3QI9C

Crystal structure of mouse cd1d-alpha-phosphotidylinositol with mouse valpha14-vbeta6 2a3-d nkt tcr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
201
structure length
196
Chain Sequence
TQVEQSPQSLVVRQGENSVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSACANAFNNSIIPEDTFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular basis for NKT cell recognition of CD1d-self-antigen
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 36
structure length 196
sequence length 201
ec nomenclature
pdb deposition date 2011-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qi9C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qi9C02
3FHAA 3S36L 3PGDA 3F7RA 3RVVD 1X5FA 7CGTA 5DD6B 4NQEE 4OLYL 3BH8B 2LTQC 2XXMB 5JR1H 3MSPA 1S5IH 1AGCB 2BRRL 2FGWH 4FG6D 1TZHB 3PWNB 1D5IL 3MLSH 4M93C 4LQ1A 1HNFA 4GW5A 4XNZC 4XHJC 5D1QD 4TNVK 1S7VB 2Q1EA 4XH2A 3UJIH 1A6TB 3OKKB 4OLYH 4TSCL 4G7VH 1I3GL 1XIWC 4HMCA 3OKMA 4HDIB 1DEEB 1FGVH 4X5XA 3ZHKA 1JF1A 2AJSH 4U0RC 1VFOA 4KRLB 3QH3B 3ARFB 3OF6D 1FFNA 4R9HA 3GSXB 2F8VA 3SCMA 4F7EB 3IFLL 3KXFD 4AT6B 4EIGB 3RIAK 6FABH 5IBUB 1ZHKA 1NCBH 1GOHA 2P5WD 1X4XA 2CH8A 4QXGL 1U8KB 2PO6C 3OKNA 2ZUXA 5HPOA 2WAHA 3HC4H 3ISWA 3QUXC 3PIQB 4TPRH 3FN3A 3BI9X 5TJWK 1U92B 3MNWA 1ZEAH 4PRBB 4XP9L 3MRBA 2UUDH 4XNZB 2BP3A 1YQVH 3AS2A 4EBQH 3L7EA 2XQBL 3WJLA 2H32B 3SKNB 4F2MA 4XBGA 3C5JA 3U30B 2YA1A 3OGCA 3JV6A 3GGWA 4KRMB 3VI3E 3GIZL 4OD3H 4Y0GA 3RTQC 4QRTB 4OZHE 1R3HB 3FCTB 3VA6A 4JFDB 4JRYD 4PRAB 3ZT5A 5F7KC 4QTIH 2ADIB 2ILLA 4UTBH 5IJKA 3VFMA 1MFDH 4RSVA 4NN7B 4LSQL 3SDAD 4ODUA 2YPLA 3WLBA 1FC2D 2X4RB 2QKIA 2FX8L 5ICXA 2IQ9H 4ZXBA 5IF0A 3TCXA 3GMMB 3P3YA 3U48A 1DEEA 4G6FB 4HF5H 2FYYB 5HHXL 1XGTA 3TH4T 5DJ2A 4KPHL 4YHLL 4B0MM 4NNYA 3EFFB 1L7TH 4WFFD 1AR2A 4KKNA 2DTMH 5GRYA 4WFGE 5IVOA 3SCMB 2VZ1A 4YHNA 5BZWB 2XICA 4PJXE 3EYQD 4FZ8L 2X89D 1U3HB 5FECB 5J1SC 1OP5H 2HH0L 4MAYA 4NSKB 2CO6B 1NAMH 2FSEB 3BP5B 3QEQB 4KJQD 4QHUA 3W5MA 1QSFB 1QLRA 3EDKA 4JFFD 4LHJB 1J88A 2ZSVA 3QWOA 5DGQA 5EA0H 5EUOF 2B1AH 4MQ7A 5JW3L 1KJ3H 2FEEI 4PRDB 5GGRB 4RAUA 1WEJL 4F2MB 3Q3GB 3T4YB 1X5YA 3KPPA 4PJFA 5F1KC 5HVFB 3ZDYF 2APFA 5E6IC 1QBLL 3CLEH 3T2QA 1MWAH 3REVB 5T3ZE 2P5WB 4HUMB 1ROWA 5KW9L 3T1WA 1RSFA 2C9AA 4OLXH 3QIWD 3WBDA 4GT7A 1A9BA 4HWUA 5C0BD 5EO9A 4ZAKB 4PJEA 3CVHA 3NN8B 1HHHA 3HI1B 2JTDA 1KLFA 5SWSA 4CRPA 4D3CH 5HI4C 2DL2A 2P5EE 4LPXA 2ERJB 5HHVL 1MNUL 3MOBL 3LKQB 3OAYH 4JFFE 4AL8H 3TP4A 2HKHL 5DZLA 4XGZB 4BQCA 4Y7MA 3SCMC 1M05B 1V3JA 3Q1SL 4S0TD 3VE0A 2BRQA 4MNGB 4F33A 3VXSB 1AQDA 4N0YH 2QHRL 2L4OA 4U3HA 4BQ9A 2JCCE 4PRNA 1DEDA 2FCBA 4IS6A 4RFEA 5KSUA 2EYTA 3ILPA 3BRFA 2AXGB 1MCPH 4KK5D 4F7TA 1LE5B 4XNQB 3GBNL 4GG8B 2JE8A 2CR6A 1TLKA 4Y16A 2XNAB 1MJUH 4ODVL 3BO8A 1U42A 3DI3B 1P5UA 4XP4H 1JGVH 4IM8A 3NPSB 2A73A 3DTXA 4GSDH 3F7VB 3ARFD 5DRZB 2ZUQC 3D39A 3IDYB 2MJWA 3C6SA 1NCAL 3VWKD 4ZFOA 2ADJB 1LDSA 3GI8H 2VZUA 4WHTB 5BW7A 3RVUD 1HH9B 2BNQD 1E28B 3UYOD 1A9BB 1QBMH 4YEEA 2CLVA 1FDLL 3UO1H 1B2WH 4R7DB 1JRHI 4C4KT 4C56B 4JFHE 4EIZC 5HYJE 4LSPL 4PUBH 3EYQC 3IJSA 1BVLA 5HYQA 4GO6B 2V17L 1OSPL 2GUOA 2DTSA 2H9GA 5I8EA 2WIIA 1IQWL 1IAMA 1WK0A 3TBSA 3Q48A 1BIHA 1INQB 1LO3H 4QWWC 5JQ6H 5D7IE 3V7AE 1FORL 3OR6B 3UC0L 3D39E 4P5TB 5BVJA 3O8XB 4HKXA 2X4QB 3BUYA 3O6LH 4KK6C 3KYKH 3ES6B 4NQCB 3BP6A 3W11D 1WC7B 4FQCH 2B4CL 1AD0B 3BRDA 3O45A 1P2CB 3PDDA 4MXWL 4X4XA 1PDKA 3FOMA 2GFBB 5SX4I 3ROLA 5IHUH 3ALPA 1NFDA 2DM2A 1KIQA 3CFBB 3MLWH 3MX0A 4JQIH 2IBZY 2W59A 2BJML 3L5HA 4NO3A 4ZXBB 5I19L 3GMMA 4HS6B 5D2LF 1G9MH 3TPUB 1PQZB 4L4VE 3JWNC 4S2SA 4L9LA 4UU9A 1IC4L 3RX7A 2VAJA 4MD0A 2I25N 2QSTA 4PREA 5IWLC 2DI9A 3GSNA 1RZGB 5DYOB 1JHTB 2F54E 2W0FB 3QUZD 4UUJA 4CNIB 2AKRA 4Y2DA 5HDBE 2OM5A 2XZQL 4N68A 4OZFH 4NO0A 3ZYIA 4CUCA 3N50A 1IC4H 4U0RB 1GIGL 5SWZE 3WDHA 2Q8AH 4J3XA 5I1LB 1KV3A 4LQFH 2R4RL 1G9ML 3HC3H 5AEAA 4M61A 5EUOB 4P46A 1DLFL 5TPWL 5LQBH 2IAND 4W4NA 4KV5F 1U8OA 4MA1B 1C1EL 4LLVB 4PRPE 5C0CA 2NTFB 1NBYB 5F8RC 4Z7UE 1CR9L 2YKLL 4S1QH 3HR5B 3VXOA 4YX2H 4P2QB 5T1LD 5IM7B 3OKDA 2J6EL 3FB6A 5IVXE 1M1SA 3KPMB 4IRJD 1BJMA 2A38A 2IGFL 3MOQA 5AYUL 2VLJE 4KHTH 4ZTPL 3V6ZA 1I3RA 2EKJA 1FL3A 1XCTB 3GMOA 1SEQL 5D2LA 3KGRA 1JBJA 3AFLA 4PY7A 5CIPB 4QY8A 5HHQA 4CJ1A 4HV8A 1FE8L 2A77L 4MAUH 3VFUA 3QUYD 4HIJB 4V1DA 4IRJB 4WEUD 4NHUB 4PJEE 4K23L 1P7QA 3PQYE 4X5LA 3ORJA 4HH8A 4PREB 3U0WL 2P5EA 5D72H 1MHPL 1OW0C 1CXHA 4LLUA 4NHCL 5EH1A 2I27N 3J7HA 1I8LA 2KQMA 2QQLH 3CK0H 1NEZG 4P9HL 3ILPB 1UQSA 5E00A 1PSKH 3DX9B 3C6LA 4KJQC 2R29L 4X83A 1N5AA 3B43A 3PL6C 5B22A 3ELAT 5LGJA 3HMWL 4H26B 2XZCL 1YEGH 3GO1H 2D7QA 2AP2A 3TBTA 4LLMB 3CZJA 4JDTH 1CGVA 2EICA 4M4RA 3LIZL 4NNXB 2CDEB 2XG5A 4O51B 3I50H 3E3QE 1D6EB 2XZAL 3OZ9H 4DFHA 1KB5B 3S37L 5MENB 1IT9L 3HG1A 4K8RD 1TETL 1IGCH 1FZKB 2IBBA 4P3DB 3PWUB 2EC9T 1QQDB 1FLRL 3MJ7A 1CCZA 4C56A 1F3JA 1EDQA 4LK4A 4OGYL 1E4WH 1BGXH 2X42A 2XRAH 4ZO8A 4Y4HA 3DIFA 5HDQH 1CT8B 5EFIA 3O4LD 4LPVA 1IAOB 1G6RH 5IGXL 3TBSB 3RVWC 3NCYS 4EN3B 4FFVC 4LPTA 4HWBH 4WHDA 3SDDB 2EC9U 1MCKA 5IFJA 1CK0H 1ODAA 4FQQA 2ZOLA 1EEZB 3HE6D 3ILQD 5AD0A 5HJ3B 4PJBB 2Q3AA 