OGXL 4S0TD 5EOTA 2LTQB 3HNSL 1Z9LA 2F19H 4NZRL 4XCFH 1MJUL 1J0IA 4JFXA 2EDXA 3UYRH 4MSWA 4NKDB 4QF1A 1ITCA 1M7DB 3MV7D 3WDHA 3S4SG 1EMTH 2FH8A 4X6FA 3D3VE 3TV3H 3WHXA 5EUOE 1MEXH 1DQMH 2VZVA 4NKMA 3LHPH 2O61B 1BX2A 3EOBA 3TVMC 4X9HA 4FMFA 1MREL 3RVVD 4Z18A 4IRJA 3UBXI 2ZOKB 2C3GA 5TFSH 4NO2A 5IMKA 3MRCB 3TIEA 3LN9A 3Q48A 4G9DA 6FABH 4EBQH 3GSWB 4F3FB 1I7ZB 4NCC2 4Z6AT 5B39G 4R7DA 2VDNH 4EN3D 4JCLA 1G7HB 2R23B 2GTZB 3RVUC 3FHAA 5C70A 4IM8A 3MGOB 4U3HA 5HVWA 4GRLB 4OLWL 2DWEA 1HHHA 5IBUB 4NFDA 1MHHA 1IRAY 2J88H 2C4FT 3WUWB 4I3RH 2DQUH 5BW7C 1L7TL 4N0YH 4F7PA 5JW3L 4Z76A 1MUJB 3VXRE 4U1IA 3REWB 3ZKSD 4JB9L 4P59L 3KYKH 1UZ8A 1Q9WB 1T7WA 3LZFL 4ZUSA 1CGYA 2GTWA 4D0CB 4O2CB 2ZJSH 4O00A 1GZQA 4DZBB 2EZ0D 4OLVH 2ZWLT 4PRPB 4QY8B 1X5JA 2D2OA 3T1FA 2Y7QB 4Q9RH 2QQLL 2WM0A 3WXWL 4NNXB 1P7QD 1LD9A 1MH5B 1MJ8L 4PGCA 3FFDB 2Y9RT 3MJ8B 5EU6B 1CFQB 3QDGB 4DUWA 2ZUWA 1XGYH 4R4NC 4Y89A 3HE6B 3PF2A 3QULA 1QLFB 1HH6A 1ZA3B 1WCQA 1IEBB 2MKLC 3PL6B 4D0BB 1ZA6A 3QG6A 4DKFL 3MMEA 4V1DD 4Q58C 3M45A 5ACZB 5JPMA 5DRZB 5C07B 4YFEA 1SY6L 2A0LC 5B3JF 1Q94B 5IK3A 4MD0A 5IVNA 2BNQA 4UUJB 5C09B 1QSEE 3VGDA 2XQYG 3O8XA 4DW2L 5C9KA 5EFIB 3GB7B 3DOSA 3X11A 1XGRA 4PBVC 2X1QA 3BKYH 5GGRY 4JO4H 4IIQC 1UWEL 4DGIH 2UZIL 2NX5A 2Y07L 5FYLE 1D5XA 3TPUB 1A6WH 4LVHC 3JXAA 2YD7A 2OQJB 1TVHB 5DTFB 2VAAB 1CFNA 1MCQA 5JW4Q 3JV4A 1VEPA 4QT5B 4X5WA 1UEMA 4D9QD 3S97C 3CK0L 5CJXC 3VCLA 1FNHA 5K9KB 4OZGE 3QDMA 5ISZB 2N1KA 4NZDA 5CZVL 1AXIB 1DLFL 4BSJA 4KRPB 4YIQA 1YPZE 1HKFA 2Z93A 3OQ3B 1I3VA 1A6VH 2ADFL 4Y19B 4PJFB 5IB3A 3JBG7 5I74B 4NZUH 2X1OA 4K9EH 3OJDA 3MFFA 3TIDB 3HUJA 1E6JL 1XR8B 2NQCA 1WZMA 1J5OL 5E00B 1NUNB 1D5MB 4JZJC 1FVDA 2DTSA 5J13C 3S3PA 3QEQE 3SKUD 1H3WM 1M05B 1QUNA 4PRPD 1L0XA 1DEEB 4PJFE 1OTSD 5SX4H 2RR3A 4P2QB 4Y4FB 2KQMA 5TGBB 3SDXB 1A02N 5C9JB 4Q74A 1OAZL 5JW5B 1QO3B 3DGGB 2A9ML 1IKFL 5IHUL 5CINL 1FNEA 4ODHH 5LG1A 3LKNA 4G43B 3DBXA 3ZL4H 5T3XE 3QUMB 4R97B 1I3RB 2Z92A 5MENE 1TPXC 5I30H 1WIUA 3QFJA 5GSRA 1KFAH 4PUBH 3UTOA 1U8MB 4IEFB 1NCAL 2MPAH 2N4IA 2IPKA 4JHWL 5I8KL 1SJHB 4L29A 3UJJH 4DKAA 1XH3B 1U8IA 4Y1AD 4YBHA 3GJEA 4OM0L 4DTGL 4XBEH 2X40A 1JNHA 5JDJA 4BK4A 4MNGB 2DQJH 4YE4H 1UXWA 1YYMH 4NNYA 5D7IF 3HNSH 1KELH 2MWCA 5I16B 4HH9B 5DMGD 3BKYL 5E4EC 4R4FH 1HOCB 3Q6GL 4RRPG 3DMMC 4PJXB 4HUXA 3V52L 1J05A 3S5LG 2YPKA 3L3IB 1MAMH 4KJYA 5KN5B 2NY0D 1J8KA 4I18C 1QHPA 3IB4A 3BIBX 1KJVB 1T7YA 2YEZA 3NFSH 4JPKL 1EGJA 5DD5H 1ND0A 3O4OC 3Q5OA 2P8LB 2HJKA 5CGYC 1ZT7A 5EU6E 2AAVA 3MUZ1 1T3FB 4NBYB 5GGRB 3V4UH 4JFDE 5LGKA 4G6FD 4D9LL 2EDDA 4OZIA 2R2BA 3LQAC 3K7UA 3PWJA 4N0CD 2HLFD 5CZVH 4MCZB 3HB3C 4HC1A 2BMKA 5ADOL 3C8KB 3CSYB 3VI4E 3G5XA 1QBLH 3HNTL 1KCSL 5L8KB 5D1ZC 5E8OA 5FM8A 3O2VH 4IRJC 4G43A 4Z7WE 3I02A 4HWBA 4JANB 2VQUA 3D2UD 5F6IB 3EDDA 5IBLD 4LLUB 1FNFA 1AE6H 4KROD 1RIUL 3CZFB 4GRWF 4JQXA 3IDJB 3QEQA 5I1KH 3E6FA 5AG8A 4JLRA 2ENSA 1M05A 5D6DC 2FHCA 1VERA 1HXYB 4MJIA 3BPOB 1LWRA 2H45A 1FVDB 3BEVB 2DKUA 3LPWA 4G7YL 5FYJD 2DIJA 2R9HD 2FJFA 2VXUL 1UFUA 3DUUA 3VFOA 4S11A 3S37H 3QEHB 3GSNB 3VXSD 2LU7A 4HV8B 3T0DA 3HPLB 5HI3D 1S9XB 4DVBA 2HN7B 1CFQA 3CC5B 1LILA 1T21A 3WUWG 3KPOA 3RBSA 3VXMA 3U83A 3RNQA 2EO9A 5FGBA 4DZBA 5TF1L 4NC1C 4M7JL 1E4WH 1WUNT 5D9SB 3SGEI 2CK0L 1PKQB 1N4XH 5EUOB 2FATL 4P4RB 2ZCKH 3SGJC 3TA3C 3ULVD 4JY6A 2EYRB 1DL7L 3OAZH 4P4KB 1S7WA 1MFCL 5JQ6H 2NY0C 4LHJB 3QDJE 1CVSC 5D2NE 3MRLB 3GIZL 4LCCA 4MMZC 3HZMA 1Q0YL 4FXGA 3AS0A 2A6KB 5T1DH 2W1NA 3N1PC 4HGMA 3GMPA 1FAIH 1CXEA 4XVTL 3S5LA 4X4YB 1QRND 4LIQE 4OGXH 2AXFB 3BOVA 3MGTA 4K3EL 4XPAH 1T4KB 1D3CA 3MZTA 3O3EA 5TPWH 5CCKL 1RULH 1QYGL 3I3DA 1CU4L 4ODTL 4JVPA 5ID0B 3T0EC 2YD4A 1NGYA 4CN1A 1FRGH 1K8DA 3QUKB 5DF0A 5IFHL 4NO0A 1T89A 4EVNA 3QUYC 2X41A 3B3IB 2O5YH 2OTUA 1DLHB 3MLWH 1IAIH 2QSQA 4EDXB 1FPTL 3X14A 5SWZE 1KENH 2IFGA 2EDYA 2WLZA 3INUL 4YPGA 5J57B 2MOVA 2JJUA 3RA7L 1K8DB 5J1AA 2VDLL 2LVCA 1KYOK 5EN2B 3CH8A 4ZUWB 3MROA 5CP7B 2A73A 3QDJA 3AROA 1XF2A 2VXUH 4M3KB 4YX2L 3R0NA 1QSZA 4QO1A 1BQLH 3W0WA 4H1LB 5I75B 5DD6A 2APVA 4JFZL 1J0KA 2HTLC 4MHHG 4FZEH 2FLBT 3ZYOA 1HXYA 3E1F1 4DN4H 5DJZB 3ES6B 3WIHL 5JHLH 3LMJL 3IGAB 3CFKB 4CNIB 3WXVL 3MREA 4Q9CA 2C4FU 1U3HC 1HNFA 1YNLH 4BA8A 4X7EC 4KI5D 1JBJA 3RP1A 5KZCB 1DFBL 1Q8MA 4GXUN 32C2B 3OV6A 4BFIA 3LKNB 5IHLB 2AXGA 1UWGH 1QLRB 4K7PX 4JKLA 4LU5L 2D31B 1U0QA 1TFHA 3LQMA 4CNIA 4OZIB 2FIKA 4KQ3L 3AMLA 3FO9B 2X4UA 3GMRB 4BFEA 1BMGA 4M3JA 5LKNA 3BDYH 2X4PA 2PXYA 4OV6F 1DBKL 2DQGL 2IAMD 4Y16B 2Q6WA 1D5MA 5TE6L 1HHIB 5HGHB 5F9WC 3AY4A 1RULL 1II4E 5C86A 4RFNC 3QWRD 2W9EH 1QEWA 1CDGA 1F4XL 3PWUA 4GG6A 3SDCB 2YUVA 2ZPKL 4JM2A 3WHE0 1JHTB 5E5MA 3MNVB 2PUQT 1I7TB 4KKLC 5IVZB 