3QIBD

Crystal structure of the 2b4 tcr in complex with mcc/i-ek
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
242
structure length
242
Chain Sequence
MKVIQTPRYLVKGQGQKAKMRCIPEKGHPVVFWYQQNKNNEFKFLINFQNQEVLQQIDMTEKRFSAECPSNSPCSLEIQSSEAGDSALYLCASSLNWSQDTQYFGPGTRLLVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k).
pubmed doi rcsb
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
molecule tags Immune system
source organism Mus musculus
total genus 55
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2011-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qibD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qibD01
4KJWC 3L5WA 2Z0BA 4G8IA 3M8OL 5DURB 5F9AC 5JMOC 4Y1AD 2HRPH 3ARED 1OOAA 1CE1H 1H5BC 4OZFG 3MTRA 2VNCA 3QXDB 3VFNB 1TTGA 2OP4H 1AD9B 4PJDB 3W11D 4HIXH 4P9HL 5E6YA 4LPXA 4OZHF 4UIKH 1A02N 3G5ZA 4JPKL 4K3DH 3RTQC 1D5IH 1KLGA 3G6AA 1FE8H 4XGZA 3TYGL 3KJ4B 4O4YH 1UEYA 3PWPB 2NY3C 4G9DB 5B39G 3U83A 2DLEA 2SEBA 5CHNB 4LSDA 1UVQB 1DFBL 4FQ1H 3WFBL 3V79C 4I3GA 1GZPB 3OAYK 1JTOA 5L6YL 1JYNA 4HUVB 4YFDB 1WWBX 2ICWA 2HWZL 1WWWX 2Z35A 4YO0A 3QO1A 5E8OA 2ZPKH 1BZ7A 3VI3F 1IEAA 5M94B 2BY3A 5I1AA 1AQDA 4FQPA 4G8GD 4R0LC 4KKBC 1LK3L 3LQZA 4JPVH 3EO1A 1ACYL 1IGYB 2ESVA 4MNQD 2VL5B 2WM0A 1D6VH 1T1XB 4OSUL 1F97A 1K6QH 1N64H 5EBLA 3MLSH 3GBML 4PJDF 5L8LB 3OMZA 4YHYC 1ORQA 3DVFA 2FATH 2VDOL 1LO0H 2OBGA 1OWWA 4YGAB 4WTZG 5J4MA 3C08L 3S4SA 4EUPH 4GW1B 5IJVB 3IXTA 5T1LD 5CEZL 5I1GH 4EDXB 2A83B 2IADA 1NFDB 1S5IL 3MRRA 3V7MA 5DVMA 5IEHA 5J9PA 1T1ZB 4RFEB 2WIMA 1U2HA 1JGEB 1FFQA 3HR6A 2BFVL 2KQNA 2ITCA 2QHRH 1OT2A 3T4AA 4U1NA 2D7QA 3NIDF 1GGBL 2ID5A 5DA0B 4F3FA 4ODVL 4XXDB 3UTSD 5CILL 3BWAA 3QEGH 1J8HA 1S7XB 4I3SH 5BVPH 3H42H 2CDGA 4QHKI 1G9MC 4LSTL 1F8TL 4UZGA 2BJMH 3UDWC 1WZMA 5HHOE 5B8CC 4LEOA 3NIGE 2QADB 4C58B 4ZAKC 1CLOL 1YMMA 4XH2B 2VC2L 4PJ5E 3LZFL 2BSSB 1AR1C 2X89A 2YPVL 4QXUL 3O4OC 5ALBL 5MEPA 4DGIH 1LP9B 2Y36H 2VDLL 4RZCB 3BH9B 3KXFE 3X3FH 1FDLL 3JZ7A 3M1BB 1HZHL 3PDDA 4IMLB 3G9AB 1G0YR 5JIHA 4J12A 2X05A 1BM3H 2YPKB 3VFNA 4FFZL 1AD9A 5CEYB 8CGTA 3B9DA 3MBXH 2O5ZH 2JJTC 2I9TA 2X1XR 3VXRB 3HI1B 4GKZA 3U2SA 1GXEA 2G75A 4NQCA 2Y07L 5FYKE 4IRJC 3L5XH 4NN7C 3NCBB 1CD1B 5KVDH 3GI9H 3RZCA 5F6IB 4ODWB 3QUMB 5FGCB 4XP9L 1CTNA 2AXFB 3D6GA 4X7EC 3PF2A 1KC5L 4GRMB 1S7SA 1KELL 2PXYC 3Q3GB 1A2YB 3MFFA 3MRKA 4KKNA 4HUVA 3NPSC 3EHBC 5LCVH 2HLFD 3MUGA 2P8LA 3DETD 4KV5F 2C3XA 4MLIA 5JQ6H 5I1LA 3LKOA 3ZE1E 3PUCA 3QUZA 3I3DA 1SJEB 4XCNA 4Q0XH 1H5BB 3QFJE 2EYSB 3VFGH 4HIIB 4P5TD 2VL5A 2DF3A 1MFEL 1ED3A 5E1AA 4XNQB 1T4KB 1TQBC 4XVSH 2HT2D 4YHIB 5BS0B 4I77L 3LEXA 3VGBA 4QLRA 3VG0L 4GW4B 4KVCL 4NGHL 4TUOB 1KTRL 4LIQE 2OM5A 4R96A 2ADFH 3EFDH 3SE3C 5D7LA 4L29B 3PGCA 1C5DA 3OX8B 1MJ8H 5KOVC 2H9GA 4HGWB 4UB0H 2NXYC 3DTXB 3N0PB 3NABL 4POYA 1NBZB 3U0WL 1T1ZA 1XGQB 3GJFK 5ADPL 4X4ZA 1BLNA 3EFFB 3OJVC 7CGTA 1JGEA 4KRNA 4DJMA 3ZO0A 1T3FB 4RAUB 5JPMA 3PGFL 3ARVA 1F6LL 4CMMA 1QFOA 3MV8E 4NKIL 4ALAH 5F7WC 4FQ2H 3WLBB 5JTWA 3ZT7A 3BRDA 4OB5H 4L3AA 4PY8I 4LMQE 4R0LB 1KOAA 3I02B 3TIDB 1B4JL 4YDJB 4P59H 4LCIH 1VGEL 4KC3B 4B5EA 4EZMA 5DZLA 2JB5H 4BZYA 4EKXA 3VXNA 4XH2A 5EA0H 3K0WA 3GK8H 3VFSB 1KIPA 1M4KA 2YD4A 4RZCA 3V5KB 2V2TA 5DMKB 3M1BA 4O02H 4PUBH 1MREH 5EULV 1FNSL 1KBGL 1BJ1H 1T21B 5BZWA 5C0AA 4X5XB 4UMGA 5ICZA 4ODSH 5INCA 4ZTOH 4PG2A 5CEYA 4XB7A 4PBWD 5KTEL 5J13C 4JDVB 3MRBB 2R0WH 4JRYD 3BP7B 5BW7A 2FJGA 3WV0A 4R90H 3TGXA 5E94B 1JTPA 2EDNA 5SWSE 5BV7C 4WFED 4FFWD 3TH2T 1V3LA 5T3ZD 4OLYL 4OFVA 5IROA 4ODWA 3QUMA 1I1YB 3FO1B 3F58H 4PP1C 2GJZB 3BYTA 4LF3B 4MSWB 5IFHH 3VWJA 5E99L 5CIPB 1BD2A 1F90H 5DGQA 1CG9B 3ARFA 3Q3GA 4JO1H 5B8CB 4UT7L 3P9WB 2JKXA 2X4PB 2ORBH 2PW1A 1OWRM 5HYFA 2E8ZA 3OB0H 4QXGH 1R5VA 4U6HB 2JCCE 5CJQL 4I18A 1HHGB 5JPNB 3WFDL 1U8JB 4G6MH 3KPQB 4I48B 1MJUH 4QRTA 4S1DD 5F1KC 4WDIB 5F9OH 2BOBB 1IGJB 5EU6B 3CMOL 3NACH 2BVOB 3CK0L 4R4ND 2EYSA 3FB7B 4PB9L 4IDJH 5CCKL 2PR4L 5CEZD 5E4EC 5ACZB 2ZUWA 5EH1A 4LPUA 4YHIA 3LS5H 5BS0A 5HJ3B 4LAQH 3V5HB 3VE0B 1C7TA 4GW4A 2HMIC 3RTQA 4U6TA 4NC2B 4M6OH 4IRJB 4QOKB 2BVQA 3O3DA 4OBSA 2CIIB 1YUHB 5GZOC 3MOAH 1QSFD 4OZFB 1OQOA 3H7BA 4L29A 4FN0A 5E2TL 5IBTH 1SYVB 1UH2A 5KJRH 4OGXH 1XH3B 3HNTL 2PXYB 1K9TA 1NBQA 3QA3B 4TQEL 3WE6B 1Z0NA 1J0YA 3NPSB 2D7MA 3I2CL 4U0QB 4RAUA 2EYRB 3NCMA 5IVNA 5F93C 1TJIH 3VA6A 1FGVH 3RIFF 2IPTH 2DM7A 2EEAA 2ZZUT 3WLBA 4X7TA 5B39B 2ZNWA 4PJGE 4Z95H 2IPUK 2Q3ZA 1MHEA 4R0LA 1MY7A 1ZA6B 2HRPL 2APBA 1CE1L 4O2CB 1VEOA 3OQ3B 3X3GH 3QG6B 3DO3A 2OP4L 1QFUH 3QDME 4HIXL 3DECA 5DJ2B 2ITDB 1TQBB 4UIKL 5DD5H 2DQTH 4RMWA 3QDJE 5DRNA 4K3DL 4P2QD 5F9WC 3VFSA 1D5IL 3F6LA 1A8JH 1FE8L 5E2VH 4XXCC 4O4YL 4Y4HD 5FB8B 4JLRA 4M00A 4NT6B 2NX5D 1YJDC 2ICCA 3TF7C 3OKMB 1ORSA 3SDXA 4FQ1L 2H26A 1J0JA 5D93C 1P84J 3MRBA 5J12C 1IILE 3KPTA 5JIIA 4KJYB 2ZPKL 3QISA 3AREC 4R2GD 1WF5A 2YMXH 4HUWB 3QB7C 3FN0H 1JVKA 2VR4A 1I1YA 3FO1A 3MGAA 4JPVL 2GJZA 4LF3A 4MSWA 1FFRA 5E5MA 3SDDD 1FO0H 1CI5A 3ARPA 5TGBB 3UDWA 1D6VL 2CDEB 5B8CA 3H9HA 1J7VR 1I7TB 4ZAKA 1K6QL 4KU1A 1P4BH 3CVHH 1MVUA 1N64L 3MRMB 3VXSD 4U4BA 4U6HA 3MLSL 4L3EB 1I9JH 