3QIBC

Crystal structure of the 2b4 tcr in complex with mcc/i-ek
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
200
structure length
194
Chain Sequence
QVEQSPSALSLHEGTGSALRCNFTTTMRAVQWFQQNSRGSLINLFYLASGTKENGRLKSTFNSKESYSTLHIRDAQLEDSGTYFCAALRATGGNNKLTFGQGTVLSVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQDSDVYITDKCVLDMRSMDFKSNSAVAWSFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
publication title Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 38
structure length 194
sequence length 200
ec nomenclature
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qibC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qibC02
3QPQD 1FPTL 2GCYA 5HYIA 3FFCE 1EZVY 1A14H 4A6YH 1KB5H 5EIQA 3ARUA 3QCVL 5JTWA 4PRPB 4X7DC 1E4XI 2J5LB 3TCLA 4ZAKA 4ODTL 1I8LA 5I0DA 1VKXB 5CUSH 3CFKB 5DQJB 3RL2A 4WJ5B 1R3HB 4D9RD 4OUUA 2UY7A 1D6VL 2BMKB 3U7YH 4PJGE 2J3SA 4P46D 4K8RC 2AGJH 1DBAH 4KXZH 5DRZB 1ZLSH 1YMMB 1CD8A 1P4BH 2YA1A 1T7ZA 3BKYH 4NWTH 4DCQB 4HAFA 2H32A 3QG6A 5MP6L 5DUBB 4MJ2A 5JPMB 3KPRB 3WUWA 3K8KA 4J1UB 1R3LB 5HHQA 1BOYA 1TJHL 3O11B 1AO7A 3BJLA 4N0YL 4EXPX 3JTTA 3TV3H 1W8NA 4XC1L 4D0BA 5TDOB 5DS8B 3QEQA 2C5DC 3DO7B 2R1YA 5HHPB 1AD9A 3GRWL 2F5AL 4KK9C 3K1DA 1NMBL 1G7MA 4YBQC 2H6PB 2YWYA 3FOLB 3BGMB 3QCVH 4RMSA 1IGIL 5EOTA 3V4VL 3KYOB 4IRSC 4YQXL 5IHBA 1P9MA 4OZFA 3WNPA 1I85C 1X5KA 1OT2A 3E6FB 4BK4A 3HC3L 4LSTL 4OZHA 5FYLE 3HG1D 1WICA 2P5EA 4XBPB 4MD4A 4RA3A 1QSFB 3TPUA 3PGDA 1W2KT 2LAAA 2QL1A 1MQ8A 3RL1A 2X4NB 1F42A 2AV1B 2BNRE 4DVBA 3KLAA 1YY8A 1L9NA 5MP6H 5F1NA 1R5WA 4QXGL 3TBYB 4FMFA 4O5LH 3OBAA 1CD1A 4JFYB 1JRHL 4M1GH 1FZOA 3MCG1 3FQWA 3L3JB 4BQ9A 3SOBH 4N0YH 4YE4L 5E2VL 3IRZA 4XC1H 1MH5A 4Z95H 3ULUE 2UVFA 3O3UN 4KQ3L 3VXUB 5TPWH 5M7QA 1CGVA 3GRWH 3WS3B 2F5AH 5HHVH 4NQCA 4ENEC 2OS7A 2YPKA 1EMTH 3QPQC 3GIVB 1CGWA 3K4ZA 4MNQB 2EZ0D 4P57B 4LDOB 4YHKL 3WMSA 1G7LB 5DFVD 3PV7A 5FFLA 2VE6A 1MCSA 4H1LA 2OL3L 3T77A 2W0PA 3MV9D 1QP1A 3OXRA 4N0CD 1RUKL 2H26A 3MROA 2VB5A 4XCEB 1J9CT 3P9LA 5GS1A 1V05A 5IQ7H 4WW2F 4P46C 5FK9B 1KTDA 3GSRA 3GSQA 43C9B 2MPAL 4JRWA 4ZUWA 4LVEA 1EO5A 3UP1A 2EEDA 5B38B 4QXGH 1GOGA 4LHUB 2WBJA 3LEVH 3EDEA 3QUZA 4P2QB 1Y6KR 1PGRB 2W9EL 5GRUL 2XWTA 5H2BB 2DBLL 1U9KA 1HIML 5E2VH 1MJUL 5CGYD 4WNQA 3PDGA 5K9QI 3RDTA 3PQYA 3TIEA 2MJWA 1UB5A 4CBPA 5IJKC 4LSQL 1IAKA 5GISL 4AQOA 1S7VB 4JN2A 4QHKJ 5C0JB 5BO1L 4Y16D 5CP3H 4P2OD 1T7XA 3BPOC 4CU8A 3T0XA 3THMH 3EYFB 2HTKD 4ZD3L 1CF8L 1OGTA 2HFEA 2OL3H 2X4QB 4RSVA 2E9JA 4IMKC 4X4ZA 2G9HB 1DVFD 2CGRH 3NIGF 5C0FB 1RUKH 2XRAH 3K2MC 4LP4A 2AI0L 4RWHA 4U1NA 4WENB 2QKIA 3TA3D 3OKLB 2HTLD 1KEMH 3TLRA 1HKLH 3VGAC 1S8DA 3LZFL 4S1QL 1I1FB 4WU7A 2D31B 3WFCL 3VG0L 1L7TL 2MPAH 4S0SD 4TUKH 1CDGA 2XY2A 3DIFB 5GGRB 2X1XR 4S11A 2D9CA 1UKQA 4EVNA 4NHUA 4HZLB 4Z9KB 4D9QE 2W9EH 3VGAB 3HZMA 2DBLH 1F6AA 1I7UA 2BNUB 4WWID 3TBSB 1J1PH 1MJUH 2VABB 5DJZB 5HVWA 3BZ4B 5GISH 3GSNB 2BVPB 1YEKH 5BO1H 2UWEA 3E8UL 1CS6A 4UUJB 7FABL 2Y5TA 4D0CB 4OLVL 3IJYB 4YFDB 2EZ0C 5EC1B 5DFVC 2H2PD 4X99A 4E41B 1CGXA 5ICXA 3P2TA 1S7WA 2YZ8A 3KPQA 4NHCL 4N0CC 1KT2B 4J6RL 2ED7A 5C09E 5KBNC 1RUQL 1XF3A 4JZNB 2R2EB 5H35A 2BNQA 5GJSL 4WO4B 2BERA 2DMCA 4ONOA 3WKMH 3WFCH 3VG0H 4Z6AT 4MD0A 3IJSB 1KOAA 1A6WL 2F54A 5CEXA 4YO0A 1NGPH 3LRSB 5C08E 5KZCB 3FMGH 1RULL 2X41A 5DMKB 4U6YB 4NQED 2DQUH 5A3ID 2OLDA 4HUXB 1XGPA 1XGRA 1OVZA 5CGYC 4V1DD 3UZQA 5HSFA 3OL2A 3REVB 2X4UB 2WP3T 3MBED 2VR5A 5IHZB 5EULV 4IDLA 5AYUL 4PJCF 3LKQB 2NMSA 1K8IA 3E8UH 4JM2F 4NZJA 4Q9RL 5CBEB 1A7QH 1VHPA 2UV3A 4Y16C 4WV1C 3S98A 4P2OC 3DUSA 3VGEA 1OCWL 4OLVH 2Z92A 4WHDA 2NX5D 4X7CC 3DURB 4M93C 3T0AA 4EJ1C 2DQTL 4PJIA 5HYSG 2P7TA 2HTKC 4LBEB 2CSPA 5ESVB 5E56A 1IGCL 4E0RA 1FFNB 2VSDA 1DVFC 4S1DD 1RUQH 3OKMA 3LCYA 5FXCH 1IEHA 2Q7YB 1UZ8B 3L3HA 1LP9A 3TA3C 5GJSH 2DQJL 2HTLC 4QRPD 4G6MH 2YC1A 3NPZB 4PJXE 1A2YA 1WJ3A 2DBJA 3Q6GL 4HWZA 3VRLF 3ZYJA 3EIFA 2EYTB 5F9DC 4D8PB 3MRCB 4NYLA 3PF2A 1KN2L 4I9WD 1DVFB 2OZ4L 1OHQA 1FQ9C 4YHNA 1RULH 4ERSL 1LDSA 4PGJA 2CDFA 3I75A 3WD5H 2GJ6E 2V5RA 2VUOA 1QG3A 3MGOB 1HNGA 3K3QA 3ZKXC 3W81A 4MJ5A 2DLFH 4ETQB 3GI9H 1TVHA 2YD2A 2CIIB 1BM3H 1FV1A 2DKMA 3NIGE 4HKBB 1JF1A 5BRZD 4HEME 4FZEH 1KULA 2PF6A 1MLCB 1EUUA 1Z6JT 1A6PA 4PUBH 1J1OH 2AV7A 4LKCB 3L5WA 4KKBD 2VLLB 1R5IA 2H2PC 4QO1A 4HIIA 4BFBD 3IB4A 4F2MB 2E7HA 1FL5B 4WWKD 5C86A 4XP6L 4LCWB 3R06A 4P9HL 3HZVA 5EU3A 5GSRB 1DBKL 1A3RL 4RMVA 1YDPB 1B4RA 3QRGL 1C7SA 1FIEA 3V4PL 3PABA 3QR2A 4H1LH 2CK0H 4JFED 1UKSA 4QY8A 3BP5A 1KN2H 2OZ4H 1A6TB 3WKNA 3RVWD 3MODL 4HAGA 4I5BA 3CJJA 4BSJA 1EK3A 3BD4A 3AAZA 4E9LA 4G8GB 5B3NA 1RIVL 3C60A 4FTVA 5A3IC 5ICYA 3U0TB 1CFNB 3T04D 3K4DA 2KZ1B 4KH2A 4NSKA 3SKJH 3GEWB 4HWBA 1T3FA 5EPMB 5E6IB 4IS6A 3CXHK 5MERB 3RWGA 3RI5K 5DXWA 5FOJA 4CMMA 1QFHA 5GRVL 3GSWA 5HVHC 4BQCA 1LEKA 3D25B 3M17B 1BPVA 4YHPB 2YEZB 1F8TL 5CEYA 4LAJH 4XP6H 1WTGT 3HHRB 5CJXC 3GI8L 4P9HH 1JPGA 4S1DC 2X7LB 1KTKE 4LLMA 2YXFA 3N06B 4DUXA 1DBKH 4MB4A 5J6HB 3QRGH 2HLAA 1S9XB 1DTUA 2O93L 1HDMB 2W9DL 1DBJL 4JQVA 4CADA 3ECBB 5I2IA 2NW2A 2BSRB 5F9JB 3QPXH 2CKBA 2IH1B 3ROLA 3IU3B 3MREA 3C8DA 5F9WC 5A40E 