3V4UH 4WWKD 1QSVA 1TZGH 1BLNB 5EU5B 3O4LB 1WWBX 32C2B 4P4KB 4NQSA 4RMWA 1QBAA 3GJEB 3L5XL 4QHNB 3MRHA 3GSQA 5I17B 1RQ5A 3O3AB 5CILL 3WFEL 4U49A 5F97E 1EFQA 4HG4K 5C0RL 2IH3B 2YPKB 5CUSH 3S36X 3DI2B 2VXTL 1NDMA 3O0RL 1YNTB 1JPTH 3P4NA 1FZJB 5C08E 1SYSB 5EU7E 5CEXA 3DX7B 1YC7A 3HC0B 3AM8A 4N90E 4OGAD 3C08L 4FXLA 2L7JA 3WXWH 1U95B 5KN5B 1TZGL 4Q9BA 2QSCH 1WAAE 4V2CB 3AMLA 3MRJA 4O9HL 2BVUA 1K2DA 3VG9B 4J1UB 3KPTA 4HUWB 5CP3A 4JZOB 2V9TA 3INUL 4LEOA 4J3VA 2CRIA 3GDBA 1F2XK 5JOEA 1K4DB 3MCLH 4A6YL 3KPRB 4XWOD 4LEXH 1K4CB 1S7XA 3DOSA 2JJUA 1LHZA 3ARZA 1MCCA 3QUXA 3MLVH 4C57C 5IMLA 3MO1A 1KGCD 4NNPL 1I9IH 4M7ZC 5FF6B 3EDDA 2ZCLL 1MCFA 4MJIA 3ZZ1A 3MJ6A 7FABL 4WI3A 3H9SD 1A4JA 4U3XA 3CJJA 3MBEA 1MI5E 4BYHA 4Z78A 4Q9QL 3OX8A 4F15C 5D70H 4UNVA 1LD9B 3BESR 1VSCA 2AJXH 5TF1H 3GMLA 5FYKE 1GHFH 1MEXH 3FFDB 2J12B 4NN7C 3RGVD 4JANB 1EZVY 4OI9A 1I8LC 4DKEH 1T1ZB 4QTIL 3NIDE 3LAFA 1FNGB 1DLFH 4UOJA 4KQ4H 2AK4D 2Y5EA 4NRYA 1XCQB 4G43A 5CKAA 2DLEA 2NLJB 5E4EB 4JRXB 4PB9L 2EDOA 4F7EA 1K6QL 1T04B 3FONA 2RAMA 5C0CE 4JY5H 4X6BA 2W91A 3DECA 5CKGA 3D3VA 3D69B 1CBVH 1D7FA 2VLKA 4FABL 2Z31A 3I02B 4G8FA 4APQC 4N0UB 3R4DA 3FL7A 2P49B 4P9ML 4TTDD 3MRCB 4RGND 1DJSA 4Y5XC 2FHCA 4GUPA 3BGAA 3V0VB 1JMZA 3I6GB 2FB4L 3VI4E 1JVKA 2NMSA 4KRPB 5I1JH 4PJ8A 5C7XL 2C3XA 3X3GL 3L3IB 2A9NH 1A9EB 2BDNL 2E6JA 2YPLE 4DZBB 2DQUH 2FZ3A 3GNML 3U1SL 3ARDC 3RHWF 3KAAA 2K7PA 4LCCA 1NGZB 5BMFH 4DFIA 2JK5B 1IKFH 3ARGC 4M02A 1RUML 3PWNA 5D5MA 5ITBH 3G6DH 4NBXB 1KLGB 4Y2DD 5DRWB 1MY5A 2W9LA 3LB6C 5DWUH 4E42B 4PJ5B 1IGYB 1RZKL 2H6PB 3MRMB 5C0FB 4X6DF 3GHEH 1MCOH 3FQXA 4JVWA 4M1GL 4JRYE 1WFTA 4HGMA 1INDH 2VXVL 4X7CC 4F3FA 1TTFA 1WCQA 3L3KB 5K9QG 5CBAB 5GS0D 3R8QA 2DM7A 3PUCA 5T5FL 2HT3C 3S37X 4AIXA 5JA9A 4BK5A 2QQNH 4QWWD 5J9PA 3WFDH 3ABZA 1I8IB 4G6MH 2HFFA 3BPOB 3LVEA 5EFIB 1U3HA 4M5YH 2DWDA 4ZSOB 4LSPH 2OP4H 1ZLWH 3SDAB 3WXVL 3MNVB 1U93B 3VFRA 3HI6L 2EIDA 4XPTH 4L4JA 1J8KA 2BZDA 1YC8A 1CTNA 3RNQA 1KEGH 5IHZA 3DXAB 2Q7YB 4MGXA 1Y6NR 4ZPVB 1A6TA 3OKKA 4JN1H 1KTDB 1VFUA 3VCLB 2ZJSL 1LP9E 4Z5RB 3LZFH 4JFOA 1JTTA 4MNQD 4UT7H 5CJBA 8FABA 3VFGH 4R96B 1JF1B 4XP4L 5KVEH 5I17A 2FH8A 4NDMA 1I9JL 3WS3B 3CX2A 1KPRA 3RWFB 3QWQB 1MFAL 1G7HB 5HGAA 3MBEC 3IDUA 3L95B 4RWHA 2IBZX 1A14L 2OI9C 3VXTA 2A6JA 1R5VB 1N6UA 1ZVSB 2PYED 3IVKB 3P0VL 4IOFC 4RBPK 1DVFB 3RWCA 5FGCE 2AJYH 1FAKT 5CMAA 3VXNA 4AEEA 1AGBA 3MLYH 3FQXB 5DHVA 3SGDI 1I8KB 1N2RB 2LAAA 1HHGA 1Z5LB 1P69B 3MRBB 4QF1A 5T1DH 4I18B 4TUJA 5FK9B 3IF1B 1IGIH 1J1OH 1KIPB 2IFGA 4FTVE 5H8DA 1MNUH 1K8DB 3ZDZE 4AYFA 4PGCB 5FO7A 4BKLA 1MOEA 2GJZB 3VWJA 3U79A 3BEWB 5JO5B 2HTKC 3UO1L 5ILTH 2H1PL 2XPGB 1EO8H 1SJHB 1AIFB 4H1LB 4M6AA 3QJFA 1L6XA 1IGTB 2X1QA 2J5LB 1GGTA 1IFHL 4YAQA 1SY6H 5FAAA 5B3NA 1T89C 2ICEB 5IF0B 3O3UN 43CAA 3SGEH 1G6RB 4L3EE 1RZFL 5C0NC 4YHKL 4LCUB 2V5TA 4NUGL 5I8CB 1Z3GL 3EYUL 3V4UL 2ITCB 3BN9C 3T4AB 3GKWL 5GGSA 3FQRA 1LEKB 4CW1A 4QRPE 2I60H 2WBJC 1HKLH 2Y07H 3K8MA 3IKKA 5JW4Q 2IALB 3UTSA 1EH9A 4JFEE 1A6ZA 4RMVA 4WW2B 5I74C 1FZOB 3IB4A 4PJDE 2A6DA 4FZ8H 2OBGA 4JPIA 5HVGB 1GYAA 3OSKA 1UWGH 3QWOB 1BGXL 1JN6B 1UGNA 2DTML 4Y5VC 2I07B 1NANH 2LVEA 4YBLC 3VWKB 5E95B 2VABB 4NWUL 4NKMB 4Q2ZA 3N0PB 5DQJB 3V6BR 3L6FA 3WO3B 3V95A 1M7DA 4XP5H 3EGSB 3WHE0 3JWOH 3MNZA 4TUOB 1SJXA 5LGHH 1U3JA 4QHMA 4PRIA 4LVEA 1HILA 4CVZA 2XXCB 4JDZA 4OLWL 3MR9A 4NKIH 2IADB 4AT6A 3IFOA 2AXGA 1J0YA 1P2CA 5J89A 4R2GD 4HSQA 3X11B 1VFBB 3Q5TA 4ZOEA 4QOKE 1WBZA 1H8NA 4M3KB 4KJPC 4ZG1A 3LN5B 4XPBH 4GJTB 2NY1C 1LDPL 4XRCB 3VXSD 3RVTC 3UTPD 4AJ0A 1KXTB 3RDTC 1MCRA 4B5EA 2YD3A 2C5DC 5D1ZD 4HUUA 1A8JH 3CFKB 4YGAB 4M7LL 2E3VA 3UZEA 5E8PB 2BVOB 4GG6E 2FJFA 3U0WH 4KKBD 1HHIA 5T1LA 2R9HC 5EU3A 3OPZH 5DYOA 3MRLA 4PJHE 3DHMA 2EDXA 5GJTH 3VWJD 1H9VA 1JZ6A 1RAMA 2AV1A 3BZDA 1DQQA 3PHOB 2DYPD 4JO3L 4Q97A 4NO0B 1N4XH 1JUFA 3M17B 4Z7QF 12E8L 4G42B 4HIHA 5SWZD 5IKCA 4MQXC 1J86A 3IFNL 5D1XB 3SO5A 5I8OL 4R97B 5IVXA 4NKMA 2P8LA 3RU8H 5FV2A 4BM7A 1RIUH 1JZ2A 2GTZA 3DLQR 4XVUC 3RKPA 4F9PA 4OIBA 5I1IL 2Z35A 5IBLC 3QPXL 5DGRA 5F96L 3VFNB 5F3HB 4S1QL 3MV7D 4HFWB 1PZUB 5FIEA 1J18A 2VDML 1QRNB 2BVQA 4QRSB 5KVGL 4LRIC 4DOHE 1U8NA 1S5IL 2BRRH 4JFZH 5DQDL 5HI5C 4GKZA 3QUMH 1NCCL 1A22B 3FOMB 4FA8A 5F1OB 3DYMA 2IAMB 1RZ8B 2M2DA 5GGTA 1Z0NA 2BFVL 4E0RA 1QYGL 3ZO0A 5I1DA 4JRXE 5JOPE 3O9WC 2H45A 3GM8A 2ZP0T 3DYPA 4NZDA 4K3JH 2ZCKH 4Y4KA 4W6YB 5A2KH 1A6PA 5KVEL 1T21B 2XWBB 5CEZH 2YD6A 3LZFL 1KPVA 1W8NA 3CVIL 3QRGL 4JFPB 4JZNA 4PV8B 2SEBA 4H20L 5E8OA 1ZLVK 1K5NA 4YXLL 3HMXA 1TDQA 4NYLA 5B39G 5J6GB 1DQQB 3CSYB 4OTXL 1J1PH 1NCBL 1JP5A 3I3DA 5DRXB 1JWUB 3U9UA 2AEIT 3OB0H 3D18A 2PO6D 1BFTA 4N5ED 2Z93B 3NZHH 3PWLA 5HGBB 5I9QB 3VDAA 2VLMD 4J6RH 1E6JL 3MZTA 5J12B 5GSVB 4YPGB 2YPLB 3CDYA 3DX6A 5IJVB 3HUJF 4JPKL 1U8JA 5C0ND 3BPOC 1WZKA 3FO9B 4U1NB 1BFSA 1UXWA 1HIMH 3MTRA 4PRHB 5E2VL 5TH2B 4MQTB 2AW2A 2NX5A 2EYRA 5FM5O 3WFCL 4URTB 1I1YB 4NJ9L 5D93C 2R1XA 1FH5L 1FFQA 5SWSE 1NBVL 2VDLH 4GKOA 4M1GH 3TJHC 3OKDB 3ARQA 1D9KD 2V7NA 5L6YL 1KACB 5FOJA 4XMLH 4YE4H 3UBXA 4YDJB 3BP7A 1BFVH 3B9EA 3UZQA 1SVCP 5T3XD 2VZVA 3RDTA 3T77B 2GSGA 4JY6A 5LBSH 