5JPNA 4XWOD 2FATL 4N0YH 1U8JA 3WL9A 4FQIH 3UCRA 1LO0L 4OT1H 3KPQA 1IGJA 3L6FB 2CSPA 1AI1L 5EU6A 5I1GL 4K94H 2D4DA 3FB7A 2VLKE 3LPFA 1T22B 2WNGA 4DUVA 4HCRL 2CKBB 4UQ3A 5ACZA 3FAXA 5J13B 1XR8A 3BKYH 3SGJA 3OKNA 3R4DA 3PV6A 3NCYP 1XF2A 4PG9B 1JWMA 1T20A 3UYPA 3V0VA 2CIIA 5BV7B 2IANB 2H3NB 1EEZA 3T1FB 2GITB 4DN4H 2JF1A 3TA3B 2VDNH 3ULSA 1IMHC 5BVPL 4I3SL 1MCEA 4M3KB 3H42L 3LY6A 2ZSVB 2W60B 3TESA 1MLBB 2J4WH 2ZUXA 3NOIA 2HN7B 3EO9H 5A2KH 1ITCA 1XH3A 4M9OA 1XR9B 2BJML 5I8OH 3QA3A 4R9HA 3WE6A 3Q6FA 4ZOCA 5AG8A 4XNZC 4NJ9H 2EYRA 1CDGA 3S3JA 3L3GA 3IJSB 5C6PB 1GOGA 4DGIL 2EKSB 2Y36L 4HLZG 3X3FL 1NAMH 4NPYB 4LBEA 3BP5B 2EE2A 1BM3L 2NXZB 3I6LD 4PJAE 3ZSTA 4GLRI 5FOJA 3LS4H 3MBXL 4NM4H 2O5ZL 35C8H 3QJFB 3O6KH 4MNGA 2RQ8A 1SQ2N 4OZGB 2F8VA 3L5XL 1AE6H 1P4LB 1P69B 4P23A 3D85D 5KVDL 4HWZA 3UYRH 3GI9L 3ROLB 2NY2B 3SE3A 5FM4A 1PFCA 5LJYH 4PD4K 5TE7H 1N5AA 3KPMA 4XAKD 1NDMB 3OSKA 3L3DB 1U36A 5EBMB 1IGCH 1NGXA 4X6DF 2PYFB 3BPOC 4JFDE 3QEHB 2PYEE 1N59B 1WAAF 2AJ3A 5LCVL 4WEUD 3GMPB 5C70A 3U4EA 1K8IB 4GUPB 4KJYA 5JQ6L 4CDHA 4WTZA 1FL5A 1Q9KA 2IBZY 3TWCH 4YJZL 3JWOH 1H3GA 4R3SB 2P46B 4OCXH 1RU9H 1B4RA 5EBWA 4Q0XL 4ZSOB 5ESQA 4BELD 1QPXA 3VFGL 1ZXQA 2EDQA 4OD2A 4NZUH 5TGBA 3O41B 2CDEA 4TNVK 4XC3H 4L4TE 4XVSL 3E2HC 3S9DB 3PWVB 4U6YB 3MRMA 5F9WB 1RAMA 3LEVL 4L3EA 4H1LA 2V7HB 3WNPA 1FGNH 2FH6A 1UZ6F 1QHOA 3HPLA 3EBAA 2ADFL 3EFDL 4X0KB 3L6FA 1MJ8L 4Z7UE 4UB0L 4KAQH 4NUJB 2Y7QB 1IGTA 3LPWA 2HLFC 5D93B 2DJ4A 3DETC 5D2LA 3O2WH 4NO0B 2UY6A 3G5YA 1XFPA 2NY5H 2GAZA 3MV01 4LLUB 3CGTA 5IJKC 1IFHH 4APQB 4B53A 4ALAL 5CLWA 4FQ2L 4PG9A 4AEIH 4Y1AB 3AREB 1FYTE 2IANA 3CDGB 1M7DB 4OB5L 2GITA 3T1FA 1M71B 4P5TC 3QWQB 2OL3H 1FNLA 1ZS8B 1MLBA 4LCIL 2HN7A 3LRSB 1NGQH 4X9BA 1INDH 2HT2C 3RGHA 2AEQH 3QUYB 5F44A 1XR9A 2JB5L 2C4XA 3LB6D 3L3OB 2Y6SC 3OJ2C 5A16B 3AXLB 4XZUB 3STLB 5EA0L 1J10A 5GGTH 5IFJB 4LU5H 3GK8L 1DN0A 4OAWB 1EZVX 2DTMH 3AM8C 2EDLA 2J8UF 4X4YA 5IFAH 3HRPA 3RBSA 3WHE1 4AIOA 3FOMA 4UILH 4DAGH 4XX1E 3WJLC 4O02L 4PUBL 3UTTA 1MREL 1HKLL 1HK6A 2HVKB 2DJUA 2KZ1B 4GW5B 1MRFH 1JPFA 2CUMA 4QRRD 1N6QH 2YOCA 3X13A 5KSBE 4ODSL 1HHHB 4NO5B 5GS2D 2E9IA 1RQ5A 2WBWB 2XQYK 4DVRH 4ZTOL 2BHZA 1A1MB 5C07E 3RA7H 1J1OH 4J8RB 2P48B 4R90L 4G8GB 3BAEH 3HA0A 4JFOA 2ZUTA 1U95A 3W39B 1P4LA 4JFEE 2GKIA 4H26B 3ROLA 3BEVB 3F58L 5IFHL 5AZEH 3L3DA 1AJ7H 5EBMA 3ZT6A 1F90L 3WXVH 4JO1L 4P9HC 2ORBL 3QEHA 4WHDA 3UTQA 5IV2A 4XNZB 3GMPA 2EXWD 2X4TB 1S78D 4QXGL 1UCTA 5HVHB 1K8IA 3IDIB 1UXSA 1JHTA 2YUZA 2N4IA 3NFSH 5T1LB 4G6ML 1ZLUH 3RDTD 3MROA 3EOAB 4R3SA 1MJUL 5F9OL 5AEAA 2HG5B 3NACL 1MY5A 5DEFB 4ZSOA 5FYLD 1S8DA 4OQTH 5CGYD 4IDJL 4V1DE 5FCUH 3L3HB 1BWWA 1CXIA 3LH2H 4M93C 3LS5L 2P42B 4U1LB 4WUUD 3PWVA 4LAQL 1F4XH 4Y8AA 4FFWC 5E6ZA 5FKPB 3UTSB 1S7WA 1NGWB 2NR6D 2V7HA 4M6OL 5TPWH 4X99B 3MOAL 1TNMA 4X0KA 3QIUD 1G0DA 2O61A 2EO1A 5IBTL 1MELA 1KEML 5KJRL 1LO5B 2DRUA 3F7YB 3K2UH 4NUJA 4OGXL 2Y7QA 3QI9D 4NWUH 1N3NA 3BPOB 4NO0A 3CFBB 4ZUVB 3EDFA 3H0TB 4LLUA 5F7HA 5IM7A 4LOUD 4YPGB 5ESAB 2EC9U 1TJIL 4S1DC 5GRWA 1FGVL 1UB6B 2IPTL 4RMSA 5I1HH 3AREA 1XGPB 5I16A 4R4NC 4Z95L 1M71A 1WK0A 1DVFC 1VHPA 4XPFH 3Q1SH 5ACMA 3VDCA 3VXUE 4I5BB 5ANME 3X3GL 1UJ3C 4FTVD 5HI5D 4YK4C 4E5XB 1YY8A 1QFUL 3LKPA 3L3OA 4OIAA 2EIZA 2YZ1A 3E2HB 2UUDK 5DD5L 1NGZB 2DQTL 4PV8A 4XZUA 1YPZE 2LVEA 1J8KA 1FFPB 1G7MB 3QWOB 3NGBC 5E2VL 4FQXD 4M9PA 1VEPA 1DTUA 4RA0C 4CVUA 4QF1A 3RWCA 2HVKA 5GRXG 3VFOA 4NBYB 3HG1D 4QTHB 1HHHA 4G9FD 2EEBA 1CFVH 1A1MA 4KUZH 5JHLH 3HUJE 2BSTB 4M3JA 4J8RA 5GGUB 4G8GA 1PSKH 5F21B 3RAJH 43CAB 2YMXL 1A22B 2LTQB 3FN0L 4GRWE 4MNQA 4P5TB 4R6UA 1OT1A 4X4MA 5HGDA 4JFYB 1FO0L 4OM1H 2VMFA 3ET9F 4XPHH 4Y5YC 4X6CE 4WFHE 4XP4H 2AJSH 1MHCA 2VDQH 1P4BL 4Y4HC 3CVHL 1PJ9A 1CTOA 3FZUD 3ZHKA 1QLRB 3IDIA 1I9JL 2EH7H 5KZCD 3P73B 5T1LA 4FQIL 1NMCC 4G8EB 3UBXG 4OT1L 1QR4A 4KTDH 2KKQA 3IETA 4MWFB 1HHIB 1KPRB 4NC0B 5CLTA 4K94L 2AERT 5F8QC 1JZ4A 3L3HA 1V7NH 2QQLH 5HHPB 2YKLH 3IJHB 3RUGE 2E9WA 1OAKH 2DQGH 3BKYL 3HNSH 4R2GC 2HT3D 2XXMB 5FKPA 3MA9H 3UTSA 3BPLC 4MJIB 5HDLA 3V6OC 4DN4L 4UQ2A 3SDDC 4RMUA 4ZFZB 2VDNL 2MCPH 4L8CB 2PCPA 4NQUA 4L4VD 2CD0A 1IM9B 1LO5A 1CFBA 2J4WL 3DGGA 5L2KD 3EO9L 1R6VA 3S8WA 3PNWB 5I8OL 3R0NA 5C0BD 1RMFH 4YPGA 5ESAA 3C5ZD 1UB6A 5JNYA 3CH1B 3TPKA 1XGPA 1ND0A 4HS6B 3VRLE 3EJJX 1I3VA 1NAML 4C56B 4PJ9B 4ZS6D 2CUIA 4YQXL 4PRHD 2VL4A 3WN5C 5IR1B 4NQXB 2ICWI 2CLZA 4O9HH 2ZCKH 4WI8A 4DVBB 3UTPD 2GY5A 1NC2B 3LS4L 4NM4L 3L3JB 1S9XB 35C8L 3QUKB 4M93B 3IXAB 2G60H 3O6KL 5TF0A 3OJDB 1Q0XH 1BJ1J 4UBDD 3UO1H 1B88A 2CQVA 1EHNA 1DQDH 1AE6L 4LQ1A 5HD8C 1L7TH 3FQWB 2KL6A 2QQKH 3QZWG 3UYRL 5AWNL 3NIGF 1HNFA 2I25N 2XWJB 4HZLB 4WGVB 2HFEB 3IDMB 5TE7L 5E8NB 4YE4H 4QTHA 5FA3A 2DB8A 1PX3A 2DM4A 2VN7A 1IGCL 1RZ8A 5D7IB 3MGOB 1S7QB 1QSVA 1TVDA 4NO2B 3VXQB 1IKNA 2BSTA 4HMEA 1ZLVH 5IJKA 4GLRH 2N7AA 1JFQH 3TWCL 3NN8B 3MFGB 4U3XA 3TVMB 4RFNC 3IVKB 43CAA 1E4KA 1PVHA 3JWOL 4JKMA 1IQDA 4OCXL 1DVFB 1RU9L 4P5TA 5A3ID 2I60L 4S2SB 3G04B 4I13B 2YHGA 4NZUL 1I7UB 2VH5H 4YK4B 3ARXA 2DS4A 1PQZB 4XC3L 5F7UA 2Z9TA 4Z7WE 1F6FB 5DFVD 3VJ6A 2YXFA 5ID1A 3TT3H 5FA4B 1AFVH 1QLRA 2IH1A 