1MWAL 3NCYP 5MEQB 5MHSE 5IVNA 3DGGB 1RIVH 4LSVL 3V6OE 4EOWL 2B4CH 4RA0C 5JHLL 4J8RA 2GSIA 2DL2A 3KWWB 1P7QA 2ZCLH 3VWKA 1XIWB 4IDJL 4RQQA 1H3PH 3B9KA 1EHNA 2O5XL 1AGCA 2VLMD 3ME0A 2VSCA 3KYAA 3QUXB 3JZ7A 1QRNA 3NPSC 3SJVD 1OOAA 1MRFH 3CFJB 3X3GL 1QFWM 3DECA 1ZA3B 2W60B 4P4RB 2GTZB 1F8TH 3KJ4C 4QWWD 3QXAB 4WWKC 2BSED 3D39E 4XH2A 3V95A 4JB9L 4NQDB 2VMFA 4GXUN 1NUFA 4LHQB 1CDBA 2C1OB 1KCVH 4AMKL 4WTZG 3O6KL 4P23D 1LDPL 2NY3B 4IMLB 3OG6B 1AR1D 1I3VA 3KJ4B 1MUJB 4YHYC 1YC7A 5IKCB 5I1GL 4MJ6B 4KROD 1KJVB 5IJVA 1MLBA 4ONHA 3RVWC 5F70A 2OTWB 2DQEL 3K2UL 4N90E 5MI0B 3QNYA 5KG9A 2GK2A 2YD3A 1UCTA 3QXUA 4X6FB 5DD1H 1LE9B 5B3JF 4YHYB 3HRPA 3I84A 2VDRH 1GGIL 4NN6C 4ZFZA 4KWUA 2Q76A 4IDJH 3IDNA 2YUVA 5HYSB 1XT5A 2AQ2A 4BH7B 2YPLB 2XZCL 2O5XH 3B43A 5L8JB 3ESUF 3V52H 1Q0YL 1QPXA 3DOSA 5ADPL 3EZ8A 4WFED 2OMNA 2NTSP 2NXYB 5I16A 4PRHB 4P2RD 4PB0L 3RFZC 1I7TB 4AT6A 3KPMB 4RMTA 3FFCD 1MCKA 1ZA6B 3WNOA 5C0BE 5E9DA 4MWFB 4GW4A 4RNRB 3O6KH 5CSBA 1EO7A 3F7YA 4EUPG 4L8SC 5CHNB 3QI9D 1FG2A 1OY3B 5B22A 3MBXL 4DGYL 1GC1L 4JO4L 1FYHB 3QWQB 1NCBH 4R0LC 1ZT7A 1F5WA 4PJFF 4MHHI 4N1EA 3DROA 4U7KA 4GRWB 4QHMA 3MV7E 2DQEH 4IRZH 3DX8B 4F33B 1BD2A 4IIQC 5EO1B 2QR0A 3L1OH 1JI1A 1MCNA 3ZTJH 3WJLC 1N2RB 2J8UE 2JJSA 4HH8A 4YHLH 3P11L 4Y4FA 2VLKE 4TOYL 3NABH 3U0PA 4G7YL 4ELKA 3N1QC 3KPPA 1B2WL 4FOMA 2C4FU 4IIQB 3NN8A 2P24A 1KYOJ 4XTRD 1IZKA 2YD6A 2XN9B 2ED9A 12E8L 4Y5XB 3IGAA 1YEIL 3QXWA 3SKOA 4O02L 4U1GB 3L3OA 1MI5B 4HH9B 4WEUD 3QQNA 4ZO7A 3OGCB 4Z7VE 1M6OB 2FWOA 3LQAL 4P23C 3SJVB 1GC1H 4JO4H 1K4CA 4OFIA 5FYLD 1AR1C 5EUOB 3VJ6B 2AS5M 5HYEA 2XTJB 4P5MB 8FABB 1MQKL 2ADGA 4PG2A 4QOKA 1DANT 5D2LA 3P0GB 3RZCD 3MRJA 4D3CH 1QYGH 2BY3A 4WFGE 2BNRD 5DHVA 2FHBA 2PYEE 4QHLB 1JPFA 2NY6D 2ID5A 3GSXB 2JB6A 1U8JA 5GXBB 2X4OB 4GBXC 4P23B 4LFHD 4PJBB 1AQKL 3I85A 2APTA 4H26A 1P7KA 3U82B 3OXSA 1NCDL 2VITA 3GSOB 3I50L 4TOYH 4ZTOL 2H1PL 2D03L 1ZHBB 4XNYL 2HFFA 2YD1A 3CLEL 4HFWB 3VW3H 3GB7A 1B2WH 2G2RB 3G9AB 2A6DA 3ULUD 4HKJB 4P4KA 4GBXB 4Y2DB 4JO1L 1YEIH 4MHHG 2ESVA 4ZFOB 1U8MA 4LLQA 4O02H 5IIEA 5LBSH 2VXSL 5JMRA 4KUZL 1G9NC 4ONFL 1CFTB 1KNOB 1FBIH 2Y1VA 2XOTA 3LQAH 5DDHB 5IWLC 4X6CA 1YEDA 2PYFA 2QSTA 3QI9C 1V7NH 4PBXA 3U36B 1YEFL 4QRTA 5H37G 5T3XE 5B3JE 2WLZA 3RVXD 3VFSA 1XH3B 1MQKH 3DO3A 3F6LA 5IBUB 3SGDI 3GKWL 3U79A 4MDIA 4YFLF 3MLVH 3MR9A 3HAEG 1G6RL 5DRNA 4RFEB 1ROWA 1E6JL 2JF1A 1CN4A 4TNWK 2ZPKL 1NFKA 1J10A 4BJLA 5FDWA 5HJ3A 2A6JB 1A22B 1CGYA 4XNMB 15C8H 2XZAL 2DM2A 1FYTB 3QWOB 2FX9H 1KJ2L 1P2CA 4TUOA 4XNYH 3CLEH 2VYRE 4Z77B 2P8PA 1LEIB 4RMQA 3TBTB 3BO8A 4M8QA 1MSPA 4R4BA 4RMRA 3DVNA 3RJDA 5JW4Q 3EO0B 5I74B 3C08L 4OM0L 4L3CA 4LVHC 4XTRC 2JCCE 3HZYB 1I85A 4UV7L 5IVXA 3FO9A 5D5MA 4PJFE 2X70B 4ZDHA 1UM6L 3HC4H 4ONFH 1ETZB 3BPLB 3LN4A 4GAJL 5GZOD 2QSVA 3VD7A 3LB6D 2JIXA 4PJAE 2FH8A 1C5DB 4KK8D 4NRYA 4D2NA 4Y8DC 1N3NB 1NCCH 1RZKL 2CLZA 3G9VA 1T21B 1WFUA 4JFZH 5DEFA 3QIUD 35C8H 3ILPB 1E6JH 3RZCC 5I1DA 5EU6E 1LNUB 4ZXBB 2RAMA 1MFNA 2NY6C 2ZPKH 4JPWL 3WIHA 4MSWB 4JFXA 1D5IH 1I9IL 2IAMB 5C0CB 1OB1A 4D9QD 1I3RA 5F1OB 4P59H 4BZ1L 3V79C 4U6XB 5ANMA 1RJZB 3F12B 3BIKA 5J6GA 1MFAH 1IKFL 4YDJB 3MRQB 4BSVA 1JGUL 3RVVD 3CUPB 4YR6B 2PXYD 3ULUC 3EDKA 1R3JB 4OM0H 1ZXQA 1U8KB 3PDOA 1INEL 4L8CB 4UV7H 4FZ8L 1IGFL 1P1ZA 4Z7WF 4NQSB 4NN5C 3RP1A 3NVQA 3ULSA 2BRQA 5C9JA 1A6VL 1HCVA 1XGYL 4L29A 4LCUA 1OP9A 4MXVE 1T5XA 5C0GA 3RWFA 3VFMB 2GI7A 3T0WA 1KLGA 3W0WE 3AY4C 5F7EL 2VXVL 2OM5A 2XPGA 2YK1H 1UYWH 3BIAX 5EOQL 5C09D 3ULVF 1RZKH 5GQBA 4Q2ZB 5EUOF 4PGDA 3RVXC 4NQVA 5IW1A 4RAVA 4U6VH 5AD0A 2BY0A 3H42L 1XR9A 1PG7L 4LQ1A 4LSRL 4PGCA 4OZIE 4OCNC 4HBCL 4PJEA 3ARED 5C08D 5T1DL 3U2SA 1AGDB 1WT5A 2AJZB 1RK0A 4O2EA 3BMWA 2XKNB 1IKFH 3LMJL 3H3PH 1JGUH 1RQ5A 2R4RL 4F8QA 3OGOE 4TNVF 4XPHH 1HILB 1NAKL 4G43A 3EO9L 1INEH 4HGWB 4XPTL 4FZ8H 1IGFH 4OB5L 4IMKA 5F7DA 3OF6D 3MLWL 1A6VH 5GGVL 5E7BA 3SDXF 5DT1L 1R5VA 1AKJB 1Q9KB 4JANB 5BS0E 2HT2D 4FP8L 5GZOC 1EEQA 1ULVA 4KZDH 4PG9A 3LB6C 4DKFL 3FN0L 3P73B 2FYYA 2O26U 4QRSB 4KK8C 4KDTA 1NC2B 2IG2L 5KJRH 1CIDA 2VL4A 4D0DA 3TNMB 4ZFFB 1NBVL 3QIUC 1FVCB 2FJFA 1CI5A 2BY1A 1Z9LA 3MRGA 4GW5B 4ZPTA 5KAQG 2YXMA 3BZFB 1F6LL 1H15A 1QFOA 1RHFA 2P5WB 3OKOB 4LGPB 1JPSL 2VDKH 2G5BA 4K71C 4HBCH 5ESAA 4GW1A 4K8RL 1WWBX 4XNQA 1X7QB 4QHNB 4Y5YA 4G8EB 5T1DH 3CMOL 3QXTA 1JHLL 4H20H 5L7XL 3FTGB 2F8VA 2GJ6D 1BZ7B 4ZS7L 4GG8A 1Q94B 2ZUQB 3CH1A 4OF0A 5D1ZD 5DHVH 3RVVC 4UNVA 4PRAB 1NAKH 2PXYC 1EAPA 4MNGE 4XPTH 3QDME 4LRNL 1OAYL 4PRNA 2O5YL 5DUPL 3LPWA 5EZIL 1TJIL 5DT1H 4ZSOE 5A43C 2P8MA 3EJYD 1UM5H 4ODBD 2GYSA 4YHOL 5TH2A 1IQWL 4QRQA 3WFDL 5EO0A 3V6FB 4DKFH 3FN0H 5HHMB 4U0RC 1KIQB 4L4JA 2KQNA 1DZBA 5J57B 1T0MA 1IEBB 5E95B 3TCXA 5ALBL 5L88H 3IDMB 1ORQB 5GJTL 2CRZA 5FOBA 1NBVH 4H25A 3H9HB 1UA6L 3H9SB 5JW5B 2HJFB 2NZIA 3AVEA 2ATPA 4NOFA 3WYRA 3RX8A 3NTCL 4M1CD 1JPSH 5JHDA 3ARYA 4F7PB 3RNKB 4K8RH 4U0RB 2R29L 2WM0A 5IB5B 3VGGA 3ZDYE 3AREC 4LSSL 5IMKB 5C09B 3L6FA 1JHLH 5LGKA 2Z8WC 1PKQB 1T6WA 4Z7WE 2R4SH 4XB8A 1IAII 2EXYD 2BRRL 3DV6B 3DXAA 3ROOB 1E4KC 5JNYB 2VDNH 2Y7QB 2FGZA 4M6OL 4P2OA 3F7QA 1T2JA 5C0AE 4EDXA 2EIZA 1JFQL 