3QI9C

Crystal structure of mouse cd1d-alpha-phosphotidylinositol with mouse valpha14-vbeta6 2a3-d nkt tcr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
201
structure length
196
Chain Sequence
TQVEQSPQSLVVRQGENSVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSACANAFNNSIIPEDTFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title A molecular basis for NKT cell recognition of CD1d-self-antigen
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 36
structure length 196
sequence length 201
ec nomenclature
pdb deposition date 2011-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qi9C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qi9C02
1JGDB 2AW2A 1T7YA 1I1AB 3RWFA 1F4WL 1FBIH 3LKQA 1EFXB 3U7WH 2O61B 1JN6A 2SEBB 3AU1B 4N9OB 5I74C 2Q8BH 4IRSC 5KANI 1SBBA 3C8DA 3VXMB 2BHYA 1D5ZB 5TF1L 3GZKA 4PRAA 2IQAA 4ZSOA 4OT1L 4M7ZB 1JRHI 1KJ2B 3BPNB 4P57B 5FYJD 5IMOA 3ZE2E 5F7KC 4PY7A 4BQ8A 4F7EB 2EDKA 2EIZA 4FXGB 2R15A 2NY3D 3ZHKA 4AEIH 2OM5A 3HNVL 4L29B 4IRSB 4NFDA 4LNVA 3TFKC 1FL6B 3L3OB 2HWZL 5EBMB 3PWPB 1FPTL 4N0UA 4XZUA 5TPWL 1GAFL 3N1MC 1G6RB 2DWEB 4N8CH 3L5IA 1NUGA 5JPNB 4BFIA 3DUSA 4X98B 4YDVA 5ICXB 5DO2D 4WWID 1IGYB 4LARH 4YQXH 5HSFA 4HLZG 3N50A 1IKNC 1Q94A 3P0GB 1FL3A 5BV7B 1KJMA 2H45A 1QR1B 4OLWH 1FNEB 4X0KA 1U95A 4ESKA 3BHBB 4KMQA 5CBAB 4MYWB 4LAQH 1EVTC 5EO9A 2QQLH 3MUGB 4YHIA 5BW7C 3QUKB 1TQCC 3HC0B 1X5IA 5IHZA 1CN4A 1V7ML 4WHTB 4LCWA 4DN4L 3ARFA 4KQ3L 4J3UA 3PQYA 1YEDA 2NY3C 5FKPB 4NWTL 5CD5D 3PHQA 2VJXA 2MQCA 3B9KD 3TNNA 1F3DH 3AM8A 3TIEB 3PXHA 1UM5L 1A4JA 5HHNA 4NQTA 1NBZB 4NWUL 4TQEL 5SWZD 2YRLA 1P4LB 2IPUG 3OKMB 3TEUA 1UACL 3F6IA 4F7PB 3P73A 1QQDA 4HEME 3VU2A 2G75A 4OM0H 1LE9A 2WV3A 5IVZB 2Y5TB 2JCCE 1AQKL 3MTRA 1IQWL 1SYVA 1BLNB 3MNZB 3O2VL 5DO2C 3FQWB 3GMQB 3D25B 4MJIE 2VOTA 1GIGH 4TNWK 1PEZA 1QZ1A 5C3LD 3OQ3B 1JPSL 2E27H 3HC3H 2BC4A 4P9HL 1BEYH 5HHMD 4XMPH 4LQFH 2OK0H 3BQUA 1X9QA 1WF5A 4OZFB 2V5YA 5EU5A 4QHLB 5DUML 3F5WA 4ODBD 4AIOA 2VQTA 3VWJA 4OLUH 4QYOA 4A6YB 1MHCB 1EGJH 4FABL 2R23B 4V1DE 5LQBH 1GOHA 1YEHH 3K2UH 3GJFB 4IDLA 2V17L 2V5RA 1YPZB 4XCFH 1YNLL 4NO5B 3P9MA 2PYEA 4OCNC 1FIGH 3ULVE 1MCOH 3V6ZA 2VSCA 3MRNA 5HJ3B 1BOGA 2IALA 3ECBB 1MREH 2Z31D 1QSZA 5F9OH 3GSNH 3ILPB 3TV3L 4OFDA 2DM2A 1UH4A 3B9KB 4U1IB 1S9XA 2VWEE 3VXRD 4G8IA 5F1NB 3TWCH 3GSNA 2GFBA 1SYSB 1AQDA 3L9RA 5DEFB 5SWZB 4JR9L 3VFVB 1DJSA 1C5DB 2FL5B 1LVEA 5TDOA 3QCTH 5TQ0H 5SWSD 2DJ4A 5D7JA 1R3HB 3MV7E 4M62L 1ZT4A 1SHMA 3HI5H 4CJ0A 5GRUH 3U0PB 4FNLL 3MZTA 4YWGL 5IOPB 4BQCA 1P1ZB 2Z93A 2ICES 3NFNB 1QRNE 1NGYA 3HMWL 4HIJA 4XPTH 2VXQH 3VXME 5HHMB 3QDJD 5SX5H 3F8UB 3P4OA 3QPXH 3TYGL 3X3FH 4HXBH 4X99B 2A6JB 1R5IA 2Z31C 4RGOL 1I85C 5L2JB 1FYTE 2E7MA 4LSUL 2P48B 4MJ2A 4ORGA 2EIEA 2DM7A 3TN0A 5DQJB 3GI9H 5HYSG 3VFPB 2R4SH 4P5MA 5DDHA 4I48A 5K9JH 3BKCH 1YA5A 5F96L 5D2NE 4KPHL 1OSPL 4L8CA 5EA0L 2GT9A 3R1GL 4D8PB 5DT1H 3QIWA 2FIKB 2Z31B 3GIVB 3HZKB 1E6OH 1QFWM 2JCCF 4NSKB 3T4AB 2KQMA 2JJWA 3OXRA 3E8UH 2FBJH 2FWOA 3GBNH 3QIBD 4FG6C 3VXRB 3ZSSA 3PV6A 3QRGL 4M9PA 4QXTB 3RUGE 1CGXA 1AI1L 1KCLA 5HGGS 3FAWA 4HF5H 1KCUL 2C3WA 1RZ8A 4L8BB 3GKWH 3K80A 3QA3B 5CEYB 4WO4D 4HWNA 1CG9B 2QR0A 5J12C 1TJIH 5HGHB 5SWSB 4N1CA 1MCHA 4LOUD 2IPUK 4X4ZA 4G6JH 2FJGB 4F7CB 2Z8VC 3S96A 3LS5H 3FRPG 1K3IA 5DHXB 4PG9A 3D39E 4O2EB 3O3DB 1VHPA 3UTPE 3QG6A 1TZGH 3BW9A 1LD9A 5CILH 4ZO8A 2ZNWA 3QDJB 5E2WL 3IETA 2NZ9D 5J12B 1P2CB 5DC0A 4XB7A 3VCLA 1HH9A 1EEUA 1ACZA 4BSJA 3S34L 3VFWB 5I1IH 1EBAA 1W0WB 2DI9A 1LWRA 4M7LT 4CDGC 1RJYB 4QXGH 1EEZB 4XBGB 2ITCA 3EOTH 3HUJE 1P7QA 2L4OA 2OZ4H 4HD9A 3B2VH 1RURH 1T1ZA 3IXTB 1IKFH 4LEOB 1FHGA 1M7IA 2DAVA 4B50A 1VFBA 1FNSH 1JE6A 5GSVA 4QY8A 1RUQL 1IC5L 3SDAD 4WO4C 5C0FA 5GSRA 1F3JA 3A6CH 2EDYA 4H26A 4PRIB 2YPVL 5FDWA 1JYWA 3OG6B 3QIBB 4KK9C 5JHDA 4POUB 1U8LA 5KW9L 3NFSH 3HG1D 3HFMH 4D3CL 4KRMB 1EEQA 5DFTA 4MB4A 1HQRB 5SWQB 2OTWB 1YPZE 3MREA 5C92A 5HI4D 5JPMB 4WO4B 1BFOB 1GRWA 3I02B 1N5YL 3JVGC 2VLJA 4NIKB 4PGJA 1T1WA 1YY8A 1ZANH 3IS1X 3FQNB 4X6FB 4JG1H 3KXFA 1TVHB 4GAYA 4GKZB 3H6JA 4OCWH 1JK8A 1Q1JH 3DWTA 3MJ8B 2QL1A 3G5VA 3G6AA 5FM5M 3TPUB 3MA7B 5IFAL 3UYPA 1T0NB 4PLNC 5KTEH 3OHXA 3NTCH 3FQRA 5T1KD 4U3HA 4QRTB 2HG5A 4CVZB 5C0GA 1YJDC 1T89C 3QXTA 3SDAC 1QFWH 4M4RA 5E00A 3KWWB 3UPAA 4QF1A 3C5SA 5FYLD 25C8H 4NHUB 5ENWB 4KVCL 3LH2H 4MAUL 5CSZA 1PKOA 3KPLB 1P4IL 4YHPB 1A6UH 1DLHA 2X1XR 5EDXA 1T0PB 1M6OA 4UQ3A 4XRCB 3KPPA 3OXSA 4ONGH 3ZTNL 2BERA 1KGCD 1ZHNB 4UTBH 1WSST 1IL1B 4X8JB 3SDAB 1S9WA 5HI4C 1IQDA 3PXJA 1DN2A 2I07B 4JAMB 3VW3H 3SDXE 1CL7L 1LO4H 3MLWL 3QCVH 4ODUA 4Y19B 4JFEA 1AGDB 1F42A 4K2UH 4LSVL 2DLFH 3V6OC 5GGRA 3U0TB 5A1AA 3ETBF 4YEEA 5J6HB 4HJJL 3CDCA 3STZB 3O3AA 2GHWB 3CSPA 2P8PB 2QV2A 4IIQC 3ZL4L 3OF6D 1RZKH 2PTUA 4OQTL 2K1MA 3IFPA 1LE5A 4Y4HD 3RKPA 1NGXB 1NMBH 4F3FB 3ZE0E 4OZGA 2XA8L 3GK8L 4WV1B 3VWKA 4ZNCD 4KRLB 1HNFA 1IC4H 2DRUA 1F6LL 3CMOH 1SY6L 2BVEA 3FOLA 4GXVL 5IGXL 4LEXH 5C0CD 1PG7L 2EH7H 2ICWI 1S7UA 1IEHA 4JQIL 3BN9C 5SWSE 3HB3D 4HX1A 2BJML 4WJ5A 1A6TB 1U3JA 1KJ3H 4GKNB 1W0VB 4ZPVB 4TVPL 2FHFA 5F3BA 2NY5L 5CJOL 3TBWB 5IB4A 1XMWA 5DTFA 