1BWMA 1BFTA 1BBJA 3AM8A 3NGBB 2XN9D 1FGNL 4G8EA 4G80B 4L5FH 2Q3AA 5EB9A 3WJLA 4MWFA 1KPRA 1HHKB 1VADB 2EDOA 4XB8A 4Y5XC 5DJYA 4KAQL 1P1ZB 4EUPG 4XMPH 3BD3A 3QEQE 1U58B 3I3EA 3ZE1F 4AG4H 1DBAH 4PRAB 4Y88A 5HHPA 4PIRF 3I9GH 3IJHA 1MFCH 2NY5L 4D9RD 2I9LB 1N26A 2H1PH 4QT5B 1AP2A 5MI0C 4ZUTB 1IFHL 2ZUSA 3NIFE 2VO5A 1HXYB 3FQRB 5I18H 4AEIL 4KI5D 3NFPB 4RMVA 3M17B 4ZFZA 3SE8H 2D2OA 2OL3L 3VFRB 1Z9SA 2A9NH 2J3SA 3VMPA 1NGQL 2W91A 1INDL 2AEQL 3OF6D 1NMBH 1S9YB 2FGWL 4P2QB 1KJ2A 4Y5YB 1PG7X 3CZJA 3ZDYE 3NAAH 4GKNA 4Y4HB 5GGTL 4LU5L 2F54E 5I71C 3ULUE 4N1HB 2DTML 3CH1A 5IFAL 4M4RA 1SMAA 1NMCB 1FPTH 4DAGL 4U7MA 1QPPA 3S35X 1BJ8A 1N6QL 2AAVA 4YFEA 1L0YA 4DVRL 5JW3H 1KB5B 4JRYA 3RA7L 3L3JA 2DIAA 1J1OL 1QUNA 1S9XA 4PJ7A 4U2YA 5DVLA 2CO6B 3IXAA 3G6DH 3OJDA 2HT4D 3NFNB 4JY4B 3S37X 1UWEH 3BAEL 3N1GC 1RUQH 2DL9A 5FHBL 3BPLB 2YC1B 3SDDB 1WQVT 2XWJA 5I1CH 2BVYA 3WS6C 3IDMA 1DANU 1MRDL 3PQYD 3LB6C 3NH7H 5AZEL 3U4AA 5TE4L 1AJ7L 1GSMA 2KBGA 5E8PA 3WXVL 1WWAX 3ILPB 1S7QA 3VXSB 3CC5A 3ULVD 5JO5B 4NO2A 3VXQA 2BZDA 4R4BB 5C9JA 2VUOA 1MLCB 4U6VH 2BOCB 5E7FA 4LFHD 5E2JA 3DVIA 3NFSL 2PO6D 3D3VE 2ARJB 1EO8H 1U93B 3UZVB 3U7WH 5SX5H 3L3KA 5I74C 3G04A 1UJ3A 4OQTL 1I7UA 4K7FB 4NOFA 4PYHA 5FCUL 2EDTA 3G6JE 1U3HD 1OVZA 3LH2L 5C0RH 2J7LA 1F4XL 1QSFA 2GK0B 2X09A 1QRND 5DFWH 4WFGD 3MRPB 5EOTB 5LBSH 1N6VA 4WIQA 4XNXH 2H2PD 3Q5OA 2YD2A 5DRXB 1HHKA 1VADA 2YWYA 3BP6B 5IB2A 1MI5E 1OQXA 2JCCF 4NWUL 1FC1A 2EXWC 1S78C 4PRAA 3RWEA 4PJXB 3FRPG 5HXMA 1FSKC 1S5HA 4OCRH 2I9LA 4QT5A 3RDTC 4JZNB 4KKLC 4OZHA 4DOHB 4FXGA 5TQ2H 2R69H 3FQRA 2QL1A 5I1HL 1BECA 1DJSA 3QWRD 4RFNB 4W81A 3NFPA 2IGFH 4P49A 5CGYC 3M17A 4F58H 4XPFL 3Q1SL 1IM3B 2VABA 3PIQA 3VFRA 2P24A 4CL7A 1I1CA 5T1KD 1WTGT 4YDVB 2GI7A 5D5MB 2YD5A 3B8YA 3ARBD 4FQJH 1RULH 2WIIB 4NC1E 4P2QA 5EUOB 4GG6E 2Y5EA 4XCFH 2NR6C 2YUVA 4Y4HA 1QBBA 3D85B 1MUJB 2NX5A 3QIUC 2M8XA 1OGAE 2NY0D 1I75A 4PGDB 1K85A 2Q86A 3AS3A 3QI9C 1DZBA 4OFIA 1YY9D 4Z78A 1CXHA 5KW9H 1UYWH 4GXVH 4QHKJ 4LOUC 5DUBA 1CFVL 1KB5A 1J9CT 4Z7VF 3VFVA 2RCSH 4KUZL 2AV1B 4PJGF 1KN4H 4DK3A 5JHLL 2VISB 3NFNA 3UBXB 4JB9H 2DL2A 2V5TA 3RAJL 4LGSB 2OJEA 3BHBB 4H0HB 2AK4E 3V6OA 1WBYB 2Z4QB 3SDDA 2X9XA 3QPQC 4UTAH 1NCBH 3L7FA 2ZP0T 3DX7B 4OM1L 2AJYH 4LP5A 4XPHL 3VXSA 4WHYH 3BRGC 4CMHC 4JAMB 1IKFH 4XP4L 4FQQB 2AJSL 3W0WD 5JO5A 1J88A 4FQXC 2VDQL 3WJJC 4R4BA 4PPTA 1K5NB 1MLCA 2EH7L 2VAJA 4WNQB 3FT4A 3KVQA 1EA9C 3CU7A 4KI1A 1CGTA 2WSKA 4KTDL 1U93A 2DWEA 1PY4A 4PRDA 1CWVA 3WIIH 3V4UH 3WN5A 3ZMRA 3O6FB 2KQMA 3BFOA 4JGMA 1FJ1A 1CDCA 1Y6KR 3VCLB 5ITFA 1V7NL 5IEKB 2QQLL 3V9FA 2YKLL 3DMMB 1OAKL 2DQGL 1A4KA 3HNSL 2DKSA 2GK0A 3JWDC 4QGYA 5D1ZD 1TZHB 5EOTA 2Z92A 3ALPA 2MCPL 3OKKA 2F5AH 1DLFH 5IMKA 3MLRH 4WW2C 4PJXA 5TDNB 4K9EC 1H9VA 2E6QA 5LWYH 1GVIA 1RMFL 4FZEH 4JM2F 1N0LA 5ISZE 4OUUB 4JN1H 3OZ9H 2VLJB 2BNQD 5AD0A 4QRRB 4YGVA 1P4IH 2DMBA 5FUOL 3AS2A 1IM3A 1HSAB 5CP3A 1NFKA 1BMGA 5I74B 4O9HL 2ZCKL 4NKDB 3WBDA 3C87A 5D5MA 3DVNB 5HHOD 2HT3C 3RRQA 3ZTJH 5EUOA 3WHXB 2J12B 2ZG1A 5SWZE 4PJ5D 2R4SH 2CJUH 2G60L 1Q0XL 4JFXB 3UO1L 3MJ6A 1KJMB 1DQDL 3V0WH 3KXFD 3NA4A 2QQKL 4UTBH 1H3XA 4LL9A 5DA4A 4PY8J 5C3LD 4HT1H 3LSOA 1BREA 4YIQB 4Y5XA 5I6XC 3ARGC 3F12B 4YE4L 5FUCC 3ARDD 4H5SB 3P9LB 2F53E 3C5ZC 1HQ4B 4PRNB 4QTIH 15C8H 3DIFA 4M6NH 2VISA 4G7VH 3UBXA 1JFQL 1TCRA 1WCBA 4ZS6C 3TIEB 3IAPA 4HWEH 2G5BA 3SBWC 4PJAF 5JIKA 2CDFB 3BHBA 4KDTC 3O3AB 3TP4A 4ELME 5FECB 4EUPB 5J57B 2QQNH 4B7IA 1U3YA 2VH5L 4X5WA 2ADGB 4MQSB 1JZ8A 2PETA 3TT3L 1AFVL 1XF3B 4LFHG 2H32H 4HKBB 4A6YA 1RPQA 4L5FL 3MRIB 1TIUA 3KYMB 5FKAB 3KLDA 3RY4A 4QHLA 4JRXB 3QI9B 4KQ3H 3PDOB 5F1IA 4DKDC 3OKEB 3QFJD 4PJFB 5J11B 4XMPL 3KPSB 2DLGA 4AG4L 2UY7A 3WEXA 1DBAL 5JDSA 3WFHB 4D0BB 3T0ED 5EOCH 3I9GL 2BERA 1MFCL 1EK3A 2YR3A 2H1PL 4LLYB 5EORH 1PKQB 2NY1C 5DVNA 1CXFA 1HI6B 4KTEH 1E4XI 1QSZA 4P2RE 2J5LC 5I18L 2K3TA 4I2XB 4U1MB 3TN0D 3S97C 1TZHA 1W2KT 1P2CB 2DQFA 3SE8L 3EOBB 3FCTA 3WS6A 4RDQG 4L9DA 4QHUB 2A9NL 3GSOB 5K9JH 4D8PB 5DFVC 3ISWA 4OI8A 1FG2A 1NMBL 5K9OB 1UM4L 2XFXB 2X70B 4CMHB 1S7RB 1J05A 3ME0A 3NAAL 4OUUA 2M2DA 4Z7UF 4U6XB 1X5GA 5DJDA 3OAZK 5FYJU 1KPVB 3KDMB 1UCBH 4JPWH 3NA9H 2HVJB 1FPTL 1CDYA 3HG1B 3HI6H 4QRRA 2MCG1 5D2NE 1YEKH 2P4AB 3VGGA 2KUTA 3TBYB 2GJ6D 1HSAA 3GMMB 3RU8H 3Q48A 3MUJA 4HQQH 1QP1A 2VAAB 5HGAB 1CS6A 1BAFH 3DVNA 5JW3L 4WFFE 1FV1B 43C9A 4OIIH 4HAFA 4KI5C 1I8KB 4PJFF 5DK0B 3G6DL 1F3RB 4ISVB 2NQCA 4XCEA 4HXBH 5HGBA 1CDHA 3TH4T 1UWEL 2NY7H 4ZXBD 4X80H 2P5EB 3QXUA 1RUQL 3MRNA 1SHMA 4KHTH 3RIAK 2YSSA 4ZFOL 3QH3A 5I1CL 2FEEI 5DLMH 2X4UB 5F7EH 1SYSB 2FLRT 3NH7L 2FHBA 3BPNC 2VTFA 2EXYD 2MPAH 1HXMA 2EDFA 3F65A 4WW2B 2P5WB 3K2MC 5DYOB 5E8EB 5SV4A 1MQ8A 3RDTA 2EZ0D 4U6VL 5HHMD 3B2UC 1VGKB 4P5MB 2VQ1B 2COQA 2CDFA 5SWSD 1J86A 1FIEA 1EO8L 1UKQA 5IQ9B 2XKSA 5I8KH 4HKXA 3U7WL 3C6LD 1X5YA 4KKCD 4OV5A 2NW2A 2CK0H 5C0CD 2XNAB 2FYYA 1WIPA 4RX4D 4WUUA 2MKWA 3RVWC 4ZPVB 4H0IA 2R4RH 1REIA 5C0RL 3LN5B 2X1OA 4Z5RA 4HUXB 1J0ZA 1B0RB 1XF3A 3CXHJ 3QIUA 4HKBA 3T3MF 1QFWI 1UA6H 1D9KD 5FKAA 3VXTB 5LBSL 3LIZH 5L2KB 3QI9A 3SE4C 2P7TB 4XNXL 4RGNE 5BCAA 4MHHG 1ES0A 5C0BB 1ZHNB 