1BFSA 1BJ1H 1U93B 1Z9OA 3PWPE 5DUPH 3T4AB 2APXA 1WVZA 3QB7C 2WBKA 4JR9H 4F15C 5BMFH 3G5VB 5D9SB 3O3EB 3BDBA 1FZMA 3MLYL 2HT2C 1VCAA 1IQWH 4WW2C 4YHOH 4JDZB 2J4WH 1QOKA 5DYOA 3C6SB 5I8OL 3HR5B 5DZNA 1VSCA 4Y4HB 1Z5LA 2UZIL 5ALBH 3CDGB 1XGTB 3ZTNL 3VFPB 5GJTH 1JIBA 1DLHB 1OLZA 2V17L 3TFKD 3TIDA 1K9TA 2WINA 4FQCL 5ACZA 4HSQA 2DI9A 3SDDB 1OGAE 2ITCB 3DMMD 1MREH 4ZUVA 1R3KA 3GIZH 4C56E 3IJHA 5I1AB 2PW2B 3HR6A 4LSSH 2IALB 1DJSA 1NEZG 4KUCF 4JHBA 3KS0J 1BREA 4I0PA 4JM2D 5MHSD 3MA9L 4FQIH 4L8DB 4PP1D 3BKML 3ZO0A 2BRRH 3SDXE 5C2BL 2Q8BH 2BVUA 3BZEA 2Z91B 3TO2A 5D1ZC 3RY5A 1RZ7H 4AENA 2X2YA 3WIHH 3N0PB 5HDBF 25C8H 2ADFH 4EN3C 1E27B 4LF3B 4PJDB 5IGXL 5TE7H 2OXGA 5IVZA 3ZE1E 2BC4B 4JPVH 5FECB 4QF1B 3SQBA 4U05A 1T5WA 3FRPG 1WGOA 2K7QA 2CLVB 1U8LB 5EUKA 4L4VB 3EJYC 3WSQH 1B0WA 2C3VA 2NY0D 1CGSH 1DDHB 1KIPA 3I6LE 4HULB 2J12B 3MRNB 1F4WL 1I7ZB 1YJDC 3FQRA 5I8OH 3EDDA 3RTQB 2UZIH 4EN3B 3D39D 2NXZD 3QUML 3AXLA 1M71B 1S9VA 3P30H 1JGEB 4HK3J 1ZS8A 3SE4A 4PV8B 3D18B 5CJ5A 1TZHA 2AJ3B 3MUGB 1ND0B 1DE4B 1B6UA 1AHWA 1VACA 5IMLB 1WCQA 4F9LC 4JFHE 1NUNB 5D72H 1IM3A 4HGMA 3MBEA 3CCHA 1A64A 3DLQR 1IM9B 1FN4B 3GSNL 3GO1L 4N90D 1MAML 2EXYC 5C2BH 4HUVA 5DJXB 3A0OA 5AZ2L 4KJPD 2HJKB 2ITDB 2NX5A 3QDJB 2I25N 3REWA 3VGBA 3STZB 5CJXA 1HEZA 2HVKA 1F90L 4ODXA 3HPLA 5FA3A 4JFFB 3OAUH 1PY4A 2EE2A 4XAKE 4JAMA 5KN5A 3ALXA 4JVWA 1F4WH 4C55A 2DQIH 4Q74A 4M5ZH 4M7ZB 2V9RA 4ZPVA 1HWHB 1SJHA 3QUMH 3IKCB 1BGXH 5BVPL 3TT1L 3S3JA 3T65B 3QRFM 5EFIB 4YHZL 3TFKC 5C0BD 5FCUL 4TYUA 2HG5A 4LNRA 5C92A 3QA3B 5CFHA 3DMMC 1RIHH 4BFEA 3ARSA 2GK0A 3V6ZB 3OZ9L 2NYYD 1X5HA 1S5HA 2F53A 4TN9A 3S5LG 2AQ3A 5KSUB 4JJ5A 1D6EB 3MV7D 4JM2C 3LHPL 4L5FH 4XPGH 1MAMH 3H6JA 4PP1C 3V6OC 4AG4H 4RX4A 4UT7H 1YPZA 4KFZC 1JVKA 4HJGA 4DK6A 3N1PC 4NBXB 4I13B 5C8JA 4Z5RB 2VLKD 5I73B 3VI4F 3VFVB 5CD3B 4RWYL 5MEOA 5IQ9B 2OCFD 2Z4QA 4WWKA 3Q48A 2YR3A 3JV4B 5DQDL 2IADA 1C08B 1QHOA 2P8LA 1FLRL 2NY0C 2YUZA 4X6BA 3WDJA 1I9EA 5DWUL 1YNLH 3FAWA 5BVPH 3IDGA 3TT1H 3IFPB 2NXZC 1ZGLA 3RPIA 1FC1A 4YHZH 1CFBA 4CNIA 4XCNA 1E4XL 3FN3A 4X5XB 5FCUH 3ISWA 5CP7B 2HFTA 1Z9SA 5HYQA 1CT8B 5FHAL 1FH5H 1CFVH 4LAQH 4JFDB 4X4MA 3OZ9H 1CFQA 1G9MC 1RFDL 3IDIB 5FUOL 1NANH 5HDBE 1JHTA 1LK2B 3LHPH 2CPCA 5IMOA 4GRLA 3KPLB 1JGLH 4G9FB 1CICC 4WFGD 1QO3B 3P0YH 2PYED 2VZSA 5JQ6H 1VADB 4LCCC 2Q6WB 4R7DB 1ADQL 5FA4B 1JPST 2OR9L 1QSEA 2I07A 3Q5YA 2AEIT 4AIZA 2BSTB 3OB0K 3V5HB 4OKVA 2D0FA 4M62L 4KJYB 2HRPL 3E1F1 3D85B 1CICB 1EHLL 3O0RL 3CU1A 4LSPL 4LCCB 4CMHC 2VLJA 1FLRH 2MHAB 4POZD 2HJLA 1GJIA 2DLHA 4F7TA 1G0XA 2A0LD 4NCDA 3MNWA 2GFBB 4JHZA 1J87A 5D96C 4IOSD 5IG7A 2OBGA 5JQHC 4DKAA 5LVEA 4OGYH 1NEZB 1CK0H 5FHAH 4QNPF 4HUUB 3FZUD 3E6HB 1NLBL 1ZHKA 4L9LA 5HBBA 5I17B 3OB0H 4HJJL 1RFDH 1CG9B 1NKOA 1A9EA 4QGYA 4CVZA 3WJLA 4PY7A 1BIIA 4FFZH 2R2BB 3I2CH 4AEEA 5C0BB 4GAYB 1VFBA 2EDLA 5BQ7B 1U3HB 3O6FC 4PY8J 5FB8B 2DI7A 1IZJA 1TQCC 2FB4H 2OR9H 4IM8A 3I02A 4J23A 5JOFB 2XKSA 3QIWA 2EDFA 5E6YA 1ORSA 2D7TL 4PRDA 5AZEL 2E7CA 2V5YA 3L7EA 1RUML 3OR6A 3P4MB 4M62H 5D1XD 3DWTA 1FJ1A 1U8HB 1EHLH 3O0RH 3FJTA 1FDLH 1BFTA 2A77H 1WWWX 3HNVL 3O6FB 3S8WA 3MLUL 1MCLA 1KJ3H 4APQD 1I8MA 3NH7L 1T22B 2DN7A 2R0WL 2CIKB 1W72L 1MHEB 3EYVA 3C6LA 4OLYH 3UO1L 1LE5B 4YXHH 4OI8A 3X3FL 3QNXA 4UTBH 5KAQF 1G7HA 4HPOH 2Y25A 4JFQB 1K4DA 4HK0B 4UINH 4X4YA 3L3IA 3HE6D 3QDGE 4DQOL 2A6KA 2DD8L 4DUVA 5HHNB 1T03H 2JJUA 1XGQB 4PTTB 5DD5L 2AP2A 4EQ2A 1P4IL 4AL8L 3TNNA 3P4OB 4XVSL 1YUHB 5E5MA 3VI4E 5DTFA 2F19L 1DN2A 3VXRA 1BQHB 5EU6D 3MJ9L 4B41A 2Q20A 1KACB 3F62A 2EEBA 1E6OL 4HXBL 1DSFL 1U2HA 4X6EB 3P4NB 4NZUL 3BKCH 4YX2L 1YNKH 5E5RB 4KJQD 1RUMH 2XA8H 3UJTL 4JCLA 3D3VB 2JTDA 5D6CA 5CIPB 2YMXL 4J3XA 5IB1B 3NH7H 1EJOH 1JZ5A 4POZC 5SWSE 1P53A 1W72H 2R9HD 2JK5B 3UO1H 1H0DB 2A0LC 4YDKL 3SY0B 4GG6B 2FJGA 2HH0L 1Z2KA 2AJSL 4G9DA 2C1PB 4JLRB 2KL6A 3T0EB 3MRLB 3W0WD 3S5LB 5E8DH 4OLZH 3QEQE 4PJGA 4X0KA 1H3XA 5CGTA 1P4IH 4P3WA 5T1MB 4AL8H 3O9WA 2FZ3A 4XVSH 1UADC 4OAWB 4IRJD 1O7SA 3D9AL 3CVHL 1AC0A 1HXMA 3C5SA 3OKEB 1NBZB 1A1MA 3NA9L 1E6OH 1PG7W 2E7BA 4KRPD 1ZTXH 2LVCA 4WU5A 4OZHE 5CCKL 1XEDA 3D69B 4NZUH 4UV4H 2Q8AH 4YX2H 3UZEA 1SYSA 3L3GA 4M9OA 2F8OA 1N8ZB 3SQOH 4NDMB 1M05A 4Y19A 5KVEH 5D1XC 4QRRA 1JMZA 4JRXE 3VWJA 4JKWA 1C12B 1Q0XL 2YMXH 5BZWA 5BV7H 1A6AB 1LILA 1XF4B 4YK4C 3T4YA 4CU6A 4YBHA 1YYLH 4UMGA 1YN7B 5FGBC 4APQC 2H9GA 4QNPE 5C6TL 1QA9B 1FNLA 3MACL 4YDKH 4NRZB 4PV9A 3GMQB 4X83A 2AJSH 2IQAA 4AK1A 3UTOA 5BS0D 2B0SH 3EOBB 4YPJA 3IXAA 4YK4B 1RIUL 4LLVB 5HYJE 4R97B 2EYSB 3HE6C 5AWNH 2SEBA 3EYOB 1T7VA 4NQCE 4APQB 3NFSL 3HMXL 2R69L 4KKNA 5T3ZH 3WFBH 5ICZB 3FO2B 3MRDA 4M1DH 4XNZC 5EOCL 3RGHA 4M02A 3QJHB 1XF5B 3CVHH 2L0DA 5CJ8A 2AERT 2ADIA 4MJIE 4NM8L 2R1WA 4R4ND 5L2KA 3RIFK 4KXZI 2ZG1A 4Y5VB 5C07B 3BRFA 3M8OH 1W0WB 4RZCA 3MRKA 4I2XA 1PW3A 1T1XB 3EOTL 5DLML 3H0TB 2A73A 4KJQC 1F3DJ 4BSWB 2AK1L 5D8JL 4MCYA 2GY5A 1HHGB 4G3YL 4HUNB 2BP3A 4WIQA 1ODAA 2NW3B 3O6LL 3RGVA 3QDMD 1RJLA 3X12B 2R9HC 4GKNB 4ELMA 5K9KB 4YDLC 4JY5H 2X4SB 1MCFA 3DETD 4JDTH 3HMWL 3TO4D 4K7FB 4Z7UF 3VXQB 4KK5D 1RIUH 4GOSA 3V7MA 5ELIA 5C0RL 3B2VH 4XNXL 3HMXH 