3WYRA 1YPZF 4YR6B 2UV3A 2X2YA 1IAKA 3F58L 5KANG 1EEYA 1JGLL 4I18A 5T1LA 1OSZB 5DVKA 3NCYP 3BDYH 1NL0L 4Y4HC 2GJZA 4G7VL 1EHLL 4LLWB 1LEGB 1MAJA 1NEUA 3VI3E 3CSYB 2UZIL 1MJUH 3QI9C 2ICWJ 1C7SA 3SN6N 2FH8A 1PAMA 1HINH 3Q3GA 3VFGL 1S9YA 4D2NA 4KKNA 5ALCH 2W0FB 5KVFL 1HH6B 1DLFL 3OAZK 1BVLA 1QFHA 3GKZA 5DD3L 5ETUA 1BZ7A 3P40A 1U92B 1YUHA 3BXNA 1J12A 4X6BA 2YZ1A 4OFKA 3BH8B 3HB3C 5IESH 1VEPA 4ZPTB 1S7WB 5BJTB 1V7NL 1S7RA 2W60B 5F88B 1KYOK 5DRNB 3FMGH 4WEBH 2I9TA 1KCSH 4U6XB 1NBVL 1NCNA 5FM5O 1KULA 4EOWH 1F4XH 5C2UB 1I7UB 4EN3A 2E6PA 4JRXD 3SE9H 1CLCA 5C0CB 2VC2L 1IEBB 1ZT7A 4JGMA 4J3SA 3SDXF 3IF1B 4WUUD 3FN0H 4J3XA 1A3LH 2NXYD 3B9AA 3U82B 4O9HL 5BO1L 2AKRB 1CWVA 1G9ML 4NKOA 4PJCB 2F19L 3RRQA 2DBLH 2J4WH 3Q1SH 4P2QA 3L95B 3K7UA 3RNQB 1CXKA 1KN2H 3OJVC 4JZNA 5HDBE 5JO5B 4PV8A 4OKVA 3G5XB 4NN6B 4RX4D 1QFOA 4UT6L 4YHOL 4IJ3B 1PKQE 4E5XA 1LK3L 1OCWH 1XFPA 1Q9WA 3FRUB 4X7DC 4UU9A 1CE6B 4JN2B 5HI5D 3GO1L 4Z77B 4O02H 3W5NA 2IFFH 4XB8A 3MYJA 4OGXL 3GSUA 4DEPC 5IR1A 5LCVH 1KLGB 3BVNA 5JXEA 3TLRA 3ZT5A 4Z95H 3BX7C 4AT6A 5DJ6B 4ODHL 4HWEL 3IJYA 4Y4KB 2BMKA 2R56L 1UCBL 1QTYT 4UOW1 1SEBA 1UEYA 2P46B 4ZAKD 4U1LA 5C0EA 3A6BH 2BK8A 1GGYA 2HFFB 4MNGA 4P23D 1ZE3C 3OJMB 3JWDH 2FECL 2JIXA 2CIKB 4PGBB 4D94A 5DJZB 1FG9C 4DK6A 1MFAL 4DEPB 3T0EA 4F37F 1L0YA 2BY2A 3EYQD 3LMJL 3NCBB 3KLSA 1DBKL 1F8TH 1UENA 3HG1E 1MJ7H 4XNMA 3KPOA 3GSXA 4F58L 1A6VL 4DJMA 1H3TA 3RX5A 4PJGE 3DLQR 2HVKA 5I0DA 1QPPA 3AAZB 3C8KA 2NXYB 3RPIA 1NAMH 4ZUVA 4ZFOB 2APTA 4P5KB 1U41A 1NAKH 3V6OE 5EIIB 5GS0C 4ERSH 2JELL 4PJXE 4RZCB 1XGRB 1NAMA 4U0RC 1A9EB 2EYRB 4KI1A 5MEQA 2OR8A 2G2RA 1ONQB 2AV7A 4NHCH 1JRHL 3VRIB 5JDSA 5D7LD 4CVXB 5I75C 1OF2B 2YMXL 5I2IA 3WKNA 4AQ1B 2ZJSL 4P23C 3FAXA 4G3YH 1NLDL 4YHZH 3R4DA 1PZUB 4FQ2L 1VFUA 2EICA 3ROLB 1NFDB 1UXSA 3TBVA 3RZCD 4N0CD 3EYQC 3SJVD 4XMLL 1L6XA 4U0RB 1OAUH 4WEUD 5FB8A 4ELKA 1LP9E 2ZCLH 3KPQA 4ZXBA 4MB3A 3VFRA 3VFUA 4NRXB 2P5EA 1YEJH 4ZAKB 2LVCA 2X10A 5DZLA 4NQDD 4JZJC 2BDNL 1VFOA 4JO4H 4P23B 3VXSD 1W8OA 2G9HB 4GQ9H 2VB5A 1WAAE 4UT9H 3RP1A 3E6FB 1F58H 1NSNL 2VIRA 3KYNB 2AJSL 4JPIA 3PUCA 1OAXH 2W92A 3KAAA 2QTEA 4N8VG 2C1PA 3NCFB 1ZA3B 4FQIL 5GZOD 4DCQA 1DSFH 4K3EH 5DZOA 4I0PA 3G5ZB 3EOBA 1ZVSB 43C9A 3BZEA 4H8WC 4ZQKA 4XNUL 1U3YA 5C3TA 3CFEB 2K7PA 4JZJB 5INCB 1FE8L 1D6EA 3MCLL 3KLAB 1S7QB 4ZFZB 2YN5A 5T3ZL 2I25N 5SV3A 1UJ3C 4NQVA 1RVFL 2IEPA 3IDXL 1MWAL 3DVFA 4BQ9A 1UWGH 1RULH 1KCRL 5ALBH 3NIFE 3OTTA 5BZWB 1U8QB 2FIRT 3H3KA 3H9SD 1AP2A 3HZVB 4N0CC 3TCLA 5CUSL 5KS9B 2D7MA 4RBPH 2XI9A 1OAKH 2IAMA 4F33A 3G5YB 5D7LB 2OR9H 1SBSH 3C87A 1UJ3B 3QR2A 3L1OH 5CLWA 3HC4L 4UQ2B 4EQ3A 4K3DL 4Z5RB 2DWDA 1AIFA 4JB9H 4Z7WE 3ULUE 3RZCB 4JM4L 3SJVB 3EOYG 4N0YH 3WKML 5GZOC 3OAUH 4XP4L 3UYRH 3QEHB 3PABB 4P3DA 4GMTL 5DVMA 3CSBA 4KJYA 5MEPA 3PNWA 4NQDB 4Y4FD 2XKNB 5DD1H 3VXSB 2UWEE 2YC1B 3QJFB 5CGTA 4QT5B 4HW6A 1ADQH 4JO3H 5D1ZC 4CMMA 2DICA 1UCTA 5DVLA 3NH7H 1EO8H 3MRRA 2J6EA 5EOTA 3D5OF 2NW2A 1ADQA 3LAFA 3C5JA 2W9DL 3WIIH 5BOZG 5C0ND 2A73B 4Q9QH 3L3GA 4PS4H 4HZAA 1YEIH 4YDJA 4LLDA 3NVQA 1RZGB 1JNJA 4U1GB 1X6LA 5EOQL 1KACB 3LQAL 1ORSB 4PGEB 4LIQL 5C6WH 3WNPA 4XVJH 2DS4A 3EYOB 1CICB 1KTRL 2O5ZL 2X9WA 2WZPD 3WXVL 3WFBL 4G8EA 1I3RA 3H9SB 2NW3B 1A1OA 4HV8B 1WC7A 2YEZB 3BKML 1BIIB 3MRMB 4F7MA 4WHYG 1KIRA 3X11B 4OGZA 1G0DA 1D9KA 4PD4J 3UTQB 4JRXE 1OM3H 4Y4FC 4CNIA 4ZUTB 5ANMB 4ZUUA 1FSKC 1X5HA 1ITCA 4OLXH 2VLLB 1Q72H 3I3BA 2IANB 3MLTB 4HKXB 4O51B 1F45A 4WUUE 3D3VB 1U3HA 5HD8D 1KPVB 1CFQB 4OFVA 4UILL 4QTIL 4E41B 3MCKA 1MLBA 4NZRH 3QQ9D 2YOCA 3B3IA 1J11A 5C0NC 3MX0A 5I1KL 3K81A 3ARDA 5I16A 4N0RA 3DETD 2DTSA 1FSKB 4XXDB 5IB5A 4YO0B 3WD5H 3WE6B 3DXAA 4LCUB 2BVUA 4OZHE 4YAQB 2Q86B 1H3PL 4Y5XA 5DUPH 3WBDA 3I6KA 1LO0H 1ZVHA 3NIFF 2DQEH 2Z9TA 1KC5L 3QDME 5EUKA 1UYWH 1EO5A 5EU6A 2VXSH 4LSRL 2X9XA 2VLKD 4M43H 5H2BA 3WFDH 4G9DA 4NUGH 5DJCA 3KDMA 1I3GH 2GYSA 2VH5H 4F8QA 4IRZL 3ZZ1A 5AYUL 4POZD 5DUBB 2OJEB 2BVOB 4LSSL 5CZVH 1OTUD 4PJCF 1HIMH 5DD6A 5EO0B 5TGBA 5HHOD 1B6UA 4H1LH 2F74B 4RMVA 4EI6A 2NY6C 3RVXD 4JFYA 1M7XA 3VXUD 2Y9RT 4D9RD 3L3HB 3QQ9C 2E8ZA 5AZEH 4PG2C 5CEZL 5DA0B 1QFWI 1SJVA 2NY1D 4OLZH 1LK2B 1NGWB 3QWRA 2FLBT 3WFEH 3RVUD 5E0QA 3IAQA 4KRPD 5AUMA 5IB1A 2LTQC 5BMFH 4ODVH 3EDDA 4WTZG 2VO5A 5JUEL 4MD0A 4NZTL 5F7EH 3JWNC 3RWJB 2HKHL 3GJEB 1MJJB 3QCUH 1T80A 1MH5B 1ZA6A 3ARUA 5AWNH 1HEZA 2EDQA 4HUUB 4GAJH 4HUWA 1YEEL 3GSOA 5DD0H 3ULSB 4QHMB 4G6MH 1JWMB 1BF8A 4UBDD 1OTUC 5IB3A 2X41A 3HAEG 2CK0L 1TXKA 4C58B 4QRQA 1RZ7L 1QEWB 2HTLD 3DSNA 2XKUA 3RVXC 2VLKB 1NJ9A 3CFCH 1UJTA 1RHHB 2Z92B 1UH2A 4KAQH 3EFFA 4NQDE 2VZ3A 1BGXL 3S4SB 1MHHB 4HUMB 2P7TB 3VI4E 3RVUC 1OQOA 1ZHLA 5HGDA 4KRPC 1CD9B 3N0PB 3QEQB 5IEHB 1NCBL 2CKBL 1X4YA 5HHOB 1KEMH 3WJJC 4O00A 4NRYA 2PKDA 5C07D 3VXUB 2DIBA 4I9WE 4X7TA 5HYFA 2F8XC 1WBZB 4O4YL 4BUHA 3IJHA 4TUKH 4HFUH 4TTGA 5F97E 1T2XA 4GLRH 1Y6MR 4I13B 2E7LC 5AD0B 3LKSA 3VA2C 2NY1B 1DE4A 2E6QA 3MLUL 5IBTH 4Z7OE 2H32B 2OR7A 4JPVL 5DK0A 5I1CL 3AY4A 4OZHF 1UWXK 2D3VA 1T2JA 3RHWF 1H3XA 2FDBP 3UBXB 2R69L 5JMRA 5AZ2H 2EXYC 1NFDF 4UBDC 2I24N 4R90L 4BH7A 4F7TB 2ICEB 2JCCA 4EDWL 3U1SL 3MV8D 