4DK6A 3ARGB 5I6XB 3ULVC 4JDZA 3JV0A 1IAKA 3WFHA 3C5ZB 1NCNA 4QWWD 3ZTNH 4LVNC 3UMTA 1U3JA 3QQ4A 4OCRL 1PKQA 2PO6C 5C9KA 3QXTA 5IVXB 1HI6A 5TQ2L 1FG9C 4JKWA 2R69L 2E7CA 3KPPB 2WBKA 4I2XA 5MENE 1RUPH 1LWRA 1KPUB 3P4NB 2IGFL 1CDUA 3SKNA 4FTVA 3ORJA 4I0KA 4D0CA 1P2CA 4F58L 3EOBA 4NDMA 4K94C 1EFXD 4YNYB 2WWMC 4P4KB 3I50H 4D8PA 1A7BA 4KRLB 4QXWA 3C5SB 1QHPA 4FQJL 5B21A 1RULL 2GCYA 4XCFL 5E4IA 5CJBA 4FQXA 4Z9KB 5T5FH 4U6XA 4MD4B 1IZJA 4Y4KD 2ATKA 5LGHL 1KPVA 3VXOA 3HC3H 1WIOA 2H2PC 2HVJA 2JJVA 3HG1A 3X11A 4LARH 4G9FA 1X4ZA 3TBYA 3WNKA 3OR7B 4NZRH 5F1NB 5KW9L 1UYWL 4GXVL 3QQ9D 1YMHB 2EYTB 1KN4L 1FV1A 4UNTA 2NY1B 3CFDA 3QDJD 3P4OB 3HKFA 4JB9L 1BP3B 3WFCH 2EDKA 2IF7A 2J5LB 2LQRA 3VFTB 3I85A 4OFYD 4BZ1H 1EZVY 1FYHB 5DJCB 4NQDB 3MRLB 4UTAL 4ETQB 4U33A 1NCBL 3ZKMD 1YPZF 4HLJA 2H8PB 2AJYL 1LQSR 3BO8B 4WW2A 3NCCB 3MO1B 1WT5C 1IKFL 4BUHA 5HDOA 5DYOA 2NY0C 2XN9B 2BXZA 2VN4A 1V3JA 4M1GH 2DQUH 4LP4A 4S1SH 1YY9C 2EE6A 3B9AA 5DR5H 5IQ9A 4MZ2A 1KXVC 4XPTH 3GBNH 1GOHA 3QCTH 4KMTH 3WIIL 3V4UL 3FT3A 5HSFA 2DD8H 4CUCA 4F15C 2XNAA 5AZ2H 1OAUH 2C9AA 3BKJH 1U8IA 1BIIB 1CXKA 5I1DB 1JV5B 4NSKA 3BGMA 2XA8H 5JW4R 3MCG1 5SWQB 4DEPC 5DK2A 4WHTA 2AGJH 3FQNB 4GXUM 3JWOC 4L4VA 3VD7A 3VXTA 1N6UA 5L2KA 3PWNA 4JM2D 3QO0A 4LKXA 4X6CF 5M7QA 2P7TA 4WTWA 3QEUB 1DLFL 1ZHNA 1I7ZB 5C0BA 3HE7B 3BPNB 5J6HB 3MLRL 2AKRB 2VXUH 2B39A 1K4DA 5IOPB 3CDFA 3UTZA 5KN5B 3FFCE 3C5ZA 2XG5A 2HKFH 5LWYL 1GGTA 3D87B 4FZEL 2WINB 1TJGH 3TCLB 5TDOA 4BYHA 5IVXA 4JN1L 3OZ9L 3PHOB 4NRZA 4LLQB 4PRHA 3C8HA 1DN2A 4KDTA 1KV3A 1Y6NR 4EQ2A 1P4IL 1WV7T 2OJZL 3RUGF 3BUYA 3EZJB 4Z0XB 4LSPH 2Y23A 4YNYA 1T6VN 4M5YH 1BQHG 5D6CB 3VFWB 4F7MA 3T0XA 2XKUA 2NY5C 1JZ6A 5DJ0A 5EU5B 3CH8A 2R4SL 2CJUL 1FNFA 5D1ZC 4XT1C 4KDWA 1ZLSH 2YA1A 1RZIB 5A43C 3V0WL 4ELKB 3RY6C 3IDJB 2W92A 4UTBL 4ZNCD 3MACH 5J7CC 4HT1L 4IOIB 2VXTH 4MCYB 3OR7A 1FO0B 3O9WC 3U36A 2DAVA 2EYTA 3VRLF 4QTIL 4LVNB 15C8L 4M6NL 5GRZA 3RNKA 3VXMD 2PO6B 1I4FB 3CVHB 4G7VL 3TBSA 1YA5A 4HWEL 2RHEA 4AQOA 2UWEA 3T0BA 5D8JH 5DJCA 3MRLA 5IB5B 2VLRB 3W5NA 2X4RA 2WAHA 2QQNL 2AVGA 1XIWD 1MCNA 2FO4A 2H8PA 2Z93B 1G9MH 1T6WA 4RMTA 2YA2A 1QG3A 4ODUA 3MJ8A 2PYED 2BNRE 1QRNB 4OUOA 2OSLA 1OPGH 4FQHA 3VRIB 3MJ7A 3HE6D 4L3CA 2K7PA 3ARDC 4KQ3L 3TZVB 5DSCB 1C16B 4JDTH 4P0DA 3UPRB 4KTYA 5I1JH 5HGHB 5SX4I 1VDGA 1FQ9C 3N85H 3IKCA 3IFPB 4L4TD 5EOCL 5EORL 4PJEE 5EZOH 3PE9A 1MFDH 2EC8A 5J06A 3K74B 5JHDE 1WZKA 4KTEL 1JPTH 2AK1H 3QNYB 1WSST 3WFEH 2PTVA 4FFVD 1RSFA 3MV9A 4RCAA 5IK3A 4F7EB 1NAMB 3MSPA 4QHMA 3OF6A 3QEUA 3U9UB 1AKJD 3GI8H 5J6HA 5KN5A 1U92B 2GTZB 3P0GB 4GOSA 4RNRA 4MAYC 4OLVH 1ITBB 2NY0B 1D5ZB 2IPKA 1HH6B 1AH1A 1MAJA 1YQ2A 3TT1H 2ZKHH 4HKJB 1UCBL 1KIRB 3NA9L 4JPWL 3Q6GH 1FYTD 1YEKL 3U0PB 3T0EC 4HQQL 3NIFF 4N0UB 4F15B 4RDQF 1BAFL 3LD8C 4JG0H 4GQ9H 3VFWA 1G7HA 4PJCB 3GSRB 4OIIL 5EU5A 5AYQA 3TN0C 5IHZB 2YD8A 3KWWB 4HXBL 4E42B 2GW5A 1RZIA 4QCIB 3EZ8A 2NY7L 3QAZC 5JORB 4X80L 2RBLA 4TN9A 3BRFA 3PG2A 4GRLD 2VRAA 3PQYA 4KHTL 3NCEB 4GG8A 3IDJA 2YZ8A 4PGBB 2AQ3A 3SE4A 1R3HB 3ZDYF 2VWEE 5DLML 4IOIA 5F7EL 4RQQB 1YEJH 3P40A 1FO0A 1T66D 1LD9B 2MPAL 4M5ZH 3W0WB 5B4MC 1A3RH 3ULUF 5C07D 2ZUYA 1MCSA 2EIEA 2O26U 3R8BB 2I26N 1I4FA 3CVHA 4WI7A 1OCWL 3CFCH 4NQSA 3UPCA 3SQBA 3BZFB 3ZYJA 5IB5A 4JFED 5IG7B 5E24E 2A6JB 5GJSH 3ZDXF 2R23B 1U3HA 1D6EB 1KLFA 2CK0L 5C3TA 3PXJA 5IKCA 2Z93A 3C6SA 1HN1A 1BZQK 5CKGA 2R4RL 1WJ3A 2CIKB 3OWEA 3OAUH 4ZXBC 5D1ZB 4O58H 4CNIB 4EBQH 1KTDA 4JY5H 4H1LH 2YD9A 5ERWB 1UA6L 2H45A 3PWLB 1NH6A 4PJCF 2EXYC 5T3XH 3WO3B 2OL3B 5DSCA 3SGDH 4KROD 3IB4A 3UPRA 2FJFB 2CRYA 4NHUB 1KNOA 4F9PC 1GC1H 3O9WB 5DMIH 4V1DD 3STZA 5BRZB 2EZ0C 3GRWA 3QHZH 3IFPA 2BVUA 1QFPA 3QWRA 2BNQB 3T77B 5LGJA 3QNYA 2CRZA 2YN3A 1RUPL 1PW3A 2DBLH 3C6LC 3NCJH 4F7EA 4KKCC 5CINH 5HYJE 5T1KA 1T89C 1J8HE 2VE6B 1BVKB 3ARBA 5K9QG 1DQMH 5IBUG 3I50L 3KYKH 1Q94B 1QFWH 1WISA 1YECH 4M7LH 2O93L 5KS9B 1YMME 1WT5A 4CN6A 4NQTA 1JNHB 2A74B 5H94B 1D5ZA 4K3HA 5T5FL 1D9KC 5EZJB 4Z7OF 1NUDA 2LE9A 3HC3L 4EQ3A 1KIRA 2ZSWA 4FRWA 2P8PB 3V8CA 4LPCA 3ILQD 3CSGA 4LARL 3BVNB 2FZ3B 1UQSA 5C09D 5D1XB 5CEXB 3VXUD 4NZRL 4QWWC 2Z8RA 4PJDE 3QULB 5FO7B 1TVBA 2XYCA 1VKXB 3OXRA 4YAQB 1FZOB 1BBDH 2H6PB 3GSRA 1IL1B 1EAPA 3TO2B 3RWFA 3KWWA 4E42A 3WFCL 3CFKB 1JYWA 5JORA 3PWPE 4BZ1L 1LE5A 2LAGB 2ZJSH 4ZODA 2B4CC 4BH8A 3CFEB 3O4LD 4PGBA 4GG6F 1R3HA 4OLWH 3P9MB 1ZT4B 3JTSB 4RQQA 4E0RA 3W0WA 2ICWJ 2HFTA 3IGAB 3KHOA 2EICA 4MAYB 2X9WA 5DD0H 1K3IA 4RBPH 4IRSD 3P77B 5J8OA 1FVEB 4M1GL 2X4QB 1FVDB 2DQUL 4Y4FD 3LVEA 5DQDH 5KVMC 1SVCP 4S1SL 1H0DA 4PV9B 5DR5L 4XPTL 3GBNL 4NNYB 5IG7A 1IEBA 3VFUB 3KYOB 3KLAB 2A6JA 3QQ9C 3QCTL 4KMTL 4X83A 3V5DA 5A1AA 4MYWB 5FV1L 5BOPA 1M7IA 2R23A 5FGRA 2VSDA 3T0EB 2DD8L 3SO5A 1D6EA 1R3KB 2WQRA 5GSVB 3HR5B 5AZ2L 1OAUL 2IQ9H 3BZ4A 3BKJL 1JZ5A 4WFHD 4JZJC 2CIKA 3QG7H 4LNVA 3TN0B 4QRUB 3VFPB 5D1ZA 4P48A 4CNIA 1MJ7H 4IRZH 3U7AA 5J3HC 3GM8A 3QAZB 2AGJL 3ZKMC 5ECJE 3RY6A 3PWLA 3NMEA 1MRCL 3RY5A 1VFMA 1BQHB 1NFDE 4PTUA 3TPUB 3VWKB 5EOCJ 1R5IB 3G5XB 5DHYB 5CBEA 2WQ8A 4NHUA 1ZHLA 1IAIH 2VXUL 1A6WH 4JHAH 1NKOA 3FB6B 2XZZA 5KBNC 2HKFL 3ZDZE 4HPOH 4LCWB 1TJGL 