4Q97A 3OKLA 4ONFH 4HLZH 3ISWA 3WJJA 1RUMH 2R0WH 1S7RB 5T1KA 2BVOA 5DEGA 3SDYL 1JPFA 2VABA 1QYGH 1I9IL 5H2BB 1CR9L 4KUZL 2AEWA 4GS7C 5KSAA 2R0ZH 3VWJB 3QH3A 3SEPA 1QLRA 3RIFK 4AMKH 5CD5C 2R4SH 1QBAA 3Q6GH 4OUOA 5IV2A 4P57B 2VH5H 1HEZB 1JN6A 2V5SA 4NQDE 1TJIL 1Q1JL 5F96H 2AJSH 1IVLA 1FYHB 2Z4QA 1DUZB 3MZGB 1MAKA 3HI1B 4MA1C 3VGAC 3FQUB 3EYUH 1DN2A 3ETBF 5IBTH 3JV6B 2H2SD 5D2NC 3PWNB 4GW4A 3I6KA 1RUAL 4S1DC 4G42A 3IETB 1TMCB 5C0FA 1N7ML 3KPSE 4G6ML 4ODXB 4PJHF 4G9FD 1OAXL 2BDNH 1JTPA 3GEWB 3IFLL 2FWOA 1G9NC 4QOKB 3BGFC 3L3OB 1KN4L 4G8IA 5E70A 1K2DA 1JK8A 1N64H 3BZEA 3MBEB 2BY0A 4KK9D 4QRPE 4BFBD 4IMKC 4O2CA 5I1LB 3P77A 1JGVH 3O4LE 2WWMC 2DM7A 4WWKD 3HAEH 2EH7H 4JKWA 4PTTB 4EOWH 4HKZA 2W65B 2XTJC 1EFXD 1CD1B 4JM4H 1C5BH 1CN4A 3O6KH 2ITCB 4PFEA 4ZFGH 2KL6A 5EC2B 5HGAB 4LLYA 3PGDA 5T3ZE 4PLKD 1U8KB 2Q20A 5ANMA 2CO6B 1C08B 5F7NC 3S36X 4JJ5B 2V7NB 4JKPL 4E41D 5C0RL 5LCVL 4A2LA 4EI5C 5I8EB 1OLLA 4I2XE 4U2YA 3ALXA 4PJDA 5JW4R 1U8QA 3MBED 1CGUA 1YPZA 1GXEA 3L9RB 3F8UB 1MHCB 3ZKQD 1SVZA 4YNYA 5E00A 3WO4C 1MHPH 1YECH 3QRGH 1J10A 3KXFA 2HG5B 1GZPA 1TQBB 2R2BB 2VB5A 3HI6H 2AQ2A 2NY2D 3GSNL 1KSRA 4Z95L 2FECL 4WNQA 1HINL 4XAWH 2IAND 3TT3H 2YKLH 3A0OA 3OKOA 1WBZB 4LAQH 5HY9B 4L5FL 2XICA 5A2FA 3EZJB 4D9RE 4LCYB 2EDNA 3D39D 5GRWA 5JO5B 4AY0A 4Z5RB 3GSOA 3CFBB 4MAYC 1AJ7L 2W59A 3T0EE 2EIEA 5IB5A 3LS4H 4QHUB 4JFOB 1A3LH 5KVGL 5D7JC 1RY7B 3VD3A 2PYEB 3C5JA 1F00I 4KKBC 4DVBB 4K55A 5CFHA 3HE7A 4XP9L 2BNQE 3A6BL 3OXSB 2EE9A 4ZTPH 1SHMA 4W4NA 5FYJH 4W6YB 4XVJL 3P4OB 4PJIF 5C1MB 3TP4A 3EFFB 3T08A 1N7MH 1EAPA 3MRGB 3UTTA 4LOUC 4WHDA 3RPIB 4NYLB 2JCCB 1DDHB 1MSPA 1IQDB 1DVFA 3SO3B 3AGVA 4CN6A 2CKBA 4A2MA 3BJ91 1ORQA 1S8DA 2FZ3A 4KMTL 3C2AL 3V5HB 5J1SC 1G7LA 4Q0XL 5HI4D 4N1EA 3RWFB 12E8L 4A6YB 4YK4B 4WDIB 4NM4H 2VSDA 1MVFA 4JO1H 3BP5A 1AKJA 1JGVL 2EC9T 1ND0B 2VXQH 3TN0D 1QO3A 4JRWA 3WKNA 5I1LA 1T7ZA 4POUB 4L4TE 4KVCL 4KMTH 4FABL 1KOAA 1I1YA 3EYQD 1FAKT 2VE6A 5CEZH 3MUGB 3RU8L 3NCJL 4N0FB 2WUCL 4OZHB 4JREB 3BMVA 3L5HA 4HUUB 4PJCB 3QUZB 2D7TH 4V1DB 3I84A 4S0SD 1MY7A 5JORA 5F1IB 3SKNB 1KPVA 4OCYL 1IEAA 3GNML 2HT3D 3MOAH 5IB4A 2BHUA 3TH4T 2AJ3B 2JK5A 1NSNH 2YC1B 1P6AB 4X9FA 3OPZL 5KAQG 5D7IB 1TZHB 4NNYB 3ZT7A 5DHVH 3OKDA 1G6RA 4OAWA 1AHWA 4DN3H 4PB0L 3G5VB 5INDA 1EDQA 3QG7H 1A1NA 4IS6B 4QXUL 3QO0A 4JG1H 4LSQL 5DD0L 3G04A 5KN5A 3GKWH 3QUZD 4L5FH 4I4WA 2YN5A 1DE4B 2GJ6A 3MLRL 1SJVA 2GUOA 5FA3B 4MXWH 4HUWA 5KVDH 1NEZB 5GRZA 2R2HB 5KSAB 1DBBH 4M5ZH 3TO2A 1KLUA 4RMTA 3WO4B 1LE9B 5I1CH 1DEDA 4TVPE 2NNAB 3U1SH 4LARH 1KTDB 4PJ7A 4DK6A 1RZJL 3MV7E 3R8QA 3VFTA 3QCTL 2ZSVB 2JLLA 1ZVSA 1YY9C 4JY4B 5JLZB 3FO0H 4RIRA 1L0QA 1P2CB 2X4TA 4F2MB 2ZZUT 1KT2B 5EO9B 5E2WL 2DLEA 3Q0HA 4E9LA 2VLKD 3MBXL 3MLUL 2F53E 3HB3D 3X12B 2NY6B 1NDMB 1B6UA 4KK5C 4KZEL 4ZO6A 3PDOB 1Q9OA 2GAZB 1RQ5A 2HYMA 4HZAA 5D7IE 4MZ2A 2UVFA 2KUTA 4MNHA 3B8YA 4LOUD 3S4SA 4RGMB 3FO9A 4NO0D 5H35A 3MRRA 1O5DT 4LPCA 1T0NA 3O6FD 1WAAA 3P9LB 1SEBB 1BEYL 1IAKA 1WZ1L 1FZKA 5HYJD 2VLKB 3MXWH 5HPOA 4OZIF 1YEEH 3IKCB 4PLKC 5EUKB 1J88A 2P48B 5EO0A 5KTEL 3T0AA 3HMXL 1LGVA 4RAUB 4BQ6A 4LASL 1UJ3A 1YMME 4TQEL 4XC1L 2I60H 2DQHH 1RJCA 2OYPA 4DGVH 1MFBH 1G6RH 4HIEB 5D6CA 4HIJA 1YMMB 1YJDH 1AR1C 4JDZB 2LAGB 4OFYA 1DQTA 5DZLA 5MEPB 3I2CL 3TCLB 1FG2A 5ACZA 1KIQB 3KNBB 1A1OB 2JJTA 2CLZB 5HJ3A 1JZ4A 3QEUA 3P2TA 5C09A 1I1AC 1MRDL 3TM6A 4QRRD 3LSOA 3RWDB 5IR1A 5GRXG 1I8KB 4H26A 2Q8BH 3TNMA 3ARPA 4XP6H 3RZCB 3EDJA 3W5MA 1JRHH 3O6LL 2GI7A 3C60A 3EJJX 1MCBA 5CLTA 3QNXA 4AZ8A 4Z7NF 4ELMB 1EO7A 2NY6C 3GHBL 4K94C 2CH8A 1T66D 1MRDH 1VFBB 3VMNA 2QADB 2AJZB 3PJSB 3MLSH 3T1FB 4FQXC 1FNSH 5ID1B 1KEGL 5SWZD 4RAVB 2PYFA 4AMKL 4HC1H 3U4BH 3UYRL 3AC0A 4HJJH 1IAOA 3CZJA 4MAUL 1SYVA 2IAMA 3D2UB 3BSZH 4BUGA 5BVJA 1OT2A 5T1KD 2P5WB 4CVZB 3TBSA 5E2WH 4UIMA 5DYOA 1I7UB 2FX8H 3OR6B 4GBXC 4OTXH 1WT5A 1N2RA 3V5DA 1H5BA 2OK0L 1KLGB 5FYKE 4U0QB 4CADB 2MCPH 4OQ1A 5E4EB 4UUJA 5ALBH 3VJ6A 4ZSOA 2VDRL 3LAFA 4M8QA 2XWBA 4RMWA 3WJLC 1NC2D 1UKTA 4PG2C 2BSED 1L7TH 2YBRA 1C12A 3RY4A 4GRMA 2ICWB 3SDDD 4AQ1B 2EXYC 5C08E 2ZG2A 3HE6A 1DQQB 2DD8L 5K9OB 3NA4A 1JGLH 3QDGA 1H8NA 4X4ZA 3C60C 3JWOC 2EDQA 4BQ9A 4Y5YC 3QIWC 4XPTL 4J3VA 5FYLH 1J1XL 2WWMD 4WWKC 5CEYA 3EOYG 2WAHA 1HCFX 4G9FA 2BVYA 4MD5B 3LMJH 3MRNA 3MRQA 3UO1L 3W39B 3PP4L 2NW3B 4LCIH 4N0FA 4YHZL 3LS5L 5MEND 1TDQA 3T09A 2A0LD 2B0SH 3B9KC 1G9NL 1E27B 2DB8A 4JG0L 5C6TL 1T7XA 3VDAA 4F9LA 3GRWA 1MI5E 4PD4J 1J8HA 2HRLA 5GZOC 1MHHB 4L4VB 2O5XH 4GRMB 4APQA 3WDIA 3VMPA 2XNAB 4IOIB 4KJQC 5T5NF 35C8H 1SM3L 4WO4B 5D7LD 4K3JL 1Q0YH 2BXZA 4QHKJ 3AB0B 1CYGA 2HVJA 5DSCA 3QQNA 1M4KA 2K1MA 4XP6L 4X6EA 4EN3A 5I0DA 2X9XA 3E6HB 4QKXB 