2R69H 5GGVY 3PWUA 5C3LD 2M26A 5EOCH 4RFNB 3P9MA 3RX5A 2JJTC 2E3VA 3S7GA 2NY4D 4LLYA 4QT5B 1CL7L 4Z7QE 4NM8H 5IB2A 4OQTL 2G60L 4KRPC 3SPVA 2J6EA 1RVFH 4LK4A 3MNZA 5IW3A 2AK1H 4FNLL 5I66B 4Z7NF 1QLRB 4ZFOL 1GIGH 1YN6B 5ITBH 3TH2T 1KV3A 2LU7A 4FXKB 4KI1A 3RWJA 4AH2B 1CVSC 3UDWA 4M7JH 3O6LH 4WI5A 5C0AD 1RJYA 4NWUL 3VI3F 2F58L 2X4RA 1YA5A 1NGXA 3U6RB 1CE6A 2CLRB 3PWPD 4FQXB 5GRWA 4ZUUB 4PJHF 2AXGA 4G42B 3LN5A 5B39A 3HMWH 4DUWA 3PV6B 3TBVA 3ARDC 3SGKC 3DRTA 4HWEL 4XAWH 1IC7L 4L3EB 3RWCB 3QHZL 3X11B 4XNXH 3IDJB 2C7UA 4Q0XL 5EU5A 1FL3B 5CEZD 2UWEE 3AS0A 4OIIL 1S7SB 2OJEB 3ARVA 3RAJL 5JOPE 1GZQA 2AXJA 1U8PB 1T1WB 4E42B 1HHIB 2B20A 4O4YL 3MLRL 1EXUA 1FVDB 1NFIA 1JPTL 3AS3A 1GXEA 1CL7H 3ARDB 4DTGH 3B3IA 3CX5K 1OGAD 3BZDA 3KHQA 4OQTH 2G60H 1ZLUK 3TZVD 4MYWB 4C56D 3QO0A 4R4NC 5EZJA 4JRYB 5KS9B 4OCXH 4KVCH 2BNQE 1XCTB 3QIBD 3LQMA 1G9EA 4PGBA 3VE0A 2NTFB 1JZ6A 4FNLH 1XGUA 1BFOA 4PJ8A 4F9PA 5HGHB 2AEQH 1F02I 4ODUB 2Y4SA 1PX4A 1JRHI 5HPMA 5CWSA 5FO7B 4XP1L 1VEOA 1MHPL 1WCBB 5TDPB 1NBQA 4MAYA 5HDLA 5I75B 1NC4A 4UTAL 1Q9WA 5JIIA 3BQUD 1WAAF 3K1KC 3GBML 5C1MB 1X5XA 1ZLUH 5F7MC 3DETC 2PCPB 2EDXA 1V3KA 4HWEH 1EHXA 1KLUA 1ZWIB 2VDPL 4L3AA 1M7IB 3AM8C 3QHZH 1I8KA 2DLGA 4KK5C 3I6LD 1I3UA 3C8KB 1F6FB 1G9NH 2FBJL 4OFYD 3MLSH 5ETUB 2X9WA 3PGFH 2NNAB 3VXTA 5EZLA 5IOPB 2G75A 3MLRH 5GS0D 3MLTB 3OKKA 4PLKC 3AREA 4YEEA 5C08A 3UBXI 1OL0A 1WFNA 2YD5A 3CXDL 5DI8B 1F4XL 1KIUA 4PLJC 2IPUK 4HUWB 1INQA 4NC1E 4Z18A 1HYSD 2RQ8A 4JFHD 1FVEB 4Y4KD 4R8WL 5LCVL 4JZJA 1U58B 4PYGA 4PRBA 1BWMA 3KAAA 2PW1B 5GS2D 4JG1H 2ARJA 3EYSL 5DC0A 3OF6A 4XP1H 2GJZA 1RK1A 4P5TD 3FQXA 4Z7UE 1DUZB 3RKDC 4MX7B 5EBMB 2XICA 1TJGH 1DQDL 3QQ3A 4UTAH 3BKJL 4WW2A 4NO0B 5FEBA 3O3AB 3ULUL 5HGBB 1EFQA 2ORBH 3FB7A 3RVTD 1D9KD 2IJ0C 5I15H 5J11C 4XZUB 1A4KA 3QUYA 4N1CA 4XAKD 3ETBF 3FT2A 5ID1A 4C4KO 4LPXA 1KPRB 3IETA 1CLOH 4PRIE 4Z7OF 4QHUB 1XF2A 2C3WA 4I4WA 1PYWB 5I1LB 3VFNB 5INCB 3HZKA 4EI5D 1EFXB 3GMRA 5FYLH 1A6ZA 4JY4A 3CXDH 5HGDB 5TQ2L 1ZAGA 2OSLA 1JZ8A 3F7VB 3TZVC 2HT4D 3BYYA 2ADJB 5TQ0L 3IF1B 4R8WH 1OAQL 5BVJB 1RU9L 3GJFB 4PJ9B 5GGRY 2GTWB 3QIBC 3KLDA 3QO1B 4PRPA 5J06A 3MFFB 4PJHE 3EYSH 1NAMB 1PAMA 4ISVB 4JVPA 1VKXA 4LLDA 1I3GH 1HHJB 1UT9A 5CZXD 4WFHE 1QFPA 4HHAA 1YQ2A 4G6AD 1R3HA 4WI2A 1OD9A 3DX7A 3HC0A 4Z0XB 1DQDH 1HHKA 3BKJH 3O4LE 4F3FB 1WZ1H 1FFQA 3ULUH 4HCRA 1XZ0A 1B90A 3BQUC 5DRZA 4FTVE 5KVGH 5ID0B 1DQQA 1YMMA 3G5XB 3N1MC 3K8MA 1P7HL 3CC5A 1PLGH 4DCQA 3RUGF 4EDWH 5DUBA 1KXVC 5JPMA 2XG5A 4J1UA 4ZOEA 1R3LA 4FQJH 3GGWA 3X13A 2ZKHH 4X5WB 1TCRA 2APWA 4KUCD 3O11A 4MNHA 2W91A 4I48B 2DWDB 3MV8B 5TDOA 1WLHA 1JGDB 5TQ2H 5I8KL 1HI6A 3DO7A 2VZ3A 4LPVA 3FO1B 5TQ0H 1HYSC 1OAKH 2J8OA 4A6YB 5GHWH 1KB5B 3FOLA 3BGMA 4Y4KC 3QAZB 2CJUL 4WY7L 5IFHL 4KKAD 4UU9B 4TRPH 3NZHH 5B8CB 1YEJL 3E6FA 5F6IB 1DQJA 1EERB 2B1AL 3J7HA 1OTTD 4RGMB 4P5TC 4ZNCD 4XBPA 5I76A 1JNLL 3U0WL 1QSFA 2J6EH 1S9WB 5DJAA 3OJ2C 3H2WA 3RVTC 4ZG1A 1HHHA 1T89C 2X44D 5BCAA 2OX5A 3BDXA 3H9ZA 3TBYA 3CD4A 4J3WA 3MMEB 1KCKA 4JFYA 3SDAB 3H8NA 2R2HA 1FGNL 3DMMA 3L3JA 2V2WB 3PP4L 5GGSB 1C5CH 1AE6L 3ARXA 1I8IA 2AW2A 4EI5C 1QRNE 4TTDD 3I6GB 4PD4K 3G5YA 4PJCA 3U48A 5H94B 3VXSB 3PXJA 4JM2A 5F3HB 3VXUA 4BA8A 5C0ND 5F1SA 4TSAH 2ATKB 1WEJL 2HT4C 4NKOA 2DLEA 3O41A 3GIVA 4TTGA 4MNQA 3C2AL 3MLXH 4NUGL 3GJEA 1G7LA 3HE7D 1YEJH 4NPYB 1L7IH 5CLWA 5IFAL 5CZXC 3D2UB 3L7FA 2ICWJ 4G6AC 1JK8B 3F58H 4NUJA 1Q9LB 3HUJF 3U0WH 1BX2A 1NCNA 5FK9A 3TF7C 3R4DA 5KOVC 4G5ZL 5I30H 3WDHA 3D39A 3GMLB 2IANB 1ZANL 3TWCL 5B38A 4LKXA 3EO1B 3S4SG 4RIRA 1FGNH 1F45A 3DVGB 5JIPA 3HFML 5D7LB 2HRLA 4BZ2H 1WFTA 1AGBB 3SEPA 5IB3A 1LO0H 1NL0L 1MCPH 1KGCE 1S7VA 3QDGD 4WUKH 5C0JA 1MY5A 2DWEA 2GSGA 2IC2A 1U2CA 3C2AH 4WDIB 3EYFA 4ALAH 1KTLB 1F11A 2NCMA 5EO9B 4KKAC 5E9DE 4ZAKD 4YPGB 1TNMA 5JO5B 3OX8B 4X98B 5A1AA 5C0FA 3BMVA 3OKLA 1AY1L 3ARBD 3MPCA 1IMHC 1XR8B 2DKSA 5IMMA 1I1FA 1OD7A 4S1SL 1LHZA 2D7OA 2CK2A 2D31A 3MRPB 3EOYG 1BD2E 4G5ZH 3QHTC 2OTUB 4F80A 2A38A 4CU7A 3TWCH 5DMYA 1T0NB 2B7DT 5SWSD 4HZLA 2M8XA 2YZ1A 4H5SB 3HFMH 5TE6L 3TBSA 2VABA 5DJZA 1CBVL 1YJDL 4PGZA 3ZL4L 1DEEB 2OR7A 3DGCR 5E2WL 2FBOJ 2VAAA 3ARGB 3BZ4A 4TTDC 3GMOA 3GSNA 3L9RB 3QEQD 3ZDXE 4NGHL 4WUUA 3MV7A 1SBSL 5C0NC 3S9DB 2BOBB 5EU7E 2GKIA 3CSYB 4Z76B 1ZHLB 4HJ0D 4D0CA 1Y6MR 4UBDD 5LQBL 4NN7B 3IJYA 2V2TA 5IW6A 1J11A 1QTYT 2K3TA 4DGIL 2OL3B 1IAOA 3HE7C 5MEPB 1MPAH 2VLKA 4E41A 3EAKA 1NCAL 1C8PA 4UAOB 1GGCL 4R26H 4TUJB 3UBXB 5JMOC 2R2EA 2BY2A 1AY1H 5E99H 5D2LE 4R4FL 4WO4A 5I1JL 2ZUYA 4B0MM 1EEYA 4JRXD 3TH4T 1VPOL 3IJSA 4F7CB 3G6DL 1HZHL 4K7PL 3UJJL 5ACLA 3W5MA 2RFXA 3VXNA 4LGRB 2E9IA 2ICES 5GRXG 1UJ3C 3QWRD 3HI6L 2IFFL 2ENSA 5D71H 1YMHB 1BZQK 2UZYB 4LMQI 1N59A 5F7YC 3OR7A 5IF0A 2IGFL 1F2XK 3AROA 4AIXA 1YJDH 5L9DH 3ZL4H 3AB0B 1MFBH 3REVA 3O3DB 5HYJD 2V9QA 2C3HA 1OW0A 4BZYA 3PL6D 5J9PB 3LKQA 2ESVE 4NQCD 5CBEA 5ITFB 1QKZL 5A16B 1MF2L 3SKNB 5LQBH 3HUJE 4XMKL 2ZNXA 3DURA 3QQ9D 4LIQL 3WCYA 1SVCP 4JO2L 4HIXL 4EI6B 4NKDB 4ZAKC 1I8LC 4LBEA 4N0FA 4XWOD 4MJID 3QSKB 5ESVA 5JW4M 1GGCH 3QXVA 4OD1H 4HGKC 4KY1L 2Q7YA 2GCYB 1JHKH 1IGYB 3KPNB 4PJ5B 4M43H 3ARBC 4R4FH 