3G08A 4K2UL 3BAEL 4DK3A 4Y16D 2JELL 2WUBL 4JG1H 3T3PE 2OJEB 3EDJA 3GRWA 5CGYD 4ZAKD 5MEPA 5IOPA 2CDGA 3TA3A 4OFKA 1OGTA 2O26U 3NFSH 1LP9B 1DVFC 3IT8D 4K9EC 3A6OA 3MLXH 5GGSY 1BLNA 3DBXB 3RL2A 3K4AA 1JYXA 2E7BA 4U6YB 2F19L 1NC4B 4JFED 4L29B 1HH9A 1BD2E 3FT3B 1E28A 1UZ8B 2H2SC 3BWAA 1KN4L 2EDNA 1OVZA 5DVOA 4IDJL 1RI8A 4PY8J 4M8QB 1E4JA 1I1AA 1GL4B 5KOVC 3P4LA 4XNXL 5DHXB 3NBNA 5E99L 2NY7H 5ADPH 4L8DB 3BIKB 1U8JB 4F9PC 5JLZA 1NDGB 5J1AA 2ENYA 2NY3D 3EOBA 1A1MA 3LQZA 4NZRL 2R15A 4KJWD 2C7UB 3BHBB 4CU7A 3AY4C 2PO6B 5CILH 1Z2KA 1KOAA 3HG1B 3MZGB 4C4KO 5H35A 1KELL 4MJIE 1EHLH 1HHIB 5C08B 3Q1SH 1UM6H 3QXDB 1U2HA 3GK8H 4XXCA 4Z0XB 1BD2B 4PRNB 3EYFB 3MV11 5I15H 3MXWL 3F58H 4KUCF 1KSRA 2NZIA 3WCYA 4M6NH 1FIGL 2Q6WB 5D70L 1NCDH 3L5WB 1QHPA 2ITDA 3B5HA 1TIUA 4GAGL 4Y4KC 3HS0A 5D7KE 2AS5M 5AUMA 1FL6B 2IANB 5LXGH 2P5WE 3BD3A 3G04B 4OFYA 1H5BC 4OCYL 5C0GB 4JFDD 3U6RA 1LK3L 3GI9H 3FQWB 2PNDA 1ZMYA 1F90H 3K74B 32C2A 1GVIA 1I4FB 3Q5OA 2HFGH 4F15B 4LCWA 2YUWA 3L3GA 3RWHB 2XZAH 3OZ9L 4K94L 2O61A 4D0DB 2UV3A 3WS6A 4LSSH 4WUUB 3U7YH 2G75B 2IH3A 2ED7A 2YPKA 3H9SB 3GK8L 3FOLA 4LCWD 4NUGH 4PR5A 1T6VN 4U1KB 5K9JL 1KJ2B 5CJOL 1UM4H 3E6HB 1ZT1A 4C83B 1TXKA 3LQAC 1IAOA 2VIRB 2EDBA 5TDNB 4IOIB 1G7JB 1IARB 3KPSE 4MQ7B 5EWIH 3BGFC 2BOBB 1YN7B 2HG5B 1MHEB 3SDDA 1DN0B 2W9EL 4XCEB 4ZPTA 3MBXL 1JPSL 1T2QH 3GSUB 4ZAKC 4M43L 3FO2B 5C0CB 2V9RA 2FX9L 4BQ6A 1K4DA 2P42B 4FQLH 1UJ3A 1T03H 5DXWA 4HF5L 3HA0A 2EYSA 3D39D 4GAFB 1I7RA 5IQ9B 5KVFL 1I7TA 1WC7A 1EGJH 4K23H 4PJ9A 2ZCHH 4JJ5B 3LSOB 3VXMB 4OQTH 1PJ9A 4GBXD 4HFUH 4PJHF 2PXYC 3QCTL 1CYGA 3SQBA 3CSGA 1ZA6B 3WIFB 4HWZA 5C71A 3U4EB 2ICWB 4LLDA 4GG6F 4M7JL 2ZUQB 3PP3K 5DD3L 1HQ4A 1JGEA 2CDEA 4RFOH 2MQ3A 1FFPA 2BERA 1CD0A 1AQKH 1ZT4B 3W9EB 1R3JB 5TE4L 4ZD3H 5I1CH 2UWEE 2R1YA 4G80A 2LU4A 1JYWA 2DIJA 3VXRD 3O4LE 3LPFA 3U36B 3ZE1F 4D0DA 5ISZA 3W39B 3R1GH 4I5BB 4NC0B 3D85A 1AGFA 4JN2B 4PJAE 1UQSB 3MPCA 5E00B 4HZLA 1FAIL 3ARPA 3WO4C 3VFGL 1LE9A 4IBLT 1PG7H 3LEVL 4IRSD 1A7RH 3AY4A 4EXPX 5DMGC 1KEGL 1T20A 4GOSA 4E41E 3D85D 2ZOLB 4XX1E 3ARBA 4ZPVA 4ZFOL 1TJGL 5E0QA 1MFBL 4NQEB 1BVKB 5DURD 3RAJH 1E27A 4AEIL 5EPMB 3VXMA 4KK8C 3KPMA 4Z7WE 1T7WA 2ZSWA 3RI5K 2RFXB 4MAUL 4NQDE 5JXAH 1ZT7B 3TO4C 2BVPA 4WFHE 3BZFB 1ZHLB 1U8IB 3DUUA 1ZKAA 4JKKA 1INDL 2VXVH 5DHVH 1EO5A 3LRSB 2KH2B 1CLOH 3TM6A 1RJZB 1IAIL 3L5JA 3P0YL 4DTGH 4JPWL 3B9KB 1CDHA 4V1DB 1UKTA 2W60A 15C8L 2XN9A 4PJ5E 1RUMH 4NM8H 1MSPA 4U1JB 3DGCR 5J6HA 2F74B 5DJ2B 3BYTA 1CGSH 2YEZB 1CLOL 3EZJB 1HSBB 4KUCD 4LMQE 4X5WA 4J3OC 5K59F 4HS3B 3CFJA 3MYZA 2W38A 3K4DA 5ACZA 3VFSB 3MO1B 5KS9A 1S9YB 5ESAB 1HYSC 3TC9A 4I48A 5JOFB 2X05A 1FC1A 5IMMA 1K85A 1MH5B 1U8HB 2VDKH 1U0QA 3VXRB 1UA6H 3DVGA 4JO2L 3R0NA 4O02H 5E8NB 5KVFH 5AZEH 1NCUA 1OB1A 3LDBC 3WEXA 2IAMD 3O6KH 4NFDA 3RWGB 1N6QL 3IXAA 5GISL 3P73A 1K2DB 4Z5RA 4MWFB 3TV3H 4PJ9C 4ETQB 3PNWA 4U31A 3VA2C 1OP3K 4NRZB 1TQCB 5EC1B 3ZKMC 4FQIL 5EBWB 3X17A 1YMMD 5JMRA 4WVRA 3EFDL 4I3RH 4EEEA 2RHEA 3S9DB 4JQIL 4ZSOA 1PKOA 4H8WC 1HHHB 4ODSL 1QBBA 1YEDA 4N0CD 5DJCB 3DXAD 1CICA 2VR5A 1MHEA 3LS5H 3ARRA 5D7IA 4GW5B 2GEEA 3DV6B 5L2KE 1EEZA 2DDQL 4K71B 2HTLD 4GRWF 1YYLH 1UB5B 3SDXA 4B41A 1ONQA 3FFCE 5C0DA 4WO4B 3HG1D 3DROA 1NAMA 4PJDB 4Z7UB 1YYMH 3DYOA 3WL9B 4AY0A 5DT1L 5FYKH 4HULB 3L3JB 4IJ3B 3VFVB 4WY7H 3QCVH 4D0BA 5GGUA 4G9FD 3AS3A 3WSQH 4HS8L 2HN7A 3FJTA 3LKOA 3HE6A 2AXFB 2EXWD 1FPTL 1AD9B 5ETUB 1E4XI 2V17H 4DGVL 2Q86A 1EBPA 3RA7H 3FRPA 3LDBB 3U7WH 4PUBL 4F7PB 1RIVH 5HI4D 3FAWA 3TNMB 2EKSB 1HWGB 4GW4B 3HNVL 1YEIH 1FDLH 1W2KT 1AGBB 1VADA 2V5MA 5E8EB 5KSAC 3RZCC 2I9LA 2PCPA 4QRRA 1DE4A 4OZHA 4JG0H 4OF3A 3GUTA 2NZ9C 5EBWA 3N9GL 3TEUA 1RUQL 1VEPA 4MJ2A 5BRZE 4DKAA 4UTAL 1M05A 1ZHNA 1YMHA 5KTEL 2W9DH 3L3IA 3VFPB 2ATKB 3ZKXC 1RUKL 2AI0H 1OLZA 3V4VH 3SE8H 2KBGA 4IDJH 5CBEA 4Y8DC 1JZ7A 1QEWA 1PX3A 4M7LT 5DSCA 2WLZA 1Z0MA 5GGTL 1IFHH 4P3CH 4UB0L 4XH2B 5D1XA 3V7MA 3X12B 3KJ6H 4J2XA 3GJFK 5J12C 4P2OA 1S5HA 4NZUL 3V4PH 1JI2A 3S3SA 5D1QB 3S5LA 3RX8A 2RB8A 4F58H 1F13A 3WL9A 2PTTB 1QR4A 3KPPB 4ERSH 4PJFB 5ILTL 3QIUA 3EO9H 1NAKH 3N1GC 5AAWA 4QXWA 1HILB 3QFDA 1WWCA 1MJ8L 1WWWX 5IIEA 2ARWA 2QSVA 4WUUE 3KDMB 3BT2L 3IVKA 3SO3C 2FO4A 4U1SB 3OR7B 1J05A 2FIRT 3NIDF 3N06B 1ORSB 2R69L 1ETZB 1MJ7L 1X5IA 2DLFH 4N5UA 3QFJA 5I1DB 2XZCH 3GO1L 5T33L 4PJAB 5DO2C 5CHNB 3ULVC 1CVSC 1MWAL 4AQ1B 2YHGA 1DQMH 4PS4H 4YDKH 5J3HC 2Y5TA 1RVFH 2Y06H 3OKMB 2ARJQ 4MVBC 3O4OB 1AQDB 5GGRY 1XZ0B 5DJZA 5FO7B 5E5MA 3OKYA 4O2CA 3KLSA 4XNXH 4QHMB 3HFML 4CNIA 1N5YL 2AJUH 2F5AH 3BKMH 1O0VA 3CDCA 1T7ZA 1CU4H 4UT7L 3B83A 3DHJA 1RK0A 5ENWB 5I1GH 3IU4L 5IVZA 1Y0LB 4XPGH 5I18L 1IGYA 5FHBH 4GS7B 2R0KL 5D1QC 3C5ZA 5LWYL 4PJHB 3QRGH 2Q76A 1WAAF 3PE9A 3R0MA 3TYGH 1F4WH 3GSWA 5I71B 5CFHA 4K2UH 5E8DL 4MD4B 3SKNA 3HE6C 2AJSL 2FNBA 4XBGB 2AGJL 2EDWA 1HHJA 4CW1B 3RBSA 1YPZA 3QEGL 2DQEH 5E1HB 3GBMH 4R7NB 1SQ2N 2D3VA 1PG7W 4JKWA 4LSQH 1QNZH 3T2OA 5F72S 3QUKA 5J0BA 1IVLA 2XTJC 3A6BH 4XNQA 2DBJA 1LD9A 5FM4A 3WFHB 2APWA 3V0WH 1GGIH 1T0NA 2M1KA 3MV9A 4NQXB 2OJEA 3VG0H 1HIML 4RAUB 5JXED 4HGKC 3ZT7A 4JFFA 4YDVA 3OXSA 5FM5M 5ITFB 5JXEA 