4WI5A 3ARFD 5TH2A 2NW3A 2V2WB 2R1YA 4D0DB 4LCWB 2AGJL 1EPFA 4PUBL 1Z5LB 3HRPA 5J12B 4ZOBA 4JZOA 3KVQA 4MA3A 2DQJL 1WFNA 2D7QA 3RL1A 5GGRA 1B0RB 4YZFE 3AUVA 1T83C 3D69B 1WBYA 2PN5A 1J0HA 3IJHA 2DQTL 1X5HA 1P1ZA 3F58H 4XVUC 2DLFL 1YN7A 3RGVD 3K4ZA 4OBSA 1A4KB 3FQNB 3MLZL 3FONB 3VI3E 4WUUD 1AGBA 3QHFH 1NH6A 3GJFK 5IW6A 1JF1B 3FB8B 2O5ZH 1KLGA 3LVEA 5BMFH 1TVBB 4YXHH 4LCWD 1UXWB 4P2CG 3T4YA 2NLJB 1IJ9A 1E6JH 1K4DA 1NDGB 1LP9E 5C0IA 5CEZE 4KY1H 4OB5H 1A6TA 1WWBX 2DI7A 2GJ6D 3WIIL 5SWSD 5IB2B 1C12B 2BC4A 1KACB 4HKXA 3TZVB 3F7VB 1PDKA 1DQDL 2DQCH 4ISVA 3VXSA 2VRAA 3TJHC 2WINB 1HDMA 43C9B 1VFBA 5BRZA 4BZYA 4ZO7A 3F12A 3FFCD 1NJ9B 4YXLL 1GC1C 1KLFA 1X4ZA 4L8SB 1BHGA 1QFWH 3MO1A 3HZKB 2RFXA 2VZSA 4CL7A 2J8UB 2YD2A 4YBLB 1FNLA 4UU9B 4J3XA 5HHXH 3BPLC 1N6QL 3TESA 4JO2L 1AIFA 5F9JB 4XB7A 3T04D 2PR4L 4OLYH 3U0PA 5F6HJ 4WHTB 2AJYH 2XRAH 4JFEB 5FYKH 1JHLL 2FD6L 5ILTL 5EWIL 3T77A 3MLVH 1HZHL 1GGTA 3U36B 1E4JA 3O3UN 3ULVH 2UWEF 3RHWK 4LBEA 3T8XA 1LEIA 4M7ZB 5E99L 1N6VA 1OT1A 1YY8B 3FQTA 4X83A 4EI6A 5HHNA 5KS9B 3LN5A 1X5LA 5C0AE 1F3JA 1G7PA 1OB1A 1U8LA 3KYMB 4HS3B 4HXBH 3VE0B 1F8TL 4PGBA 2E8YA 1HKLL 3L5WA 2PYFB 4ORGB 2VIRA 4KDTC 4HUMB 2Z0BA 3MODH 3NACH 3CVIH 3GMOB 1NPUA 5E6IB 3KPMB 3T65B 2EYSA 4MJ5B 1FJ1B 2VR5A 5FGRA 4M43L 1LO5A 4D8PA 4GH7B 3PWPE 4LPUA 1EH9A 4KV5E 4NQUA 3SCMB 4NQCD 4KHTH 3FO0L 1EAJA 1HXMB 2P44B 2B4CL 3KHQA 4GOSA 5CD5D 3QFJD 3ZDZE 1ROWA 1CQYA 4YGAB 4FXLA 4L3EB 4R3SB 4MD0B 5AUMA 1AGEB 1MWAB 5EU4B 2BRQA 4K23H 2EXWD 3RWGB 3KPSA 3P77B 5KBNC 5FDWA 2ATKA 4L3EE 2BC4B 5FUCE 5I1KL 3WEXB 5KG9A 1KJ3H 1F4HA 4NN7C 4XMLL 5T1MA 5SWQB 1ZT4A 3RZCD 1H8SA 3TA3D 4FFWC 4HMEA 5DLMH 3CK0H 4PGCB 4AT6A 5DGRA 3WUZA 4QRTB 5C3TA 1WIOA 4NRXB 4O2FB 3ALPA 4OLXL 1LP9F 4UV4H 1I9RL 5FUZH 2YZ1A 4NQDA 1R5VA 2BDNL 5C07D 1OGAE 3KJ6L 3I85A 3BVNB 3GMLA 1RZKH 5FO9A 4X9IA 3U4AA 4CAGA 5KSBB 3KPMA 3CCHB 3T65A 2OL3L 4P9MH 3WIFB 1CFSB 3GSUA 3FB7B 3EAKA 2F15A 5B8CB 4XMKH 4GQ9L 4KJWD 3V7AE 5FHAL 5EU3B 1G9MH 3AXLB 3U7WH 1P1ZB 3MLVL 3OGOE 4PJCF 2ZSVA 1H3UA 4GAJH 5EZLB 5HYSG 3U46B 2BNRB 3V7AG 4FQPA 1X4XA 5J6HB 1CLZH 3GKZA 5IEKB 1F4WH 3MRBA 5DR5L 1PX3A 4PGEA 5IF0B 2AK4B 3U36A 1CL7H 4HQQL 3MX0A 3IRPX 4RGOL 5FCUH 5IWLC 2MNUA 2QR0B 4HXBL 5D5MF 4CVXA 4Y4HB 1DUYA 5AAWA 2W9DL 3O45B 1BVZA 3C8HA 4RMQA 5JTWA 1F13A 2WUCH 2BNRE 3VRLF 5FA4A 2RAMA 1B2WL 1V3LA 2Y25A 4IOFD 4OZHF 4XNQB 3VXUD 2VE6B 2AQ3A 2ADIB 3H0TB 3PABA 3RVWC 1K85A 2I25N 2ARWA 9CGTA 3BYTA 4HDIB 3KPNA 4ERSH 5BQ7A 2BNRD 1FZMA 1UZ6F 1DUYB 4U1GB 4PJ5B 2HKHH 4XPGH 4H0HB 3HC0A 2CR6A 3ARSA 1JTOA 3WYRA 5TQ0H 3FT4A 2EDKA 4U1LB 2VDOL 2IG2L 4K07A 2IQAB 3HI5L 4O4YH 1JNNH 3HFMH 2BNRA 3F6IA 1FLTX 3RA7H 1NBYA 5HXMA 5E2TL 3ZTJG 5E8DH 4HWEH 4DGYL 4XP5L 3AXLA 4UT6L 1EXUB 1K4DB 1CLCA 2DQCL 2VQ1B 2V2WA 5EB9A 3RVVC 2I07A 4CW1A 1OOAA 1JPSH 4PRDB 4ZS7L 4HEME 2DQTH 1JTTA 4UNTA 5DRNB 4U1SA 1RHHA 3W0WE 4BUHA 3FT4B 3UPAA 3U7YH 3HLAB 2Y6SD 4K9EL 2XZQL 4C54A 2D7PA 4BZ1H 4PJGE 4O2EB 2XNAA 4ZPTA 1EMTL 1JWSB 4CVUA 3GBLA 4XX1G 2LQRA 4XNXH 3DWTA 1KCLA 1ES0A 1FVEA 3MLXH 4TTDD 2CIKB 4PJ9B 2BFVL 5DA4A 4Q9QL 1I8IB 3NCFB 2NCMA 5I1IL 3RVTC 1G84A 4ZNEE 5L2KE 3BESR 3PABB 4HG4K 1BBDH 4LMQE 3PG2A 1R3JA 4CU6A 4RX4A 5JW3H 1OTSC 1QFWI 4TUOB 3UTZA 3MJGX 3VXOB 5IKCA 5FOJA 1OAXH 2HVKB 5HPMB 1J18A 4EN3B 5E5RB 3DI3B 3U9PL 1UXSB 1TJGL 3P0VL 4WW2C 1R3KA 1A5FH 4OGYL 5EZJB 1YEKL 2ZCHL 3MC0A 5IJVB 2BSTA 5E9DA 4PJ8A 2VN4A 2R0KL 4O02L 3CIQA 2HMID 3CJJA 4YHKH 4EUPH 4PJEB 3IXAA 4ZUUB 3BRFA 3H7BB 1OGAB 3G6DL 1C5BL 1MOEA 4NPYB 2NY4B 4Y5VB 1F4XH 2VLLB 2M1KA 5EOQH 4QOKD 3S88L 1F6FB 3L7FB 3DUSB 4UI2A 1JRHI 1MCPH 1C1EL 4PBXA 3T2NL 1T0PB 4R7NA 5DS8B 5IOPA 2H8PB 3CDYA 3IYLW 2R0WL 3MV9E 3IFOA 1ZHBB 1ZGLA 2QSVA 4R4ND 3QJHB 2MCG1 4RISH 4QYOA 3U0TA 3ORJA 2XXCB 4JFYB 1LEIB 4G6KH 4XCYA 3HI6L 4MJ4A 4QOKA 2JF1A 2ADGB 1QA9B 4MNQB 2EYRA 4EUPG 2PW1A 4MA8H 4PY7B 2AK4E 3C2SA 3VFVB 4QXTB 2DQEL 4YHOL 5D2NB 3PXJA 1JWUA 1V3KA 5C0AA 4CBPA 1FG2B 1IKNC 3FCTA 2NY4D 2GT9A 1S5HB 1Q9KB 3AS1A 5TF0A 1LK2B 2A6JA 1KCSH 3GSQA 2Q3ZA 4MJIE 3S4SB 3KGRA 4DOHB 4PY8J 4PRIB 1T1YB 1RUKH 1KPRB 3D85B 3BT2L 4TTGA 1BWMA 4J3UA 2OX5A 1VFAB 4WUUA 1IEHA 4MA8L 1XCQB 2Y06L 3CX5K 4NNPH 1FIGL 1JGUH 2OJEA 1PSKH 3D85D 5FEBA 5E2UL 4EN3C 5H94A 4QHKI 5JIPA 2IBZX 2CDEA 3QO1B 4PJ5E 4JPWL 1XH3A 3U9UA 1U2HA 2FX8L 3ZZ1A 3SKJH 1AXTL 1KT2A 3PHSA 2IQ9L 4QWWD 5BZWB 1I7RA 4LCUA 3MYJB 3RGVA 2J8UF 2OK0H 3HI1A 2ICEA 1G7JA 2HFEA 2I60L 2GITA 3WLBB 2VDKL 4PGBB 4JQIL 2DF3A 5D71H 4AH2A 2WP3O 1EHAA 1P84J 5H37G 2FJGB 2ITDA 4OGAD 4NBZB 2E7HA 4LFHD 1CICB 1WZ1H 2A9NL 1KEML 3SKJL 5BXFA 5IR1B 2XG4A 5MENB 5BS0E 3KR3H 4E0RB 3MRRB 4JKKA 1AQDB 4LASH 4YHKL 2RJMA 1DBKH 4LLMA 3BGMB 