1DFBH 1DQJB 2HTLC 4MJIA 3T8XB 2XXMB 3GGWA 3V52H 5FF6A 4UINL 2ILLA 1F97A 4WU7B 3B9DA 3DX8A 4QLRA 4DZ8A 1UM4H 2AXFB 2C3XA 5C8JA 4WDIA 2R1XA 3MV9E 3L5JA 4HFWB 3HS0A 2VZVA 4HXAH 5E2VH 3WS6C 1W8NA 4POYA 5TE7L 4K9EC 1L4IA 2G60H 4DTGL 5CJQH 5L88H 5MP6H 4G8FB 3PG2A 4LPXA 4V1DA 3ULVH 4M5YH 1ETZA 2VLRD 4FFVD 3GHBL 1G7LB 1G7MA 1R0AH 3TT1H 4QHKI 1I9JH 2ZP0T 2YD3A 1RMFL 3RGHA 1M7DB 1D6VL 3MOBH 3DARA 3GBML 4LLUA 2EH8L 3LKRA 2DQJH 4DGYH 2HKFH 1ZEAH 5D2LB 3MGTA 4Q2ZA 4S2SA 3Q0HA 3TBSA 4JHAH 3MMEA 2O5XL 3MJ9H 4RNRA 4AENA 5HVGB 4RQQA 1XF2B 3G08B 4G8GE 3MLZH 1ZLVH 3GMRA 3MJ9A 2YR3A 3MO1A 2QJDA 2Z35A 2J2ZA 4XT1C 5HPMB 5KVGH 3UTTE 3STLA 3RGVD 2OBGA 4QHKJ 5IWLA 4PJEE 3MV7A 3B6SA 3MV8B 4PJFE 1JGDA 1NCDH 3D6GA 4H5SA 1I1AA 3BGAA 3L5XL 4KU1A 4WWKD 2YZ8A 5I15H 4YBHA 1QRNA 3DNKA 4JY6B 2ATPA 3K1KC 1DBBL 2GAZB 4JPKH 3D85A 3VXMA 1D5ZA 3VI4F 3MA9L 3IS0X 1MELA 1RIVL 3VD5A 2F5BH 1MRDH 3CC5B 3PWLA 1M05A 4JY5L 1FYTA 4LKXB 2IPTL 1JZ5A 3IJSA 5DJYA 2VLRB 3SY0A 3W0WB 5EORH 3KR3H 1Q9OB 1Z9MA 5D2NA 3KPSD 3VD4A 3GRWL 2YWYA 4YHMH 4JFDD 3NCYS 4BFBD 1PLGL 2CXKA 3V4VH 4YHYC 4LSQL 1INQB 3HI6H 2IPKA 1AD9A 1CZ8H 3QWQB 4NP4L 4Z78A 4OZFG 5JPNA 4FZ8L 3RGVC 1LHZA 3PP3K 4XHQA 2A77H 5M94B 4LF3B 4R7NB 3C6LD 1ZGLP 3PDOA 2EKSB 3PWUA 1OGTA 2AABH 1URLA 2H2PD 3RUGA 1FNEA 4WWKC 3FQUA 5TDNB 4I4WB 3BHBA 3MPCA 1IGFH 3DV4A 5MEOA 5AEAA 1FBIL 1I8MA 5DJAA 5E6YA 2YSSB 4J1UB 2Q76B 3U7WL 4J2XA 2Q8BL 1HI6B 4NN7B 3RGVB 3RY4A 3BZFA 3MRHB 3E6HB 4Y5VC 3QUYB 1KPRB 2ADJB 4XMKH 3ARVA 2VQ1B 3D39A 1IKNA 3A6OA 3B43A 1KUMA 1VKXB 1MCJA 4JG0H 2AEWA 4WWKB 4JJ5A 3C6SA 4TSAH 1P53A 4AEIL 2R2CA 5JIHA 3IVKB 3R0NA 3IDNA 4W6WB 5IVNA 4N9GA 4LDLB 1NBZA 3B83A 3AROA 4KV5F 2VLMD 1P4LA 2B5IC 5BW7A 1MHEA 5A2JH 5EH1A 4NQCE 1TVBA 4WFFE 3L3JB 5A2KH 3IT8D 1JMXA 1CDCA 2OL3B 4N8CL 3C6LC 3HUJA 3GMQA 3AXLA 4Z7VB 4LNRA 3U2SA 2AK4E 3KGRA 1S7VB 5GRZA 4MZ3A 2H2PC 4LARL 4YQXL 3T65A 1AXSB 4CU6A 1CFTB 1D5XB 4OLWL 5B38B 1PY9A 3B8SA 1I7TA 4RWHA 5FGRA 4ELME 1SJHA 2EZ0D 1J8KA 4PJEF 3VXOB 4L4TE 1P9MC 4LAQL 4NUJA 4UIMB 3ELAT 3K74B 1JPFB 2QQLL 2H6PA 1GCFA 5J1AA 2FEDD 1MHCA 1S7XA 2VN7A 3GUTB 3ARXA 5EPMB 2OI9C 3TBTA 4CN1A 1GPOH 1QLRA 1YPZA 3NMEA 1JPST 2H2SD 4JLRB 2CJUH 3PL6A 3V4PH 3OPZH 1TENA 1KELH 3EJYD 1B0RA 2MWCA 1MCFA 2PETA 1E0OB 2CO6B 3BZ4A 3RL2A 2RAMA 3PF2A 2IH3B 3TIDA 3ALXA 5C07E 4ISVA 4OM0L 1EHXA 3U4EA 4RAUB 1KENH 4CUCA 5C09D 5DS8B 2OI9B 4U1IA 4MNQE 4PJBE 2Y7QB 3BGMB 1N0LA 4LASH 3GDBA 1MCWM 3VGGA 1ERNA 3KJ6H 1HDMA 1JMZA 3B9VA 3VFVA 5J11C 4KZDH 1GIGL 2LQRA 2QBWA 5GGVH 4UT7H 5HHXH 3PWNA 2E27L 3L3IA 4TUJB 3HC3L 1JGEB 2EZ0C 5JW5B 1G1CA 2Y1VA 1BEYL 2EEAA 5J8OA 2PNDA 4LQFL 4XMPL 2OK0L 2A9NH 4WFED 4XNZC 5L8LB 4FHBD 1ES0B 1MFDH 1INEH 4CN6A 3KYOB 3U0PA 3FO1B 1FL5A 1MQ8A 4PREB 2VABB 2IG2H 3I2CH 1RZIA 4OLUL 3A67H 4JFFE 3MFFB 1WT5A 3ZKQD 1EGJL 1MCSA 1VACB 4G43A 5LQBL 4FA8A 1DQLH 3F7VA 2AAVA 1YEHL 3NA4A 3K2UL 4G5ZH 4XCFL 3EO0A 3EJYC 2YPKB 4OLEA 4NQED 3SDXA 4GXUM 3CZFB 5E8DH 5C0AB 1FIGL 1MCOL 4PGCA 2MMXA 4NBXB 1MREL 4PJDB 1ND0B 5B3JF 4MNHB 3DSFH 5C9JA 3MRBA 2VLRE 1INDH 5F9OL 3GSNL 3V4UH 5ABDE 4YFDB 3L5WB 1T3FA 5E9DE 3VGEA 3DROA 3CVIH 2RFXB 3QUXB 4PRPD 3TWCL 1AGEA 4XCNB 3E2HC 4Z0XA 4ODXA 4C57C 2BOBB 2Z31A 3GIVA 5ESAB 1I85A 1ZT1A 4F9PC 4I2XB 1AO7D 4YLQT 5DMYA 3QCTL 4N1EA 2A2QT 5TQ0L 2COQA 1FZJA 1UM6H 5ACMA 1TTFA 4G6AD 4P46D 4TVSa 3HI5L 5D7IB 2DQIH 1VEMA 5GRUL 3LOWA 4KJQD 1R3KA 1VPOH 4EQ2A 4NBYB 3S37H 3E2HB 2AJ3A 2X4TB 3BE1H 4N68A 1R24A 4NCC1 4XPTL 2VXQL 4OUUB 5SWSA 1BF2A 3QPXL 3JV4B 3HKFA 3X3FL 4HGKC 4HXBL 2XPGA 1OPGH 4YNYA 1MCQA 3O3DA 3CCHA 4JFQA 1U8IB 3CXHJ 1OWWA 3A0OA 2CK2A 1OLZA 4LRNH 5SX5K 2AJZA 1KLUA 3GI9L 2R4SL 4FQXD 3REVA 4NJ9H 5C1MB 5K9JL 3BKCL 1F2XK 4NQEB 5D2LF 4Z8FH 3PDGA 3OX8A 3OBAA 4JFXA 3BGFC 5DT1L 1RJYA 2OTUB 1YC8A 1E6OL 1NPUA 3E8UL 2FBJL 4G6AC 4P46C 3CD4A 3GBNL 3KPSE 3AB0C 4J3WA 2VR9A 5IFJB 4KJQC 4JFDE 5HHPB 1BBJB 4PRPB 3MBXH 1KCVH 1S5IH 4OCYH 1FNFA 2DTMH 4HF5L 3QZWB 3MC0A 1Z5LB 3GKWL 4U2ZA 3OL2A 1AO7B 3FFCD 2MQ0A 1TJIL 2ICCA 3HNTH 4PD4K 1K8DB 4BZ2H 4RRPG 4G6JL 2BNRD 4LHUD 4MCZA 4P46B 5EN2B 4NKMB 3LS5L 3AB0B 3VJ6A 4DKEH 5CD3B 2Q3ZA 3LQMA 1I3VA 2ZNXA 5SWQA 2OTWA 4M8QB 2HFGH 1TZGL 1YECH 3AVEA 4AJ0A 5ITBH 5CILL 4YPGB 4XBPA 1IT9H 1CF8H 2XIDA 1CT8B 1A6WH 5E6IB 1VDGA 1CS6A 5BVJB 5I1IL 2ATKA 5MHSD 5IEKB 3LD8B 3BKYH 2V5MA 4QXGL 3EOTL 1PKQA 3MA7A 2OZ4L 4NRZB 1HHHB 3B2VL 4FQXB 1CIDA 1RURL 1R3IH 1YN6B 1IKFL 5H94B 2WBKA 2VLME 4M6OH 3VXTA 4N8PA 4S10A 4RA0C 3DVGA 1FNSL 5E7BA 5IMMA 2OQJB 2MPAH 5MEND 3EYSH 3EYFA 5A3ID 1GL4B 1MUJB 1P4BH 3P4NA 5GGRY 3A6CL 3U46A 4JHWH 1A7NH 5EOCJ 3I85A 4IRJB 2HLAA 1HSBB 3MRQB 5KSAD 2D03H 1I7RA 3NFSL 3HFML 4U1KA 3RAJH 5F1SA 2FSEA 4MQSB 1IL1A 1BQHA 1DDHA 1T89A 2G5BA 3GMPB 1IAOA 1GC1C 1S8DB 2CQVA 1CI5A 4ZOEA 4GLRI 3FFCB 5JMOC 5JZ7D 4R4BB 3QQNA 1JUFA 1ZANL 2BNRB 4LHUB 2QHRH 5T3XE 4JG1L 3HG1A 4HH9A 1V8HA 2VL5B 4OCWL 5TE6H 5J6HA 1Q1JL 4GAGH 4PJGA 3STZA 1MAMH 1PDKA 4NKQB 1J0ZA 5CP3H 2C4FT 1F4AA 4B53A 3MRJA 5KTEL 3NABH 1NGXA 3NTCL 3T3ME 5I8CA 3F6LA 3UBXI 1N8ZB 3JWOH 2PO6D 3V6OA 3IYLW 1L9NA 2NTFA 4BZYA 1HZHH 5A3IC 2YN3A 1R5VB 1QFWL 4PJXA 2M8XA 2VZUA 