3PP3K 3O8XD 5FAAA 2BNQA 4GAFB 4D2NA 5HBBA 1GIGH 3OR6B 1EDQA 2VKXA 3IJYB 2GJ6B 1GGYA 1P6AB 3DSFH 2DKMA 2C1PB 2VE6A 4MA3A 3S96A 3QQ3A 5HHOA 4LSPL 2JIXD 4I9WE 5GGRB 4UOW1 4M5YL 1NANI 4PJ5A 1QFHA 5KS9A 2R15A 3S98A 2FL5B 1JNHA 1ZOXA 4ZXBB 5H94A 3KXFA 1ZLSL 5GIRB 2AS5M 1LP9E 4NBXB 3TV3H 1OSZB 4P5KA 3RWGB 6CGTA 2P8PA 3ARDA 1QBLH 3MACL 3BVNA 2FZ3A 2VXTL 2W9DH 2X1PA 4O2FB 4PP2A 3QULA 5FO7A 5D6DC 2VITA 4C57C 2ARWA 5HHMB 4YAQA 1FZOA 3P11H 3VXRE 3GFUA 4WEBH 4XRCA 1IL1A 1FVCA 1LEKA 2HTKD 3TO2A 5LVEA 4OI7A 2PTUA 3FB5B 3MUZ1 4HULB 4ORZC 1N2RB 5D8JL 1X5HA 5FGCE 5C0CB 3S36H 3P9MA 4HPYH 1ZT4A 4JY6B 3BN9D 4JJ5B 1QRKA 3NZ8B 2Y9RT 2Y5TA 3DWTA 1G9ML 4LASH 3HAEH 1UWGH 1P9MC 2OQJA 3MR9B 3HCVA 4XVJH 1ZVSB 4KUCD 4ZOBA 3RVUD 1OPGL 4WHYG 1D9KB 1H8NA 1G7JB 1FVEA 1T7XA 3AAZB 4NRXA 4X7SH 3CD4A 3QFJA 4XVUD 4BH7B 4NNYA 3VFUA 3IFNH 2B8OT 1ZA3B 4JDTL 5IT2H 1ZT1A 3T0EA 2ZCHH 3PHQB 5EIQA 1PG7H 1R3KA 5I1JL 5GSVA 4K3GA 5TH2B 3ESVF 3N1QC 5K9KB 4GMTH 3N85L 5BS0E 1PEZA 1CF8H 4F33A 4LVOC 5EZOL 3TN0A 4U7KA 4QRUA 1MFDL 3VFPA 1T7VA 3MUHL 4G7YH 2A0LD 2AK1L 3WFEL 3IU4H 3ZYZA 3OXSB 5F3BB 3S35H 1EFXB 1XIWC 3F7RA 2Q1EA 4LGPB 1BQHA 4UT9H 1F6AA 1R5IA 3H9SB 3G5XA 4Z76A 3GI8L 2DWDA 4KJPD 2J88H 4PLJC 3QEQD 3V0AC 3HPJA 4OLVL 2A6KA 1U41A 3S37H 1G6RH 4NKOA 4MCZA 4WV1C 1ZGLA 3HE6C 5ICYA 4OGAD 1VENA 3OR6A 3TT1L 3E6HA 5CWSB 2ZKHL 3B9KD 5SX4H 4I4WB 5DMYA 5HYQB 4MNHB 3Q6GL 3T3PF 4AEEA 1C12B 2GHWB 5DRZA 1QQDB 3MNZB 3F7VA 2H2SD 1IGMH 1ADQH 5GGSB 3GZKA 4HGKC 2VZSA 2X1WL 4DFHA 2W07A 3PL6D 4ZUUA 3UBXI 1WBXA 5KOMC 4GQ9L 4WENB 3EJZD 1UM5H 1C5CH 4Y5VC 4JZJB 2FL5A 4TVPE 5DXWA 1H3PH 4ZXBA 4OZ4A 4FFVC 3ZE2E 2HJLB 1CZ8H 1JF1B 1G9NH 3ZTJG 2I5YH 5GIRA 4J1UB 3I6KB 1HOCB 1KCKA 4HK0B 4KVNH 4LSVH 4EIGB 5HYIA 1S9KC 1BQUA 4MQ7B 1YEJL 4F8TA 1Z3GH 4F9PA 4M5ZL 2R0LH 1A3RL 5C0GB 3GSQB 1OP5H 4BSWB 3O3EB 4CADB 3V6FB 2FD6H 2B5IC 3DBXB 4U2ZA 5SWSA 1OTTD 3KG5A 3CFCL 2D7PA 3FB5A 1NEZA 2WBJB 1NCDH 4DKFH 3C6LA 4ORGA 3DV6B 5H8DA 2YWZA 1T89A 4U49A 5C0CA 4RX4A 5GXBB 1OB1B 4KZDH 1MJJB 5GJSL 1LDSA 4JY6A 2QR0B 3NPZB 3NZ8A 5KVGH 3MR9A 3QDGB 2C26A 3AU1A 1TPXC 2JCCA 2X6MA 3MRGB 4QKXB 4GRLC 1D9KA 4O58L 1HH9A 4Q6IC 4EBQL 3BH8A 4FXKB 3QNZA 2DMCA 3AAZA 4JY5L 2ADIA 4PJIB 2YUXA 4LCYB 3GSNA 5EZLA 1RUMH 4BH7A 2W9EH 5EU6E 5IBUB 4WO4D 1T66C 5T3XL 3GSXA 2FRGP 4G42A 1ZA3A 4X9GA 1YEIH 1GC1L 4YR6A 5DMIL 3S4SG 1KGCD 1JGVH 3QHZL 1SEQH 3N1PC 3B5GA 8FABA 5ELIA 4ZS7H 2Z31D 4QOKE 1A1NB 1KCSH 2DBLL 3MRQA 4OF7A 3NCJL 1MAKA 3OXSA 5CINL 5E8DH 5E03A 3RX7A 1EFXA 3OGCA 1M7XA 4P9MH 1D5MB 1L0XA 1T0MB 1DQML 4BQBA 3TNNA 3IFOB 3J7HA 3KYKL 1QFWL 1YECL 1I9IH 3ECBB 4AYFA 1RZ7H 4M7LL 4K8RD 4CN1A 4PR5B 4NQEB 4Y4KA 2EH8H 1KJ2H 5F89A 5E95B 5A2IH 4PJBB 3IAQA 1RURH 2IBZX 1J18A 3FOLB 5CWSA 5HYQA 4D0DA 4BSVB 4KROC 2IH3B 4JKLA 3EJYD 2G2RB 4XBGB 1C12A 4OI9A 4ZFOB 3O3UN 3QJHB 4GAYB 3MNZA 3D18B 1KXTB 4EVNA 5FYJH 1RJLB 4Y2OA 4IJ3B 3TBTB 3H3BC 3VXMB 4UIMA 1A6TB 3QDJA 5EU7C 3CFJB 1CQYA 2R1XB 3RIFK 3U30C 4JZJA 1XGTB 1BBDL 4JR9H 4LVOB 4OFYA 1EEQA 2HJLA 1JWUA 4OD3H 4HS3B 5BXFA 3RFZC 4M7ZB 4BKLB 5L7XH 1MCOH 1OGAD 1JGUH 3I6KA 5T3ZH 1UFUA 4JEGB 3V4PH 4JVPA 5LQBH 1QR1A 3DX6B 2ZJSL 3MREA 4HK0A 1XIWB 3DRTA 1ZVHA 4HIJB 1WC7B 1EO5A 4ODXA 4OLWL 4MQ7A 4GAJL 4S0SD 5C0GA 1RY7B 1I3RA 3O3EA 2FBJH 5DD0L 3V6FA 2WANA 4CADA 5MHSD 4X8JA 5MERB 4N8VA 3DBXA 1PGRB 3HE6B 3ILQC 1HCFX 5DQDL 2WLYA 2AK4D 3DV6A 4FHBD 3WD5H 4GKSB 1OHQA 2Q6WB 5IIEA 1K2DB 4L4TB 2UYLB 3KNBB 2IQ9L 2NTFB 4HBCH 4PRPD 4Y5VB 3QG7L 4JREC 2XWBA 2CLRB 5D1QD 1HINH 1QTYT 3GMOB 4JM2A 1MJ7L 3GHEH 4IRZL 2P8MA 1U42A 4PJIA 1AKJB 3ZT5A 5IVZB 3E6FB 5FM5O 3NCFB 2DDQH 3IU3B 1BQLH 2DQCH 2BY2A 3BN3B 3DXAB 1YJDL 4M61A 1IAIL 1A6WL 3R0MA 4JHAL 4IRSC 4YEFA 3MYZA 3EDJA 4OIBA 3LV3A 5J6GB 1IAOB 3FQXA 4V2CB 2B5IB 4HPOL 1NFIB 1Q1JH 4Y4FC 3O81A 2NY6C 4YBLC 4LAJH 1ULVA 3P4MB 2IANE 1U3ZA 3P4LA 3PWUA 1XCQB 3DSFL 2C5DC 1T0MA 5F9JB 3RPKA 2ZCLH 4DW2H 2EDBA 5DGRA 3FO9A 2GY7B 3WLWD 4FABH 1QZ1A 1UXWB 1K8DB 3IFOA 4M8QB 2PW2B 3ECBA 1A3QA 1CGXA 2DN7A 1TPXB 2C3VA 5ISZD 4FA8A 1F4WH 4GRLB 4PJBA 1A5FH 1KLUA 3FOLA 4P2CG 2VDMH 3DLQR 4OTXH 3TV3L 2AJUH 1JWSB 2IH3A 1A7PH 2G2RA 1RZGB 1QBLL 4PJAA 3ABZA 4HS8H 3REWB 4K7PX 1RJLA 5FYKU 2W9DL 1IC1A 3TBTA 3HC4L 4HC1H 3VXMA 3LQAH 3O8XC 1A6TA 1XCTB 3CFJA 2MMXA 2R1XA 4TSBL 2BDNL 1XGTA 5I0ZA 4WEBL 5SWZD 3DVGB 2R1YB 5SV3A 4H8WC 1NANH 4P4RB 4JFEB 4OZGE 4B7LA 3MV7D 4M4PA 4P46B 4DZ8A 1AD0B 5IHUH 5F71A 5CBAB 5IMOB 4HJGB 3DX6A 1U8NB 2HP4A 1G7IA 3S36L 1WC7A 4HPYL 4LSUH 4UDTA 1EHLH 2PYEA 3I3BA 2F74A 5CSZA 3JBG7 4LASL 1UWGL 4FNLH 2APVA 2IALB 2F53D 3TH3T 4XVJL 1N5YL 2Y06H 5MERA 5HI3D 1A14H 4WV1A 1LO4H 3HE6A 3T1WA 3MLZH 2E7BA 4X7SL 5GRVK 3TBVB 1PX4A 2MFNA 3M07A 5C0DB 4MD5B 4ZO8A 2XKNA 1K2DA 4P57B 1I3GH 1E28B 5IT2L 5DHVH 2ZCHL 4K23H 4L4TA 2MQCA 1PG7L 2UYLA 5T3XD 1CCZA 4TTDD 3INUH 2J8UE 3KNBA 1ZHBA 2HTKC 3O45B 5EN2B 1YQVH 3VI4E 1VEMA 1KULA 1OTSD 4GMTL 3OKOB 3U30B 2Y4SA 4Y5VA 4NO3A 1CF8L 3IFLH 3K80A 1I1AD 5ACLA 3KJ6H 5MEOB 3GMOA 4G7YL 2A1WH 3IU4L 2VLMD 3L5JA 1PG7W 3RWDA 5JOPD 4Z7UA 1BFVH 1AKJA 3BN9C 3S35L 3E6FA 3QIWD 3E0GA 3STBA 3P3YA 4Y16D 4HH9A 4L9LC 1EHAA 3BMVA 5EBGA 