3QINA

Crystal structure of hiv-1 rnase h p15 with engineered e. coli loop and pyrimidinol carboxylic acid inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
148
structure length
137
Chain Sequence
MYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIITQWIHNWKVKNVDLVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Binding Analysis of Pyrimidinol Carboxylic Acid and N-Hydroxy Quinazolinedione HIV-1 RNase H Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Transferase, hydrolase/inhibitor
molecule keywords Gag-Pol polyprotein,Ribonuclease HI,Gag-Pol polyprotein
total genus 43
structure length 137
sequence length 148
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3qinA00
1RCHA 4CFAA 4J2BA 3LAMA 3LP2A 2FBXA 1NK5A 1BGXT 3T3FA 3HP6A 1KVCA 4KV8A 5CYQA 5KTQA 4YFUA 3OYHA 3HXMA 4HHTA 4DQSA 1Z26A 4Y1DA 3AVMA 4CECA 4DQIA 2BGGA 1ASWA 4AHUA 2WOMA 2B6AA 3KKSA 1RTHA 3DLEA 4CJ4A 1B9DA 4DTOA 4F3OA 3V6DA 5J2MA 1X9SA 2E4LA 1D9FA 1KFDA 1RDBA 1RBTA 1NKCA 1FXXA 1KLNA 1Q8IA 1HQUA 3LPUA 4E0DA 3NGZA 1TK8A 3V9UA 1JL1A 1LW2A 3QIOA 2P51A 5SZTA 2G8KA 3PO4A 5FROA 3SNNA 4Z4FA 1C0UA 2KZMA 1IKWA 3AA3A 1ASUA 2HHQA 1NKBA 1L3TA 3U3YA 4TSXA 3SUNA 4RW6A 5C42A 4W5OA 4J2EA 2YHAA 3AVCA 1WSIA 4LH5A 2IDOA 3WNGA 1QSLA 2E6LA 4FJ7A 1JL2A 4RG8A 3I8DA 2EX3A 3KK2A 3MAQA 2HNYA 3VN5A 5FRMA 2G8UA 4KFBA 4KPYA 4FLZA 2Z1GA 5DK5A 2Y1JA 3TI0A 2F8SA 3ZSQA 1UAXA 4ELTA 3QEXA 1NK8A 1NJZA 1YTAA 4Z0UA 2HHSA 1HRHA 4IG3A 3WNFA 4DTNA 1VSKA 4F2SA 1BIZA 3S3MA 4B9UA 3I0SA 4N56A 4CJEA 2Y1IA 4W5RA 4E1MA 1RDCA 5KGWA 3AVFA 3AVHA 2HHVA 1NK6A 1L3VA 4CGIA 3P1GA 4BE2A 4DTMA 4M41A 1TAUA 3BGRA 3AVJA 3ZSXA 4IKFA 3JSMA 4FJJA 5C24A 4CHQA 3MEEA 1FKPA 2ZE2A 3HVRA 3RTVA 4DF8A 1ITGA 4KI4A 4DFKA 4QAGA 4KREA 4CJSA 1BHLA 4OKJA 4N5SA 1XC9A 1KFSA 4W5NA 1IKVA 4IBNA 3OYKA 4BDPA 3RMDA 1HYZA 4G1QA 4E7KA 4M3UA 2KW4A 4M42A 1LWFA 2VWKA 4EZ9A 3OVNA 4KTZA 1NOYA 5CZ1A 1K6YA 2Z1IA 3ZCMA 4OLBA 3AA2A 1REVA 4EZ6A 1VSIA 4KHNA 