3ROOA 1D9KC 5C0ND 4JPIB 2X5PA 5C0GB 5BZDB 5E5MB 2X4QA 1CT8B 5EORH 5IV2B 3HUJB 4RGMC 1FIEA 1F2XK 2KH2B 4RGNE 1KJ2B 2Y1VA 3KYOB 3L3KA 4UZGA 1Z5LA 3OTTA 4NOFA 3RVTD 2QQQA 3KR3L 1VFUA 3MNWB 2R1YB 4PB9H 5T1LB 4JFFB 3GBMH 1U8JA 4RBPH 4AENB 5BV7C 4K3EH 3BKMH 4BFIB 3VG9B 1RJYA 3BP7A 4XH2A 3RGHA 2X7LA 4M61B 1JHKL 2FDBP 4XGZB 4PJBA 2HFEB 1DVFD 1A6AB 1VGKB 3NBNA 4JZNA 1B2WH 3HA0A 5KSUA 3L3HB 3MYZA 4TRPL 3V6ZA 5I9QC 4PJXF 1ZEAH 1U6AL 4OZ4A 2PCPB 5T3XH 1FVCB 2ZNXA 1JMZA 1W72A 1QFHA 3Q3GA 2ZUSA 4PJXE 1J12A 3BISA 1TVBA 3D25B 5E2UH 3C09C 5MERA 1I1AB 5J3HC 4LARL 2LU4A 5ETUA 3FZUD 1FBIL 3HUJE 5FF6A 4X6DF 5KVMC 4GAGH 1Z2KA 4JO3L 1GGUA 3W5NA 3O41B 4PRPE 3O9WC 3ZTNH 3QSKB 4H25A 4UBDD 1RZGB 1GGIH 3KDMA 5EU5B 2ZUYA 5HVHB 4LP5A 4GLRI 3UBXA 1V7MH 2QADC 2HRPH 5F1NA 1ZA3A 4J12A 5HHOD 1QLFA 4PJIE 4G9FE 3DMMA 5CWSA 1RURL 1PG7H 4YAQA 2SEBB 3U30B 5LVEA 4M1DH 4QYOB 5DT1H 1BZQK 3KS0J 1CIUA 4QHNB 3BDBA 4NRYB 2X42A 1DDHA 3FOMA 3LV3A 3ZKNC 5JPNA 3RIAK 2X10A 4UTAH 5JOFB 2BSSB 4GBXB 1YQVH 2IGFH 5DJXA 4KUCF 3TO4A 5IMOA 4NO0B 4WDIA 2BOBB 4QT5A 4G6AD 2C3VB 5MP6L 4NRZA 2NY3D 3O3BA 4MLSA 1IC7L 2H26B 1H3PL 2J8OA 4ZFOL 4LEOA 3KLSA 3QIBB 4P23B 1BOYA 2W60A 1N4XL 5LBSL 1HSBB 1T22B 4LSVH 4R7DB 1LDPH 4HKBA 4TUJB 2V5TA 4WCYL 5TF1H 2EDTA 1WBZA 3QIWB 3FTGB 1U2CA 3KJ4B 2YA1A 1DANT 1NUFA 4WUKH 4JREC 4QRUB 1H3PH 5E6ZA 2C7UA 5EDXA 4DEPB 3U1SL 4M7KL 4JZJA 1U8KA 3NZHL 4FFWD 3MACL 1A6UH 4W6XB 3B9KB 4XXCC 3THMH 4DQOL 5F1KC 1QSFA 4X4YA 4ZFZB 1RZ8B 3UBXG 3SJVD 2NY1D 3NA9L 3RIAF 2IF7A 4U1NA 4FP8H 5HHMB 3D1MC 4CADA 4S1QH 5EZIH 3SQOH 4U6HA 2NX5D 3MLSL 1GGCL 3UTSB 2JCCA 1XGTB 3JZ7A 5GRVL 1IGML 4MWFB 5E94A 1Q9LA 4PYGA 4ZUSB 3SDXE 4PS4H 5MERB 2A83A 5DRNA 3UTSE 5D8JH 3VXNB 3C6SB 5KAQF 3U7YL 2VWEE 1IAKB 2W65A 4G6FB 4NWTH 2WBJA 1RUAH 3PHOB 2H1PH 1VFMA 3KLHD 1T20A 3TJEL 4YDJA 2HFTA 3CXDL 3OB8A 1F3RB 4C56D 1NL0L 3MOBL 2D7MA 3FQUA 1BREA 1K8IA 1OM3L 4LHUG 4ODUB 3MLTA 4IIQA 4U1NB 3MV9B 4LLUA 4RFOL 3GSRB 1YEIL 1KYOJ 3NFNB 1FFNB 4XH2B 3VXPB 3PGDB 4NWUH 1Q9OB 3E3QE 5E5UB 4IDLA 5J8OA 1IM9B 5D72L 1S9YB 1B0WA 4ZFGL 1TXKA 1S5IL 2YPKB 4X7FC 1L6ZA 2OTPA 2YK1H 3L3HA 5IW1B 2UVEA 5MEQA 1QFWM 5DEGB 5T1KB 5CAYB 4ZAKC 2Q7YB 3ARBD 5GS0D 1U58B 4MJ6A 4CN4A 1DQLL 4TVPD 4Y4HA 1FFOA 2F53A 2PW2B 4Q6IA 2VNCA 5F7KC 1RJYB 2XRAL 3V95A 2YPVL 3UDWC 2FX9L 5GSRB 3KPPB 4HF5H 5ANMB 2XZCL 1A6UL 4QNPE 3P40A 4MB5A 5E99H 2CLVB 4JO4L 5F97E 1FV1A 1LNUB 5EZLA 3RUGE 1KJMA 1LDPL 3IDNA 1JPGB 3WO3B 1WWAX 2JELL 3FQRA 3VDCA 4M61A 3PWLB 4OFVA 3KYNB 5B8CA 5AZEH 1VPOH 4M48L 4O58L 1SEQH 2VXTL 4S1QL 4YHIB 3JV4B 1G6VK 1FNAA 3NVQA 5I16A 3CSPA 1QRNB 1PYWB 1AP2A 5EH1A 1A14H 5IB4B 2I9TA 2OJEB 2P5EA 1MCNA 4JFQB 4ZUVB 3QRFM 4AT6B 1P4BL 2X9WA 3ET9F 5L88L 2EXYD 4IRZL 4PD4K 1Q9LB 1OAQL 3FAXA 3CH1B 3DTXB 3BMWA 4DK3A 2H41A 3O8XB 2WBKA 3GM8A 4XMLH 3P0GB 1ONQB 5CUSH 3BJLA 4OV5B 4FZEL 4I0PA 3OX8B 2C3HA 25C8H 4HWNA 1MFNA 4NQCE 1DQJB 4NP4L 1CE6A 1EGJL 5IIEA 3FMGH 2B1HL 3SGKA 3RY6C 3EBAA 4OFPA 1MCHA 1N0XH 5FXCH 1KLUB 1FNEB 1WBXA 7FABH 4NKOB 3G08A 2HMIC 1EJ6A 3GZKA 2Y06H 4NNPL 3VFPB 6FABL 4ZUWA 1HNGA 1U8HA 1W0WA 5BXFB 4IIQB 3MLTB 3OB0K 5I76A 2O5ZL 5TGBA 5D7LA 3EYSH 3FQWA 1HWHB 2QLVB 3ARBB 1QSFE 2V6HA 2E7MA 3CDGA 1JGDB 3D5OF 4M6OH 5JR1L 3GB7A 3IDNB 2J6EA 4PLNC 2Z8SA 3S37X 2P1YA 4LVNB 3BP7B 2CRZA 4JFEE 4HT1H 2YZ8A 1N64L 2PETA 4H88L 1PLGH 2AJUH 5D5ME 5I1JH 4MWFA 4F8QA 4ALAH 4OCNC 3QUMH 4QRQA 1VGEL 3I3EA 1TVHA 2DWDA 2G75A 1AGCB 4OCRH 4FG6D 5D96B 1BQHA 3DO7A 2GJZB 1ZV5A 2H2PC 1B4JL 1VFAA 4M93B 4D9RD 1A7QH 5I8CA 4AIXA 4JHAH 2Q86A 2W91A 3OZ9L 4YO0A 4M7KH 5FUOL 4G80A 1REIA 2G5BA 4DKEL 1T04B 4ALAL 3TYFB 2XXMB 3GI9L 4ZS6C 4W70A 3P9WB 5CBAB 5KSBF 5A2JH 2V5RA 1OP5K 2LABA 4N90D 5FM4A 1VEOA 1PY4A 1IGJB 3ILPA 3VA2C 4G8FB 1R3HB 3QP3A 1G0XA 3TYGH 5C0CA 1ZHBA 2YXMA 4GMTH 1IM9A 1B0GB 3D87B 4DCQB 5MEOB 4PB9L 4GRWB 3FRPG 4X5LA 4CJ0A 4YHML 4RWYH 2CUHA 3H42L 4ORZC 5CILL 3PWPB 3GMMB 4PLJC 3OMZA 4JGUA 4OFDA 1F90H 2YSSB 5TDNA 4MDJA 3HRZA 3QIBA 4P23A 3EO1B 3H3PL 5T3ZH 3ARXA 1KCVH 4NQEE 2H26A 4GW5B 3KXFE 4ISVB 3DSFH 4POYA 3F7VA 3N1QC 1MIEH 3O11A 4X4ME 5DQJB 2RCSH 4P48A 1HSBA 3LEYH 1QQDB 2BY1A 4EUPB 1A7BA 2AEIT 2VLJE 1ZVYA 4YUEL 5LAXA 2R1WA 5AD0B 1NGXB 1YA5A 5D5MA 1EEYB 2VZ3A 5TE7H 4IRJB 2V7HA 4PRHA 5I71C 5A3ID 1MRFL 5GRVK 2EDEA 2EDOA 4ZUUA 2H9GA 3BUYA 1N59B 2HJFB 4P9HC 4ZODA 2G60L 4XPBH 1KB5B 4N8VA 4P2OC 1OY3B 1ZE3C 4JLRB 5IMOB 3EYFA 3H2WA 4QEGA 4UOJA 1EBAA 2CO7B 4WFEE 1KB9J 4Z0XA 2MTPA 4TUOA 1ZT1B 4G3YH 2DLIA 2HTKD 3BPOC 1OP3H 4ZFZA 4OCLC 3SE9L 4DN4L 5F9OL 4NO5B 3MJ9A 2UV3A 2QL1A 4Y7MA 2A77L 1FL5A 4CW1B 3IDGB 4MA7H 1MWAL 4F7CB 4QRPA 1YEGH 1ZOXA 2O93L 5IW3A 3OJ2C 3KLDA 5CHNA 3BN9C 4IDJH 3DYMA 