1RJZB 4UT9L 1X5XA 1VESA 3PWJB 2A77H 3FAWA 2J88L 2DQHH 3RVUC 4NYLB 4HG4J 1EEYA 4N0RA 1IAOA 1FLRH 2WV3A 3S37L 3DV4B 1G6RL 1NFIA 3PHSA 1FYTA 2DQDH 3MOBH 3G5ZB 3MNWB 4P2RD 4LPWA 3SJVD 4Y1AE 1QLFA 1KLGB 4IOFD 3BDBA 4YX2H 4JQIH 1HILA 4XGZB 5C09B 3VD9A 3D2UD 4YHMH 3LEYH 3L7EA 5F9JA 4PJEF 1IGML 1ADQL 5CKAA 3RX5A 2SEBB 5CP3H 4MJ6B 1UXWA 2Q76A 5IW3A 4NN6C 4B50A 4PJ8D 4YHZH 4KRPB 3D25A 2A0LC 1C5CL 3U1SH 1H3PL 4JREB 3B3IA 4U0RC 2ICWB 1FZMA 1CZ8L 1G9NL 5HDBF 4GRLA 2I5YL 4Q6IA 2VZ3A 3QO1B 2N7BA 3O4LB 1EMTH 1BZ7B 2LU4A 1JWSA 1A9BB 1TJHH 4OZIB 2ED9A 4KVNL 3CUPA 4LSVL 5KSBA 1OGTB 2AJXH 5EO1A 5AUMA 5C07A 3LQZB 1LE9B 1Z3GL 4ONOA 2ESVB 4BFGA 1VFAA 2ICEB 4IRSB 1XEDA 4OGAC 2FD6L 4Y4FB 3B9KC 3CNKA 3DVGA 2BRRH 2NY6B 1RZKC 4G8GE 1P7QD 3MA7B 4JFEA 4P4RA 2QV2A 2H32B 4PBXA 5KVEH 1AD0A 1NCDL 1TQCC 2H2SC 4I0PD 5IMOA 4DKFL 4AIXA 2VZ1A 1WLHA 1A7RH 4RIRB 4XPBH 4KZDL 3IXTB 1EPFA 1PBYA 3EJZC 4HZAA 4WI3A 4BK5A 2XI9A 3V6BR 5KVGL 4WWKD 4XC1L 3MRRB 4F37F 4L8BA 5IEHB 1XF4A 3KGRA 2IALA 2FJHA 4F8QA 3O2DA 1EXUA 3L5IA 4M7KH 3TO4D 5TF1H 4QNPE 4OCMC 2ITCB 4RGMC 4ODBD 3TBWB 5CZXC 2VXVH 1CR9H 1RUML 5EU4A 4A6YH 2W9EL 4HIHB 2ENSA 5C0DA 4F3FB 4MD5A 4V1DA 2Q20A 4X6BB 5IROC 5CJ8A 3BWAB 3FB8B 4P57A 4PGZA 4KXZH 1YEIL 4M43H 2Q87A 4A2MA 1HWHB 3O8XB 2BHYA 3O45A 1DR9A 1OTTC 4HKZB 3ARFC 1JGVL 4LEOB 1SEQL 3R1GH 3MLXH 3OJMB 4NM8H 5ESVA 1VERA 5MEOA 3UTSE 2Y1VA 1DQJB 4ZS7L 3SEPA 1KCSL 5MEPB 4ONFH 3NCYS 5E8DL 5HHNA 4P9ML 5IGXH 5I9QC 3PDGA 3KPRD 1RJZA 4XHJD 3MLWL 1A4JB 2NY4D 5CD3B 1IAIM 3PWJA 4BZ2H 3RL2A 1I9IL 4NYLA 1QEWA 1UG9A 5ABDE 2EH8L 3DV4A 1KJ2L 1KCLA 5HVWA 5GGVY 2I9TB 4PRBB 1F4AA 3D9AH 3MNWA 4C54A 1RURL 4WO4C 4GKZB 3U2SB 2G75B 4X4XB 4NQCB 1IAMA 5MEND 1T04B 2W9LA 4KMQA 4E41E 5C09A 3MPCA 3H9ZA 3VXUA 5ANMA 3RZCB 3MQIA 5LG1A 4X7CC 5GS2H 2ZOLA 5FYJL 1CICD 2ZUQB 4MJ6A 5J1AA 4F7TA 1S7SB 2Z31C 3MFFB 3MRKB 4PRIE 4JR9L 3U82B 5C6WH 4OD3L 5JW4Q 2V9RA 3MUGB 2P8LB 3O4LA 5L7XL 1MCOL 5T3ZL 1JGUL 3UROR 4B0MM 5I1LB 1SJHB 1WIUA 3LKOB 3V4PL 3QUZB 5LQBL 1A9BA 1F2XK 4OZIA 2DJSA 4L9LB 1OGTA 1OW0C 1EHXA 4XCNB 4K8RC 4JGJA 1LE9A 4LK4A 3HUJA 2R0ZH 2ICEA 4IRSA 1ZT7A 3EYUH 1ED3B 2FBJL 2X1QA 5E1AB 4DFIA 4Y4FA 1L9MA 3EJYC 3LEXB 3MA7A 1S7UA 5KANG 2H32A 3VH8G 1T80A 4PGEA 3WD5L 3WDIA 4R96B 5FYLH 4RIRA 4JFPB 4TULH 5D7LB 2H41A 1C5DB 3PGCB 3CDYA 2H9GB 2W0FB 4X6CA 3RHWK 4QRSA 3TFKD 3RNQA 4F7CB 1CL7H 4HBCL 4EN3D 1BLNB 2QSQA 3DURB 1EUTA 1HINL 1FNGB 5JPMB 3GHEL 4CMMB 3GUTA 3TBWA 4JFZH 3EYFB 1AGCA 4HIHA 2DDQL 4H1LG 1BQLL 2DQCL 4X6BA 4OF6A 1JMZA 4PJHB 3FB8A 2A6IB 5A2FA 1JUFB 1UH4A 3SPVA 3EGSA 2JJUA 2AEIT 3O8XA 4HX1B 1WGOA 4HKZA 4YUEH 3S5LA 5T5NF 1Q1JL 3B9KB 3VXNB 2KH2B 3GDBA 1GZQA 2R2EA 1FL3B 1DQJA 3RWHB 2R2BB 4MJIE 1E4JA 1KIPB 1TQCB 2C7UB 4X6FB 2JIXA 3EO0A 4XWGH 5B38A 2V2TB 3QUXD 3TLRA 4LPTA 3MJGX 2ZCLL 4WW1A 4DW2L 1MCRA 1YN6B 4FABL 1A4JA 5BZWB 5C0AB 5CD3A 2B20A 5ICZB 5D1QC 5INCB 1B3JA 3ROOB 2LU3A 4OFKA 4PRBA 3MLYH 1F4WL 1OP9A 4QYOA 3SGJC 1NFDF 1A5FL 5HPMA 1RHFA 3FMGH 4X4XA 1HIMH 2FJGB 2VDML 4RGMB 4OTXL 1T04A 2AJUL 4C56E 4NP4H 1A7PL 2R39A 1W0VA 3WUWG 2VQTA 3D0VB 4HS8L 4R8WH 3ZDZF 1R3IH 1INQA 2YUWA 2R9HD 1MCFA 1JYXA 3SKOA 1QSED 4HC1L 3VWJB 3LQAL 3A6BH 3MXVH 1NEUA 1BD2B 2YN5A 1JIBA 2DLFH 1Q0YH 3ARFB 4O00A 1KB5L 5D96C 2X44D 1QVOA 4DKAA 3RJQB 3AGVA 2PW1B 4MHHI 1F4YH 2EIDA 1R5VB 5CUSH 2Q7YB 4I18B 1SJHA 2AXHA 3JWDH 5IHUL 5IB1A 4YWGH 3WDJA 3WLWC 3CX2A 4QRTB 1AGBB 4WCYH 4L9LA 1QD0A 2V5MA 4N68A 4LSUL 2ENYA 1EHLL 1CGWA 2RB8A 5C08D 5D7IE 1LP9F 3RPIA 4FNLL 5E9DD 2PTTA 2Y06L 4K9EH 2ERJC 1A14L 1I8IB 1LO4L 1MH5A 1VFOA 3MLZL 2E6PA 4WO4B 3RTQB 1X5LA 2BVQB 3O3DB 1V3KA 4P23C 2NY3B 2DIBA 5CEZE 4JFPA 3H7BB 1I3GL 2IAMD 2W0FA 4K23L 4MB4A 4Z7WA 4WI5A 3INUL 1NDGB 4F7CA 1YQVL 2PNDA 3AB0C 1TNNA 2Z31B 4ZNEE 3IFLL 4JN2A 2V5SA 3DURA 4EEEA 1HYSD 3MGTA 4MB5A 1E4WH 4UU9A 3KJ6L 4JFFD 4P3DB 1FNGA 5FO8B 3B43A 2A1WL 2Q8AH 4MA8H 3TNMA 1BFVL 3EYFA 4X7TB 1KIQB 3ALXA 3DGCR 3RQ3A 3QEQA 1MHEB 1Z9OA 2JELH 2FR4B 4PJHA 2A6IA 3L9RB 1JUFA 4L1HA 2K1MA 2A77L 5HI3C 2DQHL 5BOZG 4HX1A 1SMOA 1AXSB 4EXKA 3GMRB 4LSSH 3B9KA 1XZ0B 3MOQA 3CFIC 1T03H 2DQDL 1OF2B 3MOBL 1P6FA 3FKUS 5JHDD 4HWNA 5DVKA 1FL3A 5DRNB 3RWHA 2R2BA 1X5JA 4YX2L 4YHYB 2C7UA 1Z5LA 4JQIL 4X6FA 5FF6B 4JLRB 4YHML 4BJLA 4ONHA 3LEYL 4TTDC 3G08A 3PL6A 1YEGL 5DJZA 4ONGH 1OTSC 1YN6A 3V52H 1ORSB 1ROWA 3WYRA 1GC1C 3SDXB 3PGDA 4ZUSA 1I1AC 1J1PH 2H26B 4CU7A 4YHZL 3QXAA 5FYJD 5TDPB 1WEJH 3ROOA 2XZQH 3U1SL 1L6XA 1OGAB 3BPCA 4UNVA 2NYYD 3QQNA 5LXGH 3QIWC 1LEGB 4Y16C 1Q72L 1EMTL 1TJHL 2XPGB 3D0VA 2L0DA 3MNVB 1OAYH 2AJXL 1CBVH 5T1DH 1IC5H 3EYSH 4XCYA 4X7DC 5E5MB 1PKOA 1CDBA 2OMNA 1A9EB 3H9HB 2GUOB 1MHPL 2RJMA 3V7AG 1RIVH 3UJJH 4ZAKB 2BRRL 1NCWH 4M62H 3TJHD 2AK4B 1MVUB 3IS0X 2Q7YA 2BNUB 4HK3N 3O4OB 3VA2C 5KVEL 3V6OE 3WL9B 4PB0H 5JQHC 3L5HA 1AGBA 1A7RL 4LVEA 4PJ8C 4XPBL 1NC4D 3ZE2F 4LLWA 5DS8B 2O5YH 2QLVB 4PRPB 4JQXC 4PLOB 5D1QB 3VXSE 1ZKAA 2VZTA 3RP1A 4UQ3B 2QQQA 4M7KL 1I8IA 4Y19D 5TF1L 1XR8B 3SDXF 1XGYH 3OKNB 1ZMYA 1KCRH 3PV6B 4WO4A 5D2NC 1XF2B 2NZ9D 1RK1A 4NOBA 1JWMB 1T20B 2VXVL 1CR9L 3V0VB 1KEGH 5C0EA 4NN7B 4A6YL 1EEZB 3UJTH 4HD9A 3ULSB 