3V81A 4ID1A 2I5JA 4FZYA 4NCBA 1JLBA 1T03A 3VQ6A 4C8LA 1SV5A 4O44A 3B6PA 4UQGA 5EU7A 1RT7A 2RPIA 2LSNA 4FW1A 4M45A 3L8BA 4QOZB 3ZSRA 3C6UA 2JGUA 3AO3A 3SZ2A 4E7LA 5T7BA 2YV0X 2KFZA 1RBUA 4M3ZA 4GW6A 3NF7A 3DOLA 1SUQA 4CERA 3OYMA 4FM1A 3WNHA 1SL0A 1QS4A 4CEDA 1EETA 3QEIA 1R0AA 1KSPA 3CG7A 4M3YA 2HW3A 1Q9XA 1RT1A 1Y97A 2BE2A 3DRSA 4FLXA 4CJRA 4K8XA 4FJKA 1L3UA 1ZBIA 1RILA 3O3FA 2HHTA 1G15A 3PX4A 3SCXA 4NCAA 1ZBUA 1QQCA 3SV4A 4CGGA 4IFVA 4HCCA 1JLAA 4FVMA 3TWHA 3OJSA 3ITHA 3HT3A 3SV3A 4DF4A 4CFBA 4Z4HA 3M8PA 3ZSYA 3NGYA 3OYFA 3V9WA 4EP4A 2OZMA 4FJ9A 4DS4A 1S1XA 2YHBA 4FM2A 3LANA 1B9FA 4H8KA 2YKMA 3MEGA 4AHVA 5HRNA 3NAEA 1UA0A 3LPTA 1IG9A 3RR8A 5DMRA 3BDPA 4O4GA 4LSNA 4B8AB 4FLVA 3SUPA 1I3AA 1U47A 3LWMA 3QIPA 4O0JA 1CXUA 1QTMA 2G8VA 1GOCA 4AILC 4HTUA 2Q3SA 4KI6A 1ZBFA 2OPSA 3M8QA 4OLAA 3AVGA 2GBZA 2YKNA 4CJTA 3G0ZA 4CJKA 2HVHA 3QEPA 4DS5A 4C8OA 1VSMA 3RWUA 1WSFA 3AO1A 5HP1A 1HYVA 2GUIA 3JYTA 2HHXA 4B9VA 3QLHA 3LZJA 3MXMA 1LW0A 1ZYQA 2KZZA 4CJ3A 1LWEA 3RRHA 4DTXA 2PYLA 1HPZA 4BE1A 4CF9A 3FFIA 3KD1E 5I42A 1W0HA 2FBVA 3AVIA 1SKRA 1ZBLA 3SUOA 3KKRA 1LAVA 2F96A 4LY7A 2X74A 4OVLA 3PY8A 4I9QA 4PY5A 1C0MA 3KK3A 4I2PA 4B9MA 4FK4A 1JXEA 3LZIA 1S1VA 2XY7A 2XY8A 4O0IA 3OYNA 2HNDA 4NYFA 3V1QA 1QSYA 2P5GA 4FJIA 3HVTA 4MQ3A 3SPYA 1D5AA 2ETJA 3LWLA 4CEAA 4GVMA 3V9ZA 3RMAA 3L2QA 5FRNA 4NCGA 3CFPA 2G8FA 4HCBA 3KLIA 3KIOA 3LP3A 2VG5A 2O4GA 4E3SA 3PV8A 1WN7A 2RN2A 3ZT3A 3F9KA 4DTUA 1TK0A 4M3RA 4AHCA 4JS5A 1T05A 4F4KA 1SL2A 3AVLA 4E7JA 3QERA 3VQ8A 3M8RA 4DFPA 4CCHA 4PWDA 3AVKA 3NF6A 4FLWA 1S6PA 2ZQBA 3QINA 3T1AA 3HL8A 4RW7A 1F21A 4CEOA 1XI1A 4PA1A 2DFEA 3QEVA 5J2NA 2HMIA 1Z25A 4DSJA 4HVJA 2O4IA 5KRSA 3O3HA 1MU2A 4FLUA 4M3XA 4B3OA 3F73A 1FK9A 1IKYA 3NF8A 1IH7A 1S1TA 1X9WA 4B9SA 3DLRA 1X9MA 3VQBA 2R7YA 4L8RB 3LDSA 4CJWA 4DLGA 3NCIA 3G10A 1I39A 3ISNC 1BQNA 3K59A 4DQQA 2QKBA 1WSHA 1RT2A 3NFAA 1DTTA 3V1RA 1C1AA 3AVNA 2YNGA 3ZSWA 4C8KA 4CHPA 1QSSA 5JS1A 1JLFA 3CM6A 2D5RA 4JRPA 