1A22B 2X4OA 5KOMC 4MXQD 5F71A 1MCIA 1UADC 2BNUB 1NKOA 1EEZA 1A0QL 4M00A 3WXVH 3DJ9A 5GGTL 3HG1D 4WW1B 3TA3B 5I1DA 15C8H 4O02H 5FGCE 3VWKC 1AQDA 4JR9H 4PRDA 4HLJA 1MFDL 3DSNA 1VACB 3LKRA 2P5EE 5DO2D 1YNKH 3IDMB 4YHNB 4YQXL 4YDVB 1XCTA 2JTDA 5F7MC 1TENA 3T3ME 4OCRL 3QNYA 1INDL 5ICXA 2ADIA 5E6IC 4LHUD 2NW2B 3NAAL 4AK1A 3DX8A 3S88H 4NQED 1K6QH 4PP1C 4R90H 2VO5A 2C3WA 4LVHB 2XWJB 3FO2B 5EBLB 2FBJL 3KPQB 3CC5A 3WMSA 5EOQL 4KTDL 4PJBB 2BJMH 3BH8A 4QTIL 5I66A 1P7HL 5GGTA 3QA3B 4H8WL 3MRPB 2GCYA 4PB0H 1OTUC 2FJFB 4JPIA 5IMLA 5SWSE 3QXVA 1RZFL 4GG6E 1ZWIB 5C9JA 2A38A 2WBWB 4Y4FA 3QUYA 4G6AC 3GBNL 1OTUD 1D6VL 4L8BB 4LEXH 1CWVA 3QIUA 4IRSB 3M17A 1FCGA 3DVIA 3FRUA 3O45A 4WUUE 3QUMA 3K4DA 1HEZA 4BELD 2IWGA 2ZUQB 4YZFF 3SOBH 2VLME 1I1AD 4KV5F 4OIIH 2WUBL 4Y4FD 1D5IH 2IH3B 3ALWA 1U8IB 2GK2A 1K8IB 2EDFA 5F7HA 4PJIB 5KSUB 5IVXA 4I48B 2IPKB 3IFOB 5IP4A 1DBJL 4LCCC 3MBXH 1U42A 2LVEA 2Z91A 1B4RA 1PSKL 5E2TH 4PJBF 4NIKB 4QOKE 1J7VR 2YPLB 4X99B 2BSRA 5DI8A 5FO8B 3QI9A 4LP4A 1A9EB 5I15L 4HFWA 3ZL4L 1KPUB 1CI5A 1T1ZA 3G6JB 2FR4A 3IS0X 4N8PA 1S9WA 4X0KA 3TWCL 3KPPA 3UTSA 3SDXA 4KRPC 1MJ7L 1J0ZA 1WISA 3D3VD 4LSSL 4L3ED 5JUEL 1NLDH 2M2DA 4WI2A 1IAIM 1X7QB 2R2EA 4FFZH 4FQCH 5LJYH 5L7XL 1NAKH 3LN4B 2FX9H 2A74A 5HDQH 4JN1L 4KZDH 2AV1B 1YYML 3WNKA 5EC1A 1C5CH 4HWBH 4R4FL 1JPTL 4KAQH 5GRJH 1I8IA 2WZPD 1VGEH 1A6PA 5DA0B 2J8UA 4OCSL 5DJCB 2NX5B 3MV8A 5AAMA 4E41A 1U3HB 3P0VH 2GKIA 5T1DL 3UYOD 1H15B 3IFPB 3GGWA 4TSAH 1SEQL 2QHRL 1FGVH 3B6SB 5C08D 1ACYH 2BCKA 1XGQA 5I30L 4RWHA 5D1XC 3D9AH 2D9QB 2RHEA 3QPXH 3CFCL 4I5BA 3BO8B 3T0BA 3VFWB 1R0AL 2VITB 5DJ8B 5L2KA 4OLUL 3J7HA 3HMXA 3JV0A 4AIZB 3G9AB 1RU9H 2ICES 3NCEB 5KSAD 3W9DB 1BOGB 2VOTA 4X4XB 3SPVA 4Z76B 3FQTB 2I5YH 4JPVL 1RUPL 5GRUH 5CJBA 4LPWA 4DQOH 2DI9A 4DN3L 2R2CA 4K3HA 1LD9B 2IPTL 5L88H 3MACH 1X9QA 3D39A 4MDIA 4HW6A 4MB4A 3H9YA 1EGJH 1ZANH 3WFEL 3LKPB 3X14B 5HHOB 4YAQB 3PV6A 4E5XA 4LLQB 2FO4A 3DRTB 3R06A 4M62H 4LLAA 1XGPB 3KPLA 4WFFD 3Q1SH 1G7MA 2CJUL 3HPJA 1O7VA 1MQKL 3BKCH 1XIWA 3VXME 1S7XA 4ZOAA 3Q6FA 3QCTH 5DJ6B 3PIQB 5FDYA 3QA3A 1OGTA 1HQRA 2FECI 1IARB 2AJVL 2FO1A 5IVOA 5TDOA 4JO1L 2CKBH 1SBBA 2OMNA 4WW2F 5I8CB 5TH2B 3U6RA 1NCWH 1QHOA 2VXQL 4I4WB 4KK6C 3MR9B 3MJ7B 2ICWI 4ZPTB 3REWA 1IC4L 3VFGL 3QO0B 2E9IA 4NM4L 4MCZA 1BX2B 3NZ8B 4K7FA 4X6CA 1JNLH 4X6DA 4Q0XH 1S7WB 4S10A 2P42B 5F3HB 4LSSH 2NY4C 4Y5VC 3U2SA 3WFHA 4YDVA 2E6QA 3ECBA 4Z7WA 2AJXL 3MJ8A 4Z9KB 5MP6H 5IM7A 4KHXL 1KCRH 5IMKB 4BH8B 4KDVA 4XAKE 4GMSL 1R3IH 2BZDA 1KEMH 1C5DB 4XAWL 5DWUL 2QHRH 3HPLA 2C4XA 2H6PB 5HYQB 4KK6D 4ODVH 4FQIH 1XR9B 5E6YA 1MNUH 5F89A 3HG1A 5FOBB 3L5IA 4Z7OF 3GMNB 5JHDD 4OM0H 4C56B 1QPPA 5FCUL 1NFDE 4M7ZC 1IT9H 4N90E 4WUKL 2XZZA 3I9GL 4OI7A 4Z7VB 2J6EL 1WC7A 4UDUB 3LKSA 5IB1B 4S1DD 3QG7L 4CMMA 3BYYA 4XP1L 3RWGA 3SOBL 5IEKA 1G7IA 1MVUA 5FF6B 5I74C 4WO4A 2HT2D 4R2GC 1HHGB 3DBXB 3ULUD 5EOCJ 4NBXB 5FCSH 3P4NA 2VLRE 5IBTL 4WENB 5CGYD 5EU3A 3ZDYF 1N26A 5EPMB 3CFJA 2R4SL 2CRIA 4XCNB 5JZ7D 2MSPA 4NC2B 2VR4A 4UV4L 4KY1L 1JF1A 3W39A 3W2DH 1H0DB 4XP4H 1BBJA 1PGRB 5F8RC 4HKJB 5HHQB 3L5XL 4LRIC 2WLYA 1E27A 4PJ5A 3LHPL 1INQB 4KKBD 2EO1A 1DQDH 2YSSA 4XHJD 4JO3H 1T1XB 4RBPK 5F88A 1Z9OA 5TDNB 3SDDB 3TO4C 3PQYA 5JOPE 5GGVH 3CXHK 4KJYB 1MQKH 4DWHA 1WWCA 3PWPA 4LCYA 3GDBA 4Z8FH 5SWQA 3PE9A 1TIUA 1G7PB 1OB1B 1U8LB 3KYMA 3VE0A 1RZIB 5KS9A 4F9PA 4OB5L 2NZ9C 1P84K 2YOCA 1Z0NA 2A9NH 3F62A 3BKJH 2NTSP 4LSPL 2AXJA 4NKIL 2QTEA 1T2QL 3T1WA 1U91A 3EOTH 3P4LA 4YXLH 3TBYB 1LEGA 2EYTB 4B5EA 4UTBH 3SDCD 3S34L 1TZGH 4GW1B 4JFYA 3O9WA 1D5BB 4ODSL 2VDMH 3L7EA 4ZPVA 3D2UA 2IAMB 3QDME 4Y16D 2M26A 5MHSD 1E4XL 1K3IA 3W81A 1ZVHA 5IOPB 3U46A 4R90L 2OTWA 3BP6B 3JTSB 1XGRB 5C0CD 3MV9A 2NY7H 3UO1H 3ZO0A 2Q7NA 1F11B 4K71B 4ZFOA 1M6OB 4R2GB 3AMKA 3KPRD 1HDMB 2M8XA 1MHPL 4U1HA 3N1GC 1TETL 1CICC 1Y6KR 4GAYA 5KANI 2YPLE 3FN9A 4YHPB 1JZ2A 3E3QC 4OCXL 4NQXA 4IOFC 3LEXB 4MQTB 4DKFH 2R0ZL 2J5LB 2V5YA 3LN5B 3RZCA 2XKUA 4I48A 3EO1A 4WEBH 4X7CC 4Z7OE 4QRTA 4ZFOB 2DM4A 4ORGA 4RMSA 5C0IB 1UVQA 5BRZE 1CFTA 1K4CA 1XF5B 1WBXB 1QSEA 1ZS8B 1XGTA 4PRHD 4PP1D 4X9GA 4J6RH 1U91B 3TEUA 1EEQA 1GZQB 1HSAA 3OF6A 4NO3B 2P43B 4KTEL 4XNMB 3DROA 1HHKA 3MRDB 5C0BA 5ICZB 2HFGL 2D7NA 4H5SB 2V9QA 1KF9B 1QSVA 3QIUD 1TNMA 4CKVX 5GPRA 2DBLL 1G0DA 2ZP0T 4UILH 1IAIL 3IVKB 3ZTNL 3DXAA 5D1ZD 3U30C 1YEHL 2LAAA 5DYOB 3VXQA 5SWSB 1KENL 4PJEE 4MS8D 1TNNA 3SE4A 3BH8B 5I66B 2EC8A 1MAJA 3X13A 1YJDC 1NEZA 3D0VA 3MRJB 3SGEH 4XT1C 3X11B 1DBJH 3QQ3B 3RWHB 1SJXA 3BN9D 3E6HA 3WBDA 1A9EA 3O6FA 2AABH 3MLYL 4H8WC 4OD1L 4Y2DA 5CJ8A 2WNGA 1RK0B 1F3DJ 2GSIA 1DSFH 3VFNB 4Y19E 4G3YL 5DD3H 1NFIA 2A6DA 1P9MC 1AQKL 4YXKH 4OF8A 1HHGA 4Y4KB 