3G6JA 5EDXA 3QR2A 1TZGL 4M43L 1U91A 5E2WH 1CVSC 1NDGA 4LMQI 5D96B 2WP3T 2Z31A 3R1GL 3Q6FB 3A6CH 3MLXL 4MA7H 4I0PC 4NM8L 2X4OA 4P3DA 3HZVB 5FO8A 1RVFH 3L3GB 3VD4A 2W38A 1P84K 2OI9C 1UKTA 3JVGC 4ONFL 3REVA 4Z7VE 3UZEA 1KIQA 1KTLA 4WWKC 4WUKH 5IGXL 1OW0A 2R2HB 2FR4A 4LBEB 3W82A 1FAKT 3L9RA 1J1XH 4BZ2L 3TO4C 1U0QA 3H3KA 3V6ZA 1JTTA 3MCKA 5C92A 1AXSA 3MRDA 1RZJC 3GMRA 2ERJB 4XCCH 1XZ0A 3CCHB 4DOHE 3D9AL 5I0DA 1B0WA 1OF2A 4GFTB 1OP3H 5DQJB 4MNGB 3PXHA 1I1FB 5JLZB 3B9EA 2QJDA 1KJVB 4TUJB 1D3CA 5FF6A 3I6LE 5HYJD 1JHLH 4P23B 5I15H 2ZNXA 4HWZB 5F1SA 4DUWA 3EDDA 4ZOAA 1FAIH 1TETH 1N5AB 5D5ME 3KPMB 4GG6A 2DQIH 2NXYB 4J3VA 5EUOE 3H7LA 4D94A 5TDPA 1NGXB 2FLBT 3AB0B 2D3VA 3MV7B 1OGAA 3VH8B 5JDJA 2AJ3B 5L0QC 3U4EB 2WUBH 4WU7A 1LEGA 3VGFA 1VB9A 1JYVA 1FL5B 1Q9KB 4XAKE 4XHJC 3RVXD 1U8MA 2NY4C 1MCIA 2XPGA 1ZWIA 3MNVA 2UVEA 1ZLWK 5IMLA 5EBWB 3W11C 5ESQB 2XZCH 3G5VB 3ULVH 2HJFA 4OD2B 1BX2A 3PV7A 1A9EA 3EYUL 2RGSA 1JPGA 4OF8A 2GUOA 3FFDA 1HQRB 3LRGA 1HKFA 5E0QA 2QTEA 3X17A 2AK4A 2BNUA 1H15B 4H1LB 3PWPD 2D03H 1CICC 3HPLB 5FHAH 5FYLL 2ED7A 3C2AH 4TULL 4JQVC 4X9IA 1RFDH 4IEFB 5EPMB 1CE6A 5DS8A 3KAAA 4PRPA 4XNUH 4HHAB 3T2PA 1I1AB 1IGTB 5D1QA 4XTRD 1KF9B 1JPSH 1CL7L 5D2LB 1OD9A 3G5YB 1CDIA 2ZG2A 2GAZB 2IBBA 3ZKQD 4Z7QE 3F5WB 3QIWB 1QLEH 2QHRL 1T1WA 4JFZL 1AC6A 4G6KH 3D69A 2W65B 3OAYH 5KG9A 3R8QA 5EFIA 3QEGL 3MX0A 1FH5H 3HFMH 3ARSA 4BFIA 2AJVH 4MD0B 4YUEL 5AAWA 3Q0HA 4P2RB 3SJVB 1I9RH 3EW3B 3E1F1 2VDKH 3GRWH 3LKRB 5I66B 2GSGA 3HZVA 5IW6B 3WUWB 1J0HA 1DN0B 4X4YB 4ZTPH 3FOMB 3I75B 1BVLA 5F6HJ 3UTTB 2R2HA 3TFKC 4ODTH 1H3WM 1ONQB 4EN3C 1PDKA 3V95A 4F7PB 2IMMA 3WS3A 1JPFB 3X13B 5ISZA 2APWA 3OBAA 1E6JH 5E4EB 1A7QH 1S7TB 1P7KA 3CCHA 3MLYL 4RISH 5DQJA 4G5ZH 1I1FA 4YHPB 1YC7A 5JLZA 2VLJE 3FMGL 1HIML 1DL7H 2ZOKB 1KJVA 4QRRE 4TUJA 4NP4L 4JFOB 1U95B 25C8H 2HH0H 4R8WL 1R3IL 4R26H 3K8KA 1WBZB 1PZUB 3KLHD 5ENWA 2V7NA 4J3SA 3A6BL 3MXVL 2OYPA 5SWZA 5IMMA 2DLFL 2QADD 1Q0YL 1T7YA 2KPNA 3MV7A 4N0CD 3VH8A 4I0PB 3UTQB 5IV2B 1F4YL 1YC8A 5CUSL 3DHMA 1UXSB 3QUXC 2OI9B 1JHTB 3JWDL 1IZKA 4YWGL 2UZXB 1A3LH 3MROB 1UWXK 1RJYB 1VFBA 4WCYL 3H6JA 3MLTB 2F53A 3K8MA 1JRHI 3G5VA 1S8DB 3HS0B 1MVFA 2FIKA 3BZEB 3AROA 3NTCH 4K9EL 1KG0A 3VXRD 1HQRA 5K9QI 1G9NC 4JFHD 1MF2H 2P49B 4ELMA 2WWKT 4JG1H 2XRAH 1H15A 4AJ0A 1S7WB 2QSVA 4PS4H 4CU8A 3MZTA 4MJ5A 1T1YA 5EPMA 2O61B 2LV4A 4HHAA 4OZGF 1I1AA 3EAKA 5DHXB 2X4SB 1N3NB 5FCSH 3JTTB 3MLUH 5L2JA 1E4WL 3F5WA 1IKNC 5IM7B 5J12B 3QIWA 2IWGA 4Y16A 2Q8AL 4MA8L 1OL0A 3KPRB 4IHOA 1F3DH 1DE4A 1O7VA 4JRXE 4R4FH 4RGOH 5I16B 2NY4B 1E4KC 2W65A 2JELL 4PJFE 2BC4A 2MSPA 3KPSE 4LQFH 4P59L 1H3UA 2ATPA 1YY8B 4MD0A 1Q9LA 1Y18A 4P2RA 3SJVA 3LKPB 4RAVB 2EIZB 4LSSL 5EO9A 3LKRA 1T03L 1U8HA 2R1WB 5I66A 4M7JH 4PV8B 3D2UA 4MXVE 1EGJH 1Q9OA 4I2XE 5IW6A 3WUWA 2GT9B 4G6JH 2IAMC 2CH8A 3VI4F 1CICB 2NZIA 3I75A 2OXGA 3RBGA 4QF1B 4PJ8A 3RWCB 5F96H 5GZND 3D48R 1ONQA 4ONGL 3VFOB 3V52L 4F7PA 4NHCH 1HYSC 1FCCA 1J1PL 4JQXA 1WEJL 4Q58C 2XZQL 5BZDB 4NNXA 1S7TA 2V9TA 1XGRB 5LXGL 1BEYH 2R0WL 4YHPA 4NKMA 5D2NA 2ZOKA 3HG1E 3MODH 5FM8A 4KKBD 1EVTC 5K93A 3GJFH 1TTFA 3WHE0 1OAYL 1T2XA 4MNQB 5HGDB 4EDWH 1WBZA 5JA9A 3GMNA 3SY0A 1CBVL 5T1DL 1IC5L 3EYSL 2VKWA 3HAEB 1BF2A 3E3QC 1WITA 1A1OA 3T3ME 1JGLH 1P7QA 3RWJA 1P53A 4TVPD 1RIVL 3UJJL 1MHCB 1AGFA 4I0PA 5FYKH 3TEUA 1NCWL 4M62L 3DRQA 5F70A 3BKCH 2P5EE 1LEIA 2YD7A 3GIVB 4PGCA 3JVGA 4J7RA 1CFTB 4UUJB 4PB0L 1S9WB 1GHFH 1RJYA 4WWKA 3MLTA 4GO6B 3IETB 5DQ9A 4EN3B 2O5YL 4K7PY 1LK2B 4RWHA 3TO4A 2NYYC 2P5WE 3HS0A 3EOTH 3FHQA 3BZEA 2PUQT 2XWTA 3B5TA 1JHKH 1XGYL 5T1MA 2NTSP 5CZVH 1FRGH 1QACA 1KEGL 1W8NA 2XT1B 3UJTL 4UQ2B 1CGSH 4HXAH 3SDCD 1SJXA 4LNRB 2PCPB 4HBQA 5C0IA 3DGGB 2E3VA 5E2WL 4N9GA 4LDLB 2X4SA 3TJHC 2DTSA 1G6RB 3SO3C 3A6CL 4XPAH 3JTTA 4MA7L 4PYGA 4LIQH 1RVFL 3QUXB 1TMCB 4ZPTA 1LILA 3KPRA 5JNYB 5L2KE 5C0JB 1C8PA 1ND0B 5DZNA 3BJLA 4WUKL 3FONB 1UB5A 3BT2H 5C0BE 5FUCE 1OAZH 3QFDA 4QNPF 3SCMD 1EVUA 3SKMB 1J1XL 3EKCA 2CLZB 2BFVH 2V17H 1BVZA 1X7QA 4RAVA 2NZ9C 4XAWH 4XCCL 5MENA 1JCKA 2R1WA 1YNKH 5IVXE 4CVZB 1OARH 5F7NC 3KS0H 4QOKD 2OLDA 1DUYA 2GT9A 4JHWH 1YN7A 4R7NA 1CICA 3UTPE 1JHLL 1QSEB 5I15L 4FQLH 4JQVA 2C3WA 3KPNB 1FAIL 1TETL 1Q9WB 5DFTA 1FLTX 1G7LB 2DQIL 2PXYD 3LZFH 5FA3B 1SBSH 4M02A 1YYMH 2ZUUA 1RZ8B 5BZDA 2K9UA 1FDLH 1XGRA 2VZVA 4CBPA 1C5BH 3RHWF 2WUBL 3K4ZA 4U3CA 2EECA 3OPZH 2HKHH 3MRJA 4MAUH 5IQ7H 1UT9A 1IQDB 5C08B 4DN3H 2MKLC 3MMEA 3KR3H 1BFSA 2ED8A 5E9DB 2XZCL 3ULVL 4YBQD 4ZUWA 2VB5A 1RK0A 1T5XB 3HAEA 4H25A 4KKAD 1T2QH 1XAUA 2AABH 2Y07H 5JW4M 3RWIB 1FP5A 3VJ6B 3X14B 5ID1B 3HZMB 1O7SA 1W0WB 2IH1B 3GIVA 1BBJB 2D03L 4NQDE 4N0YL 1CFTA 4UUJA 5GRUH 1S9WA 5FHAL 3C2AL 1M1SA 1RFDL 2QSCH 4JFQB 5GHWH 1BHGA 4EN3A 1NUNB 5DJYB 3CSBA 1LK2A 4XNUL 4OM0H 3LQAC 3QDHA 4L1DA 1JPSL 2C4FU 4LEXH 4JFFB 3X12A 1DUZA 2XN9E 1KJ3H 4PREA 2WMPA 1FZJA 3RVXC 4KHXH 2VOTA 1AP2B 4Q2ZA 4DGVH 1QLEL 1OD7A 5CAYB 3DYOA 2D31B 1NGYB 5TE6H 1II4E 4G6KL 1QYGH 1CT8B 3D39D 3GSNH 2JK5A 4K71C 5J89A 2VXQH 5DDHB 1G7QA 4LNRA 1FH5L 3HFML 1TITA 1NCTA 2NNAB 4GH7B 2AJVL 2R29H 2YPLD 1J12A 5JHDB 4FMKA 1I9RL 1G6RA 1KJ2B 2VDKL 