5C09E 1G7IB 4WTWA 25C8L 4JRYB 3UAJD 4GW4A 3LH2L 1FFPB 5J89A 2YD6A 1NBYB 1YQVH 3ARED 3LRHA 4RIRB 1QVOA 3MODH 4WCYH 3VE0B 4IIQA 3RL1A 1A6UL 5T1KA 2FRGP 2XNAB 3ARQA 2NLJB 4ONGL 3O3BB 5E5MA 3KPMB 5IV2A 1AKJA 5I1LA 4UTBL 4R4NC 1A6TA 4WFEE 2C7UB 4X4ME 3QNXA 1JF6A 3VW3L 5JZ7C 1LO4L 3QCVL 3DGGB 1LP9A 5FGCE 3TBWA 5JOPD 3CFBB 4K2UL 2HJKB 2DLFL 5KSAB 4YR6A 5GGSB 1V3MA 3KS0H 3BP7B 1FFOB 1WAAA 2DLHA 5KSBE 3RWDB 3BKJL 1PFCA 3EJJX 5DSCA 1RZKL 4AIZA 1AC0A 1AGBB 1XIWB 3BO8A 3WHE1 1NMBL 4OFIA 2JF1A 3RWEB 5EBLA 4ZDHB 1C5CH 3ESUF 5HXMA 4QRRD 1BAFH 4X5WA 5GISH 2HLFD 1IC4L 2W0FA 3AREC 2AK1H 5F44A 3O2DA 4PRPE 3OF6A 3CMOL 3EKCA 1JPGB 3MYZA 4Y4HA 2B1AH 4L3CB 4LEXL 3LPWA 1CD1A 3DMMD 2PO6B 2EH7L 2FYYB 4BFEA 4JN1H 4LVOC 1U8PA 2AQ3A 4M1CD 3QI9A 4HIEB 1A14H 1FYHB 4EIGB 1KJ3L 3IFOA 3D9AH 3AREB 1MRCH 3HZYB 1F6AA 1DUYB 3ULUH 1A1MB 4HWBA 5DURB 4P2RD 5J4MA 2HRLA 3OGCB 5F7DB 2J88H 4LVOB 4Z7WA 5D5ME 3VRLE 2GTZA 4QGTA 1EV2E 1T7VA 3BDYL 4LK4A 4J6RH 5FHAH 4PJDF 3X13B 5IROC 4RGNB 2M26A 5DHVB 1WIUA 5D1QC 2YA2A 3BP4A 3MRPB 1QPXA 1MJUL 3JV6B 3M45A 2HLFC 2HFEB 1HINL 1OGAD 4AEFA 2UWEA 5J57B 3H9HA 4NO2B 5ALCL 1RIUH 2R2HB 43CAA 5DHVH 3ROOA 3GSVA 5DQ9B 4Z7NE 2PF6A 3DMMC 1WJ3A 3QXAB 1BJ8A 1O5DT 5HPOA 4KDWA 4M1CC 2YRPA 5DMKB 2HVJB 3GIZH 5HDLA 5IESL 1CBVH 3T4YB 2H9GB 4QRRB 4Y5YA 5D7IF 4JRWA 5KG9A 2NNAA 3EBAA 1K4CA 2ORBH 1IGCH 3FMGL 4WEBL 1QSFD 1GSMA 4DKDC 5BXFB 1KCSL 3QDHA 5B39B 5DJ0B 4EOWL 2ZKHH 1FZKB 1F4XL 1AGFB 1T21B 3SE9L 3DMMB 4M3KB 1CE1H 3WUWB 3V6BR 1A4KB 3FFCE 5DJDA 1PSKH 2X4QA 1G9NH 3QHFH 3FN0L 1A3LL 4ZUWA 4XPFH 4FOMA 2DBLL 4EDXB 1CGVA 2J4WL 3Q1SL 1KN2L 4JRXA 3QXWA 4YH6A 4G9FB 5BCAA 5DHYB 1U2HA 3CFDB 3MCG1 1FN4B 4P2RB 4RMTA 5KSBF 4WUUA 1Y18A 2CIIB 1OCWL 4X7SH 4PV9B 3RWGA 2AEQH 3S5LA 3FQXB 5B4MD 4RSVA 1DBAH 4OZIE 5EIIA 3AS0A 4O02L 1MI5D 5C0BE 1TPXB 2IFFL 5MHSE 4YGVA 3WDIA 4RX4A 5LCVL 3IDMB 1EAPA 4U1NB 3PHSA 4W70A 3VRIA 4Z95L 4M1GH 3QQ3A 5GS0H 1AGCB 5ACZB 2YK1H 4OZHA 3A6BL 3P30H 1DBJH 1X44A 5MENE 4EZMA 4MJ6B 4PJ9B 1F2QA 3QDMA 5CGYC 5ICYA 3JWDL 4HAGA 2JJSC 2D7NA 2XZQH 4JY4A 5D6CB 3FQTB 1E27A 2EC9T 3IDIA 1B0GA 2JLLA 3L3KA 3CAFA 3MZGB 4HIHA 3VXNB 1F8TL 5EC1B 1WK0A 3DRTB 4GBXB 3WS3B 1MJ7L 4X6EA 5E1HB 3P0VH 5HHVH 5E8PB 3FZUD 2Q1EA 5FO8B 1S9KC 1CGWA 3B4NA 2X4PB 2EDDA 1LNUA 3P77B 1T1XB 4HKJB 1EXUB 1DQQA 4GUPB 4HS6B 3QSKB 4JM2B 4JHZA 2DL9A 5B4MC 3MRIB 1F00I 1NAML 3CNKA 2CLZA 1NAKL 1B90A 1U8NB 5DR5H 4ERSL 1H5BB 4G6FD 4GJTB 5JW4Q 4UUJB 4JZJA 4U6HB 1BD2D 4F2MB 1FLTX 2X05A 4PLKD 2BSSA 4X4YA 4NHCL 2FATH 1OL0A 4Z7NF 1MJ8H 3DX6B 4AEHH 4TNVK 3O8XC 4YK4B 4RWYH 3U36A 1ZLSH 4G3YL 1MI5B 4YHZL 3V0WH 4PJ5B 3CX5J 5IMKB 1TETH 2GJ6D 3WEXA 2BVTA 1UXWA 2BOCA 2OJZH 1OAUL 4TSCH 3UTSD 2AGJH 4DZBA 2ZCLL 1FNHA 3FKUS 4JDVB 3NCMA 1YEJL 3FZUC 5J6GB 1FO0H 2IF7A 4KTYA 5J9PB 4JO4L 3EDFA 4GQ9L 4P2OD 1WVZA 4UT9L 4QRPD 1F58L 4RFNB 1FO0A 2B2XH 4YC2B 5JOPE 1OAXL 1BZQK 1WFNA 1CTNA 4BA8A 5B21A 5I73C 1ZWIB 1DSFL 1PZ5B 3GMLB 2F54D 4K3EL 2CXGA 4QXUH 5H37H 2VZ1A 2HYMA 4NQDA 3E1F1 2XKNA 1A7RH 5DI8B 2JK5B 1RZJC 1KBGH 4MCYA 3ARPA 2YC1A 2Q6WB 4PLKC 3RTQC 1WWWX 2QSQA 1ORQB 4MB5A 4HS3B 2X1PA 1UVQA 1T22B 4UOJA 2XFXB 2Y6SC 3FONB 1C12B 2APFA 3QEUB 2CDGA 1UWGL 1RULL 2GUOA 5ALBL 1G1YA 1EAJA 1KT2A 4ACPA 4QRRE 2YHGA 4G6FB 4LCCB 3Q6FA 4PJ8D 4HG4J 3WN5C 1MFBH 1QOKA 1YZZA 4UI2A 2VQUA 2K7QA 4H1LG 1OAKL 2BNQB 1VEOA 4L9LC 5ADPH 4X80H 5D1ZA 2OR9L 1SBSL 1XF4A 4OIIH 1QLEH 2WUCH 4J4PD 4R7DA 4P4KC 3HE7A 3L1OL 4K3JH 4P2OC 3MJGX 4RBPK 4F8TA 1OHQA 3HHRB 2YEZA 4KMTH 4JB9L 1YDPB 3O4OC 4HBCH 4L5FH 4HGWB 1GXEA 3WN5B 2E7CA 3DO3A 4N0YL 3UTSB 2ZCKH 3ILQD 3OAUL 3UYRL 4HKZB 1DVFD 3MV9A 4JKPH 3N85H 5DD1L 3MLTA 3WNKA 3WNNA 1MEXH 4P2OB 3SHSA 2A6DA 3EZJB 4QRPB 4ODTH 1ADQL 5IBUG 3NBNA 4JO3L 2C3VA 3CU1A 2HJFB 3FB6A 4TVPD 3TO4B 3NH7L 1IM9A 1B4RA 1EO8L 2F54B 3BMVA 4JDZB 4PJ8C 4Y4FA 4U7SA 4NPYA 1I4FB 3WIIL 4TPRH 1OGAE 4QO1A 2FD6H 1J1PH 4YO0A 3QHZH 3V6FA 4PTUB 4Q9QL 1PG7X 4Y1AD 4K8RH 1IGJB 4PS4L 1OTSD 1CR9H 2BCKA 1B9ZA 1YEIL 3L6FB 1G0YR 4YXLH 1I9IH 2J5LC 3G04B 1L6ZA 1WUNT 4J4PC 5GRVL 4HUXA 4UV7H 4XVUD 2P45B 4XVJL 1EERB 4PBVC 1AH1A 3DX7B 1FAKT 4O2CA 1ZHBA 3L7EA 4L4JA 3LZFH 4AY0A 1FIEA 5C9KA 4G8GA 3CUPB 1QSFE 5INDB 4F9LC 3LN4B 1YMHA 1DVFC 2GQHA 1OAYH 3S4SG 1OM3L 3UTTA 5E99H 1J05B 2C26A 4MD4B 1NGZB 4TNWF 1KB5H 4HIIB 5F9WC 1I9RH 2BVQB 4OCXH 3CXHK 4OLXL 4PJEA 2UZXB 2A1WH 3RBSA 1Q72L 3ZKMC 2PTVA 4PJFA 3MNWB 5F7LB 2OYPA 4WENB 1KB5A 2H41A 2X4OA 2DJUA 4DVBB 4FTVE 2KUTA 3G6DH 2OCFD 4PB9H 4NZRL 4MJ5B 1ED3A 1KTLB 5CKAA 1DVFB 1G9EA 4HDIB 2QSVA 5D93C 5I1HH 1OTSC 1T4KB 2G5RA 4QKXB 3WNLA 5L7XH 4XGZB 1RD6A 2CUIA 3WD5L 3DV6B 4APQB 3UBXG 3SGKC 3DTXA 3BD5A 2QEJA 3IXAA 3M1BB 2EECA 5DUPL 5I1DB 5IB2B 4XVUC 4XC1H 4FQ1H 1LO0L 2DQEL 1MCDA 3RIFK 4PG2A 1UYWL 2VXSL 2LU7A 2GW5A 3PJSA 4YZFE 5DWUH 1WV7T 1J5OH 4M43L 4Y1AB 3ZDXF 5F8RC 3ULSA 3MRDA 5FOBB 3WFDL 3D2UB 4NUGL 1F11B 4QHMA 1CDBA 4M61A 1I3GL 3CFKA 2VH5L 2EYSA 3RJQB 2FO1A 4NO0D 3SKNA 4NKDB 3EOAB 3B5HA 5CZVL 3MFGB 5K9KA 3DURB 4HJGB 1JZ6A 1HIML 4PRDB 3UC0H 1NUDA 4P3CH 3P9LA 1WEJH 2EKJA 2DDQH 3TZVB 2OXGA 4PGDB 3M17B 5AZEL 4LVHB 2UY6A 3OR6B 1KJVB 1MHHA 4HUNB 