5T3XH 1G7MB 2NLJA 1KPRB 3RWFA 4YHZL 2DQUL 3ARGB 3BUTA 5C07A 4O2EA 1T66C 2O5ZH 1MPAL 2R0LH 4X9BA 4OZFA 3P40A 3RBGA 3DVIA 1NFKA 4FMFA 2UVEA 4OT1H 4ZUVA 1N59A 4I0PD 4MA1C 4MZ2A 2VLLA 3JUYA 2FJHA 3UTTB 4FXGA 1BOGB 5MI0B 3BD5A 1XMWA 3VRLF 3P9MA 1OAZL 2AK4B 3WN5A 4B7LA 1WAAA 2X4NA 2K1MA 4X98A 43C9B 3G5XA 2NXYC 4ELME 4KTDH 1JHKL 2AVGA 4HIJA 4NHUA 2CIKB 1CG9A 3NIFE 4OLVH 1GZQB 2FH6A 3H9HB 4OZIF 3M1BA 1HI6B 5L88L 1D5XA 4BK4A 1BM3L 1OL0A 4GFTB 3CSYA 3MLTB 2BNUB 1S9XA 3RY6C 4UBDD 2XTJB 3QIWA 5MHSD 4YBQD 4MXQC 3OB0K 4JAMA 3V6OA 1CFTA 1TQCC 3PWLB 3T77A 3G6JA 4ZOAA 4G6JH 1GHFL 1MEXL 4HC1H 5D6DA 4PTUB 2C3HA 3H2WA 3S88H 1FZMB 3T8XB 4M6MH 2HLAA 1KCLA 1MCSA 3V7AG 1T1YA 2VDNL 3EO1A 2UVFA 3UJTL 4XI5C 5DZOA 1F4AA 1A6AA 1U2CA 4Z7WB 3HMXL 5D9SB 1UFUA 4P2QD 3FTGB 4QXTB 3MRKA 4GMSL 3HZKA 4XNUL 4JFDE 1VFMA 4R7DA 4ODTL 3P9WB 3MXVH 5C6WH 3C5ZC 5L2JB 2J4WH 3H7LA 4GXVL 4AIZA 3TT1L 1C8PA 2QADC 5CEYA 1DANT 2F15A 2Y07L 3AMKA 1T66D 4BSWB 3VRJB 3B3IB 4X9FA 5CZXD 4LIQE 5L0QB 4O58H 4KV5E 1QO3B 4EN3A 3MRIB 5C0AB 5E56A 2AQ1A 5GGRA 2EDTA 2DJUA 3OJDA 1DUYB 5IVXB 2V2XB 4M6OL 3UDWA 1JYVA 3ARXA 1D5MA 2UZIH 3FFCB 5C0BE 2EEDA 5F3HA 3MUY1 1Q0XL 3MV7A 5CUSL 1D5XB 1P7HL 5DJ6A 4NC1E 3RUGA 3GBLA 3IS1X 4DZ8B 2DQIL 1TNNA 2HVKB 2G5BA 4WCYH 4I1NB 2ZKHL 3V5KA 2FATH 3BFOA 3AVEA 4K7FA 4XNYH 3RGVC 1CLZH 1SMAA 4AL8L 2ID5A 4TULL 4ZFGH 4TSAL 4NCC2 4M4PA 1JPFB 1IC1A 4QY8B 4LLMA 2WUCH 5CCKH 5HHQB 4Z7VF 3AM8C 5C0GA 1VB9A 3IDGB 4KAQL 5GRWA 1KCVH 5CEZE 1G6RL 2ZG3A 2CKBA 3S3JA 1N0LA 2FJFB 4PP1C 2FATL 2Y7QA 2YWZA 1KGCE 4QRUB 1YJDL 3O2DL 3CVHH 4DVRH 1Q0XH 4LDLB 2MWCA 4P5MB 1HH6B 3FOLB 4YK4C 5KS9E 1RUPH 1MREL 2XQYG 1UYWH 1IT9H 5HYJA 2XFXB 1JWMA 4G9DB 1C16A 1H3GA 4M1CD 1KLUB 3FO0L 3VFOA 2H41A 5EA0L 4IRSC 5GS1A 5L9DH 3ULUC 5D7IF 3H9SE 2YA0A 3V2AR 2K9UA 3MA9L 2HLFC 1AKJB 2RBLA 4JANA 1OGAA 1OQXA 3TIEB 3RY6A 4PJFE 1JRHH 3S96A 1JHLH 4P3DA 3DV4A 4DZBA 4FN0A 3WXVH 3P30H 4MA8H 3V6ZB 1DSFH 2JK5A 3CUPB 4PYHA 4OFVA 4M6ML 5CEZD 2NX5E 5SV3A 4YEFA 2Y36L 1U95A 5CZVL 4G6JL 2NY2D 4ODXB 4GRLB 3O8XA 4I2XA 2AEPH 5EOCH 3AB0B 5C08A 1I1FA 4I18A 5AYUH 2AJYL 1QSEE 3HB3D 4K71C 3DSNA 1D6VH 1KCSL 2MQCA 3X14B 3BWAB 4J4PA 3NA9L 3O2VH 4OFIA 2JCCF 2CUHA 3LV3B 4JPWH 2BC4A 4NRXB 2W0KA 5FDWA 2D03L 1NDMB 4KRPC 3OHXB 2CKBH 5E6YA 3CGTA 3ESUF 3HHRB 3MYJA 4H8WL 2W1NA 3S35H 4KWUA 4Y4FB 4PRHA 2WK2A 4PJ5D 1YEKH 1R5WA 2VQTA 2F5BH 4OCSL 1MF2H 4BUHA 1XH3B 3MJ9A 4P2CG 4XBPB 3ARUA 4LCWB 1G7LA 3W39A 4FXKB 1QQDA 3RGHA 5ISZB 5EB9A 1G84A 4F37F 4C54A 3PG2A 1MCHA 4PR5B 1LEKA 3SPVA 1RPQA 4M7KH 4ZNCD 2VZ3A 5E2TH 1LE9B 1Q72L 4FQXC 4RCAA 4MVBD 4HQQH 4HKBA 5KSAD 2A6KB 2FD6H 2GSGB 2X10A 3VG0L 2VDOH 2F5BL 4KK6D 1EAPA 4LHQB 4CJ0A 1MCWM 3NCYP 4FFYH 4GRLA 2X4UA 5ANMA 3TA3B 1FJ1A 4LLVA 2PETA 2FR4B 4WW2C 3CC5B 3ZSSA 1I7RB 4JQVC 5C2UB 5MEQA 5BMFL 3VMNA 2GJZA 3O6LL 1CD8A 1ITBB 2VZOA 1YNTA 5JLZB 4NKDA 4WDIA 1NFDE 3VXRE 5J1AB 1BOYA 1AI1H 1VFBA 2ZZUT 3CMGA 1OB1B 4OM0L 3D0VA 2NY3B 2WQ8A 2PN5A 2NXZD 2H6PA 1VGEH 4UINH 1NJ9A 2ARJA 3BSZH 4F9LC 1ADQL 4ELMB 1IJ9A 1NL0H 4U1JA 2FDBP 3WDJA 2B0SH 1X6NA 2UUDK 5HJ3A 4LIQH 1A7NH 2QSCL 5FCUL 1D5ZA 4HS3A 4JY4A 1QBML 1ZLUK 1KB9K 2R0WL 3VW3L 4OZHF 5H2BB 4ZXBC 1JWUA 3U9UB 3GI8L 1OD7A 4NJAH 5CBEB 1BZ7A 1AIFA 2PTVA 3D0LA 1T80A 2VLKE 1A7QH 2JJTC 2X1PA 5DFTA 3F8UB 4MYWB 1N0XH 3PDOB 3U7YL 3JTTA 3LB6D 3RKDD 3ME0A 5F6HJ 1MWAA 4XCCH 5MENA 2VWEC 4K3DL 2YPVL 1V7NL 4HWEH 5DC4B 4UT9L 1OP3H 3GRWH 4ZUTB 3KPOB 5HVWA 1SM3H 2FECL 4MSWA 1KIUA 4X0KA 1CFBA 1FBIL 4QNPF 3NPSC 2AERT 4AZ8A 2ZG2A 2ESVD 1C12B 1RMFH 5TE7H 4KI5F 5BV7L 5D7LA 3GRWL 4BQBA 4R3SB 4N5EC 4XPFH 2WUCL 4LP4A 4LASL 2HKFH 4GAJH 5IHBA 3QI9A 2GUOB 3KS0J 4XVSH 2E6QA 5T3ZH 1CL7H 4Q6YA 3C60D 4YHML 3SE8L 3NACL 4JM2D 4MX7B 2CGRH 4KC3B 3SDCC 4DQOL 1T2QL 1KIPA 4OUUA 3SQOL 1RJLA 4L4TB 4NO2A 2HP4A 1PKQE 4JFPA 1HQRA 4TOYL 3VFVA 1WT5A 3UYPA 3RPIA 5SWSD 3OBAA 3WIFA 1IAIM 3FT2A 4Z7NE 4ZS6C 5C0RH 3EOTH 1F3RB 1H3UA 3BZFA 4G8GB 4JG0L 4UIKH 2QV2A 3BKCH 3O4OC 5M95B 2VLRA 4PTTA 1NEUA 2VXSH 5JXEC 4PPTA 5BVPL 1TCRB 1RIHH 3HRZA 5JIKA 1U8KA 1IM9B 3IKCB 4PJ7A 1RIVL 4XNMA 1OM3L 5L2KB 5DTFB 1KYOJ 5FA3A 5B38A 5HGHB 3TFKD 5C6TL 2NY6D 3PNWB 2EO1A 4PV9B 4U1NA 5KANI 3IU3B 2ED9A 4DCQA 3GUTB 1JV5A 5I1AA 3KPNB 4L1HA 3MOAH 2NR6C 4BUGA 4ZUUB 4ZYKB 1DLHA 4HKJA 2R1XB 2DQCL 1PLGL 2X2YA 4LGSB 4EOWL 4OGYH 4ZTOL 3OQ3B 3U4AA 3CFCL 3LKPB 3BH8A 1WFNA 5IMMB 1FVDA 1QA9B 3RY4A 3K46A 4PJBE 3MQIA 4LHUG 3PHQB 2EDKA 2YKLH 5I15L 2J7LA 5DDHA 1W0VB 4JPVH 1RK1A 1TCMA 4Z7VA 2X89A 3T0DA 3E6FA 4AG4L 1L7IL 3BXNB 4UIMB 4OZGB 4UTBL 4NKQB 3F7VA 1OAQH 3MBED 3RTQB 1LQSR 2P46B 4KKCD 3EUUA 4FTVA 2SEBB 5E8OB 3OXRA 4YFEA 3QH3A 5E2VH 2A1WL 1C5CH 4ELKA 4D9QE 5GIRA 1FYTD 2DICA 1YPZF 3LRHA 2MKWA 2BY0A 2R0WH 1J0ZA 1OY3B 2PW2A 4NZTH 3S3PA 3TV3L 2UWEB 1JHKH 1A7NL 2HLFD 2FJHB 4CDGC 3TJEH 3NZHL 5EORL 2G9HA 3RWIB 1JNLH 1IKNC 2GCYB 3F6IA 5CLWA 1F3DJ 1LMKA 4UINL 4IIQA 3FO2A 3LQZB 4YQXL 1I7UA 3FQTA 2A77H 3I2CH 4L8CB 2N7AA 1OWWA 5GS0C 1CDCA 4S0SD 5HYSG 5IQ9A 4Z76B 4LPCA 4LRNH 4O2FA 3HPLA 4XCYB 4CGTA 4ZTPH 2VC2H 2ZCKL 5D1ZC 3WKNA 5IT2L 3BEWA 5JO5A 1G7HA 5HGAB 1V8HA 4MDJB 4MXWH 3O6MH 4HJ0D 