3UZEA 4NJAL 3FFCB 1PZ5B 5I76B 5B38A 1M7DA 4HPYL 4WFHD 1WVZA 4FFYL 3WLWC 1JUFA 3BX7C 4NC0B 4FTVB 1JGLL 1OW0C 4NN6B 2GJ6B 1MH5A 4HXAL 4ZYKA 5ELIA 3QUML 4RX4D 5JLZA 5FV2A 5JORB 3HAEA 5A3IC 3S34H 3S3SA 3RKDC 4RNRA 4BK5A 4RGNB 5E4IA 4XMPL 5TDOB 4FQ2L 2N7AA 3VGFA 3EO9L 2DQFB 2MHAA 1I3GH 1YNTB 1TZHA 3LKSB 1EBPA 2KQNA 5IB1A 3VH8A 1WLHA 2OXGA 1W0YT 2XTJE 4JY4A 5FYJE 5C6TH 2IBZY 3DV4B 5B4MC 4EIGB 4RAHA 5GS1C 4F37F 5I1AA 4F7TB 4WHYH 2HWZL 4JFQA 2VLKA 2DQDH 4O2EA 1AP2B 2BY2A 2VKWA 4FQ2H 2IANB 3CXHJ 3N1MC 1YDPB 1DE4A 3RTQA 4EI5B 5C0JA 4BH8A 4GUPB 2VL5B 5C08A 2F8XC 2ZOKA 3GI8L 3PWVA 2DBLH 2R56L 3EFDH 1C16A 3CFEB 3KG5A 1IGIH 3T3PE 3W11D 2VLMD 1PEZA 2NZIA 3ZKMD 4PJHA 1JV5B 4J8RA 4DJMA 4JGJA 1IEAB 2VDRH 1KPVB 1HE7A 3BT2H 4YUEH 4V1DA 1AR2A 5IW6B 2QQNH 4WY7L 5D1QB 2XKSA 1X5IA 1KC5L 1R5VB 5B22A 1FHGA 4G9FB 3E2HC 5L6YH 1MFEH 1UGNA 1W0VB 4LPYA 3TN0B 4F9PC 3Q5YA 5IG7A 4KGLA 4NQVA 1T6VN 2RB8A 3MJ7A 3DX6B 1P53A 4KK8C 5AEAA 1H15A 3IFPA 4TVSa 1WQVT 1EVTC 1DN0B 3TJHD 3X13B 3QWOA 4FQQA 3UPCA 3IU4H 3SJVB 1Z3GH 1P6FA 5IQ7H 3RWFA 3MV8E 4EJ1C 3AU1B 3NCYP 4TNWF 1RVFL 2J8UE 2PTTA 4L9LA 3WFDL 5JA8B 4L3EA 5D71L 4D0DA 4OTXL 3FMGL 1GL4B 2GUOB 3W11C 3U48A 2COQA 1AKJB 2XTJD 4QHUA 4CVXB 1DJSA 3H3KA 2DYPB 5C0JB 2FEDC 3QDJD 1JZ8A 5DJYA 4Y1AB 5DK0A 2WSKA 1I7UA 2AI0H 3GSRA 4G7YH 4M8QB 1MCSA 1X7QA 5DHVB 1KBGL 4XNMA 1BQLL 3DO7B 5B38B 3FFCA 1NSNL 3HZMB 4FXGB 1HSAB 2CMRL 1ZHLB 2DQHL 2X1XR 4YDIL 3BH9B 1LO5B 1WFOA 3MRLA 2F9BT 1U36A 5J89A 5KVFH 4IBLT 4P5MA 1NGPL 5GGUA 3K4AA 1QPXA 3RPIA 4LLWB 4WO4C 3STLB 1Z9MA 4I1NB 4UIMB 4WFGD 3V0WH 1YNTA 2AJYL 3FB7A 4ODHL 3NIGF 1VPOL 4M48H 1BAFL 5CMAA 2BRRL 2NY2B 4HUVA 5F7DB 2IALA 4QHNA 3HC3L 1UB6B 5F21B 1XGQB 1CTOA 4R26H 4Z7VF 3SGKC 1PY9A 2VDML 3GI9H 3WFZA 3EUUA 4FQLH 4PG9B 4TNWK 3S3JA 1A7OL 1GYAA 2ATPA 2WIIB 4P2RD 5E1AA 5SX5K 2CXKA 2YD5A 1YQ2A 2GFBA 1QR1A 4KJQD 1YN6B 4B53A 2XWBB 1NFIB 4HKZB 2A6DB 2VR9A 1GHFL 1LE5B 1F2QA 5EO9A 5GS1B 4NP4H 2QKIB 3IJYA 2XPGB 3DECA 4K8RC 3MJ9L 2YD6A 2EE6A 2V17H 4Y4HD 5CUSL 5K93A 1ZVSB 3GGWB 3IAPA 3SDAD 4QXUH 1J0YA 3B5TA 4P5TB 5E2VH 3BW9A 4HULB 4HFWB 1DANU 4JDZA 3SCMA 4BM7A 1QR4A 3TBSB 2P5WA 4CVZA 3A6CH 4UB0H 3DX9A 3LRSB 4ONGH 3ARBC 5GS0C 1IGMH 2OSLB 1T5WB 3O4LD 5C0FB 4X0KB 2PF6A 1ZANL 3H3BC 5J12C 4LVOC 3BP4A 1NGZB 3KXFD 2XTJB 4GXUM 5F88B 2VABB 2APBA 3MRKA 4FNLL 5DC9B 2LU3A 3L3JB 4G5ZH 4PJ7E 4XWGH 3JWDH 5DUPL 1XIWC 1AD0B 1K2DB 3WFEH 2XQYK 4P99A 2Z31C 5EIIB 2OTWB 5E9DD 5ITBL 3UDWA 4L3AA 3CDFA 4UB0L 1MPAL 5F3BB 4XVSH 4LLVB 1OM3H 4P5TD 5DLML 5K59E 4AENA 1K5NB 2BSTB 2GJ6E 2XIDA 5FV1L 1U8HB 1W0WB 1KJ3L 5CWSB 1KJ2L 3IFNL 3P4NB 1L4IA 4QRSA 1B9ZA 5TFSL 5FECA 4ETQB 1GGYA 3GNMH 3NFPB 3KLHC 1LQSR 2DM2A 4MNGA 4RFOH 4ELKA 1SJEA 3HE7D 3PDGA 1MJ7H 5E0QA 1NEUA 3QUZA 4DEPC 2EDJA 4OD3H 4YC2B 3GHEL 4YHPA 2CLRB 1KIUA 3RL1B 3HS0A 3CMGA 2O5XL 4JDVA 2J8HA 3DVGA 5DJAA 5IVXB 3L6FB 5KVFL 3SDCA 3C6LC 2X70B 3TO2B 3JWOL 3UC0L 3Q2CA 2QADD 4YEEA 4JB9H 4IHOA 2W9DH 5GGVY 5IT2L 4UIKL 5H2BA 3HC3H 5F89B 5D1XA 32C2A 1YC7A 3CU1A 2XQBL 3D25A 5JNYB 2BXYA 1FZKB 3THML 3BD4A 2JELH 1QRNA 4KHXH 5TE6H 4WI4A 3V5HA 3RAJL 2FGZA 4L4TA 5DMIH 2KPNA 3HZYB 1T1WB 2WBJC 1JNJA 5F1OB 5F9DC 1MAML 4HCRA 5DMKA 4DW2H 3VXUA 3OBAA 2XY2A 4E42A 1R5IA 1FO0L 1X5AA 3EJZD 3RL2A 5ADPH 2AXGB 3KJ4C 3O2DA 4XBGA 3VRLE 3W82A 2P24A 2OLDA 5J6GA 1CDCA 5HSFA 1MY5A 4Z95H 2VZOA 3LH2L 3MNWA 2PXYB 4ZO8A 5DFVD 3WNOA 2WANA 3VRIA 1JMXA 2XOTA 1NBVL 3QDHA 2DL2A 4LHUA 4R96A 1CT8A 3MOBH 3VFRB 5DJDB 4HKJA 1FFPA 4JFDB 4F33A 1A6ZB 1G0YR 3QHTC 3WNNA 3QPQC 4G8EB 2Q7YA 1VA9A 2R56H 4HS8L 3BKCL 3EFDL 4H1LA 3ARUA 2X4NB 1ZTXH 1FSKC 5F3HA 4YXHL 4HJJL 4U0RC 4KHTL 4NZTL 2P7TA 1S8DB 2WMPA 3P73B 5GISH 2CJUH 4PJGF 4X80H 4R4BA 3FTGA 2P47B 4N8VB 5I8OH 4OLWH 1JP5A 3O6ML 3MRFB 2YRPA 4JG0H 1IGYA 5DJ0A 2NXYC 5IHZA 1I7RB 3D39B 4MDIB 2N56A 2DDQL 4HD9A 3O9WD 1TPXB 5E03A 4YHLH 4F7CA 3QXAB 3RX5A 4XMPH 3QIUC 3QO1A 2CDEB 2XWTB 4DKDC 1BZ7B 4X8JA 3HRZB 1HH9A 5HHXL 3OKMA 4O51A 5J3HD 4JEGB 1R3KB 3CCHA 3TPKA 4JGMA 1HILA 1UXSA 3C5ZC 4MZ3A 3CFDB 4RMUA 5D7LB 3CD4A 3GIZH 1ETZB 1FGNH 1IC7H 2EICA 3DMMB 1WWWX 1X5YA 2B1AL 1C5CL 5T1MB 3OKMB 4O51B 4F57H 5FB8B 3VGBA 1OVZA 3MRMB 5F9AC 2NY3B 1VADA 4JN1H 1RK1B 4GKZA 4WCYH 2YD1A 1CICD 1RJZA 3VWKD 3ABZA 2GJZA 1FP5A 3QAZB 1KIRB 5E1HB 1NCBH 1NCDH 1UWXK 4LLDA 4WEMB 5INCB 3QJHA 2OXHA 4N8VG 5LQBL 3X3FH 4Z7WF 4KQ4H 1KB5A 4NYLA 5GGSA 1U3ZA 5HVGB 2W0KA 2A1WH 1AGDB 2EH8L 2UY7A 3O0RL 5GIRA 3DXAD 3VWKA 1YYLL 3DMMD 1KC5H 5AYQA 4WFGE 2BERA 1F90L 2OJZH 3K2UH 1MJJB 1CR9H 4ZUTB 3ZT5A 1G7MB 2WBJD 1T5XA 3WFCL 3QZWB 1DQML 1OSPL 2ZCLH 3UJIL 2F8VA 2EDHA 2QQNL 4WY7H 4MDJB 4APQC 3B6SA 4YHOH 1E28A 4Y5XB 2DRUA 3TBVA 2EIBA 4F9LC 