3QNZB 3NCJH 1U8OB 4OLZL 4Y16A 4DFHA 1XH3B 4FQHA 2ZUSA 5IEHA 4H25A 1FVDB 2C5DC 1J18A 2FO4B 3WFEL 1K2DA 5BMFL 4ODVL 4QOKD 1S7TB 4U6TA 4YDIH 5EFIA 5GIRB 5JR1H 5F7EL 2NY4B 5I71B 1KEGH 1A7PH 1CQKA 3QCUL 5IJVA 2X4NB 3FFDB 5FAAA 3GMOB 5AWNL 1BD2E 2ZSWA 5ESVA 5FUOH 4GAJL 4TOYH 4XPAH 3HR5B 4EUPB 5IFHH 1YEGH 1PYWA 1TCRB 3GMMA 3KVQA 5DD0L 4NQCA 2KQNA 1A9BA 4G6ML 1VADB 4D0BA 5TE4H 4EUPH 1NDGB 2AK4A 1RK1B 2DYPD 2GJ6E 5J13C 5D9SB 5B8CB 3C9NA 4XP6H 2X70A 2CSPA 5EC2B 4NC2B 4FQCH 5IKCA 3LPFA 4Z7UE 3CFCL 3C08H 5K93A 4K23H 4WU5A 3MRGB 3LDBC 4ELMA 4KAQL 3FO9B 4JKWA 3BP5B 3OAYH 2R9HD 1CGSH 1BX2A 1CDIA 4L4TA 5GRWA 4QRPE 1Z0MA 3GSRA 1G7HB 3O6LH 1KEML 2DQFB 4Q0XH 4R8WH 4IMLB 2K3TA 5LXGH 2E3VA 3DIFB 3WFCH 2BSTA 3D18B 4TUKL 4HFUL 3S7GA 2ED8A 1J7VR 1H0DA 1M7DA 4QHUA 5IJKA 4CN4A 3WS6A 1I8IB 4S0TD 3QAZC 2VDMH 3JTTA 5IBTL 3LKOB 2BY0A 4Z76A 3KYKH 5C07A 5TFSH 1UB6A 4QOKB 1K5NA 3D0LA 1NC4D 5AZ2L 2NX5D 1TVDA 3B2UC 1Q38A 4MNQA 4ALAH 4PJBA 5JW4M 1DFBL 2X40A 5JOFA 1E28A 4CMHB 3V52L 4GKSB 3QAZB 3T2OA 5DEGA 1AE6H 5T3ZD 2NY0D 4OD1H 1UM4L 1KPUB 3RKDD 2FX8H 2R9HC 4TUOA 5D96B 3M8OH 3SKUD 2NQCA 4HT1H 4HXAL 5E2VL 5I9QB 2DYPB 1W72H 3LHPH 1FVEA 1VFMA 2G60L 4CW1A 5CJQL 2Y06H 4JFFA 1NFIB 4KTEH 5L88L 2VDPH 5MP6L 3CDGA 3ULVL 1S7SA 4M5YL 2XV6B 1AHWC 1ZSDB 5KSUA 4X6DE 6FABH 1W72A 1R0AL 3TT1L 1HKLH 4HWUA 1I9JL 2YPLD 2AEPH 3KG5A 4JQVC 3MOBL 4HC1A 4QTHA 2XWJB 1LO5A 1JF5A 2DQJL 4IHOB 4DGYL 2HKFL 1CFVH 1ZEAL 4GG6E 2VLRA 2FJHA 1IILE 1PEWA 3VD9A 4JHAL 4NZUH 3ZKND 5L0QB 3MJ9L 3G6JE 5E9DA 1FCCA 2XN9B 2ZOLA 2EDBA 1JWUB 3DUUA 3MLZL 3O45B 3IKCA 1HXMB 2NY0C 4N0FB 1A6ZB 4K94H 3V0VA 3HPLB 3ZDZE 4LCYA 1NC4B 3SCMD 5KVGL 1UWEH 2NX5B 2XZAH 3X12B 4OCRH 2EKSA 4QNPE 4G42A 3V95A 3CLFH 2CDFA 2DIAA 1NCDL 3QXUA 4O5LH 1RJZB 2XTJC 1LMKA 4R4FH 3LN5B 5I15L 2NY0B 5C71A 4WNQB 1HI6A 3RGVA 4JPKL 5GGTH 1MWAB 3ZDYE 3KLDA 3VFTA 2F5BL 1MRDL 1D5BA 1T1YA 1JNNH 1TZHB 4UAOB 4HHAA 5GGTA 5IVOA 3ZKNC 2P5WD 4Y2DC 4PJHE 1P84J 4KKCD 2XACC 1WZMA 4KKLD 5HVHB 5EORL 3KR3L 3T77A 1RFDH 2HH0H 3D48R 5I0ZA 5I30H 4Y5VA 4YHML 3O11B 4OCSH 1T5XB 4LP4A 1XF3A 3NN8A 3V4VL 1KNOB 1QO3B 3L3JA 3HI6L 5CFHA 4Y8DC 1CZ8L 3SCMC 2RJMA 2OL3A 4U1MB 4HIXH 5EZJB 2A77L 4P4RB 5GS2H 4PR5B 4LGRB 1FGNH 3PIQB 2FEEI 1R3JA 3KPSA 1XGYH 4L3ED 2AABL 4JFDA 4EVNB 1J8HB 1SVZA 2ADFH 2VZOA 3JBG7 3CVHH 5TDPA 4CBPA 5GJTH 5B38A 2A83A 4NT6A 5ILTH 1IGFL 4YHNA 3MV01 1T20A 2NY2C 2WBJD 4RDQG 4K7FA 3LQAC 4HLJA 1N3NB 1RPQA 3CVHA 3C6LA 3NPSC 5F3HA 2YD2A 5EIVA 3EAKA 5EPMA 4PRHD 3B5GA 4XMKL 5FO9B 1QSED 4PJIB 2ZSVA 3I75B 1X4ZA 4JG0L 3DECA 3EJZD 3DBXB 2X9YA 4TSAL 3QNYB 2BXZA 4UB0H 5HHQA 1P9MA 2W65B 5I8KH 3U7YH 4OF6A 4HPYH 4Z18A 4MDIA 2GTWB 1FNAA 4NJAH 4NZDA 2HAZA 2FZ3B 5ICZB 4ZS7H 3FB5A 3WNOA 5J1SC 5GS1C 1F5WA 3FTGA 3BGMA 8FABB 3OKNB 4ONHB 5EUOB 3ES6B 3EGSB 3G6JF 5CEZD 2P5WB 2R0KH 1YNTB 3MXVH 2UYLA 4U1SB 3X17A 3QDGD 1I1YB 4J8RB 3FOMA 2WBJC 4NNYB 4OQ1A 3SDDD 3LSOA 5B3NA 1E6JH 3S35H 3PGCA 5D72H 2JB5H 4FQQA 3WMSA 2MHAA 5GS1B 3GMNB 3FO1A 3HPJA 3T0XA 2WQ8A 3CFJA 3L3DA 4L3EB 1HILB 2Z8SA 3QO0A 4NNXA 1VACA 4UDUA 2AEIT 3PHOA 5DYOA 5E1AA 3RVWC 4N8VB 3EJZC 4Y88A 2HN7B 1GPOL 4GW1B 5HYJD 1FGVH 3IDJB 1RZFH 3LEXA 1RU9H 5EU3A 5T3XH 2CJUL 3V4PL 3OPZL 4QRSA 3EHBC 1GZQB 2HRPH 4IS6A 5E94B 1KELL 5K33A 2V9QA 3U9UA 4KQ4H 4WGWB 2DM4A 1HSAA 4O2FB 3EYUH 5DMIH 2RIKA 3KHOA 5F1IB 2Y25A 4PRHB 2GK0A 1QSEB 3VH8A 4A2MA 2HTKD 5HYIA 4C83B 1KENL 1GZPA 2PYFB 2ESVE 1I8KB 3FT3A 2WQRA 4LASL 5LGJB 2YUXA 3MRKB 3VMNA 4YFEA 1KTDB 1A7BA 3KJ6L 4KZDL 2APVA 3CX5K 4LLQA 5GGVL 3SDDC 4KHTH 4UT7L 5HHXL 5DRWB 5C09A 3U30C 1B0WA 1CCZA 3C60A 1JZ4A 2A9NL 1U8JA 4XAKE 2F5AH 1MFDL 3NFPA 1BJ1J 1INEL 3KYMB 4OCMC 2AXGB 1OWRM 3Q6GH 2IG2L 3I2CL 4L8DB 4X7EC 3A67L 2PW1B 3QDGB 1P5UA 4QCIA 3VFMB 4BH8A 1L7TH 2YD5A 3WIFB 4F9PA 1E4JA 4OUUA 1DQLL 1HCFX 1Z9OA 2QADD 3W5MA 4G5ZL 1NC2D 5FUCC 4X4MA 3EZ8A 2WINA 1PVHA 5E8DL 3ARRA 5KN5A 1XF5B 1ZGLM 1U8IA 5GZND 3ME0A 1MCWW 4NO3B 1UADC 2AV1A 3U48A 5KVEH 1VB9A 2XTJE 1U8KB 1HQ4B 3DSFL 5FA4B 1INDL 2AS5M 3F12A 1ZLWH 3V4UL 2Q3AA 3REWB 5E8OB 1CU4H 2YPLE 5T1MB 4ENED 3QRFM 5KSBA 1BFTA 3O4LD 3IGAB 4Q6YA 3CVIL 4GRWB 2R4RH 2X4SA 1C08B 1IAIH 4HG4K 5KSVA 2GI7A 3R06A 5BQ7A 1Q9LB 1UQSB 4XHJD 2C1OB 1HOCB 2KZ1B 2ZZUT 1JV5B 1UM6L 3AMKA 5C08B 2EE2A 5IFJA 1BBJA 4JFPB 4PRPA 4BSVA 5E8EB 2DQIL 1K8IB 2BHUA 3V5KB 4H20H 1VPOL 4GG8B 3S37L 3OKKB 2CKBB 2QADC 3RQ3A 3BE1L 4Y89A 32C2A 3QFJD 3C09B 4HWZB 3WFHA 5I66A 5BS0E 2CRMA 4LHUG 4NC0B 4OI7A 3Q5YA 2R2EB 1OPGL 5JLZB 3F7YB 2P8MA 2FBOJ 1JJUA 1K4DA 4ZS6D 4J3VA 1FJ1A 3BN3B 4LRNL 3IDGB 2QADB 1NC2B 4NJ9L 5D5MA 3BH9B 5EZOH 1WBYA 3TVMC 3QFDA 4Z8FL 2X5PA 1XGUA 4L1DA 1D5MA 2RGSA 4KDTC 4MXQC 4XI5D 1MCPH 5EUOE 2V9RA 4NRZA 3DGCR 5IVXE 4D9LH 2PXYB 1U6AH 4P2YA 4LSTH 4AM0B 4K3GA 1U93B 1LEIA 3QWOA 3RWHB 3MBXL 1B4JH 1KCVL 4U4BA 1S5IL 5EZLB 4OCYL 2DTML 1JNHA 3T09A 2W91A 4M93C 5C0DB 1MUJA 1OTTD 5I17A 5CWSA 1RK0B 3HNTL 3LV3A 4BZ2L 4GRMA 3QQ4A 4RAVB 3LIZH 4DKEL 4ZS6C 4L8SC 5LBSH 1ZGLB 1J1XH 3HCVB 4K7PH 2Q7YA 5EO1B 2HFGL 2HJLB 3TM6A 1LEKB 1TZIA 1NBQA 1YECL 3QFJB 4GRLA 3FFCA 5ITBL 1NEZA 4S1DC 4IOIB 1G7PB 3H8NA 1RUPH 2X7LA 4U3XA 2EYTB 