4JCMA 2DF3A 3ZE0F 4XGZB 1C7TA 4N1HB 3G6DH 4K7PH 3O2DL 4KRMB 3UJJH 3U4AA 4GKSA 2EYTA 2ZOKB 4JPKH 2IFFH 2WBJD 3QUZD 1A5FL 1M4KA 4OUUB 1A6UH 4ZOBA 3CPLB 1KCRL 5FKPB 6FABL 4K3GA 2Z8SA 3WLBB 1CQKA 3QG6B 3WUWB 4HKBA 4N9GA 4WHTB 5EBLB 1ADQA 5D5ME 5DURD 4YDIL 4F7MB 4BQBA 2D4DA 4HJ0C 1NFDB 3EW3B 5DEGB 4UBDC 4JO2H 3Q3GA 1AO7B 2DDQL 5IM7B 2APFA 3JTTB 2YD8A 2VLLA 3DI2B 3QEQB 4WHCA 4MQ7A 4KY1H 2R1YB 5GSRA 5K9OB 5HGAA 2BSSB 2Y23A 1HH6B 1KXQE 4XMPL 2D0HA 4U7SA 5DA4A 1C5BL 4HV8A 5FF6B 5F9AC 5DD0L 1SM3L 2LU4A 4NJ9H 4Z8FL 1U0QA 3PWVB 1E28A 4PJFA 3PHQB 3C87A 3TN0B 1GAFL 1PY9A 4LEOA 2IWGA 3I6KB 3LKNB 4FFVD 2P5EB 4MD4B 1MCWM 3TPUB 3PGDB 3SBWA 3RL1B 1T4KA 1KCRH 1OWWA 4YJZL 1CFNA 3AGVA 3ILQD 3O45B 5DJCA 4YC2C 3PL6C 5EPMA 5E6IA 2BFVL 2AJYL 3TYGH 3ZTJG 1CD1B 5JOPD 5MERA 4N0UB 5FYKH 3C09C 3FB6A 3JV6B 4ZFGL 3QQ9C 3D25A 1MH5B 3M17A 1G9MH 3QP3A 4YHPA 4G6FD 1SYVB 4XWOC 1BWWA 2DQCL 1J88A 4KMTH 2BNQD 1VGEH 3WFEL 3SDYL 4XMPH 1CU4H 5D7JB 3RWEB 5I1IL 1J5OH 1F3RB 5GS1C 4DZ8B 5J6HA 1MNUH 1IAIL 3MJ8B 4OTXL 5T1KD 2QV2A 1HDMA 2DQGH 1BOGB 2VE6B 3ECBA 4H1LB 2HWZH 1FC2D 3BVNA 2BSRA 1CYGA 4ZUTB 3TVMB 1RZIA 3OXRB 3BWUC 5J3HD 2IH1A 5IEKA 3IU3A 2F5BL 2VRAA 3JWOH 2WBJC 3QUZC 3V4UL 2Z31B 3DGGA 5KSBF 3GDBA 3LKSB 2MCPL 4GKOA 3MJGX 1H8SA 1FE8H 1KTDB 5D7IF 3GSRB 5JR1H 5HVFB 1X6NA 3CFDB 3RDTC 3CU7A 3KWWA 5GZND 4TPRL 4JGMA 4IRJA 2ENYA 4ODWB 5FGCE 1HN1A 1XIWA 2BFVH 5C71A 4ZTPL 3CSGA 4LVNC 5F9OL 4KPHH 3UPRB 3QFJB 5JUEL 4G6JL 4JKPL 1MJ8H 3ZE0E 5FM8A 4ZS6C 3VRIB 3CFJA 3RDTB 3PQYB 1T0PB 3TIEB 1ZA3A 2W60A 2GTZA 3IAGC 4PLOB 2XWJA 1K2DA 1IAKB 2DQCH 2YD7A 3BGAA 1QBLH 4RISL 5BZDA 4DFIA 2ILLA 4LVNB 1BP3B 3WFEH 1JZ3A 4GUPA 5I1IH 5CZVL 5E6ZA 2HKFL 2C1OA 4OTXH 4OCLC 3TGXA 2R1XA 4IMLA 2HFEB 4LDLB 1ZE3C 1RMFH 3O3BB 4GQ9H 1MUJA 1EEUA 3HPJA 5IKCA 4MJ6A 3MGTB 1R3IH 1RPQA 4FFVC 4RAUA 4JE4B 1UM4L 1S8DB 1TTFA 2MCPH 2FLBT 3R8QA 4WU7B 4NO2B 4XVJH 5I1HL 2APVA 4X6FA 3ILQC 2HT3C 3FL7A 1TVBB 4PRID 2PO6B 5HYSA 4NHUB 4U2ZA 5DJ0B 2YPLA 1MCRA 2AK4B 4BH7A 4YNYB 1UB6B 5JUEH 4G6JH 3O2WL 1F6AB 1DP0A 4OT1L 2E6PA 4HS6A 2EXWD 3Q6FB 1A7RH 4YWGL 4OGXH 5T3XL 4PRHA 4UT9L 3D0VB 4RISH 1I7TA 2BJMH 1BVZA 4IOFD 1JCKA 3HCVB 1HSAB 5CZVH 2Y5TB 2ICEB 3LS4L 3F8UB 3V0VB 3OAYK 3VU2A 4MWFA 4JN1L 5CAYB 4OSUH 1R0AL 1Q1JL 5E4EB 2BXZA 5JHDE 3DPBA 2CDEA 5CHNA 3GMNA 3ZZ1A 4WFHD 5ICXB 1S7WB 3TO4A 3O4LD 1J8HE 2EH7L 4OKDA 5H35B 4GMSL 4PJ7B 2AEPH 5IEHB 3F6IA 4FTVD 4M4RA 3DX8A 3DXAE 4AEHL 1ZSDB 4UIKH 4O9HH 3T3MF 3LEYL 4F8TA 1N2RA 5I1CL 2F54B 5GZNC 3U46A 3OAYH 2VLRB 3O2WH 4OT1H 4DW2L 4V2BA 4LQFL 1XGRB 5CSZA 4XB7A 4YWGH 2XQBH 5K93A 2XN9A 2A1WL 5I0ZA 1VFAB 3WE6A 4Y5XA 4NC1C 1JL8A 4Z7WA 4IJ3C 3RWDB 3UJIL 4LSDA 5F71A 4K9EH 1OLLA 4UT6L 3T1FA 3LS4H 5TDNA 4HH9A 3DUSB 5C0AA 4K55A 5KSBE 3OGCA 1R0AH 1Q1JH 3TJHD 4PJIB 3T0DA 4HK3N 4EXKA 2OJZH 5EUOA 3QQ4A 3VJ6A 2GJJA 1G0YR 4P5MA 8FABA 4GMSH 3PJSB 1HCFX 1LP9B 4JFOA 3EYUL 4IEFB 4XNUL 2XZQL 4AEHH 2YC1B 3JTSB 3DYPA 4FQHA 3GSXA 3R1GL 1A2YB 3KLHD 4L1HA 3UTSA 3LEYH 2XTLA 4YHML 4JG0L 3VWKD 4NYLB 3EDFA 1FCCA 2W59A 3GSOA 3B9KD 1OGAA 4YXKL 1ZHBA 2APBA 4DOHB 2A83A 1RSFA 4HFWA 2CDFB 4C56A 1ZVHA 3HNTH 2EXWC 1QRND 4XXDB 1CFSB 2DJUA 1OQOA 3QIBA 1U6AL 2PUQT 4Y2DA 4QTHB 4UILH 2YPVH 4PIRF 4MJ5B 2Y06H 3U4EB 3UJIH 1BHGA 1TVHB 3BX7C 5EBWA 3SDXA 1GOFA 1FV1B 4Q9QL 4UT6H 1JF1B 5I19L 3HLAB 2X42A 3PXHA 5KTEH 3GMPB 2IBBA 2AV7B 5CMAB 3L5WB 3ZYIA 4N5UA 5DDHA 2XNAB 1KJMB 3A6BL 3ARQA 3U36A 5EBGA 2MNUA 2OK0L 1XH3A 3R06B 4HX1A 2FR4A 1GGUA 5D93B 1GGBL 4HF5H 2YRPA 4RFEA 4XNUH 2XZQH 5L8LB 1N6UA 3R1GH 1IVLA 4OFYA 3PABB 3VG9C 4WEBH 4YIQB 4K3HA 3WBDA 2A6JA 5I71C 1IL1B 4QY8B 3SCMB 3BP5B 4XNMA 3QCUH 3STLB 2DTML 1FYTA 1A1OB 3QWOA 4YXKH 1LEIA 3AAZB 3TBTA 3C60B 2GUOB 5D2NE 3O8XD 2R56L 5F8RC 1U6AH 1H3WM 1KGCD 4L9DA 3V6BR 2UZXB 4TVPH 4U7MA 5SWZB 5BXFB 5I71B 3QBTB 3UZVB 2B5IB 5KVDH 3HZYA 1T3FB 3QT2A 4WTZA 4Q9QH 4IS6B 1FNFA 2X70A 1B0RA 4UNUA 1ETZA 4P5TA 5E9DD 5F44A 2CR3A 1WIPA 1D7FA 4NZDA 1UC6A 4L4TE 1OSZB 4K7PX 4JQVC 1C5DA 3T3ME 5CEYB 2I5YL 1D9KA 3BUYB 1EVUA 1JPGB 2F53E 1T21A 3OKDA 4LLMB 3CDFA 1I9JL 1C16B 3UTPD 3ILPA 4OJFH 1JTOA 1EHAA 1X44A 4Q6IA 4PGEB 3AFLA 1BD2D 3O6ML 2HLAB 1LNUA 3OJDA 1YPZE 4KAQL 4ZXBA 4LARL 5ERWB 5MENB 4ZQKA 1NDMB 2DLTA 5C0CA 2NW2B 4U3XA 1TQBC 2VXQL 4OCYH 5F7LB 3TBWB 3VWKC 3ROLB 4MXWH 5ISZB 3B9KC 3F12A 3VCLA 4OUOA 4YDJA 2VO5A 1N5YH 3MRQA 3IFOB 4X80H 3CUPA 4YR6A 3SKMB 1UFUA 1CLYL 4J8RB 5K9JH 1R3JA 2P43B 4H0GA 5T3ZE 3D0LA 2G5RA 4I18B 1YQVL 1P7QB 2B8OT 4EUPA 2FECL 4OLWH 4RQQB 3RU8H 1ES0B 1A7PH 1I1AB 1QRNB 1KENH 2Q7NA 4CRPA 1U3YA 4DZBB 3T08A 4X4ME 1CR9H 2ZJSH 2I5YH 1Q72L 3WHXB 3UYRL 1WIOA 1A1NA 4Q2ZA 5HHOE 4C57C 4XH2B 4K3EH 4DEPB 2GQHA 2XXMB 3Q1SL 4WHYG 1FGVL 3CSBA 5LAXA 1IQDA 4R9HA 5CS7A 4OCWH 3O81A 1L6ZA 3FQNB 1I4FA 1QSEE 1WIUA 5JXAL 1AGDA 4P5KB 4X9HA 4ONHB 2AJZA 2XKNA 4Q9BA 4P4KD 3HTLX 3FB8A 3WNLA 5IUSA 5KG9B 2VLJE 5I8EB 4JREC 1HILA 3OKNA 1FNEA 1QBAA 4HS8L 2ESVD 3ZT5A 2X4PB 3DBXA 4Y1AE 5I1EH 4JANA 3NA4A 4QLRA 5TE4H 2IQ9L 2F74B 5I16B 3P73A 1LO5A 3NFPB 5I6XB 2WBWB 3S88L 3UYRH 1LO4L 5DHYB 1NC2A 3DV4B 1MCOL 3TNMA 3B5HA 4ZFFA 1RURH 2I60H 1FVCA 5J0BA 