1BQHB 5DVKA 3MLZH 3B2UC 1B90A 3L3OA 4MGXA 2WQ8A 3P9MA 4KVNH 4OQTA 2YWYA 2VDPH 4ZXBC 4JJHA 4WNQB 2X09A 1GVIA 2FLRT 3P30H 4UILL 1CZ8L 3O4OB 4KRLB 4M6NL 1TITA 3A67H 4HHAB 4UT7H 3WL9B 2JJVA 5EA0L 4F2MA 2JIXB 4XBGB 5C2UB 4PGDA 2A77H 2GSGA 3B8SA 5DVMA 2J2ZA 1HI6B 3O6MH 1PBYA 4H25B 3HE6C 2APTA 4PJ8D 1CK0L 3VFWA 5DQDL 2QHLA 4HIEA 3DYPA 5D6CB 5D7JD 1U92B 4OD1H 1PYWA 4ODSH 4MCYA 3CZFA 2P5ED 4UT7L 5J6HA 4RDQG 1F58L 5M95B 3LY6A 4TTDC 4RQQB 4N0UB 4WIQA 4DKEH 5I1IH 1OAYH 4BYHA 1W72B 1GOGA 1VDGA 1WT5C 4G8EA 4K3JH 1F42A 3VXSB 1QLEL 1T0NB 3QH3B 5HHPB 1S78D 3QIUB 4IRSA 5CIPB 2YD8A 4PRAA 5FKAB 3DRQB 1NCDL 5KS9F 1CF8H 3CNKA 5SX5H 4JRYB 1A3QA 5CD3A 1UKQA 1FYTE 1WTGT 2BOCA 1MRCH 2GQHA 5D96C 3JVGA 4LK4A 2CK0H 4QCIB 1EEUA 3QI9D 5JIHA 4ZDHB 5GHWH 1NANI 4NQDB 1SJEB 1NDGA 2MMXA 3G08B 4HK0B 4HBCH 4NKOA 2OL3A 3RWIA 2C5DC 3V6OE 3OKYA 4PLOB 1V8HA 3EJYC 1I3GL 4WUUB 1RZJH 1BIHA 2Q6WB 2D4DA 1ZHKB 4JRXB 1GIGH 5IB3B 2YMXH 4UV7H 4PRIA 2VDOH 4UT6H 3CAFA 5FO8A 4M6MH 4JKMA 3HNTH 1MCPL 4HS6B 2AW2A 4HK0A 4TUKL 3L3DB 1JPGA 4WGVB 2BOCB 4WWKB 4HGKC 1BQHG 5IFHH 1RIUH 4ZG1A 2JJTC 3C5ZA 5IEHA 4P49A 5BOZG 3ARDC 4LFHG 4XCYB 2BVPA 2CSPA 4MVBD 5C6WH 3HN3A 3VWJA 4L8CA 5SWZA 1VACA 3NCCB 2XZQH 2VUOA 5L8LB 1EIBA 2PO6B 1OTTC 1VFOA 3VW3H 4K8RL 4WI3A 1CD8A 2YA0A 1XF4A 3P9MB 3MCLH 3O8XD 2Q76A 1T22A 3HC4L 5GXBB 3F6LA 3EO0B 3DUHA 1FC2D 3IDIB 4LLDB 2YHGA 5INCA 2R8SL 1CD0A 4HHAA 3NIFE 1IQWL 1CQKA 5DFTA 1I3UA 2E7LC 1LO3H 1DQLH 2ZOLB 4JRXA 1S7SB 2DMBA 5A1AA 1HI6A 3LIZH 1AFVH 1SVCP 2ESVD 5I6XB 4KRNA 2JB5H 3OSKA 1AGDA 3SKNA 1FYTA 4RZCA 5FHBH 5JOFA 1E4WL 3BW9B 4Y16A 1N6UA 3BZFA 4I3SL 1NAMA 4U6HB 3RVUD 2R4RL 3MNZB 1ZHNB 1KCRL 3KPOB 2JCCF 3B2VL 2HN7A 3GJFH 2Q1EA 4Y5XA 1E28B 1T03H 1ZLVH 1W8OA 1N0LA 4YHLL 1FAIL 4HGWA 2PYED 5F1NB 3AS2A 4M4PA 3VXNA 4I18B 1MELA 4F7PB 4Y8AA 4YH6A 2ATPB 3CPLA 2EE2A 4KKCC 1CFNB 1PKOA 4YFLI 2C9AA 4Z0XB 4YE4L 1CDBA 3WD5H 4O5LL 3EYFB 5TQ0L 1FNSL 3GK8L 3MOAL 5DURB 4PRPA 2BP3A 1DEEA 4OLUH 2H8PA 1JZ6A 3WHE1 2EYSB 4JANA 4PJ5D 3QXWA 2BVQA 2MPAL 3IDXH 5GGSB 2A6KA 3I6LE 3SE3A 3ZKMC 4D3CL 1IMHC 2OP4L 3OPZH 3KPRE 4Q6IC 1OAKH 5ANME 5SX4I 3B83A 1NCCL 5CIPH 5CHNB 25C8L 5CBAA 4ZAKA 1QZ1A 3CLEL 5JPMB 1V05A 1V7NL 2AKRA 1AC6A 5IJVA 1T21B 5FYJL 1TJIH 1Q9WA 4TUJA 3QNXB 4MSWB 4LBEB 3T8XB 4DUVA 4AQOA 2YD9A 3H9SE 3OKEB 4GG6F 1P7KA 4WWID 3OR7B 1X5FA 4JPVH 3SDCC 4NNXA 4XPGL 4X8JB 2NXZC 2BVTA 4OZIE 1GSMA 4Q2ZB 3EOAA 2O61A 4HJGB 2OI9B 3UTPE 3T4AA 1R3JB 1MHEB 3WE6B 4HWUA 1WZLA 4GO6B 3BH9A 1CFVH 2R1WB 2UUDK 4UAOC 43CAB 3A6CL 5F8QC 3N50A 1IGCL 3TV3L 5D72H 4YO0B 2Q86B 3HZKA 4LMQI 3V5KB 1I7ZA 1UCTA 4WJ5B 3GSWA 5ITFA 1AE6L 5DK2A 5CP3A 1G7QB 1NMCB 1OL0A 3QEQB 2R8SH 3OG6B 3MGOA 5EZOL 3VRIB 2HVJB 3TBWB 2R23A 4GFTB 4P3CL 4OCYH 2B5IC 4JJ5A 2XN9D 3T3MF 5BO1H 2OCFD 5DR5H 1BJ1J 4N9GA 2QBWA 2F58L 5T3XD 4X6FB 3VGGA 2I9TB 3V4PH 1DBAL 3GMQA 4G8FA 1FVCA 2VERN 3TLRA 1GAFL 1LVEA 4XXDA 4M1DL 1ZGLP 4P9HL 1UM6H 4YFLF 4LKCA 2R4RH 3SDAB 3V0VA 4NRYA 2P4AB 4XNYL 1XGYL 2DAVA 2AJXH 3SCMC 4WFHE 5IHBA 3T0EB 2SEBA 3N0PB 5ACMA 3NIDF 5F7YC 4HV8A 3V52H 1BAFH 5L2JB 2DMKA 4EDWH 4FG6C 4QXWA 2XZCH 1U8JB 4S2SA 1I75A 2BHZA 5KZCD 3IVKA 3WUWA 4PJFA 2HH0H 4Y4KA 3O41A 4O5LH 1RHFA 2UZXB 4P4KC 3MUHL 3VRJB 3TBTA 3IJSA 1FLRH 3U0WH 3ULUH 2E7LA 1U6AH 4LPTA 4PR5A 1GCFA 1GHFH 3O4LB 3ARGD 3MRKB 4ZUVA 2P5EB 3X3GL 2FYYB 3Q3GB 2PO6A 4U3CA 4E0RA 2AK4A 3EYUL 4IHOB 1S3KL 4U49A 3ZDXE 3EOBB 2L0DA 3ZKXC 4P0DA 4ZTPL 1I3RA 2F53B 4Q6IB 2X4NA 4DGIL 5BZDA 5CEXB 5C0GA 1U8PA 4Q6YA 3NABL 4Z77A 4R0LC 5DS8A 1OSZA 3SJVE 1UM5L 1A3LL 3FB6A 1XFPA 4U6XB 4Q7DA 4LRNH 1CTNA 3SQOL 4RCAA 4P4KD 1D5IL 3HKFA 5KSBA 5FGCB 3MGAA 4F37K 4S2SB 4KROC 4AG4H 3PP3H 3PNWA 3LRSA 5A40E 5GJSL 2E3VA 2IGFL 1XR8A 1QFWL 2DQIH 5L2JA 4IRJD 1BJ8A 3QHZL 1CLOH 3VXUE 1NCUA 1IGTB 3OHXA 5BV7H 2F53D 2OTUB 4KJPC 4L9LC 4Q9RL 4PRBB 3SE9H 5J9PA 4FQHB 1Q0XH 1TCRB 3RWHA 5L7XH 4IMLB 1QLEH 2BVUA 1H8OA 4KH2A 1T5WA 2NZ9D 5FO7A 3JVGC 1QSFB 4M1GL 2CLVA 3VXRD 3MXVL 4LCIL 4YHZH 3BDYL 2A83B 3FAWA 2HWZH 4A6YA 1AFVL 3K8MA 1ORSB 2ED8A 5DMJB 4LAJH 3WLBA 5HHVH 3HE6D 3UZQA 3GSQB 2WINA 4JR9L 1ACYL 3VXRA 4JDTH 3V5KA 4NQEB 5KSAC 5C07E 2ZPKH 4MQ7B 2GSGB 2EDRA 4XNUL 4PYHA 4ZO9A 4L8DA 4NCDA 3OL2A 3TIDA 2K3TA 1RSFA 1Y0LB 3R1GH 5E08H 1IGTA 2E8ZA 3OHXB 4P5MB 2G5RA 4RGND 2NXZD 4FQXD 4OCXH 3K0WA 3DURB 4KTEH 3TO4B 1KUMA 3NFNA 3VXPA 3TNMB 4CDGC 2CGRL 5CJQL 1ZLWH 1S5HA 3IXTA 5CMAB 2ICCA 1T83A 3Q5TA 2NYYD 4HWZA 1V3MA 3GSNA 4JFXB 4NFBA 4CMMB 3NPZB 1JFQH 5EOTB 1FIGH 3QZWA 3B43A 1PVHA 4GG8A 1EA9C 1GH7A 2CQVA 1FO0A 2P5WE 1C8PA 4I9WD 2YRZA 1LK3H 3RGVC 3MV01 4OKDA 3T2QA 2EH8H 5DGQA 3CFJB 1D5XB 3TPUA 1UCBH 1EO5A 5I9QB 4C55A 4LEXL 4EI5D 4J3WA 4S1SH 