1IT9L 1CF8L 1IC1A 5E7FA 4PRHE 2GCYB 5CMAA 5F9DC 3QHTC 3ARBD 4XI5C 1GC1H 1A6WL 4P2CG 4WFHD 3OG4B 4W81A 1J0HA 1UKQA 3BKYL 4L8SB 5D7KE 4JGUA 5GHWH 4JKMA 4OTXH 3V7AG 3HRZB 5IF0B 3BYTA 5C0IA 1R3IL 3MJ7B 1HNGA 1I7ZA 1L0QA 3KPRE 2IH1A 2EC9U 4M6OL 4HK3N 3Q5OA 5DRXB 1N5AA 5I8OH 3FCTB 2QSCH 5C0BA 3DX9A 4LRIC 3MRCB 2MPAL 4NM8H 4PRNB 1OTTC 3EYSL 4PP2B 1MSPA 5IMLA 1KYOJ 4U7MA 4Z6AT 2ICWB 3ZMRA 3OKDB 5CEZE 2CUHA 1P4BL 4DOHB 5F6IB 4RIRA 3GB7B 5EBWA 3HAEB 4JHWL 1A7NL 5CP7B 3BWAB 3ZKSD 1QBLH 2XNAA 5T1DH 2D03L 1N2RB 3RAJL 1U8HB 1CFNB 5MENA 2VUOA 3OKEA 3TYFA 3VXPB 4X6CB 5JNYB 2VR5A 1ITBB 3VMOA 3VRJA 1YC7A 3LCYA 5D1XB 3BP6B 4PJIF 4U1JB 3ARBC 1LGVA 2QHRL 3IDYC 3PWPD 5LAXB 1DEEB 2IBBA 4NQSB 4ODWB 4ZYKB 5HYJE 5TE6L 4OUOA 1KLFA 4FXLA 4GAGL 4NYLB 5FUCE 4HPOH 2BHZA 1MAML 1F02I 2XT1B 1T03H 4LCWD 3IKKA 1EHNA 2L0DA 3NABL 3JWOL 3LKQB 5KVMC 1HXYA 1EZVX 1B6DA 1PGRB 2VDKH 4IOSD 5EUOF 1HZHL 3WXWH 1JN6B 3RWIA 5IVXF 2EXWD 2JJTC 1HHGA 3ZO0A 4PRAB 2IQAB 3CPLA 3OJ2C 1YQVL 4S1RH 4ZSOB 2AJXH 4M7ZC 3BPNC 3MODL 4WCYL 4DN3H 5IMOB 5B39G 5I8EA 4PRBB 2Y5EA 2FYYA 5DF0A 2EIZB 3WUWG 4Q74A 3S5LG 3K46A 3WHXA 1BQSA 1DN0A 2N56A 2AQ1A 3SKOA 4R3SB 5J7CC 1KXQE 1HHJA 3FT4A 3HZYA 2H8PA 1S3KH 4N0UB 4XZUB 1S5HA 4U7KA 5IM7A 3TBYA 2B7DT 4BFIB 3WJLA 3RU8H 1TLKA 3X13A 1Q94B 3SE3A 1FL3B 1KJMB 5BV7C 5F9JA 2R2BA 3GI8H 4X0KB 1IVLA 1U95B 2GJJA 2DLIA 4BQBA 4FQJH 1UZ8A 3JV6A 5CBEA 4LDOB 1C5CL 5CINH 2PYED 5JW3H 2EXWC 1BAFL 4M4PA 5EO9B 5GISL 4YHIB 4NO2A 2XXCB 4E0RA 2AK1L 2BSRB 3O4LE 1VSCA 3PGDB 5IHZB 3FB8A 2VRAA 4JQXC 3BEWA 4LCWB 3ARFB 3PQYB 2B1AL 3NCCB 4P59H 5IROA 3PHQB 5D1QA 4JFOA 3TNNB 4AG4H 2H9GA 4JN1L 4QRRA 1II4E 1A14L 1A4JB 5HHNB 2BVPA 2VXTH 4WY7H 3D9AL 1NCCH 1BQUA 3P0YH 5FYKU 5E08H 1JWSB 2Y4SA 4FFYH 1G7JA 1FZMB 4M7JH 3P73B 1QQDB 5ISZE 2G75B 1FZKA 1MRCL 1LE9B 3PP4H 3JSSA 5F89A 4DGIH 3ULUL 5D7JD 1SYVB 3T2NH 3NIDF 2I9LA 4XX1G 1FH5H 1HHKA 2J88L 5CEXA 3FJTA 3H0TA 2CO7B 3OWEA 5C0RH 4J6RL 3U4BH 5FHAL 4RMWA 4N90D 3RJDA 3UTZA 1DP0A 1XGTA 3BQUB 3TT3H 2D31A 2DQCH 1G6VK 1ZHKA 5EU5B 4L4VE 4GRWF 3F5WB 3UO1H 1NCWH 3VWJB 1RIUL 4QYOB 3SO5A 4OIAA 3JTSA 2P24A 2JJUA 4TRPH 5ID1B 4O58H 3GIZL 5ESQA 3P9MB 3T1FA 1CBVL 2PYEB 2IBGA 3GSWA 1OGAA 2W0KA 1W0YT 3V6ZB 1WFTA 1BOGB 4E42A 2IALB 3BMWA 2A38A 2ORBL 1IGCL 3QIWD 2ZUUA 1XGPA 4U33A 2MOVA 5D7JC 2ZKHL 2VAJA 5HDQH 5H37G 1R5WA 1U58A 5CD5C 1MLCA 1CE1L 4WGVB 3V8CA 5D6CA 3B9KC 5ELIA 1S9XB 4XXCC 3WUZA 3F7QA 1PSKL 4G8IB 4CU8A 1G9NL 2EDWA 3QHFL 3GSNB 4UDTA 1AQDB 5C70A 1XEDA 1J86A 1QSFA 4TULH 4XPFL 1VESA 5FO8A 5EG6C 5TDOB 4BSWA 5D7JB 4HKJA 2EE3A 1ZT4B 2JJSA 4DKAA 1RJCA 3MRIA 4X7SL 5MERA 2AEQL 2Z93B 1DBAL 1P84K 1EUTA 4KY1H 4MSWA 15C8H 4FTVA 4WFHE 1NGYB 3D0VA 4HIJB 1PQZA 3P4OB 1YN7A 2ADGA 4WI6A 4DKFH 4M1GL 5GS0L 1R5IB 3LRSA 1JCKA 2YK1L 4ORGB 4Q6IA 1XR9A 3P30L 1P7QD 2R0LH 3TN0B 1DBJL 5FO7A 3OJDA 4P5MB 2MFNA 3RNKA 5DDHB 4I48B 2XZQL 4RFEA 2E9BA 1A64A 4L8CB 4ZO6A 4D0DA 2XY1A 2F53D 3ZKXB 5L8JB 1QHPA 3INUH 3QIWB 4NN5C 1DANU 4P9MH 5HY9A 3O8XA 4XNXH 2B39A 3OXRB 3P0VL 5HHVL 4LPYA 2FWOB 2FEEL 3MV11 1ZS8A 2Y07H 1I1FB 1CGUA 3PV6B 4MA8H 1DQDH 3HN3A 2AI0H 5AYQA 5HYQA 5ID0B 3GMLA 1RZ8B 3PWPE 2NYYD 3K8MA 3FT2A 5DR5L 4NN5B 1WWBX 3IFLH 3PWVB 5D4QA 1ORQA 1FQ9C 3S96B 4PRID 1MY7A 1Y0LA 2FATL 4PG9B 12E8H 2FJFA 1MJ8L 2XFXA 3VFSA 4AEHL 1C12A 5DC4B 1RZJH 2FNBA 3QEUA 3QG6B 1AD0A 1T6WA 3CLEH 5LWYH 2WIIA 4RWYL 1ZLSL 3BW9B 5DD5H 5IW6B 1ZK9A 1JTTA 1LD9B 1A6AA 3NA9H 3V0WL 3W9EA 5KJRH 3D69A 4Z7QF 5JA8B 1HWHB 2FGZA 4RMQA 1TETL 2X4UA 3IETB 1BD2A 3MBED 3RTQA 3OB8A 2Q87A 2OJZL 4TSCL 4WW1A 1SMAA 1HH9B 2AGJL 3V0AC 5HVFB 4OF7A 3K3QA 2VTFA 4L9DA 5DA4A 4X6CF 4YIQA 1JZ3A 1FO0L 2ITCB 1P7QB 2V2WA 1GGCH 1T1ZB 2JB6B 2GJ6A 3TH2T 1M7IB 3WN5A 1VFBB 2B2XL 4Z7UA 5GSVB 4L9LA 4CADB 4QY8B 2F53B 3UPRA 2NYYC 5FYJE 1NGQH 1IAII 4QXUL 3UTOA 1UEMA 2KH2B 2VDOH 4JEGB 5TH2A 1A7RL 5C0FB 2ITDA 5GSRB 3O6FA 1KBGL 4P4KA 1F3JB 4H26B 3VFOA 1NUFA 5HYSA 5FDWB 4QRPA 3EO9H 3QIBC 2CR3A 1U8LB 2UVFA 2CRYA 3ET9F 2R1YB 4ETQA 1N6QH 4LMQE 4FS0A 3P2TA 1XGQA 1JHTA 3MREB 3FO0H 5AAMA 3OB0H 3MBEC 3WCYA 2VLJB 1JYVA 4LOUC 1T1WB 1MFBL 1YY8B 2X6MA 4Y19D 3BIAX 3WV0A 3TO2A 2QLVB 2ARJA 2BRQA 3KXFB 5ADPL 1UZ6E 4GAYB 4X80L 4MVBD 1JK8B 1WICA 4UIKH 1EIBA 3QG7H 4JDTH 2PW2A 1F6FB 4OIIL 1QLEL 2WUCL 3G5VB 4NDMA 1WCBA 3G6AB 1ROWA 4PJ8A 4K3JL 1D3CA 4FMFA 4KMTL 3OHXB 2XWBA 3MBEB 4HBCL 3FQRB 2NZ9C 4L5FL 1TCMA 3C5ZA 4H0IA 5C0GB 5E8NA 2ZCKL 3FRPA 1B88A 5E00B 4MD4A 4QF1B 1NGZA 3HTLX 4J4PA 2CRZA 4JKPL 3N85L 1SJEA 4JKKA 1PG7W 3BESR 2GSIA 4WUKH 2O93L 3MNVB 1S9VA 4WI3A 3MLRH 1MEXL 2IMNA 1DLHB 4LCIH 5DFVD 3KJ4B 2VAAA 5IP4A 1M6OB 4ODTL 3S3PA 4UQ3B 1FAIH 4C56D 3I6LD 3KPPB 3OXSB 4N90E 5SWZE 4XAWH 4BYHA 1ZAGA 4JPWH 4PP1D 1BECA 1S9WB 4X6DA 1SJXA 1IQDB 2M1KA 3QH3A 4EUPG 2ZUWA 4ODUB 4TPRL 3WO4B 2FD6L 2NMSA 1J1PL 4JFEB 3QHZL 2YBRA 4X9FA 4K8RL 5F70A 1CR9L 5GGRB 1RZKC 3M1BA 4MVBC 4YXLL 1I9IL 2WIMA 4GG6A 4UV7L 2P8LA 1BFVH 3SGEH 2GEEA 5HHME 3O3AB 4JO1H 3G6JA 3LZFL 1BJMA 4CVWA 4FP8H 5IHUH 3IFPB 1LE5B 3MSPA 1KG0A 3SGKA 4OZGB 1OAYL 2D0HA 4WV1C 5E5UB 3QIUA 5E99L 4R2GD 3EOAA 1KB5L 2L7UA 1I9RL 4OCXL 4Q7DA 4PRDA 2A1WL 5DFVC 1JHLH 