9CGTA 3KPLB 2V7HB 3TIDA 2I9TA 5DEZA 3UPRA 1GGBH 5HPMA 5HHOE 5EZIL 5FYLL 2WLYA 3X12A 3TN0B 4OZIA 5F88A 3VXMD 8CGTA 4PJHA 4PGEA 5I1EH 2EXYC 2GAZA 4I8DA 1HHGB 3VGEA 4PLNC 2NY0B 4HZAA 3KLAB 1MIEH 1H8SA 4LCWE 3UX9B 2DKSA 3ARFA 1KB5A 2CDFB 5HHMB 3GHBL 4YHNB 5CJ8A 1RIUL 4OZFB 4TNVF 3KLHD 3HZKB 3L5IA 3GSNL 4ODWB 1NUNB 4WV1A 2YA2A 1HSAB 3U7AA 1LEGA 1KTLA 4WTZG 3ULUH 5L7XL 2E9WA 1BOGA 2ATPA 3G5YA 1YA5A 2HVJA 5DD0L 4QXUH 2D0FA 2X9XA 3UTTE 1CD1B 5LWYH 2A0LC 5IEKA 1G0DA 3W0WD 1G7JA 4PJIA 3W9DA 4MQXD 1GGCH 2A9ML 3CXDL 2QQKH 4OCXH 3QNXA 4OFPA 3FB5B 4GH7B 4O4YH 2CKBL 1WIUA 1NUFA 5EC2A 3GSUA 2YD7A 4ZQKB 4UAOC 5IHUL 3KYOB 5EU7C 5GGUB 3TNNB 5AG8A 1INEL 5DVNA 5F7YC 2EXYD 1QYGH 1JPGB 2KL6A 4OKVA 3HNTL 4R8WH 3WIHL 4HXAL 5CJ5A 4OZIB 3ARBD 2J2ZA 4CU8A 3B9KA 3DX6B 3NTCH 4NGHH 4JLRA 3MV8D 3LKRA 1S7UA 3OKOA 5HYJD 3V8OA 1G7IA 43C9A 1DP0A 3C6LC 3MACL 3TGXA 5I1AB 4KROB 3KLAA 2XKUA 4LHUD 4I3GA 3NH7H 3QPXH 1BAFH 3LQAL 4X9GA 4N0FA 2DQTL 2CLZB 5T1LB 2DBLH 3QXTA 2EH7H 2BHYA 5C0AD 4Z0XA 3AGVA 3AXLB 4M43H 4ONFH 1DBJL 2ATPB 3TCLA 3ZHLA 4JO3H 4YDLB 2DLTA 3G6JB 5I1KH 4PJIF 4LARH 3FMGH 5DJYA 1WBZB 4KZDL 4RMTA 4OGAC 2ESVA 3MROB 4YK4B 4MJ5B 4YC2B 4NC1C 5FEBA 4ZFZB 2VL5A 1HKLL 4HEPG 2GTZB 4XCFL 4G7YH 4M6OH 2Z35B 2Z92A 5BO1H 2D7TL 2GK0A 5ALCH 4G3YL 4W70A 2KKQA 1B6UA 2VDPH 1NGYA 3S96B 1NC4A 1LDPH 4L29A 2VR9A 1H3WM 3SKOB 4YWGL 2DJ4A 1OTSD 3WS6C 3RZCB 4H1LG 2CUMA 1A21A 4N0RA 1QVOB 3ZLQC 1S7TA 4H88H 4EVNB 3QWRD 3LKNB 4N0YL 4L8SB 4NKIL 5DMYA 1G7IB 3D6GA 4NFCA 1YEJH 2DQGL 1DZBA 3G08B 5TGBB 3B5GA 1QOKA 4ACPA 4LBEB 1DUYA 5E2UH 4X4MA 1T21A 5F7EL 3BQUB 1OGTB 2VLJB 3KLDA 2IQ9L 4BSJA 1J1OL 3NH7L 2X4QA 3Q6GL 4TULH 1JK8B 2HT4C 1I9RL 4XBEL 3C6LD 1FSKC 2EYSB 5DT1H 5FYKL 5HSFA 3UMTA 3BP6B 2EDLA 1I7TB 1U58A 4GRLC 1R3LB 1YMME 1YN6A 1I85C 2B5IC 2BVEA 4OF0A 4PLKD 2NW3A 4OLXL 1A6VL 4EDXB 3S34H 1QBLH 4NUJA 4FQ1H 4U6XB 3P4NB 4WU5A 3LN5A 3MROA 2ESVB 2R56L 2DQDL 4CADB 1UC6A 2FLRT 4X6EB 3WEXB 1T6WA 4NQVA 2APXA 5GQBA 4KMQA 4Y19E 3KNBA 4BFGA 1B4JL 3QFJD 2CPCA 4I9WD 4R90H 1A3RH 1ITCA 2FX7L 5DUBB 1UENA 3HC4L 1Z9OA 3M8OL 1MRFL 2O61B 1G1CA 4WIQA 1HDMB 1T5XB 4MJID 4QHLA 3WNMA 4FQIH 4Y2DB 2B20A 1YY8B 1MRDH 3VXPB 1MPAH 2R0LL 1KIRB 3PP3H 1Z9LA 5DS8A 3VWKC 3PWPE 5IEHA 2BOCA 4IRJC 3Q5YA 3JV4B 3O9WD 3C09C 1FL6A 3CU1A 1OSZB 1FGVL 1HCFX 2IANA 4WTZA 2I24N 2XN9B 4J3UA 4RISL 1AXSB 1FVEB 1QG3A 2DYPA 2VE6B 5C9JA 3WNNA 1H3TA 2BNQE 3FQWA 1GGIL 2GJJA 3JV5A 2YXFA 4KZEH 4RIRB 1AHWC 1H3PL 1ZLSL 1WITA 4HK0A 1WF5A 1NLBH 4PJ9B 1AD0A 4OIAA 4Y5XA 4ZUVB 1WUNT 2ZSWB 5GZOC 1XAUA 1A4KB 3FN9A 4YBLB 2B2XH 3EYSL 4HWZB 4LLDB 3WUWA 1VENA 3RZWA 5HD8D 4LHUB 3D3VB 4NQED 1CFSB 2PR4H 2BNRB 2X4PB 1D9KB 3CZFA 3NA4A 5HI3D 2BSRA 4XB8A 4UV4L 4N8PA 5D5MF 2JIXD 3WFZA 1J5OH 1DQJB 4FXKA 2IPUG 2PYEB 4U6YA 4JN2A 1YY8A 1W0YT 3B9VA 2YD4A 1C7SA 3IFLH 2OL3A 4LLQB 4TVPE 3VD3A 3QEHA 2AEQL 3VD5A 1YECH 1P7KA 5JTWA 4U6HB 1Y0LA 2GJ6D 3QAZC 3QIBD 2DQHL 3VXRA 3VFOB 1FNEA 3SDCA 5LAXB 5A16A 4YXHH 4HEME 5ISZE 1EPFA 3KPSD 2XACC 1IBGL 1MCWW 4X7FC 2E5EA 1JGEB 1J8HA 1OAXH 5ICZB 3KPQB 5KG9A 1F00I 4MAYC 3G5VB 4BFIA 4IDLA 3V0WL 3BZ4B 3MRJB 1MWAB 4U1IA 3B9DA 4LSTL 3VXOB 1A6WH 1LO5A 3MLSL 5BS0B 4MA3B 5D9SA 1M6OB 1UWXK 3FQUA 4HBCH 4JPVL 4U1GB 1F3JB 3HNSL 1CF8L 4S1RL 4JM4L 3LRSA 2ITDB 4F7PA 4RNRB 3VXQB 4EUPA 1K3IA 2CRZA 3GSOB 3UTQB 2VXQL 5HI5D 1ORQB 3GB7B 5FUOH 1J0JA 1O7VA 5DA0B 3ZTNL 1F4WL 1UACH 5HYFA 2DQCH 4NQDA 1H3XA 4NM4L 2ORBH 4FQQB 4FQ2L 5CHNA 3CAFA 4A6YH 2FR4A 1MUJB 1P4BH 5CZVH 1CXEA 2CK2A 4KDWA 5DQJA 1ZHNB 4OQTL 4WO4A 5D2NC 1BVKA 3VD9A 1G9EA 3OPZL 4X80H 4KI5E 4QHNA 5C0IB 3OKLB 5HI3C 4L5FL 4GW1A 4MA8L 3TJEL 3MLZH 5FDWB 2EZ0D 3K7UA 1Q38A 2MTPA 2UY7A 2CO7B 1A2YA 1WZLA 3G5ZA 4X99B 2N7BA 4ZDHB 4MNHA 4W68A 2P43B 4BFEA 4XPBL 5DR5L 4RBPH 1OCWL 3RWDB 2BY2A 3KNBB 1U8QB 3VXNB 2AK1H 1OGAD 4X8JB 2W60B 2Y9RT 3FB7A 4PRHE 1A47A 2F54B 3RJDA 1U8PB 1KCUL 1W0WA 3DURB 1H0DB 3VRIA 2EDHA 4AG4H 3QZWB 5GZND 2APVA 3U36A 3HNVH 4Y16C 1AO7A 1P9MA 4N1CA 1CL7L 2LE9A 3Q6GH 1IEAB 3U7WL 4HPYL 5AWNL 1PYWA 5CWSB 1EXUB 2EDDA 5B8CB 4NWUH 3RKDC 3MRPB 2EIBA 3CU7A 3GSOA 1YEDB 5DJCA 1ORSA 1EA9C 4H88L 2MCPL 4G42A 4HIHB 4LVNC 3ARBB 1BBDL 3KYMB 1L6ZA 1JL8A 4GAGH 3FFDA 4WHYG 3KVQA 2AABL 4HWEL 1V7NH 3G6JE 4LDOB 4UIMA 4NPYA 5F1NA 1HEZB 4PJDA 4NCC1 1IAKA 3GSQB 1OM3H 4TQEH 3QIUB 5DJAB 5MEQB 3WIIH 5BVPH 4K7PH 5I71C 5C86A 2YD5A 4UDTA 1DBAH 2EO9A 2PXYD 1CE1H 3HE6B 1NBQA 1ZOXA 4X4ZA 2YD2A 2ZOKB 1KCUH 5DEFA 2CRYA 2VXTH 3O0RH 3HMWH 2WINA 1QO3A 3WNPA 4N1HB 1FV1B 3ARFC 5BZDB 2DIBA 1PSKL 4JZOA 4XP1H 4EI5A 3DV6A 4GUPB 3V0VA 1YEHL 3PHSA 2MQ0A 4HKZA 5FA4B 2X41A 2ZUTA 4OLUL 3O6KL 4TQEL 4L5FH 5MI0C 3KLHC 1EMTH 3RVXD 3AAZA 3P77A 3PGCA 1FNSL 4OM1H 4A2LA 3VD4A 2R2HA 2F53D 4PD4K 3K2UL 3FN0H 3NFNA 4FFZL 4UOW1 1K3ZA 1H15A 3WSQL 1ZSDA 4PRIB 3SDAC 1VGEL 4M1CC 4UAOB 3TT3H 3UTPE 5I2IA 5DC0A 2HT3D 1GRWA 2WW8A 3V6OE 5CD3B 5HDQL 5BRZB 4PP1D 4QOKD 3TNMA 1PBYA 1U9KA 2PUQT 5F6IB 4RGOH 5IJVA 3O6FC 5IBLD 1II4E 4HPYH 1DE4B 2NNAB 3TH3T 1NC4D 4K7PY 5F3BB 2ERJC 2Z8RA 4F3FB 2VSDA 3AU1B 1I7ZB 3MODL 1KPUA 2ZUSA 3O2DA 2BY3A 1NCTA 4XPAH 1IAIH 1N0XL 2NX5B 4IMLB 3LD8C 2VH5H 