3GRWL 4XWOC 2IQAA 4GKNB 4HF5H 4HJJH 4NJ9L 2YD6A 3DYMA 3QUXA 4Y89A 4K7PH 5CP7B 4ZTPL 5C0JA 5J1SC 1MCLA 4JJHA 2B4CH 3FONA 4MXWH 2N1KA 4ODTL 4XTRC 1ADQA 3SKMA 3DOSA 4OCSH 1KSRA 1R24B 1YNTB 1SJVA 1E6JL 3EYVA 1U8KB 1A7QL 1A7NH 4JRYB 3IF1B 4ZYKB 4PJ7B 2DLTA 4CVZA 3OB0K 4RISL 1AXIB 4G5ZL 2YXMA 3U0TB 1DL7L 1WFOA 5GSRB 2J6EA 4U31A 3W5MA 3TA3D 5A2JH 1QSEA 25C8L 2HH0L 1HSBA 5DC9B 4R26L 4S1RH 3KPNA 3LHPH 4LLMA 3RX8A 1Q9WA 5LAXB 5DJXA 1G7LA 3PJSA 2P1YA 5E8PB 5FEBA 3I6GB 1MCWW 4RFOH 3CC5B 3SO3B 5C9JB 2WP3O 4WRLA 2X9YA 1B90A 3GM0A 1A3LL 2BX5A 5C08A 2KDGA 4FQCH 2VLLB 2XQBH 2NXZD 4OV6F 5E9DA 3AS0A 5GS1A 4YDKH 3L3KB 1UJ3B 1T5XA 4Y19B 3OTTA 2VUYA 1U2CA 5C2BH 3NTCL 3RWIA 3ARUA 5IB4A 3IT8D 4KK6D 4KFZC 1FORH 1YEDB 1ZV5A 1MF2L 2YA0A 3C5JA 5EC1B 4OLYH 3X14A 3HZMA 1O0VA 3IDGA 1W72H 1U8QA 1QSFB 1SY6A 1W0WA 2XRAL 4JG1L 1A0QH 4PS4L 3GSUA 2VLRE 3KLHC 2IAMA 3L95B 2NY2D 4W70A 5M95B 2FX9H 3VDAA 2QADC 4JFQA 2AV7A 4LRNH 1KENH 3B5HA 3OGOE 3EDKA 5IB2B 4N0CC 3JV4B 3C9NA 2DQEH 4JFFA 1M05B 1QRNE 3RWEB 2OTUA 3O2WL 2E7MA 1NQBA 1EIBA 1S5HB 3MLUL 3VU2A 1EFQA 1JRHH 5F3HA 4LHUD 1XF1A 1R3JA 2MQ3A 4OZHB 4FXGB 2D31A 5D7IF 1NGYA 2OTPA 2A2QT 3QCVH 3QXVA 3GB7A 1CT8A 3CPLA 4N0FB 4R4FL 4RGOL 3QCUH 1UM6H 3WMSA 1F58H 1F2QA 5DDHA 1NBYA 3MV9D 4KK8D 2VABB 3PIQB 2P24B 4LQFL 3OG6B 4K3EH 2NNAA 1FFOA 5JHDA 3HI5H 4NJAH 4NCDA 2HFFB 1EGJL 2ADJA 2NX5B 2BCKA 3SGEH 4G6JL 5CP7A 3L3IA 4UILL 2Q86B 2YBRA 4GJTB 4AY0A 5F96L 1D5BA 4Z78B 1MRFL 5IB3B 5CGMA 4CJ0A 4Z8FH 1R24A 1YNTA 2E5EA 2G9HB 5DUBB 1U8KA 3VFVB 3IF1A 5E5UB 5HHQA 2V5YA 1JZ2A 4ZYKA 1G84A 1YNLH 4APQD 4R2GB 3ZDXE 1BEYL 3U0TA 1HDMB 1ZAGA 3S3SA 2IJ0C 5HPOA 2MOVA 5GSRA 5I8CA 5GRJH 3MODL 5C0ND 2OJEB 4K71B 4C59B 2BVPA 2J1KA 4EDWL 1EUUA 5DTFB 4RMRA 4N0UE 1MQKH 5LAXA 4E9LA 3L7FB 3QUYD 3BQUD 3P30H 1HHJB 3I6GA 1JGLL 3OG4B 4I1NB 4PJCE 5I8EA 1AGDA 2IFGA 4WU5B 2X7LA 5FYKL 4X7FC 2F5BH 4MX7A 3BKCL 4YHNA 2V6HA 3FQUA 3FT4B 1NC4A 4XP6H 4UAOC 5GZNC 1GHFL 1GYAA 1N7MH 2DWEB 4PRDB 2VLLA 3SDAD 3W0WE 5DHVB 3WN5B 3QNXA 4K3JH 5JZ7D 4Y19A 3EOTL 1FJ1B 5ITFB 5CJXA 4HV8A 3HB3D 4PTTA 5KVFH 2XTJD 1YEDA 1A4KB 4FOMA 1JHKL 5EC1A 5H2BA 4AH2A 5CZVL 4QHNB 1V5JA 1FRGL 3L95A 5TPWL 1Y0LB 1Z9MA 2HYMA 1UJTA 2Z92B 4U1SA 1CGSL 2E27H 4HXAL 5I17B 1QKZH 3OKKB 5BVJA 4Z7OE 2D9QB 4J4PD 5IMKB 3K2UL 2FWOA 3JV4A 2RAMA 4HSQA 1I8LC 5F7FA 1M05A 1NCCH 4D9LH 2EDRA 1X5FA 4XPAL 3CMGA 1JN6A 4LIQL 3JV6B 5T33H 4MVBD 1A7OH 2C1OA 1AI1H 3BW9A 2ZUVA 1OSPH 3U46A 3O6MH 4KZEH 3WNMA 1RHHA 4C55A 4N0FA 4BQCA 5AD0B 4YGVB 4HCRH 4GT7A 3BT2L 3WIHA 3MV11 1OAZL 4JO3H 3SKJH 2BP3A 4JRWA 1T5WB 2V17L 5BRZE 1ZHKB 1UZ8A 2AJZB 3LCYA 4QRQB 4CW1B 2BNQE 4XAWL 2HFFA 1YNKL 1OARL 3GMLA 5HYJA 3BD5A 4YFLI 1E27A 4JHWL 3UTOA 1RV6X 3SDCC 2WWKO 4JANB 4J3XA 1R3LB 4FQLL 3LSOB 4Y5XB 5IB3A 4HC1A 3W81A 2C4FT 1SBSL 5E2UH 1YYML 5KS9E 4P2YA 5B3JE 2G9HA 1MEXH 2N56A 3DIFB 1ODAA 1C5BL 5HDQH 5MI0B 1HDMA 1TCRB 1WCBB 2G5BB 1PSKL 3OPZL 5I19H 4PJXF 1MCWM 4E41D 2HKHL 1QBAA 3SCMC 3QXDA 4MAUL 5IQ7L 4PJDA 4DN3L 5HI5C 5DTFA 3KR3L 5DO2D 2JB6B 5DF0A 4AQ1B 2LABA 1T2QL 1HHJA 4X5WB 2AABL 3UYOD 1NL0H 4PRID 4WU5A 3PWPA 4G9DA 5I2IB 5D5MF 5I71B 1DP0A 5CHNA 1UVQA 5EUOF 5GRUL 3T4YB 4A6YB 2PKDA 1GZPA 4GSDH 4QHLB 4Y2DD 2QSCL 1IBGH 4XBPB 5F1IB 5GHWL 5DHVA 2UUDH 4XP1H 4OM0L 4U3HA 4LEXL 4M1DH 3WEXB 5JDSB 5CJ5A 1JP5A 4WGWB 1KJ3L 3O2DH 4KHXL 2DMKA 4HWBA 4LLVB 4DGVL 3K4DA 3MA9L 1D5XB 4QHNA 5TE6L 1IGYA 3BP4B 4J3WA 1QYGL 4POZD 3GSNL 1Y0LA 4YBQC 1T1XA 2DQFB 4RA3A 2VXQL 4KKAC 3FCTB 3T0EE 5I17A 2OZ4A 4CJ1A 3QIBD 1Z6JT 4W4OC 2Y6SD 2R29L 1CLZH 3LEVH 1FG2B 4WJ5B 4LPVA 4WY7H 3FZUC 3LKQB 1J05B 4NNPH 1F3DJ 4KK9D 3JV6A 4LHUG 4HF5L 4HJJL 1QA9B 4L4JA 4GW1A 3BIKB 5IJVA 3BZDA 5DJDB 4EDXA 2A83A 1NFDA 4K7PL 4UAOB 4OGZA 4RFEA 2B4CL 5E08H 4MXWL 5FGBC 4FFYH 4OFPA 1X44A 4Z7QF 4WTXA 1T5WA 4OCSL 1ZHKA 2AJZA 4QRQA 3H3PH 5DJ8B 3V2AR 4LCWE 1A7NL 4CW1A 2OR7A 43C9B 3LKSB 3A67H 4XXDA 1RJCA 4XCEB 5HGBB 1YEEH 4W6XB 1S7XA 2GJ6E 1G7PB 4MJID 1ZLUK 4JANA 4Y7MA 1OTUD 3MRNB 4NZTH 3SOBH 1L7TL 1R3LA 2YSSB 3QH3B 4S1RL 1IM9D 1J0IA 3LHPL 2AW2A 7FABH 2BSSA 1M6OB 2B0SH 3D5OF 1HXMB 1LGVA 4RFOL 5INDB 1LP9A 1UKSA 3BH9A 1FSKB 3RDTB 1HKLH 4IMLA 4LDEB 4WEMB 5FV2A 1I85A 3NVQA 5FYKD 4C56D 4PJ9D 2YPKA 3BE1H 3SKUD 4FQCL 1ZANH 2XQBL 4HKXB 2JB6A 1F11B 4YDKL 4OLEA 3CLFH 3VXRA 4OV5B 2NW2B 3HI1A 1NC2D 2FYYB 5HHME 4WUUB 2GIYA 2D9CA 4UV7H 5C2BL 3BKMH 3OL2A 4UBDC 1FORL 3T8XB 4Z5RB 1CD1A 3TA3C 3BIBX 1W72L 5I2IA 2AXFA 2WK2A 1A0QL 4GRWH 3QIUB 3QP3A 4GRMA 3SDCB 2A9MH 4JO2H 3T4YA 5C0CE 2EDDA 1KIUA 2FX9L 3KLSA 1A2YA 5HTSA 4EI6B 3N50A 4XBPA 4LRNL 2JE8A 1ES0B 1KENL 1DEEB 4JDZB 1IAKB 1B6DA 2BHUA 2DQEL 3T3PE 3DX9B 3M45A 1MCPH 3QQ4B 1SJEA 1JRHL 5F7YC 3OKDB 4G6FD 4LLVA 3TVMD 1D5XA 5CSBA 1H5BA 3QCVL 4HIIA 5EWIH 3BP4A 2NXZC 5A3IC 3SCMB 3ARRA 1DVFD 3AC0A 3QCUL 1UM6L 1X6LA 3SKNB 1F58L 4FTVB 4D0CB 3EOYG 2DM2A 4XNQA 5I1KH 1T4KA 4NDMB 3ZE0F 4S10A 3F62A 3DUHA 4K3EL 4KK6C 2QEJA 4ETYA 4TUOA 4WJ5A 3HI5L 2MJWA 4NJAL 3LKQA 3BI9X 2GCYB 1HCVA 3JUYA 4FQXB 5DZOA 1IE5A 4P3WA 2NY2C 2YS4A 1QA9A 3BIKA 3OX8A 4H8WH 3WO4C 3MV8D 4HGWA 2ATKB 1KEMH 2R56H 1KACB 3VXOB 3DTXA 3TC9A 3ARQA 4R9