1XCQA 1EX0A 1CLZH 3BKJH 4IDJH 3BEVA 4PGDA 3FOLB 4EN3D 1RV6X 4X7FC 4PP1C 4I18C 4U1HA 1S7UB 3G6DL 4PB9L 2V2TA 5IIEA 4OM1H 4HX1B 4WJ5B 4NM4H 4MA3A 2QKIA 5E4EC 5IHBA 4Y2OA 3W9DB 5KOMC 5DC9B 1OVZA 4MS8D 2EO1A 5I1HL 4FXKA 4JVPA 5F3BB 5L7XL 3VXRE 4YJZL 4LPVA 3SDCD 5IB4B 5GIRA 3WLBA 4KH2A 5DTFB 4C56B 2E9IA 1IAKB 2YUZA 1PBYA 4XC1L 1EEYB 4FQ1L 4I18B 5DJXA 5T1LB 5EZIH 3UJIH 4PJHA 5DWUL 2RCSH 5DK2A 4PLOB 1J5OL 5E4EB 3TJEH 4BUGA 2GJZB 2O5YH 1UZ6F 3VG0H 1EO7A 2J1KA 4PTTA 1BP3B 3BJ91 5M7QA 1NGPH 3GSQA 3UX9B 4KK5D 4WFGD 4R2GC 5JXED 4AL8H 4GMSH 3Q3GB 3RDTA 3QDJE 3N1PC 4LPUA 5FM8A 5ETUB 3UC0L 1BZ7B 4P3CL 1WEJL 3K2MC 1I1CA 4RAHA 2DDQL 1Y6NR 2F53E 2C9AA 1YUHB 3BXNB 5GQBA 4X6BB 3AS2A 2VMFA 4NO0A 3QDAA 5DVOA 3T0ED 3MLYH 1S7RB 3NCJL 4R2GB 3MR9A 2EE9A 2H26A 3SKMA 3SDCC 2N7AA 2DQFA 2I9TB 5JIIA 4Y4KD 3D87B 4IMLA 3MUJA 1K6QH 1T2QH 1G7QA 4YDIL 5CIPH 4EN3B 3O6MH 4HULB 2FR4A 5JR1L 1KEGL 1A7PL 4OFYA 1FNGA 1ZT7B 3DYMA 4I0KA 5K9OA 1N59A 2VDLH 1FV1A 1ULVA 3FHQA 5CIPA 5FUOL 4NKOB 4TOYL 3KNBA 5GGUA 4PRIE 3LKOA 4XPAL 5IFHL 1YEGL 4XNQA 5C7XH 3CH8A 5GRJH 4P2QB 3SDCB 2VXUH 2B4CC 4KFZC 4KK5C 4JZNB 4PV8B 5JXEC 2WWMD 2CLRA 4OKVB 2J3SA 5DRZA 5FYJU 2OP4H 4NN6C 4IJ3C 2DKUA 3VDAA 5TE4L 4E5XB 1IC7H 1Q9WB 2MNUA 4XP6L 4UU9B 3V7MA 1OW0C 4FQCL 3UP1A 3BRGC 1JF1A 3C08L 4K23L 1U91B 3MYJB 1MHPH 3GSUB 1MCLA 1MFNA 5IR1B 5ADOH 3BVNB 3P4MA 1CGSL 3JWDC 3OR7B 2DYPA 3I9GH 4AT6B 5CHNA 4ZXBD 4OZ4A 4DGVH 1QBMH 3IJYB 4Y4KC 2BMKB 2P5ED 2A6IA 1NFIA 3O6LL 4U1LB 5C0EB 4Q0XL 4R8WL 4MNGB 1JP5A 2VKXA 3OAYK 5LXGL 3DRQA 2JIXB 1A22B 3O9WA 3WFCL 5JORA 5E2TH 2L7JA 2MKWA 3T0EB 3NGBB 5I1EH 4XH2A 1LO2H 1CIUA 2VDML 4MQ7A 4GSDH 4ZOAA 5C0JA 1C7TA 1IARB 1X3DA 4XNMB 3M07A 4LPTA 3KYKL 4I0PD 2APBA 3KPOB 2WWMC 3BDBA 3GSXB 3LKPA 5TFSL 4AH2A 3RI5K 4GW5B 3VGAB 4U6YA 2HVKB 1AHWA 3I3EA 2DQDH 4ALAL 2ESVA 4NQXA 4Y19E 3C8KB 4JQVA 2NXYC 2IBZX 1JWUA 3RPIB 4ZUVB 3T2PA 3I3DA 1P7KA 1AE6L 1NC4A 4OD1L 1RI8A 1NAMB 2QQNH 2FX8L 4KDVA 5I1AA 2D9CA 2EDTA 3CFIC 3M8OL 4ZXBC 4HT1L 5MEQB 1JZ8A 1RUKH 2G2RB 2AV7B 2IAMD 5JDSB 2V2XA 3CGTA 1W72L 3LHPL 5I2IB 3MOAH 4PBXA 2Y06L 4KTEL 1IE5A 5HI5C 4AK1A 2VDPL 1RUAH 4BKLA 3S36H 6FABL 2XY2A 1UXSB 1T04A 3RY5A 3TBVB 1HKLL 5FB8B 2AEPL 4ELKB 3KPQB 4ZXBB 3VFRB 3GEWB 1F3DJ 3VFUB 4C56E 2P5EB 4ZAKC 2Q8AH 1CFVL 4G80A 1JI2A 4MLIA 1JTPA 4X5XA 3CIQA 1EHAA 2YPLA 4UMGA 4NZUL 4BFGA 2VIRB 4X9BA 5FYLE 1FNLA 4JPIB 1MNUH 3MROA 3TCXA 2C1PB 3CK0H 3TJHD 4KC3B 4DCQB 1IFHH 4U1MA 4I0PB 3EOBB 43C9B 4MAYA 3BZEB 4ZQKB 2BP3A 4K94L 1KGCE 1UWEL 1QLFA 3PIQA 2XZAL 4OCRL 4Y2DA 1D6EB 5I76A 2KZWA 3LKNA 4LLMA 1HHIA 5DJ8A 1R6VA 4N5ED 3CLFL 1A1NA 2PUQT 4O5LL 4RISH 4NQVB 1BBDH 2K9UA 5I19H 4LKCA 4R4FL 1PJ9A 1NDMA 3DVNA 4KI5D 3VFNA 3SCMA 1AP2B 1IM3A 4I5BA 1EBPA 1VGEH 5GGTL 3ZT7A 5BS0A 4FQPA 2IAMB 3NACH 4F33B 5FOJA 5FO9A 1D9KD 4LLVA 1XCTA 1JNNL 3RWCA 5FYKH 2KBGA 3B5TA 3H2WA 5IT2H 3QULA 5FCSH 1JVKA 4DUXA 1CICD 1AIFB 5IW1A 1U3HD 4HGMA 2MKLC 3RZCC 1WIPA 1RFDL 2HH0L 4WI8A 3X14A 1A21A 5I30L 5SV4A 5BVPH 3OMZA 1CXHA 4OCSL 4P3DB 4OJFH 5ICZA 4KJYB 2Z91A 5MEPB 2DMKA 5EUOA 5C0CE 4HIXL 1X6NA 5JW4N 1WZLA 5IVXA 4N5EC 1FGNL 1V3LA 4YFLI 3DXAD 2IAND 3D3VD 1BM3H 1XGYL 1MFCH 4CMMB 4PJCE 2B20A 4OZGF 2ADFL 2DD8H 3CVHL 4E41D 5GJTL 3MRRB 5ILTL 5EU6D 5EOTB 2NW2B 3I50H 3BD4A 3C5JB 4OAWA 4OD2A 4HSQA 3ISWA 1B2WH 5GS1A 4HEPG 4KZEH 3HI1A 1D9KC 4YDJB 4OCLC 4LLDB 3W39B 5I1GH 2J6EH 2UUDH 2R8SH 4U1GC 1H3GA 3BD3A 2WBJA 5CLTA 1CICC 3LEYH 3W2DH 1C16A 4G8EB 1I3RB 1FZOA 1A1OB 3JUZA 4UB0L 4ZUSA 1WC7B 2V5TA 1DR9A 4O2FA 5I8KL 4F7MB 3U7YL 1KIRB 5F1IA 2VUYA 4HPYL 4PRHA 4R9HA 2J12B 1D9KB 1BOYA 4ONFH 4NJAL 3WNMA 5IK3B 5F7YC 4YUEH 1WFUA 4ZS7L 3ARGD 5LGJA 3MGOB 4G7YH 3MRLB 1H8SA 2R0KL 2GSGB 1U3HB 3MXVL 3KPRA 5K59F 1MLBB 4MZ2A 3IAPA 4ZFFB 3B3IB 3RA7H 2I5YH 3LQZA 1BZ9B 1E6JL 3ARDB 5I16B 1R3LA 4XPBH 3S35L 4I3GA 5M95B 1NUNB 2ERJB 5D72L 5IB5B 2JB5L 3U6RB 3TESA 1XAUA 3DXAB 4RMSA 2XWTA 2X89A 1DQMH 4Y5XB 5L6YH 3I6KB 4OF8A 1LO3H 3KPNA 3SDDA 2VE6A 5EUKB 1QKZH 4C4KT 5EU6B 4U05A 1FGVL 1MOEA 1RZFL 1RU9L 5T3XL 5FK9A 2HRPL 4RFOH 3I6GA 3QJHA 4KQ4L 4NO3A 2GK2A 4G9DB 1QNZH 4JO2H 3TF7C 1JGUH 3EYUL 4LBEA 5DMIL 5DJCB 3KDMB 4U6VH 3BPLC 4BK4A 2VITA 2Z4QA 3ARGC 5HYJA 1JZ2A 4JZOA 4HK0A 3FB7A 4XTRD 5T1MA 2PR4H 1NFDE 2GITA 5TGBB 3NCEB 4EI6B 4JFYB 4BELD 1BWMA 2VNCA 4LSPH 1NEZG 1XR8A 4KHTL 1Q9LA 4JCMA 4H1LB 4LVNC 4HMEA 5JIKA 3BPLB 1DCLA 4RCAA 4X4XA 3ARGB 4UNUA 2F5AL 1TNNA 3QEQD 3W82A 5IB1B 5HD8C 3Q6GL 2V6HA 4MD0B 3C2SA 1L7TL 1QA9A 2PTTA 1SVCP 4YE4H 1GOFA 1ZA6B 1VGKA 4MJID 5HGBB 1HEZB 4LVNB 1M71A 4OF3A 2Q7NA 3BI9X 2ZUQB 3DETC 1NLBH 4HUWB 4ZTPH 3F7YA 3ZHLA 4IMKC 3ALWA 1Q9KA 4QHNA 5IBUB 5KVEL 3IDGA 4XTRC 5IB3B 4FMKA 4W4OC 1NC2A 1EJ6A 2VXVH 1KTKE 1CU4L 1Z3GH 1FDLH 2DBJA 5KS9E 3SKJH 1NJ9B 1GVIA 1RQ5A 3HE6D 3Q5TA 2R4RL 1OAZH 2A74A 5D7LE 1IAIL 4UTAH 4FZEH 5GS3A 3EFFB 1ZLWK 3K8KA 1MVUA 4POZC 3QISA 4YBQD 4NOBA 1DUZA 2DQHH 4ZTOH 5HGDB 1TIUA 3O4LA 1CXEA 3SJVE 5EZLA 4H20L 4X7TB 3TVMA 4XCEA 3ZLQC 1F4HA 5SX4H 4KDTA 2CH8A 4K7PY 4PJ7B 3LKSB 4TNVF 4V2CB 2NY1C 3VXSE 5ERWA 1DE4B 3DHJA 4RGMC 3H7BA 3O41A 5DK0B 1AXTH 3BPCB 4YHLH 3H42H 2ZUYA 5ISZA 1W2KT 