3C9NA 2VL4A 3P4MA 1B90A 1A7QL 3VFTA 1K8DA 5ICYA 1QSED 4O4YL 4QHKJ 4LSTH 5KS9B 3RQ3A 5A1AA 4N0CC 1C12A 1QFWH 3NGBC 4L3EB 3RUGF 1S7RA 4POYA 3F7QA 3EOYG 5EIQA 1QLRB 3L3DA 4HQQL 1CICB 4JFQA 4P57B 5E2TL 4JFXB 4JRXD 1UEMA 5KAQG 2P24A 1MHPH 4HH9A 5JHDA 4I3SH 1UB5A 1AXTH 1EHXA 1F42A 2MHAB 5KSBA 1XGQB 2IG2H 1ZGLB 5JNYA 3U46B 3BSZL 4X5XB 5GGVY 1UZ6F 4U2YA 3FT4A 4NRZA 5E2WH 1HXYA 3T08A 3WS3A 5E08L 2IPKB 4K3GA 4Y89A 3RRQA 1PG7L 4UV4H 4OV5B 3K3QA 4NO0D 5I1EL 3UAJD 1CN4A 1T83A 3MCKA 4PTTB 4K7FB 4LNRA 5FUOL 1WQVT 2C4FU 1PAMA 3UTTD 4GW4A 4HXBL 4BZYA 1G7PB 3O6FB 4PTUA 4Y5YA 4OZGF 1WZ1L 2B4CH 1GPOL 2GAZB 1QFOA 1MFEL 4PRBA 4C56E 3IFPA 1CXFA 5CGYC 5M94B 4PFEA 2YN3A 1P6FA 4NOBA 3JZ7A 4YDIL 5EOCL 4AMKL 3B5TA 3ZE2F 4N0FB 1A1OB 4Z95L 3ZKSD 2H8PB 5C0EA 4S1DC 3UC0H 5C7XH 2J88L 1MI5B 3M1BB 5IMKA 3BZEA 5DD6A 5IV2A 4P59H 4I48B 5JQ6L 5KS9F 5KVDH 3MLRH 2VQ1A 4AIZB 1OSPH 3AROA 2W65A 4OZ4A 4J12A 3PGFH 5HYJB 4M7KL 5F89A 3D18B 2J8UB 3EO0B 5T1KD 4E41A 2NX5D 3ZT6A 4GLRH 5IFAH 5L2KA 3CLFH 5C08D 1BJ1H 3MFGB 1ZGLA 5F1NB 3DNKA 4N90D 2BSSA 3EYVA 3SO3B 4Z7VE 4ZUSA 4LCUA 4XPGL 5KJRH 2YMXH 4KROC 1YMHB 4GBXB 4DW2L 1X4YA 4KQ4L 2D7NA 1XGRB 2F53B 4Z7WA 3DRQB 3GSVB 1VCAA 5GIRB 3RHWK 2EXWC 1N5YH 2V7NB 3MJGX 1SEBB 3FO0H 3B2VH 1KCRH 1EAPB 1LVEA 3GBNH 1MJJA 2HVJB 5F44A 3IAPA 2YUXA 3WNKA 1FJ1B 1Q9OA 1LK2A 4XPHL 1RK1B 4ZO7A 1OTTC 1DL7L 3LEYH 1KEMH 2HG5A 2HJLA 3BWUC 3CX5K 3MLVL 1MJ7H 2LV4A 5ESQA 2IFFH 3EGSA 2CLZA 5DFVC 4J8RB 4JR9H 3STLA 4A6YA 3O81A 4KZEL 1OARH 2HTKD 1D3CA 3BYYA 1C08B 4X4YA 4NT6B 2OS7A 4DKDC 2IPUK 1UZ8A 2MMXA 4HJ0C 1QLFB 1R3IL 4OCLC 4M6NL 1P6AB 4QRRD 3O3DA 1QHOA 4PG2C 4Y88A 1A7BA 4XXCC 4LLAA 2OQJA 1B9ZA 2D7PA 3DUSB 2CRMA 1FZMA 4ISVA 2ICEA 4HK3N 4LKXA 3TWCL 2VISA 4NZUH 3V4PL 4HPOL 4OF8A 4JRYA 3GMRB 4XCNB 5GGTH 3JWDH 3O41A 4LU5L 5J4MA 3UTZA 3VFPA 3QHFL 1N6VA 2GI7A 4QXTA 2HJKA 2N1KA 2XA8H 3BJLA 3F5WB 3H8NA 3BD4A 4NSKA 4NQDD 2COQA 5GS3A 1DN2A 3WHXA 3CUPA 1C5DA 3ZYOA 1NPUA 4HKBB 2DRUA 2E27H 4JRWA 2Z93A 3RWEA 4ZO6A 4LP5A 4EDWL 4KKLD 3NIFF 5CINL 2BOCB 2HH0H 2AJZA 4JO4L 3T0ED 5DMKB 4OCYH 5DO2D 3S4SA 4TUKL 5IGXH 1ZE3C 2P8LB 2ORBL 5EG6C 1ZA3B 2DWEA 1X3DA 4ELMF 1LO2H 5HY9A 3IDIB 3TZVD 1FVEA 3BPLC 3FFCA 5J3HD 3KHOA 1OT2A 3QISA 1OGAB 1EFXB 5K9QI 1K8IB 5FDYA 3REVA 1FVCA 1QFPA 1IC5H 1V3LA 3QFDB 5A2IH 3CSPA 5IG7A 3LEXA 5F7EH 2NY4B 2GSIB 5GGQL 2G75A 4M48L 2P44B 4XMLL 1FL3B 1XCTA 1KF9B 3GMOB 5E24E 5HDOA 4PJ8C 3U4BL 1UJ3C 3ZDXF 1CD1A 1DBML 3VH8G 1NGPL 2VDQH 2WIMA 2DJSA 3IFPB 1KEML 1QRND 2BVYA 3KWWB 4HV8B 4BFBD 2HFTA 1BMGA 3LMJH 2IANE 2NR6D 5JW4R 3GIVA 1BM3H 3MRNB 5MEPB 4D0CB 4ZOCA 1PZ5A 3VH8B 4FQXD 4OD3L 3UTZB 4ZFFB 4I0CC 4L4TA 5DUML 4PIRF 1BQHB 3ALXA 3V5DB 1Q1JH 3GMQA 1ULVA 5I73B 1PKQB 3QBTB 4HJGB 1FIEA 3H3KA 4EI6A 3HE7C 1HH6A 4DZ8A 1WTGT 1ZANL 5JPMB 3LHPH 4JAMB 4HJJH 1Q9LA 2A9MH 3HG1E 1JFQL 4P46C 4XNUH 5FHAH 4L8DA 5DK0B 2YUZA 5FOBB 4J3WA 5ID1A 3M07A 3C8KB 1U3HC 3UJTH 3PWVB 4XI5D 5IBUG 3EOBB 3NGBB 3OJMB 5FB8A 1EFXA 3LY6A 2CLRB 1FVCB 2DBLL 4X6FB 3A67H 1CF8H 1X5JA 4WHTA 3O2WH 3VXUA 2EDRA 4ZMAT 1XF5B 3MJ8B 3C5ZD 2XY2A 1EV2E 1QTYT 3H7BB 1MIEL 2D4DA 3CDFA 4MAYB 5T5FH 1TTUA 2GK2A 5FM8A 5B4MD 4NJ9H 2VR4A 4G9DA 4Q9CA 4JHZA 2Z91B 1NKOA 1CGSL 2G60H 4JO1L 1INQA 1QNZL 4R4FH 2VDOL 3QDJB 4P23D 5F96H 4ODXA 5TQ2L 1PEZA 2X4UB 2YWYA 4JFHD 1KNOA 1T2XA 2VE6A 4LL9A 5D1ZB 3RTQA 1LO0H 1XR9B 4L3AA 3CC5A 3OXRB 2A6IB 1EEYA 4DGYL 4R4BA 4JGUA 2AJ3B 3N85H 2D4FA 4O2EB 1E27B 4TPRL 2IQAB 3BGMB 1NKRA 3E3QC 3DV4B 2PW2B 4ONHA 1CQKA 1CL7I 4QXGH 1XF4A 4OB5L 4TRPH 1OQOA 3ULVF 3MGOA 2OQJB 3LHPL 4H8WH 1FZJA 3S35L 1F58H 2WNGA 3GMPA 5MERA 3N1FC 4JLRB 3D0LB 3I75A 5F9AC 5EORH 4M7LH 3UROR 3ZDXE 3GSRA 1YEEH 4HK3J 1V5JA 4AIOA 4Y19A 1E4XH 3BQUA 5F21B 1PY4A 5TQ2H 3QQ4B 5DVMA 4O2FB 3L1OH 4IOSD 5DRNA 4NO5A 1A7RL 3BPNC 4FQ1L 5LG1A 2DB8A 3MJ7B 1JNNH 1KBGH 2RQ8A 3D25A 4X5WB 4P5MA 3MLTA 4MNQE 1E4KC 1H5BA 1CLYH 1DBMH 3QWRA 3X14A 5J56B 4L4VD 3BKJL 1CT8A 5L0QC 4OGZA 1EK3A 2BHUA 3CXHK 2GQHA 2HWZL 1A3LH 3DETD 1IQWH 3L3HA 4PBWD 2YC1B 1CDJA 4OQ1A 3BMWA 3O6FD 2D0HA 4XXDB 5E9DA 1OTTD 3PXHA 2JJTA 2Z92B 3PDOA 2D2OA 2P5ED 1XGTB 5D71H 1PD6A 2WWKT 3VGBA 4M62H 4U1IB 3KYAA 1PLGH 3S4SG 5CSGA 4KQ3H 1AO7E 2Y23A 5A2LH 3CDGA 4H25B 1TPXB 1JFQH 5E1AA 2OL3L 4M8QA 5ADOH 3FT2B 5DD1H 5E9DD 1BVLB 4TYUA 1XIWB 4PG9A 4KKBC 1ZANH 2FX7H 2Y1VA 2AJUL 2DMCA 2F5AL 3AB0C 2FO4B 4RDQF 1MRCH 3MREB 1YEHH 4ORGA 2XKNB 3KG5A 3TYFB 1CZ8H 4PJXA 5C0AA 1JPSH 2Q8BH 1RUKH 4D9LH 2B5IB 4ELMA 2NY5C 2XWJA 3BP4B 2DQDH 2VLJD 3QQ3A 5IVXF 1MIMH 5HHPB 1JGUL 3ULSA 3TO2B 3GMQB 1B0WA 5H37G 1LWRA 4LARL 3GFUA 3QDAA 4NN6B 4Z0BL 2WBKA 4ZUUA 3TNNA 4MB5A 4CVXB 5SWZA 3IXTB 2OR9H 5C0JA 5FGBA 3JV6B 1AJ7L 5C09D 4Z76A 3OKLA 4G6KL 3QUXB 1CE1L 5FYKU 1S7WB 1NC2B 3LV3A 4JCMA 1FHGA 1KCVL 1ZA6A 3IRZA 5GGQH 1BX2A 4R2GC 4XC1H 2VB5A 3MBEB 2YC1A 4PGJA 4XVJL 4POZC 1FL5A 3GMNB 1K9TA 2BY1A 2VERN 3T0EC 3GI9L 2G2RB 1CFSA 5K9KB 4GMTH 3TBVB 4X6CB 3I85A 3W2DL 1CLZL 3CFCH 1XF2B 4G6AD 1QFUH 1NCWL 1C7TA 4JGMA 4Z77B 1UWGL 5EBLA 4YGVA 4OLZL 1QLEH 3BJ91 3QCUL 3WIHH 2XOTA 1J9CT 3QDMA 3QUMB 4EJ1C 5LKNA 4U05A 4GKNB 2VDRH 4UNUA 5LGKA 4JDVA 1R6VA 3JWDC 