1UA1A 4Z4IA 1BCOA 1TKXA 1YVUA 4H4MA 2PY5A 3THVA 5I3UA 3VQPA 1TK5A 2XY6A 1HJRA 1C1CA 1T7PA 4ID5A 4Z4EA 1U48A 1C0TA 1NOZA 3MECA 1EXQA 3AO4A 1C1BA 4FK2A 3VQCA 2KFNA 1D8YA 2RKIA 4OPJA 1VSEA 3PUFA 3CYMA 4E7HA 3UIQA 3L2WA 4W5QA 4DTPA 2YNFA 5HRSA 2VWJA 4F8RA 1HNIA 3AO2A 3HK2A 2DTUA 4PQUA 4ELVA 2FC0A 3TABA 3NBPA 4FJ5A 2DFFA 4CIGA 3WNEA 2HHUA 1HMVA 1RDAA 3OYJA 1YT3A 2HHWA 3L2VA 4DQRA 4AHSA 4CIEA 4ICLA 4DU4A 4Y1CA 4CF8A 3IAYA 4CEFA 3TR8A 3HPGA 1A5XA 4ZTJA 4M3TA 4RW8A 5J2PA 3ALYA 4LH4A 4JRQA 5HROA 4FJHA 1RDDA 3AVAA 4OPKA 3K58A 3S9HA 4DLEA 1UWBA 1TGOA 2HB5A 3SPZA 1KRPA 1NK0A 1XWLA 3L3UA 2IS3A 4RW4A 2D0BA 3HPHA 4B9NA 1NK9A 2EHGA 3TAMA 2BDPA 4AHTA 4KHQA 1UOCA 3C6TA 3O4QA 3ZSZA 4BDZA 2IC3A 1VSDA 1NK7A 2G8HA 1J5OA 3ASMA 2IAJA 3CM5A 1W9HA 4CJUA 4I7FA 3ZT1A 5FDLA 5SWMA 3VQ9A 5KGXA 2X78A 3K57A 4CHYA 4KTQA 1BIUA 1RBRA 1KTQA 4ELUA 2BANA 3VA0A 4N41A 3HJFA 2G8IA 1CLQA 3KJVA 2PYJA 3OS2A 3OS1A 1S6QA 4FJNA 1KVAA 2Z1HA 3HYFA 1RBVA 2ZD1A 3AVBA 4CF2A 1SKSA 1J54A 5E41A 4CIFA 3NH1A 2GV9A 3NE6A 5J2QA 3VQ4A 4KHWA 1T8EA 2PZSA 3L3VA 1EX4A 3OY9A 2VG7A 3OYBA 2X6SA 3H08A 4E1NA 4FM0A 3P83D 3EYZA 3DLHA 4KAZA 3QNOA 4O5BA 4M3WA 4KHSA 1IKXA 1SL1A 1JXBA 3SQ1A 1U49A 1JLQA 1S1WA 1VSHA 3SQ4A 4W5TA 4RW9A 3A2FA 4E89A 2OA8A 1WAJA 1LAWA 3CFOA 4CJFA 3OYLA 3KLFA 1KCFA 3K5NA 1X1PA 3SYZA 3V9XA 1NJWA 4CJLA 4DU1A 4GMJB 3U6FA 1WAFA 2WONA 1FKOA 3D0PA 3IRXA 3I0RA 2XRIA 1RBSA 4WE1A 4XIUA 1CZBA 3TAFA 4DQPA 4IFYA 3DYAA 3DOKA 3LALA 4O55A 3QESA 5HLFA 3KD5E 3MXIA 1CZ9A 4CK2A 3S3NA 1VSLA 1Q9YA 3NDKA 4ZTFA 1RTJA 1TAQA 2FBYA 3DI6A 2Z1JA 4B9TA 1YTUA 3DLGA 1BL3A 5HRRA 1S1UA 4MFBA 3DM2A 1N6QA 2VG6A 3PO5A 1RNHA 1O1WA 2XY5A 3HPOA 4OGEA 1RTDA 2D0AA 1RT4A 3HP9A 1CXQA 4OKKA 1A5VA 1TKTA 2NUBA 4CF1A 1B92A 4BDYA 1XHZA 1U45A 3LP1A 1TKDA 4K8ZA 2JLEA 2HNZA 4JLHA 4CGJA 4CHNA 1L5UA 4DSLA 4FYDA 4AHRA 4KB1A 1BI4B 3KLHA 2DFHA 4DTRA 1SKWA 3VA3A 1DLOA 1WSGA 3VQEA 2ATQA 5HRPA 3TANA 1A5WA 4JS4A 4LSLA 3VQDA 3TAEA 3P5JA 4F2RA 5CZ2A 3V1OA 