1WBXA 5EO1A 1QRKA 4BH7B 2JCCB 1G84A 3MRFA 4MJIB 4H0GA 3GGWB 4CL7A 3HE6C 5FDYA 1BVKB 1A3RH 5EZOL 2AJVH 2UVEA 4RGMB 3SPVB 4J3OC 4MLSA 1QRND 1X7QA 1NMAH 3DX8B 4DZ8B 1VFAA 5C8JB 2R1WA 4WDIB 3D85D 2R1XB 4WTZA 1V5JA 3JUYA 1MCPL 5J3HD 3O3EB 3HS0B 3DHMA 3RY6C 3HRZA 5IF0A 4L4VA 3VGFA 1CK0H 3MJ7A 2F8VA 4D9LL 1U6AL 3H9SE 3N06B 4LSTL 4MX7B 1QG3A 1FYTD 2X4RA 2V9TA 3IFNH 4I3RH 3WSQH 3HE6B 1B4JL 3MLSH 4V1DB 2ZOKA 1ETZB 2IADA 5ITFB 1EJOH 1G7MB 3EO1A 4OV6F 4OD3H 5ANME 3V5HA 5I18H 4R26H 5GGQH 4S11A 5IG7A 5IQ9A 2IANE 1B3JA 1AJ7H 4LLUB 3D3VE 1CYGA 3CH1A 3QUMH 3LKRB 4OV5A 3LIZL 3MGTB 4E41E 3BYYA 3QO1A 5LBSL 2XRAH 1J1XL 4S2SB 2V7NA 4K7PL 3VXPA 2B0SH 4LRIA 5JNYA 3TBSB 2R0ZH 3QUMA 3MMEB 4R96A 4RNRB 3BUYA 3W0WD 2XOTA 4HKBA 2V7HA 4RQQB 1RUPL 3SBWC 4HZLA 4D0CA 5A40E 3TFKD 2OSLA 4NFBA 2H3NA 3GMRB 3GNMH 3MO1B 4KV5E 5DJ2A 2Z35B 4JANA 5FKAA 1GC1L 4ODWA 5J3HC 4DAGH 2C4XA 3STLB 3IU4H 5GHWL 3MV7B 3B6SB 4OTXL 1QYGH 2ZG1A 4FQLH 5KS9F 4ZD3H 4H5SB 3D39D 3UTPD 3ARBA 1H15B 5A16A 5I8OL 1QRNB 2QSCL 1MY5A 1ZV5A 2ATPB 4NM8L 5D2NC 3THMH 3D85B 4I77H 1CXLA 2A0LD 2DIJA 4M6NH 3EUUA 4KHXH 3Q2CA 3T0AA 5DXWA 2NPLX 4PRBA 3QUYD 3PWLB 1M05B 1FYTB 1QBLL 5T1DL 3WIHH 1LDSA 3IJSB 5DJYB 1BHGA 1EFXA 3PDDA 4FFVC 3T3PF 3SY0B 2DMCA 2O61A 1KJ2H 3AU1A 2SEBA 5I74B 5D2NB 3WIHA 3SGDH 1CLOH 2JJTA 4R3SA 1KN4H 4XPHH 2VYRE 1BIHA 1KJ2A 4P57A 2IPKB 3VG9C 1A02N 1AD9B 4TYUA 4Z78B 4F7EA 4KI5F 1J0IA 4CGTA 4Z0BH 4FXGA 5FCUH 5E70A 2JTDA 4WW2C 4B0MM 3LEVH 3PDOB 4DW2H 4HPOL 3PWUB 1OGTB 3O3UN 4L29A 3DI2B 1T03L 4IRSA 1G6RH 3RUGB 4PB0H 3FQUB 4I3SH 1FL6A 3O0RH 3L3OA 5MEOB 3DV4B 5EBMA 4XVSH 4YHKH 4YX2H 3PWPA 5DJAB 5IQ7H 1I8MB 1C5BH 3PL6D 3VG9B 2VDKL 2DKSA 4K3HA 1G6RA 2A0LC 2DWEA 2JJVA 3WXWL 4NN7C 5BV7H 3BZFB 2BSRA 2KL6A 1EH9A 4MJ4A 2NR6D 4X98A 3PGDA 4WW2B 5ICXA 3QUYC 4S1RL 1IGYA 2AJXL 4DN3L 3D39B 2VLKE 4M48H 1QR1A 4TN9A 3VGDA 1N64H 4JJ5B 4PJ7E 3C6SB 5CBAA 3IDNB 1XT5A 4N9GB 3H3BC 3WDHA 3MUGA 2EC8A 4J7RA 3QEQE 3RIFF 1JWSA 3QUKA 1MHEB 1FZMA 1TQCB 3HC0A 5HHOE 8CGTA 1TVBB 4JQXA 1S3KL 4WHTA 3K4ZA 5D7SH 3VXUE 4MMZC 2NY3B 4D9RE 5FKPA 1IBGH 3HUJB 5B3JE 2BNUB 3AXLB 2H1PH 4LNRB 1WISA 3BISA 3U2SB 5FYJH 3RU8L 1GGBH 5L9DH 4DVRH 3TIEA 3UJJH 4CVUA 3T65B 2F9BT 3GI8L 3OKMA 3PL6C 1GGIH 4F7PA 1I7TB 4FQJL 4EKXA 1SJHB 5IVZA 1J9CT 2FGWH 2Y5TA 5JDJA 4RMUA 1A6PA 5CINL 5JW3L 2XG5A 4NUJB 1T0MB 2FH6A 2NZIA 2NR6C 1BLNA 3MNZA 2VISB 3FQWA 3D25A 2H6PB 1T83C 1VCAA 1WCQA 5J1AB 1FFRA 1S7XB 3W81A 4Q9RH 4OZFH 4AIXA 2D7TH 1X5GA 3TBTB 2WWKO 4P59L 1A0QH 4M8VA 4S0SD 1QLRB 5ID1A 1X5KA 3PL6B 4TSBH 1EGJA 2LABA 4A6YH 4AG4L 4TTDD 1JYNA 4OZFA 1B0RB 3ZE2F 3RL2B 3BZ4B 4QHLA 2VXTL 5C0AD 4WY7L 1NCCL 3GJFH 3P0YL 5E08L 3TIDB 4A6YA 2IQ9H 1L9MA 4FFYL 4ISVB 1MCBA 4M7JL 1YY9D 3N1GC 3U4EB 2R23A 3PP4L 4DGIL 4LQ1A 1J10A 1UB5B 3HNSH 3GJFA 3T2NL 3DPBA 3HZMB 4NO5A 3SE4C 1FH5L 4QRUB 1HDMB 2DQGH 1WT5C 5DGQA 3QUXD 4P99A 4AMKH 5HJ3A 1C1EH 5C0RL 3U4BL 3ECBA 3PWNB 4OKDA 3L3IB 5D2LE 1BVZA 2P42B 3ILPA 5F21B 3TT3L 2DQCL 3B9KA 3BIKB 4XXCA 3UO1L 5CSGA 4FG6D 1NCWL 3U79A 1FL5B 3DJ9A 1KB9J 5F1NA 5DEZA 1RZIB 1WFOA 1SYSA 5DEFA 5SWZA 4G43B 3ARZA 1MF2H 1C5DA 2FL5A 3F7VB 4OF5A 4TTDC 4TRPL 2DQUH 2LU4A 3EO0B 2GY7B 4O58L 4NGHH 3SDXB 1R3HA 3BAEH 3MV8E 3S37X 1PY4A 4PGCB 5E95B 1J88A 2DMBA 4IM8A 2FEDC 1YY9C 5IOPA 3T0WA 1P1ZA 2YKLH 4C59B 5C9JB 3MRBB 3NFNA 4PJ7F 3MUY1 2W0LA 5HDQL 5E24E 2H2SC 5E56A 1T3FB 7FABH 3DROB 4C4KO 3QUXC 3CSGA 1AGEB 4Z0XB 3LS4H 4ODXB 1RUMH 4XVTH 4N1HB 4X99A 2A6JA 4TULL 3UMTA 1ZT1B 5L2JA 2YA0A 1I8LC 5DQJA 3T0DA 1FZJB 2WNGA 3VFPA 1I1FA 3W0WE 1H8NA 4ODSH 2AJUH 2W59A 1R3KB 3S3SA 5ID0A 2AJ3B 1U36A 3AFLA 4KY1L 4D8PA 1R24B 15C8L 1JPTH 2FIKA 4OGYH 2X1WL 3HZKA 4NSKA 3T4AA 5LGHH 3TP4A 1NCAH 1OP5H 4Q9CA 1IEAB 3PWVA 1OT1A 3L5HA 1IZKA 2XPGB 4YNYB 4KK9D 3VXRA 4DKFL 3CCHB 4JFQB 4WI4A 5J1TC 4QXTA 2EDFA 1NKRA 5IW6A 2AJZB 2R0LL 1KLUB 4L8BA 3REVB 3QA3A 5CEYA 4LFHG 3ULVF 1CG9A 4R0LC 1ACYH 5HGHA 3U7AA 2FJGA 2MQ3A 3MXWH 4F7CA 3OX8B 2BRRH 4JFXB 3INUL 4DWHA 4O2EA 1BPVA 4P9ML 5E6ID 1AR2A 4XNXL 4ZMAT 1FP5A 2JB6A 3QDJA 2Y07L 3CU7A 4PLJD 3MOQA 4R0LB 1FRGH 1UA6H 4MA8L 2E9WA 1RHFA 2OZ4A 1DQDL 1P2CA 4CADA 2AI0L 2CR6A 2F53A 1HYSD 2DJSA 1OP3H 3R0MA 3VFWA 1W0WA 1EEZA 4XBGA 4Z7VE 3IFLL 1MVFA 3QYCA 4MCZB 3IXTA 3QEGH 4LEOA 2R1YA 3N9GH 3VJ6B 4IRJD 12E8L 4LAJH 1QUNA 1RZJL 3CLEL 5LWYL 5HI3D 5DD5L 4HJ0D 3NA9L 5KJRL 4OBSA 4XBPB 1DL7H 2HT2D 4PRIA 3QIBA 4MQTB 4WI5A 5E6IC 2ATKB 2YXMA 2OLDA 3LD8C 2UY7A 4F57H 1HQRA 1PKQB 1F4YH 4FQXC 4PLJC 1GGCL 4WO4A 5JPMA 1BFOA 3MBEA 3I02A 3SDYH 1KSRA 3VXTB 1HYSC 3FQNA 4X6FA 3DVGB 5IMMB 1AKJD 1TVHA 3EYFB 4GKZA 1NGQL 2VDOL 3MJ8A 5JXAH 3P4NB 3MNVA 4JRYD 3ZE1E 5C86A 3RUGF 3TPUA 3U46B 3AC0A 4IRJC 1CXFA 1T0NA 3EO9L 4RA3A 2HLAB 1I7RB 4U1KB 1WZ1H 3JVGA 4MXWH 4QRTA 1N6QL 2FSEB 3H3PH 4CVZA 1BQHB 1DDHB 1DTUA 5HI3C 4B5EA 2LFGA 2G5BB 4HJ0C 3FO0L 3BN9D 3KWWA 1IAOB 3GM0A 5SX4I 4WW2F 3C8HA 4NHUA 5ENWA 2HT2C 3KPLA 5C6TH 1JUFB 1YJDH 2MCG1 4YHPA 3HG1B 4HH9B 1CDHA 3LY6A 4XRCA 1JL8A 4OLVH 3OB0K 4UIKL 3JWOC 4JDTL 3QG7L 4EBQH 1ZHNA 4DUVA 4PJGB 4X8JA 3SDAA 3J7HA 1WIOA 2I07A 4JAMA 3MRJB 4Y19A 5C0AE 4WIQA 1AGDA 5I8CB 4RRPA 1XIWD