3NABL 5L8KB 4QRQA 5F93C 5D2LE 1P7KB 1HSAA 3EYUH 3PQYB 1WCBB 5TFSH 1A4JB 4QNPE 4FQJH 5EZJA 3LIZH 5SX5K 1ZWIB 1OSZA 4J7RA 4GXUN 1RHHB 3PHQA 3QG7L 4PJGE 4RX4A 2ZJSH 5HHPA 3EFDH 4YXKL 2P8MB 3SOBL 4ODTH 5DI8B 2R29H 1DFBL 5E2JA 2Y4SA 5IR1A 3O4LA 2APBA 3HLAA 3Q3GA 3LOWA 1YNLH 1CFNB 1FO0H 1HNGA 3ARDA 3IDXH 2PXYB 2DMBA 4H1LH 3O9WA 1DBJH 5L8LB 2OTWA 1YEIL 1BQLH 1TJHL 3ZE2E 3C60C 4WWKC 3ARGA 3U4EA 2B1HH 3LH2L 3CFEA 3I9GH 4KVCL 1IILE 1JWSA 4OZGE 2VLLB 2G2RA 5K9KA 3WJJC 2VLKD 4GRMB 2HT4D 3HRZB 4KDVA 3U2SA 4GKSB 3QRFM 4UQ3B 2VJXA 1R3KA 3MRCA 3SDYL 5EBLB 3ZTNH 3HI5H 4IIQB 5KSBE 4N9GA 4KHTL 4WEBH 3RGVB 5FO9B 4CN1A 3I6LE 3L1OL 1AGFB 5KOMC 3W0WB 1RJLB 3G6DL 1GPOH 1VKXA 1ACYH 1BZ9A 1GOFA 4D94A 3L3JA 4XWOC 2QQQA 2VZSA 4XP6H 5GRJH 4EBQL 1X5LA 2NXYB 4KTDL 4HBCL 4LLYB 5DJXB 1U8HA 4H26A 1ZLUH 2XWTA 5E5RB 3L3DB 1ZEAL 4FZEH 1FH5H 4DEPC 4RDQG 4JFQB 5B39B 1A6WL 3X3GH 3MFFA 1KLGA 1NLDH 4XAWL 2B4CC 1GJIA 4B53A 2XNAA 5CP7B 2Q8AL 2FEDD 2DD8H 1XH3A 1IBGH 2J8UF 2OTPA 3HLAB 4AEIH 5FKAB 3LS4L 5DRZA 3ALWA 4BZ1H 3ZL4L 5FCUH 4NDMB 1DBBH 4DGYH 1G9MC 1E6OH 1E6JH 3WV0A 1FFRA 3PQYD 4ZYKA 4YR6A 3ZL4H 3TN0C 1BIIB 3VXTB 4RQQA 3TA3C 3Q0HA 2CQVA 3MRKB 3UYRL 2FECI 3EOAA 2VYRE 4ZNEA 2G5RA 1L0XA 3G9AB 4WV1B 5BXFB 3UJIL 4W6XB 4Q74A 1G7QA 4KVNH 4XAWH 2O93L 3L7FB 2LU3A 2Y72A 3MGTA 4P48A 3SDCD 1A6UH 1OW0A 4YH6A 1JE6A 1I1AC 5JR1L 2VABA 2O5YH 1AGEA 4WI6A 4FQCL 3WD5L 4HKXB 1NCNA 3H42L 3UBXI 3JV0A 1RFDH 3NFPA 4N0UE 1S9YA 5GSRA 1RZJL 4RAVB 4DN3H 3IDMB 2DI7A 4YIQB 2P5WA 4JM2A 2VZTA 4UDTB 5DQ9A 4HIIA 1BX2B 4ZTOH 5F7DA 4POZD 3TYGL 1T4KB 5E8NA 1IGJB 3H9YA 3N1PC 1JNJA 1OAYH 4LMQI 3D0VB 4YQXH 5DVLA 5CMAB 1BZQK 2FIKB 5CP7A 5F88B 2Q3ZA 3WDIA 4NQCE 4X98B 4DCQB 5TDPA 4OLUH 3C60A 5BCAA 5D7JC 3L7EB 3ARSA 4LSVL 2ITCA 4UDUB 3T4AA 2CIKA 4HKJB 2PTUA 5BZWA 3EDFA 4NP4L 1K6QH 1TZIB 4AEFA 1C5CL 3SOBH 1A6ZB 2Z4QB 2R4SL 3PQYA 2RCSL 3BKYH 3QEQA 1KTRL 2X4TB 3TCLB 1ES0A 3HZVB 4ONGL 1U91B 2OMBA 5EOQL 1H3VA 5IQ7H 3D2UD 1RK0B 1NGQL 4ODVH 4D8PA 1S7VA 4PJIB 4O51A 4KUZL 4ODUB 4HH9B 5JHDB 3JV4A 2OTUB 1GAFL 1BWWA 4P46B 4GS7C 4I0PA 4PLKC 43CAB 1MCPL 5BS0A 5I1CL 4M03A 3VI3F 5F9JB 4G9FB 4RFOL 5BV7H 3U0PA 1NAKL 1F6AA 3QO1B 1I9IL 4UV7H 2AXFA 3LKOB 1FG2A 1VA9A 2EE6A 2QEJA 2XTJD 3FONB 4YC2C 2A6JB 1DDHB 4PGDA 1QLFA 3CFEB 3MUGA 5BV7B 4JQXC 2UWEA 2EKSA 3KJ6L 2MCG1 5I76A 5SWSB 2E6PA 3IJSB 2EH8L 5GXBB 4C59B 4MHHG 5CGMA 1TFHA 3K0WA 3QP3A 4NN5B 3PIQA 2UZYB 2EDYA 5IFHH 4P5TD 1XT5A 4U1HB 5ISZD 5D7LD 2R1WA 3VFUB 2R2EB 5FO9A 3RGVA 5JW5B 3OJDB 1VFAA 4HAGA 4LOUC 2X4OA 4TVPD 5EU3B 3T0EB 2QL1A 4O5LH 3MRLB 4JFYA 4U6TA 2F53E 4PRID 4XHQA 5IB2A 3MA9H 2HT2C 3BDYL 4QHLB 1C5BL 1OF2B 2PYFB 4BH7A 3P11H 3QG7H 4G8GA 1BJ8A 1RJCA 2NY7L 5ADPL 1LE5A 1XGYH 4EDXA 4RFNC 1M7IA 3EO0A 2B8OT 4NHCH 4QGYA 1J12A 3UTTA 1MRCL 3QFJE 1J0KA 1UH2A 1NL0L 3DPBA 4A2MA 5JQHC 4WTXA 1JGLH 4NNXA 4XPFL 1AR1D 3HN3A 4EZMA 4JJHA 1JV5B 3SGKA 2APTA 4HUUB 5MHSE 5AAMA 4KI1A 4NNYB 1FE8H 2DS4A 3VE0B 1QLEL 5IG7B 5EO0A 5JPNB 2BVQB 5EU6B 2OLDA 4P9HC 1HZHH 2CLVB 4QRPD 1CTOA 2BNUA 3G6JF 1BQHG 2DQTH 4ORZC 1S7TB 4EVNA 1TJIL 5D7LE 1OGAE 1FIGH 4WU7B 1A3LL 4P4KD 2J8UA 2DLIA 2O5YL 3B2VL 4U1GC 2R2EA 5JW5A 1MFDL 1HXMA 2J3SA 4NBZB 4ZS7L 4IRJA 1CLYL 2BMKA 4ONGH 1UWXH 5DJAA 4NJAL 1HXYB 1NBYA 1PKQA 4MLSA 3PXJA 3DRTA 4EI6B 1QRNA 1UADC 3VFWB 2IQAA 4OLEA 1KB9J 4HWBA 1R3LA 4DJMA 3P4OB 4H0HB 1OTUD 4KXZH 3SE9H 1TPXC 2IMMA 4MA7H 1IM9D 5IP4A 2NY0D 2X09A 4QHUB 3I02A 4YNYB 1DQLL 3DUSA 4N0UA 4Y5YB 4KU1A 2X4SA 2CMRL 4PJCB 4WJ5A 4ESKA 1GGCL 2FEDC 4MNQA 4YXLH 3I6GA 1AKJD 3DO7B 4P4RB 4QHKI 3UTSD 1PZ5B 3VH8A 3CVIH 5H35B 4QXUL 3KS0H 1VESA 4FFWD 4MA3A 2KPNA 3EIFA 1MCJA 3KJ4C 4LAQL 3D25B 1RJYB 4QRTA 1RZJH 3QUKB 3PABB 1S9XB 2VQ1B 4EKXA 1MFEH 5IMLB 1H8OA 3JTSB 1I3GH 1JUFB 4YO0A 1D6VL 5JPMA 2QQNL 4E42A 3ROLB 3BPNB 1NCCH 2Z8VC 1KIQB 3CFBA 4K8RL 4LSUL 4UQ2A 1T7YA 3QDGD 1IEHA 3Q6FA 4ZFZA 5D4QA 5F3BA 1UH3A 2BX5A 3FB8B 1QZ1A 1GCFA 1BQSA 2QR0A 2DQFA 1VHPA 3OG6B 4G9FA 3DBXA 5GS2H 4ZFOB 3SGEI 1HEZA 1XGRA 4JPKH 1KJMB 1GC1H 3IAGC 4ZUTA 3NCJL 3AXLA 4IS6B 5KSUB 2FRGP 3U1SH 1BFOA 3MLUH 1DBBL 5GGVL 5A40E 4IOFD 4ODHL 3WHXB 3RWJB 2X4SB 4JKPH 2YD1A 4QOKA 2H9GB 3V52L 2Y6SC 5F71A 4HUVB 3CCHB 4QGTA 3KWWA 4JQVA 1DFBH 3MLPA 2CIIB 2ZUWA 4W4OC 2R1WB 5GJTL 5I1HH 3HZMA 2BOBA 4MS8D 2FHBA 5JORA 5CIPH 3M8OH 1XGQA 3DO3A 1M7DB 2HRLA 4J1UA 5IFJB 2R2BB 3TZVA 1JNLL 1Y18B 3QQ4A 2PW1B 3ULSB 2MKLC 1JK8A 4LLUB 4X4YB 2C3GA 1LILA 3EAKA 3O2VL 3AAZB 3P77B 4MD5A 3FRUA 3QZWG 2N56A 4F37K 4Q6IB 1L4IA 3JTSA 1RVFL 2C3VB 2QTEA 4LSDA 2D7OA 2B2XL 3EYSH 3O3DB 1ZLVH 1VERA 3MGOB 3S34L 3EJYD 5DZNA 1QVOA 5LAXA 1ED3A 1P5VA 4PY7B 4AEHH 4IHOA 1FCCA 2D9QB 3QB7C 1ZAGA 3FO9A 2GT9A 5DA4A 3HUJA 1BREA 2DMKA 2MFNA 1B88A 1G9NL 1I9RH 3IETB 1FFPB 2X4PA 4UI2A 5DJDA 2Y36H 1F97A 3D2UA 4ZODA 4YBQC 2BSED 4XVJH 3RX5A 3VXSA 5EU6A 3FTGA 2FYYA 2HJKB 2RJMA 3P30L 4D3CL 5D1XC 5HXMA 1UVQB 3WJJA 2VKXA 1VACB 3PV7A 3KXFA 4DUVA 4F58L 1J7VR 5CEYB 3DX9A 2QBWA 4Q6IC 1JF5A 5CWSA 3RVXC 3UXFA 2C1OA 2BC4B 4G8IB 3ZDZF 4E41B 3CLEL 2JJVA 4HJJL 1ACZA 4G8FB 2E27L 4WGVB 4R2GB 2FHFA 4GSDL 4PJIE 4YUEH 4Q9RL 4U1LA 4WEMB 2WWMC 2BMKB 1MAJA 