4WU5B 4HUWB 4JQIH 2AABL 3MLYH 4V2BA 3F12B 1EK3A 3MRCA 1T2QH 1T0MB 4ZXBD 1OSPH 2ZCLL 3LPFA 2FB4H 1A7NL 2ARJA 2BNQB 4PJ7F 5HHQA 3TFKD 4PY8I 2FL5B 2H32B 3EOTL 3BE1L 5I2IA 2YPLD 1B4JH 3BRGC 4NJAH 5D1QD 4G8GD 5DJXB 4JFDA 4F33B 5DD3L 4X98A 4TN9A 2NY7L 1NLBH 5EOCL 3J8F7 3SE4C 5C8JB 4YHYC 4TYUA 4QY8A 3UP1A 4XB8A 1PQZB 1YJDL 3UPRB 2ADJB 4D0CA 2IEPA 5BQ7B 4NKDA 4U6YB 1XF3A 2X1PA 1BEYH 4HEPG 2E9JA 15C8L 1A4KA 3FQNA 4M7JH 1MCOL 3PIQA 5F6HI 1YN7B 3AVEA 4NHCL 2EC9U 4JFFA 4TVPH 3QIBD 4P23D 4N68A 2F54B 4F7EB 3DX7A 2VL5A 1CL7I 3FFCE 3QEGL 4PJAB 4CUCA 4QTHA 3PGFH 1I9IH 3LRHA 4XVTH 2E6PA 1A21A 1G7HA 2VN7A 4GBXA 3B9EA 4E5XB 1R5WB 2C1OA 4I3GA 4KPHH 3OAZK 4K71C 4PJ8C 3T2PA 2CKBB 1SMAA 1OWWA 2R29L 2QR0A 2FH6A 1PEWA 3QQ3A 1FN4A 1AXSA 1A1NB 1ZLVK 2VKXA 2X4SA 4GSDL 3SKMA 4WW2A 3LRGA 3OAYH 1JI2A 1NBZA 3KWWA 3K2UL 3SN6N 4JFFE 5AYUH 1JPFB 4XP5H 4U7SA 5ADPL 1KNOA 1E4XI 2Z31B 1M7IB 1EJOH 1I7TA 5ICYB 5CJ5A 1IGFH 4XI5C 1WF5A 1AI1L 5D2LF 3MR9A 2VXSH 4NUGL 1HHKB 3MRDA 5C0BB 5F1IA 4ZOEA 2GHWB 1HOCA 4PJHE 1PQZA 3HAEB 4KKAC 5DJCA 5KJRH 2BK8A 3VFSB 3MV9D 2IANE 5FGBC 5DRWA 1BBDL 2P24B 2AXHA 3UTQB 1MCLA 2AERT 4FTVA 3VXQB 1D9KB 3L1OH 1RJLA 4Q9QH 3WNMA 2QV2A 1J0JA 3H8NA 3SE8H 4X80L 5B3JE 4OZGA 3O6FB 1L6XA 4TOYL 3NIFF 1PX4A 5LGJA 3WIHH 5CIPA 2FATH 5BCAA 2VZ1A 5L2KB 2GT9B 1LO4L 5D6DA 3VFNA 1H3TA 5ESQA 3OJVC 3I2CH 2NR6C 4HIXL 5FUOH 4GMSH 4HAGA 4OGYH 4ELME 4I9WE 4JQXC 5D7SL 3BXNB 1AR1D 5IBUG 1K4CB 1XF5A 4P3DB 4WTXA 3WEXA 5KG9B 2NX5E 2HAZA 1BVLB 3K1KC 4UTBL 4YWGL 4LCUB 1MNUL 3IJYB 4U1JA 4Y4KC 5ICZA 1UM6L 3T0XA 3LPGA 4LLQA 2W07A 4L3CB 3DROB 2ZCHH 5E95B 5HHOA 4KXZI 3NN8A 2R69H 2AV1A 2D0FA 1GOFA 1JNLL 4RMRA 4XTRD 3H42H 5CILH 4MLIA 5B3NA 4FQHA 1JIBA 2ADGA 3HNVL 5IQ9B 2JIXA 1HHJA 2VSCA 1XF2B 2MQCA 1NCAH 1F11A 3MXVH 2Z9TA 1WITA 3QUZC 3PGCB 3EYVA 1OCWL 1E4KA 1T1YA 2AV7A 3OXRB 5JIKA 2EIZA 2ITDB 3L7EB 5DURD 3ME0A 4A6YL 1R3IL 1UZ8B 3KHOA 2FR4B 1V5JA 5BVPL 4L1DA 3AAZA 4JG1L 4LSQH 5DD0H 3WNLA 1INQA 1BFTA 2FNBA 2UWEE 1GGCH 1PJ9A 3WV0A 4OM1H 3OWEA 2RBLA 4M5YH 4MJID 2UWEA 2Z31A 3JSSA 2Z35B 4PS4L 4U6VH 2I5YL 3PV7A 2NY5C 1IT9L 1HHHB 5CEXA 5IFAH 4JFPB 4NWTL 2EEDA 3MGTB 5ADOH 4HPOH 1RZIA 5DD1H 2APFA 2ZUVA 5JHDB 3VXTB 3EYQC 2XA3A 3DHJA 3VA6A 3WIHA 1NL0H 3QWRA 4RFEA 1AO7D 5BRZB 1V7NH 1Z6JT 4J7RA 3QCUL 4EEEA 5LGHH 2H1PL 3AAZB 1F4YL 5D1QC 1R3LB 3DLQR 1TLKA 4KZEH 1UH4A 5HHOE 1MCWW 4XCNA 4ODBD 4FQCL 1OP3K 3B5HA 1DN0A 4EQ3A 1ZLSL 3FT2B 3DVNB 4M93C 2IMMA 4C56A 5GS2D 4JE4B 4P2RB 2NLJA 4YDIH 4N0YL 1FNGA 2LFGA 5KSBE 2EKSA 3ZE1E 3QUXD 4KAQL 4YDKL 5GJTL 2CR3A 2WW8A 4X7SH 2Y23A 4D9QE 4PJAF 1CGXA 3V0VB 2VLLA 1IC4H 3SE3C 3VFGH 3VG0H 3CU7A 1KTRL 1VB9A 3B9AA 4MX7B 1A7OH 3QNYB 1SY6H 2CDGA 4FA8A 3GM0A 4EOWL 43C9A 3F7YA 2H32A 3FRUB 3VD4A 1H3XA 2ZUTA 4D3CH 1TTUA 2NXYD 2ZNWA 4F3FA 4G9DB 4P9HH 2FD6H 3LQAH 3WS3A 3QUXB 1H5BB 4A6YH 2HVKA 1WK0A 5I71B 3HE7C 5IF0A 4LSRL 1N5YL 4N0RA 1PG7W 3TT3L 4U6VL 3QHFL 5GRJL 2VH5L 3L6FA 2AEPL 3IDXL 1CFBA 1MHEA 1XF3B 3PQYE 1S7XB 2Z8WC 2ZG3A 3WKMH 2P8LA 7CGTA 1FVEB 2Y5EA 3LKRB 3PJSA 4WO4D 2HFFA 2VLRB 4ONGL 5MI0C 3GJFB 3TGXA 2R29H 4GAGL 3IJHB 1RU9L 2ADFH 3MRNB 3C60B 4OZHA 3ULUL 1K5NA 1U95A 4DCQA 5MEOA 2HRPL 1RUML 5F70A 3MV7B 1MJUH 3V7MA 4ZAKB 2ICWJ 4PJDF 3A6BH 2D31A 4KXZH 4DZ8B 4YC2C 3CFEA 2B4CH 5TDPA 5KVGH 2FGWH 2DN7A 1FL5B 4Y2OA 1EJOL 4G80B 1RUQH 2ZKHL 5A2IH 4UDTB 3S5LB 5DSCB 2K7PA 3RWJB 3D0VB 3MRJA 3HTLX 3CXDH 5MEPA 4K8RD 4K23L 2XA8H 3ARDA 2VITA 3VI4F 4HMDA 3EKCA 4Y88A 3RTQC 1KBGH 1JYNA 4LQFH 1XIWB 3PL6D 1C08A 3S98A 1BFOB 1RJZB 1XGUB 2UWEB 3LS5H 5CEZD 1F58H 4X5XA 3TWCH 4G6MH 4IMKA 4XZUB 5GS1A 1MWAH 3PHQA 4LSVL 3EHBD 3IAQA 1KXTB 3MJ6A 1OP5H 1U3JA 1M7XA 2OI9C 3BIKA 4I77H 5JA9A 1ADQH 2A74B 2AI0L 4ODWA 1VENA 4EXPX 3V6BR 1NGPH 3MBEA 4N5EC 2NPLX 4YPGB 4NRXA 4O2FA 4TVPL 3R06B 1X6LA 1SM3H 5HYIA 3ULSA 3ZE1F 3S36L 3ZSSA 3VFPA 3NZHH 5GZOD 1RD6A 3V8OA 3GSXA 1G9NH 4E41B 1HWGB 3MV8B 3PDOA 3LD8B 1JPST 2VC2L 4Y4FC 4BSVB 4B7IA 1OW0A 1NQBA 3OXRA 4EI6B 1UEYA 5JIIA 4UOW1 4IRSC 5CZXD 2V5MA 3BN3B 3VMOA 3CVHB 1KPUA 2FX7H 5CZKA 3OKNB 2OZ4L 4MD4B 3X17A 2XKNB 4O9HL 3EZ8A 3SPVB 3NAAH 2CLZA 4KJWC 2HKFH 1MRFH 3L5WB 4TUKH 2X6MA 3NN8B 4POZC 2VYRE 1JHKH 1RUKL 4Y2DC 1Q1JH 4ZPVB 5J0BA 4OUUB 5L9DL 1OCWH 1AGCA 3ESVF 3RI5F 2BNQD 3WJJC 2IPUK 5ALBL 4RAUA 2C26A 3UX9B 3IKCA 5EUKA 3RJDA 4LLYB 4IRSD 3JWNC 4Y5YA 1T2XA 4X99A 2DOCA 3GSVA 4PP2B 3TCLA 1GRWA 1S7TB 5LGJB 2DTML 4GBXD 4N9OB 3MA9H 4PJFF 5DRZA 5C07A 3W9EB 1YYLH 4ZXBA 3VFRA 4KI5C 4Z78A 3B5GA 1LDSA 3ZTJH 3MNZA 2XG5A 4N8CL 1L7IH 5DVLA 4MA7L 4KKLD 3IAGC 4HSQA 4LQFL 1CFTB 1YPZF 1EO8H 1UYWH 4G8IB 1YEHH 1AKJD 5F9OH 3I50H 2FCBA 5HI5D 1E0OB 1W0VA 5IG7B 3TN0A 4M03A 4CU8A 1XT5A 3S9DB