3VXME 2WIIB 1FGVH 2L7JA 2AABL 2MKLC 1TZGL 4GW5A 3KPTA 1BAFL 3MJ6A 1OARL 3F7YB 3S97C 2X4TB 3ULVH 4TNVK 4QGTA 2JJSC 4LHUG 4G8EA 1ZT7B 2ZWLT 3JV5A 3FTGA 1YEHL 1BZ7A 3C5JA 5JZ7C 1K6QL 1Q94A 1UENA 5CEZH 2XQYK 4ZUSA 1MAJA 4PRAA 1A14L 4A6YL 3ZT6A 2QR0B 4O58L 1KB5L 1KELH 1Y0LB 3SE9L 2XWBB 2EDHA 4Y4FB 1KLFA 4JHWH 5CUSL 2I26N 5JXEA 2QADD 4ELKB 1QFWH 2CXGA 3BH8A 2IQ9H 2ZSWB 1NANI 4KHTH 5FKAA 5BW7A 3HAEA 1PKOA 4PB9H 4X7EC 1KIQA 4BFIB 2VR4A 3S88H 4UDTB 3SDCD 2AKRA 1I75A 2VDOH 1MCOH 3IDMA 3SKOB 5KSAB 1P4BL 4NWTL 4PG2C 4W6WB 3H9HA 3H9SA 1FCGA 1MCBA 1T1ZB 2KKQA 1A9BB 1AGEA 2HJFA 2X40A 3VXRE 3L3OB 4N8VG 4DAGL 2AABH 1TZGH 3BYTA 3CFEB 5BOPA 2NY2B 4DK3A 2FWOB 1P4LB 4F7PA 4RDQG 5CD5D 5IB5A 3WLWD 5IMKA 1JMXA 2ADGB 3QCTH 4P3CL 4QOKB 1PKQA 2OI9C 2C3XA 1K6QH 3MRJB 4UIMA 3DV6A 1U95A 3MRRB 5JNYA 3NOIA 2Y7QA 5DHVB 1JPFB 3KDMA 4P4KC 4O58H 1IC1A 5CJOH 1IC5H 1JNHB 2R0KL 3VXPB 3SE9H 3CZJA 2XXCB 5GS0H 5DJDA 4H26B 3MRMB 3T4AA 1FFOB 2VITB 4CVXB 4NNXA 4XPAH 3G5VA 2OI9B 2OXHA 4XPFL 5D9SA 3GB7B 1X5JA 3O3EA 3ARBA 2FL5A 4JDZA 1PEZA 1ZVYA 3LPGA 4PBWD 3S37L 5EIIA 1NGZB 2Z8VC 4Y4HA 1L0QA 1XGTA 5GS2H 1DLHA 3BEWB 1Z3GH 3BEVB 5ADOH 2D3VA 3QNZA 4DAGH 4GMTH 1J05B 4O5LL 5SWSA 5FUCE 3ARRA 5E03A 3SDDA 4M1GL 3L95B 4K07A 1QEWB 1U8OB 4X6CB 1YEDB 2PW2A 3SOBL 3QJFA 4NZTH 3UROR 1NMCC 4Z95L 1F13A 3VFSB 4P3CH 3FHQA 4JVUA 4L8DA 4Y19E 2BOCB 5D1QD 4MDIB 5TPWL 3MR9B 4QRRE 4HS3A 3NCJH 3G6JF 5HHVL 1EMTL 2XYCA 2Z91A 1DFBL 3D6GA 3BRDA 4MDJB 3T2OA 3WIFB 2P47B 2R0KH 1NEUA 5J1AA 2MQCA 3DX9B 1MELA 1E27A 3I3BA 3UAJD 3RBSA 2WLYA 1HSBA 4QF1A 4H88L 2GY7B 2P4AB 4TUOB 4XWGL 4XPFH 2P8PB 5CKAA 2CLVA 1U8LA 1RZJC 2QADC 4L4VA 3BO8B 4M8QB 4R4BB 1DBML 3DVNB 4CUCA 1P5UA 3S37H 2ZG2A 5IQ7L 1I7ZA 1KFAL 4IRSB 2EC8A 3KVQA 3O2VH 4JRXA 3RTQA 4C4KT 3WL9A 2VZ1A 4EUPH 5IVXB 2LQRA 3FO9B 5D5MB 1NKRA 3D18A 1DQMH 2AJ3A 3QWRA 3MUGA 1DE4A 3LEVL 4XI5D 5L2KE 1WF5A 2JIXB 4NRYB 3IU4H 4W4OA 5CD5C 4I2XE 3WLWC 4LLWB 3LD8C 4LVOC 2CLZB 1LEGA 5C9KA 5A2JH 5FYJE 3SO3C 1NUGA 1IM9A 1FN4A 3ZKND 3K4AA 5HYJA 3PL6A 5I1DB 3TYFB 5DJXA 1X5YA 2YWZA 2O5ZL 1DFBH 1EGJL 2HJKA 3THML 2E6QA 4LGSB 3LN9A 4NBYB 2ITDA 3BAEH 1LQSR 4M00A 2W1NA 3QDJA 4ELME 2PTUA 4AYFA 4P3DA 1I3RB 4MJIA 2GITB 1MCQA 4H88H 5ANMB 3OTTA 2CGRL 3STZA 4XWGH 2XRAL 1CE1L 1OAXH 3OV6A 1DBMH 1O5DT 4Q58C 1KEML 1EA9C 1HKLL 2CQVA 3DHMA 4OF8A 1KFAH 1CXHA 1YEEL 3PDOB 3IKCA 1XF1A 3T65A 4TUKL 4MA3B 4KHXL 2AXHA 1NMAL 3U9UA 2N7BA 3OHXB 1VFMA 4NT6B 2E27L 5JHDD 3QA3A 3HI1B 1T5XB 2DYPD 1MVFA 3RWFB 3WN5C 5GGTA 1KIRA 3ZT7A 1J1PL 3IFLH 4P46B 3V6ZA 4RGNE 5F3BB 1J8HD 5E1HB 1N4XL 3H3KA 3BRGC 4PGDB 2DMBA 1KC5H 4GRMA 4X9IA 5KSUA 1UWXK 1WT5C 4YZFF 5IW1B 1CLZH 1YEKL 4RAVB 2E9WA 3DXAD 3H3BC 1BJ8A 4KI5F 2PN5A 2O5ZH 1XR9B 1F58H 5HDOA 1EGJH 4LU5H 3VFGH 3LV3B 1BBJB 2W38A 3BPCB 4PJEB 4XC3H 5E94B 3UAJC 3U2SB 3SGJC 1CE1H 2EIEA 5B4MD 1V7ML 3JV4A 2YUWA 3MUHL 1C08A 3BPOB 3B9EA 4OCRL 2VDML 1IFHL 3D87B 3WKML 2X1WL 4N8VB 1UWXH 1YEEH 1OPGH 3O2DA 3QUMB 4KDTC 32C2A 3IFPA 5C6WH 5BJTA 3N85L 2GAZB 5F7DB 4KHXH 3TJEL 1NMAH 1KN4H 4X5XA 1R5VB 3KXFE 1KYOK 3NFNB 1S7UB 1NGPL 5CP7A 3HG1B 2E27H 5H37H 5C7XH 3KPSE 2N7AA 3FMGL 4XI5C 1U8QB 2DQUL 5GIRA 4JFDA 1NCTA 3NGBC 4PG9B 3OB8A 3HAEH 3PWNA 2FYYB 4Y5YC 1N4XH 5F7FA 4I0PD 3HN3A 1LK2A 1RAMA 3NCEB 3KPLA 4G9FA 4JM4L 1QO3A 2Q3ZA 2FLRT 2V7NA 4S10A 4YGAB 3ZKNC 1A7QL 4GAGL 2Q6WA 3MRGB 5INDB 1BEYH 2IMMA 4X7TA 1R24B 3EYQD 4GW1B 4YUEL 3VFRB 3IYLW 1WZLA 4G8IB 5D4QA 1T1YB 3UTTD 2BSTA 5FDYA 5HI5D 3V5HA 2WAHA 1S9KC 4KJYA 1B88A 4GJTB 1V7MH 4NQTA 2PTTB 4OZGB 1BMGA 5F88A 5E08H 3CH1B 3PWJA 3BD3A 4OCRH 2VDMH 2MHAA 1IFHH 5L0QC 4G6ML 4YBLC 4HPYL 1VESA 5K9QG 3GMMB 3RJQB 3FQTB 5T1KA 3RWHA 5DVLA 4HG4J 3N85H 2YUXA 4HC1A 3MV9B 3TJEH 1T04A 1IKNA 1NEZA 5GRJL 3SO5A 4RRPG 3FO0L 4HUUA 5FM5O 5C3TA 3QH3A 1HXYA 5I17A 4R3SB 3WD5L 3D1MC 3FT3B 1FO0A 5GGUA 4OZ4B 2DJSA 1DCLA 4OBSA 5IVOA 2DLFL 4H25B 2H32H 4JM4H 3GI9L 4FQ1H 1BM3L 4MAUH 4WCYL 4GAGH 3S96B 5I18L 2ATPB 1U3HA 2QQKH 1WBXA 3LIZH 1HKFA 4FZEL 3PGCB 1YNTB 3FRPA 4YUEH 3BD5A 4PUBL 1J1OL 4MB5A 4GLRH 5JW3L 1ZT4A 5I8CA 5LGHL 1A4JA 3L6FB 1UH4A 2EO9A 3QISA 1U8HA 5EORH 4FQLL 3DI3B 4AEFA 3CDCA 5B4MC 1K5NA 1AGFA 2DQDH 5HY9B 4Y16B 4WV1B 3FQUB 4P2OB 5F96H 1S5IL 5F89A 3EBAA 4HPYH 4QRUA 4M93B 2CIKA 1J0HA 1NGYA 2EIZB 1MHEA 4EDXB 1CL7I 1LE5A 1JP5A 4OZFH 3L5HA 2CK0L 2A9NH 4Z7UA 2D2OA 4OF5A 1JNNL 5GRJH 4L4TD 3FO0H 3TA3B 4GT7A 3CX2A 1T66D 4KI5E 3F65A 1FZJB 3QEHA 5HHNA 5DYOB 4PTTA 1RHHB 1XGQA 3MCKA 3JXAA 1Z5LB 1P6AB 2F53D 1P6FA 4PRPE 4I0PC 3SKJL 1YEGL 3BPNC 4HIHB 5KW9L 2QQNH 2VKWA 4RX4D 2NQCA 5ACZB 4PRIA 4WCYH 1QR1B 5I18H 1QBML 4Y89A 1AP2B 2C4FT 4FA8A 2YSSA 2KBGA 3BN9D 4L8BB 4X6EA 1R3KB 3P4NA 4EBQL 2XACC 3IJHB 3RHWF 5JW3H 5LGHH 4CL7A 4XP4L 2Y36L 3ZKXB 3CZFB 5HI5C 5IESH 4FQLH 1YMME 3D3VA 1DEDA 5CIPA 5M95B 1MVUB 4UZGA 1S5IH 4UOW1 4Q9CA 5C0IA 5IB1A 3KPRE 3TO2B 3QULB 5T3ZD 3QEGL 3T3PF 4AENB 4HQQL 5DJ2A 2JK5A 4PJHA 3LKPB 4KTEL 3JUZA 4JY6B 4O2FA 5IVZB 3SE4C 3QPXL 4PS4L 2FRGP 1JNNH 5DJ6A 4JLRA 4RDQF 2QQLL 1FNSL 1UQSB 3O4LA 3GNMH 3EFDH 3MRLA 3S5LA 1CXEA 5FHBH 2C3VB 1AHWC 1AD0A 1KIPB 2B4CL 5AG9A 5HHOD 1E0OB 2BHZA 