3EYVB 4L1DA 2V2WB 5SWQB 2CLRA 5BO1L 5ABDE 4PJCF 3DRTB 1UJ3B 3BKCL 1Q9KB 4OZGA 1UYWL 4K7PX 5B21A 2VDRL 2J4WL 1C5BH 4GXVH 1BD2D 1MCQA 3WLWD 4MXVE 4Q58C 4KKCC 3N1MC 4TOYH 1A6VH 2UZXB 3FFCD 1FGNL 3RIAF 2F8XC 1OAUL 3L9RA 4XX1G 3BIKA 1VPOL 2DLHA 2K3TA 4L8SA 4Y4FC 2YZ1A 4P23C 3SKUD 3RWDA 2BSTA 3LPGA 4GAYA 4M48H 3NCFB 2YRLA 1EZVX 1LP9F 4OKDA 1R3JA 3HAEB 2BSRB 1NMBH 1NCDL 1UXSB 2YUVA 4X6DB 4H0IA 1IC5L 4TSBL 4K3EL 2IPTL 1GOGA 1XR8B 1NGWB 2OJZH 1GXEA 5TE7L 5JHDD 3HTLX 1I3VA 2H2PD 1FBIH 3BGMA 4JDVB 1IM3A 1YN6B 1HQRB 2DQIH 1A1NB 1C16B 5I2IB 4RFEB 3SDAA 1MFNA 1WIPA 3BVNA 5J06A 1KFAL 2XPGA 3NCCB 4OD2B 4WU5B 1U8LA 4P57A 4EXKA 1BWMA 5J57B 1AY1H 3RNQB 3W0WE 3OKEA 1UXWB 2W92A 2XQBH 3WLWC 1Z3GH 3MLZL 1SJEB 3IKCA 4OF7A 3P73B 3WLBB 1IGFL 5D96C 1VGKA 3UAJC 5EOQH 1I1YA 4MQSB 3LKSA 2HAZA 5JHLL 4I3RL 5MEND 5ADOL 5F7MC 3LPWA 4LSRH 5I6XC 2X9YA 4NP4H 5GGSB 3TWCH 1JGDA 4HZLB 4RQQB 3L9RB 1TTGA 3TN0D 1EJOH 5FF6A 2ZUVA 4ODHH 5GISH 4WW2A 1J11A 4IOIA 4CBPA 1QA9A 1LO0L 2XYCA 2FL5B 2GJ6A 3AREB 3TVMB 2E7LC 1AGCA 3HZMB 2V5SA 3KPSA 3VI4F 3H0TA 3SJVB 1L9MA 2XWJB 3BP4A 4P2RD 3I3BA 4XZUA 2PW1A 1YMMB 1FCGA 1ZHBA 2J88H 3VU2A 1F4XL 2J8HA 1QPXA 1IKNA 4P2QA 3PWUA 3D1MC 5CJQH 1QSFD 1U8NB 4NIKB 5E1AB 1A4KA 3ULVE 3BVNB 5BQ7B 3E0GA 3IJHB 2BHZA 4OLVL 2WWKO 3SE4C 2V6HA 4DTGL 1YEEL 3ZKQD 5HGDB 1TVHA 4PJGB 4J6RL 2DN7A 1ZVHA 4XP9H 3SN6N 3BHBA 5K59E 2BDNH 4MWFA 3LKSB 1W0WB 2ADFL 4HMDA 1TQBB 5C2BH 4TRPL 3RIFF 2HYMA 3RTQD 5I18H 4YZFE 4MX7A 3BH9A 4LVHC 3C5JB 1P53A 1Q72H 4MD0B 4NCDA 5E7FA 3K2MC 5DRXA 5BS0D 2IG2L 2O5ZL 4BKLB 4XVTH 5KZCD 3JUZA 1N6QH 4P49A 2EDJA 1J8HD 2E8YA 1ZWIA 3JSSA 5B39A 4U1LB 5D7KD 3DVFA 5DSCB 1T0PB 1UA6L 4ZOBA 2Z8SA 3U82B 3PWVA 1MELA 5DK2B 3DX8B 1L0YA 2AJZB 5D2NB 1LO4H 3EBAA 4MJ5A 5KZCB 3WFBH 4HUWA 2Z8WC 5KVGH 2BNQA 2DLFL 3ARED 3TVMD 1H3PH 1ZLSH 1M6OA 2VH5L 3NFPB 1UT9A 3OMZA 4EN3C 5I0DA 5EZIH 1QKZH 1Q9WB 3HR5A 4B7IA 1KB5L 4QRSA 5H37H 4YFLF 2W0PA 3K1KC 5B8CA 3BPLB 5I8OH 1IEBB 2KUTA 4WEBL 2NXZB 3PWJA 4GRMA 1YZZA 4PJAF 3SDYH 4ISVB 4M7JH 5DLMH 1JN6A 1WT5C 4GXUM 4WO4D 1AP2A 3ECBB 1W0VA 3EYOB 1UWEL 4QTHB 2P4AB 4LSRL 2I5YL 5E5UB 1CGUA 2MHAA 4JHWL 1D5ZB 3IF1A 5FUZL 2UWEF 2OSLA 1F4YL 2DF3A 4OUUB 1XEDA 1MFBH 3OTTA 5B38G 3O3AA 4R90L 5TE6H 1XCQA 4G43B 3S7GA 1WWAX 3ZTJG 4NOFA 5ERWB 1MH5A 4AK1A 5F7DB 3UPAA 1AD9A 5ETUA 4F57L 1PGRB 2VXUL 1C5DB 5D5MB 2IH1B 5DFWH 5GJSL 3OAYK 2PF6A 4OKVB 3O3EB 3C2AL 1ZLWK 4YAQB 4NO3B 5JW4M 4ZXBD 2VTFA 4XRCA 4WHCA 2BCKA 4B50A 1X5KA 3QIUC 1A02N 1H0DA 3VRIB 4KTYA 4OLWH 4Y1AD 2E7MA 2IPTH 5GS1C 3W0WA 4KJYB 3B6SA 1R3IH 3WJLC 5DJ0A 2KDGA 5IB4A 1TJIH 2F53A 4YBHA 3TF7C 1W72A 1REIA 3ARYA 4LLWA 4FFVD 4HWBL 3UBXB 4U1SA 4S1SH 4I0KA 2Z4QA 2BNRD 3QCVL 5I16B 4S10A 5DD3H 1KTKE 1QP1A 2VN4A 4H1LA 4K94C 3NVQA 1KG0B 1QSEA 3B2UD 3CIQA 1QFUL 4RWYL 2HKHH 4LVOB 3VJ6A 5BJTA 5FYJU 5I1LA 5IEHB 2I07A 4EDWH 4XMPL 1XGPB 4LPYA 5C0DB 1YNKL 2BXYA 3NAAL 1EGJL 3T4YA 2D7MA 4XMKL 3LS5L 5ESQB 3AU1A 4U3CA 5CBAA 3CD4A 3L3GB 2PXYA 4TUOA 3RWHA 4V1DD 5J8OA 4HFWA 1HINH 4MCYB 2ADJA 3C09B 4JDTL 4KY1H 4L4VA 1PFCA 1SY6L 5EWIL 3MREA 4ORGB 5KJRL 3N9GH 1OCWH 3BOVA 1IRAY 2UZIL 3T1FA 4WI7A 3DUHA 4Y1AE 2OR7A 4LHUA 1NFDF 2L7UA 3DXAA 1RZKC 3B8SA 2B1AL 3QNXB 3OR6A 2Y5TB 5IW6A 3MRDA 4LEOB 5DC9B 3PGFL 2ATKA 4AENB 4OI7A 2ICWJ 5B8CC 1CICD 3MLRL 3F7PC 3I84A 1EEUA 1P4BL 4X7TB 5F9OL 5HDBF 5C70A 3UTSE 3DVGB 4PRAA 2IFFL 4J23A 2OL3B 3ARBC 4KRPD 1UB6B 3QA3A 1DL7H 3LEYL 2XQYK 5FYJH 1SM3L 2AV7B 3T04D 1Y6KR 4WI4A 1N2RA 3HZYA 3SJVD 5TDPB 3F58L 1MFAH 4HUXB 4LF3B 5F9WC 4FTVB 3BZ4A 1A6UL 1X5XA 1C1EH 4YR6B 5A2JH 3MRQB 2CDFA 1A64A 3BKJH 1KJVA 4PRIE 3VFTB 3OAZK 3MGAA 3WFBL 4ONHB 2IALA 3UTSB 2AK1L 4OSUL 4PY8I 5E2WL 1GIGH 4BELD 4O00A 5IW1B 1R24A 4F57H 4PGZA 2ZSVB 4HT1L 4LIQL 1D5BA 1R5IB 3GIVB 4QEGA 2A0LD 5CSZA 1AGEB 1NC2D 5IOPB 2VAAB 4KHXH 5BVJB 4OD1L 5HVHC 3QDMD 5DMGD 4JHWH 1NGXB 1XR9A 2A6IA 3EYFA 5C2BL 4U4BA 1BQUA 3B9KC 2OXGA 1X9QA 3LEVH 4JZJB 4OT1L 1NMCC 3GSVA 2CD0A 3EKCA 5IK3B 4HGWA 3MUZ1 2OYPA 3K8KA 4P3WA 4CN4A 1NC2A 1NANI 1S9VA 4K3JL 1T1XA 2NZ9D 5FCSH 3HR6A 5J11B 5GSVA 3U2SB 4NN6C 4RX4D 1CGYA 2PCPB 4QRRB 5FYKD 2NPLX 2QADB 1KB5H 3Q6FB 1UZ6E 3BPCA 1CDBA 4XTRD 4KMTH 2F74A 2NYYC 3ARWA 4Y4KD 1OLLA 1JZ5A 5FGRA 2C7UA 1VFAB 4S2SB 5CJQL 3HI5L 1IZKA 1D5IH 4X6FA 4FFYL 1OHQA 3MNZB 5EU6D 3VXUB 3WYRA 1F4XH 1RULL 4NO5B 2IF7A 5IB1B 3SDXF 1CICC 5DJXA 2XWTB 3QNZA 1KJ2A 2CMRH 4G6FD 1QEWB 1DQTA 1WLHA 1N7MH 1DSFL 3O45B 4HLJA 1DQLH 4X4XB 5IEKB 3RWEB 1CLCA 2P47B 2YBRB 2AEQH 5DJYB 1BQLL 1TJHH 1PX4A 3UDWC 5C6PB 4P2OB 1U36A 2DQJH 4HT1H 4M61B 3V0AC 4NZTL 2HLAB 4I4WA 3T09A 2NY4C 2Q7YA 1EHNA 2AJVL 4OCRH 4WI8A 1QFWL 2NTFA 3O41B 2IAMC 1EEYB 1NMCB 5INDA 3OJ2C 2NW2A 1F3DH 5I19H 2ZG1A 1JGVL 5DHYB 3FB6B 1RZGA 3FQUB 2D03H 5TFSL 4G6AC 3RVWD 4Z7QE 1Q1JL 3NZ8B 5T5NF 3RZCA 2BVPB 5I6XB 1FNLA 1NH6A 2JIXA 2MSPA 4Y2DC 5DEFB 1RURL 1ZVYA 3MGTB 4IJ3C 1AQKL 1EIBA 1CDIA 2D31B 2XG4A 3O2DH 3ILQC 4Z6AT 1MQ8A 3TO4B 3OG4B 2BK8A 4JGJA 3L3OB 5IB5A 1GZQA 3H9HA 3QIBA 4J8RA 4QKXB 1K5NB 1LO3L 4R0LA 5FYJD 2MNUA 4I5BA 4ETYA 3BGFB 2J8UE 4YHYC 2W07A 4TTDC 1YUHB 5HHVH 3SDXE 1FYTB 1IE5A 5EZOL 3L5WA 1E0OB