3BT2H 4OAWA 1S9VB 1YEGH 5KW9H 4U1JA 1QVOB 3MBEC 4GRLD 2Y07H 2ZCLL 1QBMH 5C0DA 4NJAL 1H3PL 1AXTL 3ZKMD 1AHWB 1VACB 4EBQH 1S9YA 1H5BC 3D69A 4NQEB 4P9MH 4E5XB 1QSED 5TJWK 4U1MA 4XP4H 5D6DA 5FGRA 1QSFE 4AM0B 2Y36H 4NDMA 4C59B 1MRFL 4V1DB 2ZCKL 4P49A 4PLNC 4GKZB 3MBEB 4R2GD 3CCHB 3KYKH 1J8KA 1C12A 5JW4N 1WC7B 1OP5K 5D2NC 4HUVB 2VLJD 2FGWL 1QR4A 1YN7A 1F3JA 2EDKA 3QEGH 4OZGF 4HQQH 1W72B 4KTEH 4G7VL 4GFTB 3VDAA 1WAAA 2NX5B 5HVHB 1KCVL 3ZKQD 1UXWB 2R0ZH 4NRZA 5IBTL 2IH3A 4Y1AD 3Q5TA 4PS4H 4K3JL 2AJUL 9CGTA 3EOBA 2QQLH 1HEZB 1FNSH 3WXWH 2DMKA 2HVKB 4PJCE 5HDQH 4N5ED 5FA3B 3HPLB 3VXUE 4QYOA 1SY6A 2VZTA 1FFPA 1WK0A 4R96B 4QRPB 4JAMB 5KN5B 3EYOA 4NQXB 2L7UA 2CR6A 1DL7H 1PZ5B 4ZPVB 4MNQE 5IBUG 2GHWB 3FO2A 5DD1L 1HQRB 2ERJC 2ZG3A 4I77H 1OP5H 4FS0A 3GHEL 3G5ZA 2VDRL 3VXMD 1HH9B 5BV7C 5F9WB 4NJAH 1CXLA 4NKMA 2HG5B 2V5TA 4LNRB 3V2AR 1AXTH 3V52L 3BN9C 4Y5VA 5C07A 1D5ZB 2GK0B 3QIWD 2QHRH 4KKBC 3UCRA 3H0TA 1FL6B 4NBZB 2ZCKH 1KTRL 3U30C 3AC0A 4JJ5B 4OV5A 3VRLE 5BV7B 1SJEB 1PJ9A 2FGWH 5BRZB 3S37X 1G7JB 3V8OA 1TENA 4G7VH 1FAKT 3AS1A 3C6LD 5FYKE 3X12A 3NPSB 5C8JB 5K9KA 4ZYKB 4DKDC 5IR1B 5IBTH 4Q6YA 2H8PA 4CJ0A 5MEOB 4K3JH 2AJUH 1NCBL 2Z4QB 1H3GA 4WWKB 1B3JA 3GHBH 3VXQA 3WO4C 2CH8A 2P8LB 2FX7H 3BIBX 1QRKA 4IRZL 4N68A 1D5XA 3MGAA 3L1OL 4X8JB 2R23A 3CVHB 3GHEH 3VXRD 4M3KB 4HC1H 1I1CA 4GRLC 1CTNA 4JFEB 4MQXD 4JHAL 4XCNB 4YHLL 1KCSH 2MFNA 5HYQB 3NABL 3WO4B 3O4OC 1O0VA 3ZKMC 1V8HA 2C3GA 3T3PE 1FO0H 3O8XA 1CDJA 1JHTB 2N56A 4KMLB 3BP4A 1S3KH 4NN6B 4R2GC 1QLRA 1S7TA 5I9QC 4EKXA 4POYA 4GXVH 2VDLH 3KPOB 4LFHG 3U4BH 3BOVA 3FB5B 4X7SH 5D7KE 3U6RA 5FV2A 1A02N 1QSEB 1XCQB 2J1KA 2YS4A 3BHBB 4XCFH 4ZUUA 4G42A 3MC0A 2A2QT 3V5DA 3PV6A 5FIEA 3RUGA 5DGQA 1PSKH 1J7VR 4KU1A 3RWCA 3HS0B 3WIIL 4N5EC 3X11A 5F7KC 4WUUE 4CW1B 4KV5F 4D3CL 3HRZA 1QYGL 4L9LC 5DD3H 1S7SA 2OJEA 4MA1C 4F7TB 3O9WD 1VFUA 1U8PA 1T1WA 4L8SB 5E00A 1H3VA 3MNWB 5T1LD 4E42A 1LVEA 4URTB 1C1EH 1FVDA 4JHAH 4R0LB 4MMZC 1YC8A 4PREB 4E41E 4RMWA 3IFNH 3BWAB 3MSPA 4BM7A 1ZHKB 3VW3L 4X6DB 4JRYA 4OFDA 3V5KB 5SX4H 3PWLB 1XCTA 3QIWC 1REIA 2NTFA 3L3KA 4Y19D 4CVZB 4QRRD 3VWJD 4QWWC 5LWYH 3EJZD 5E4IA 1GRWA 1ACYL 3DYOA 4HWBL 3CGTA 1VFBB 5LBSL 5EIVA 1S7RA 3VFOA 5TDPA 3CK0H 4NM4H 1FBIL 2WUCL 3C6LC 2VXTL 4U6HA 5IFJB 3L7EB 1GH7A 3OR6B 1UH3A 3VMOA 4TSCL 1V7NL 4FMKA 2PCPA 3ZKSD 1ZWIA 3NIDF 4KROC 1HQ4A 5C0EA 3WIIH 4XMLH 3MLVL 2VXUH 2BVOA 2WK2A 4QXTA 1I8MB 5ETUA 3MNVB 5EB9A 3B9DA 2D7QA 3MLTA 3QDAA 5LKNA 4UQ2A 3DVIA 4J4PD 4KROB 15C8L 5DI8A 1K4DB 2NLJB 3KS0H 1CWVA 4HUWA 3SE3A 1HK6A 5L2KD 2FX9L 2J7LA 1T83A 3EOAA 1FVEA 4XXCA 1U58A 1D5MB 4M3JA 5FYJD 5E5MB 5E7FA 2PW1A 5DTFB 4NKQB 1MCDA 5JDSA 1ACYH 4HWBH 3MV11 2ZUSA 3BH9B 3IXTA 4CGTA 1ZHNB 1DUZA 3HUJA 3HC4L 3RGVD 5EBMA 3JWDH 1K8DB 5F1KC 4NO5B 3VXOA 2WUCH 1BLNA 2VXTH 1MEXL 4YH6A 4QKXB 4M48L 3MOBH 5HGBA 2Z93B 4TSCH 4LCIL 4P2RB 1NCCL 5D6CB 3B9AA 3PIQB 3FFCB 4JFZL 2EH8H 1TVDA 35C8L 1KPRA 3ET9F 1F4YH 4UDUB 4QHUA 5DVNA 1U92A 5B21A 4MA7H 3O9WC 3VFNA 5INCA 3MRIA 4XVUD 3QI9B 1D5IL 1EFXA 3KR3L 3B8YA 2CKBH 5IT2H 1RUPH 3PNWA 5FUCC 1J0JA 4P59L 2NY1D 1YYMH 1QZ1A 1MFAL 1SY6H 4LCWE 4PJGB 4X0KB 4RBPK 4RGND 3QEUB 2ADJA 3ARFD 1ONQA 3IF1A 1VGKB 5BVJA 4PJ9A 2WANA 3EDJA 2FZ3B 3MYZA 3QO1A 4MGXA 2MCG1 1JZ4A 1MCHA 1NAMA 5E2UL 3VWJC 2IBZX 3EJZC 4OD3L 1IARB 5J8OA 3AU1A 3TM6A 2A6IB 1AQDB 1GOHA 4X9GA 3ZLQC 2EDWA 4WU5B 4Z0XA 1H3TA 4OCSL 1OAZL 3S6CA 4F3FA 1SYSB 1MEXH 4M48H 4G8GE 1M05B 4LCIH 2YK1L 4LVHB 1UYWL 4Y19B 1W0VA 4LLUB 3BI9X 2XFXB 3VWJB 5ACMA 3SDCA 4YEFA 4RBPH 4M61A 2W65A 3W2DH 2AJXL 1I1YA 4U6VL 4GRWF 1TDQA 5CSGA 3FCTB 3PG2A 1WWAX 3NZ8A 5L2JB 3KR3H 4I48A 2DWDA 3KXFD 1CXIA 3MV8A 2IQAB 3C5ZD 3KPSD 1JGDA 3IXAB 2EICA 3RA7H 4CN4A 5F21B 5EC2B 2HAZA 4M9PA 3FO1A 3RZCB 1JE6A 3H3PL 2SEBB 2HFGL 1WBZA 2BNRB 2YBRB 2NY6B 5E2TH 4XPHL 4UU9A 2DQFB 3MRDB 4PJ8D 4I8DA 5EH1A 5E2UH 5B8CA 3SGEH 4OD3H 2YRZA 2VZVA 3NIDE 4WGWB 2R1WB 4MAYD 4OCSH 1OAZH 3RGVC 1QQDB 1NC4D 1JUFA 2B39A 3VA2C 4RZCB 5J7CC 4JZOA 4Z78A 5D7SH 4KZDL 2A73B 5DRWB 5CJBA 1FORH 4MCYB 1U3JA 4LNVA 4NIKB 4TVPE 2X89D 5KJRL 2AJXH 4NN5B 3ALPA 2E7MA 1CLCA 4MD5B 3MMEA 5C2UB 3QUKA 3SDAA 4XVTL 1RJLB 2LTQC 4I3RH 3WN5A 2FIKB 2V2WA 2VDKL 2M2DA 2H45A 4XVUC 1Z9MA 3I6GA 3NMEA 3VXSA 4PJBF 5H94A 3N50A 2UY6A 4H20L 5D1QA 2NY1C 2A9MH 1MRCH 1MCEA 2ATKA 3B5GA 2DJ4A 2HFGH 4RGNC 2LTQB 1JGVH 2VDQH 1UEYA 3RQ3A 5EG6C 5JIHA 1H8NA 4YGVB 1BF8A 4LLYB 2E9BA 2IEPA 3MO1B 3ESVF 1IGTA 3SGJA 4LCYA 5IB2B 4AIOA 3UDWC 3D2UA 3KJ6H 4CN6A 1Q9LA 1UM5L 3T2NH 2O61B 1KCUH 3MNZB 1WBYA 2C26A 5K59F 5F6HJ 3QUYD 1UKTA 2IANA 5L88L 2EKSB 5E8EA 5GRZA 3RWJB 2K7PA 3CAFA 3EO1A 1S78D 1I7RA 4FXGB 4OFPA 2ZOLA 4R90H 4XVTH 1RJYB 2YPLE 2X4RB 3DVGA 5J89A 4I3SH 3VGFA 5D7LA 1EZVX 3LN5B 2NY5H 4OBRA 3TT3L 1BVLB 5F6HI 1YZZA 5J1TC 4N0RA 1N5AB 1FIGH 4PRHE 3C5ZC 5DJYA 4U1IB 4KI5D 3GRWA 3QIUB 2R4SL 2C7UB 4U1KA 3VA6A 4XP9H 2IPTH 3LDBC 5E8PB 2VDNL 2MOVA 4WDIA 1CXFA 4PRPD 1GZQB 4G8FA 4K71B 5EO9A 1NGQH 4PJ8C 4F9PC 1IGJA 1EXUB 1NFIB 3WXVL 3SHSA 4BYHA 4YPGA 4EZMA 5ESQB 1A3QA 3B3IB 3OX8A 3MYJB 1J12A 4JR9L 4ORGA 5AUMB 5BMFL 3QO0B 5GS3A 4MAYC 4GRWE 5ILTL 5DJ8B 3P77A 2ZUUA 1V3MA 1P84J 4PGBB 3VE0B 2J4WL 2PXYB 4YXLL 1U3ZA 3MCLH 1YMMD 3MRPA 1XGUB 1BFOB 2LVEA 2OTUA 4ZOCA 2FDBP 4AQ1B 2X9XA 4ODVH 1KXTB 2Z35A 1T0NA 4U1HB 5HPMB 4RFOH 3KPRD 5CWSB 3P0VH 1B6DA 3BE1H 2C4XA 1U8IA 1RZJL 2RCSL 3AMKA 4F37F 2VISB 3T0BA 1MREL 2DYPA 4HKXB 5EU4A 1VB9A 3GIZL 5DMGD 5JIKA 4FHBD 3TT3H 4AJ0A 1DEEA 4LRIA 1J1XH 3ZHKA 1J8HA 1F2QA 3L9RA 2XN9E 4HD9A 4JDVA 4FQIL 3BESR 3LQZB 5CP3A 3L3DA 1JYNA 4WI3A 2Q8BL 4JZJC 1RUAH 1MI5E 1N64H 3VXTB 1RZ7L 3OMZA 3WIHL 1AJ7H 2OL3A 25C8L 3OKKB 3WXVH 4GO6B 2ADFL 3AREB 3ES6A 3X14B 4ESKA 5MEPA 1QHPA 5C08B 5TE7L 3ULVE 4JPVL 2IMNA 5EUOE 1KUMA 4KK9D 2XTJE 5I1KL 1E4WH 5ILTH 1QSFD 3R0MA 3CNKA 1MJJB 3WSQL 5IBLD 2I9TA 4YXLH 1CGSL 4PRBB 5CEZE 2VNCA 3ULUF 4PR5A 2XKUA 4F7CA 1U8NB 5DVOA 2ARJB 3UTSE 5JLZA 3QUYC 3P30L 3OJMB 1A7OH 3UC0L 4BKLB 4F15B 1FRGH 4PJBE 1JWMB 2IPKA 3FQXB 5KSBA 1S78C 1YMHA 1FG9C 3WS6C 1RZJH 2RCSH 4WW2B 3S36L 5D7IA 3ZHLA 3BXNB 1MCWW 3J8F7 3L5IA 1N7ML 1JI2A 5D72L 3VXUD 5J9PA 3IDYC 3OPZH 3FT2B 4KI5C 1CXKA 3W9DB 5ID1B 3LS5L 4PJXB 1MFDH 2E8ZA 2FEDD 3IETB 1IT9L 4MNQD 1RD6A 2GT9B 4N8CH 1TIUA 4JFPB 4F58L 3HZKB 1LD9B 4KTDH 4NKDA 4FQQB 5DQ9A 5EZOH 3GMRB 4HMEA 1A6ZB 1MRDH 4H8WC 3UTTA 5K59E 3DTXB 1EBPA 2FO4A 1T20B 3W9EB 2EDQA 3ALWA 1DQLH 5I1KH 3TP4A 1N6QH 43CAA 2GJ6B 1IGYA 3KPNA 4PJ5A 3CFBB 3OAUL 5D1ZB 4XGZA 2DQIL 4MZ2A 4M5ZL 5DK2A 3UTQA 4NO3B 1BGXL 1N26A 4LLDB 1ZGLP 1PVHA 2ZOKA 3UC0H 1YY9D 4HHAB 4LHUD 1NLDL 3HC0B 3DX7B 4P2QD 5FYKD 1HHKB 1FYTE 5HTSA 3S36H 2AJVH 4S1RH 4M1CC 3CPLA 1RIHL 1XZ0B 1DN0A 5DMGC 5FKPA 1DQQB 5DK0B 1FNHA 1N7MH 2DM3A 1JV5B 3CC5B 5E8OB 4DN4H 3WLBA 4L5FL 1AIFB 3GBNH 5EN2A 1M7DA 3LS5H 3K0WA 4XPGL 4WHTA 5EBLA 4AG4L 1IT9H 4UT7L 3GGWB 3X13B 4F7MA 2NY7H 1HOCA 1H5BA 1NFDA 1TCRB 5DEGA 5AYQA 4F58H 4MNHB 1BQHG 1FSKC 1ZVSB 5IM7A 5JORA 3PDDA 3U9PH 1MHHA 3QG7L 1JJUA 2QSCL 4LEXH 5HVGB 2VKXA 4PTUB 1F3DH 2B2XL 1HI6B 1X9QA 1FPTH 5K9OA 2BSSA 5D2NA 1HH6A 4S2SB 2BHUA 5E8NB 5DR5L 5IBLC 5FF6A 1HINL 4U1LB 3S4SA 1FSKB 4A2MA 4ODTH 1YNLL 3PWVA 1IAIM 3MXWL 4XHQA 4G80A 3PHQA 4P2YA 5C0CE 4H0HB 3F7PC 5LJYH 1DQJB 5F7NC 3TN0A 1B4JL 1NLDH 5JPNB 4QCIB 5D7KD 3I6KA 3LKNA 5I76B 4L4TA 5FO8B 1D6VH 3WNKA 4U3CA 1UWEL 3GSVA 1FH5L 1CFVL 4LAQL 5DJAB 2DM4A 3O45A 1IRAY 1HHHB 2MKWA 4WUUD 3F5WA 1JGLL 2AXFB 3P0YL 2OTPA 1U91A 5JQ6L 4AEIL 2FEDC 4N0UA 2R2HB 3DMMB 4RAHA 1TJHH 3JV6A 4UB0L 3JUYA 3LOWA 4NRXB 4OD2A 3QG7H 2QSCH 1I8IB 4HEPG 2DM7A 4E41D 3PHOA 1FNAA 3G5YB 1SYVA 4PJCB 3OWEA 4JM2B 2B2XH 2Q86A 4U4BA 1NMBH 4NKOB 2VQ1B 3O41B 5D7JA 4WO4D 3RWEA 5DR5H 4DZ8A 1IGIH 2W0FA 1HINH 3V4VH 3A6OA 4YQXH 4BQ6A 3GJEB 3MJ8A 1LMKA 3MRHB 1BOGA 1SEBB 3MXWH 2F8XC 4B7IA 5DD6B 3MRFA 4ZUTA 3HC3H 3TVMA 2OZ4A 3G04B 4LSTH 1B4JH 1YY9C 3T2QA 4DJMA 3B4NA 3L7FB 4OGYL 5KZCD 4MZ3A 1H8OA 1CK0L 4NUJB 2Z31A 1UWEH 3FRUB 1BX2B 3LKSA 2EIDA 4O2CB 2NY0B 2K9UA 3GSUA 1KG0B 3CFDA 3I9GL 5HHOA 3RIAF 3D39B 2NXZB 4ODWA 3VFTB 4FFZL 4LKXB 4CAGA 2XIDA 3I2CL 4C83B 4AEIH 1JRHH 3UPRA 2W07A 3QFJA 4RIRB 4PJXF 4C54A 2FB4L 2ICWA 4KJPC 4UB0H 4YE4H 3VRIA 5IB3B 5IK3A 2VZOA 4KKCD 4KQ3H 4PJDF 3V9FA 4HIEA 3NACL 4OI9A 3JWOC 1FDLL 2DWEB 2A77L 2GSGB 5DRXB 1KJ3L 4F7EA 1F11B 4YHKH 4C58B 3UXFA 2ZNWA 2P5WE 4OLYL 4YFLI 3O3BA 4YXHL 1AR2A 4YAQB 3RWIA 4Y1AA 4UTBL 4QHKI 3MGTA 4HPOL 4MCZA 2HP4A 5HD8D 1W0YT 4UINL 2VN4A 3U7WL 4CMHB 5IMMB 1T03L 4NO2A 3MA7B 1DQTA 3I9GH 2NYYC 1FAIL 2FCBA 3P40A 3VD4A 5D96B 5HXMA 4JKKA 1TVBA 4I0KA 4U1SA 2PO6A 2EDRA 2N4IA 3VXMA 5E5UB 2I9LA 5DJ0A 2AK4A 4YNYA 1UB6A 5GRUH 3I3EA 3VGHA 4JQIL 3Q6FA 1HIMH 3WFZA 3BKCL 1G7IA 1YNKL 1ZLVK 2XA8L 3D0VA 5HHME 4NZRL 1TTGA 2VAAB 3MFGB 4LSQH 2FO1A 3GMOB 3NACH 4LCWD 1JYVA 1V3LA 3MV7B 4WUUB 5F7UA 3HCVA 3EGSB 4KJWD 3K7UA 4K2UL 1HSAA 3H9SE 1AXSA 2ICEA 1TQCB 4WO4C 3V0VA 1EJOL 2V2TB 4O00A 2BVQB 5IW6B 4ZD3H 1CF8H 2J8UB 4R7NB 4K3DL 1IAOB 2VLKB 5DSCA 4IHOB 2AI0H 2CKNA 1MWAA 3LRHA 3LKRB 2DS4A 3U7WH 3QDGA 3BJ91 3B2UD 3LZFH 4PJ7A 1PKQE 4G8GD 4JJHA 4OLZL 4S1QH 5DMJB 5E8DL 5IEHA 2FSEB 1ZLVH 1NBYB 1EEYB 1ZSDA 1QD0A 1L7TH 1FAIH 2FECI 3JWNC 4XRCB 1LK3L 1OW0C 2RFXB 3VXNB 1A7BA 5E6ID 2VLRA 4Z7VB 1N59B 1ZTXL 3ZYOA 3UMTA 4JQIH 1OF2B 1RZGB 3M1BA 3IDUA 3OR7B 4UV4L 1VFOA 5IF0B 2Q8AL 3MZGB 5KSVA 3SQOL 4NZRH 3OJVC 4KKCC 3W39A 5KVEL 1VFAA 2YD9A 3M07A 5GPRA 3RWDA 1QPPA 4HWUA 1VEMA 2PYEB 5BV7L 4K2UH 2CXKA 3GK8L 7FABH 4ETYA 4WEMB 1YYLL 2CDGA 3KNBA 5CBAB 3ZHDA 4HWNA 4HZAA 4K3DH 4AZ8A 4N0FB 1GYAA 4NHCH 3KYMA 5IV2B 4J6RH 1Q9OB 2B0SL 1X5ZA 1KF9B 3KGRA 2E7LA 5L6YL 3PJSA 5HD8C 4LP5A 1TMCB 3FZUC 1ZT1B 5AWNL 3JTSA 3VMPA 1L9MA 1VA9A 5T3ZL 3WFBL 4M8VA 4TVPD 1A6WH 1LK3H 5T1LA 4M1DL 2K1MA 1AC6A 4GKSB 3ZSSA 5E1AB 1XIWD 4PJDE 2KZWA 4K9EC 4Q7DA 1QFWI 4YDVB 4A2LA 1H3UA 1FZKA 1H9VA 4BH8B 5JA8B 3FT4B 3QUXD 3RBGA 1TXKA 3M8OL 4J3OC 4L4VE 1CFSA 4XXDA 2UYLA 4DFHA 4QTHA 2V2XA 2CO6B 3U4EA 2H3NB 5AYUH 4OCMC 4Q9RH 3C9NB 3GK8H 4N9GB 4NQDD 3U7AA 3HLAA 4ZNEE 4KJWC 1OCWH 2MMXA 1BECA 1OM3L 3Q2CA 3GMPA 2DQTH 2XI9A 2NY3D 3Q3GB 5CMAA 1BQLL 1I1RA 4NC2B 2X5PA 2XNAA 1KJMA 1IGCH 4JY5L 4JDTL 5D1XB 3LKOB 3BP7B 4MQ7B 5L6YH 5HGAB 2DQJH 3B2UC 3B2VL 3SBWC 1NDGA 4HV8B 2CRYA 2JCCB 3Q6GH 1IEAA 1UACL 4K23L 4YIQA 3NCBB 3VFWA