3ZSVA 2ITGA 3EY1A 4HUFA 4FJ8A 2G8WA 2P1JA 2IGIA 1HYSA 4DFJA 4BACA 2A1RA 4KHYA 1VRUA 4Z4GA 1TKZA 4I9LA 3HM9A 2HVIA 4OKEA 4CEEA 5HBMA 2FBTA 4CE9A 3MXJA 4BWJA 1GOBA 2AJQA 1WNSA 3RMBA 1XHXA 4N76A 1WSEA 2YNHA 3KLEA 3KK1A 3NHGA 3PX0A 4FJMA 2OPRA 4DU3A 4DTSA 1NJYA 3K5MA 1VSJA 3CFRA 1S9EA 3IG1A 1ZBHA 1JLGA 4ZHRA 4HUGA 4CESA 3TAQA 3NH2A 2QKKA 1TV6A 3DLBA 3K2PA 5KI6A 1DTQA 4I2QA 2B4JA 3SQ0A 1RT6A 1NJXA 4FCYA 1D9DA 3KLGA 4AH9A 4CFCA 4E7IA 3TAGA 3OJUA 1EP4A 2W42A 4CGFA 4CK3A 4PUOA 1TVRA 2XHBA 3OYGA 4OJRA 3RRGA 1N5YA 3DRRA 3ZT2A 1BI4A 1VRTA 3AA4A 5CY4A 4CJVA 3NGIA 3HSTB 2A1SA 1KLMA 1HQEA 5J1EA 3OYIA 3VQ7A 3OYCA 4J2DA 2F8TA 1VK0A 5KRTA 3O3GA 4FJXA 4FJLA 3DLKA 4QCLA 4C8NA 4CJQA 1EKEA 4CGDA 1BQMA 4KRFA 4FZZA 3ZT0A 1LV5A 1L3SA 4CEBA 3CQ8A 4FXDA 3SI6A 3KTQA 1C6VA 1JKHA 4H4OA 3IS9A 4CGHA 4E19A 5C25A 4FLYA 2QXFA 1BCMA 3LP0A 3ZT4A 4N47A 2P5OA 5JS2A 3L2UA 4DSEA 3QNNA 4DG1A 3T19A 4BWMA 2OZSA 1TL3A 4C8MA 4OGCA 1JLCA 4KB0A 1QHTA 3VQAA 1J9AA 2OYQA 3SQ2A 4F3TA 3DMJA 3K5LA 4DFMA 3PX6A 2D0CA 4CHOA 3TARA 1RTIA 1QE1A 3C94A 4CEQA 1WLJA 4R5PA 3OYEA 3S3OA 4KHUA 2QK9A 4DSKA 4FLTA 3C95A 4CHZA 2KTQA 3D45A 3AA5X 5CYMA 4Z4CA 3E01A 1NKEA 1WSJA 4BE0A 5K14A 4FZXC 4LD0A 3MEDA 4Q0BA 4KO0A 3VQQA 4CEZA 2B5JA 1BISA 3AO5A 4FW2A 1LWCA 1S9GA 4DMNA 3L2RA 2RF2A 4FJGA 1S5JA 3LAKA 3M8SA 4J2AA 1RT5A 1VSFA 4IG0A 4B9LA 3O4NA 2OPQA 4IDKA 4KTWA 2IOCA 4Q5VA 3AV9A 1RT3A 1ASVA 2YNIA 4DSFA 1U4BA 2OPPA 4B8CA 4EP5A 2XO7A 1NK4A 1U04A 3NF9A 3HO1A 1TL1A 4DTJA 1IO2A 3U3GA 3V4IA 3B6OA 3ULDA 4B08A 3SJJA 4CK1A 3VQ5A 5D3GA 3NH0A 3ZSOA 3OYDA 4CJPA 4KKOA 4HUEA 3QEWA 3TAPA 4FK0A 1GOAA 1J53A 2X6NA 2E6MA 4CF0A 1KVBA 2KQ2A 4NYNA 4DWIA 3OYAA 1HNVA 3DRPA 4CJ5A 2DY4A 4YNQA 3RMCA 3EZ5A 3OS0A 4DSIA 3QETA 3RR7A 4CFDA 3K5OA 3SUQA 1JLEA 3QO9A 3V9SA
chains in the Genus database with same CATH superfamily
4XH5A 2KKZA 3LP2A 4BR5A 1BGXT 3HP6A 5CYQA 4HHTA 4YFUA 1GLJO 1Z26A 3AVMA 1ASWA 4CJ4A 4IO8A 2E4LA 3D6RA 1NKCA 1FXXA 4WQ4A 4JKGA 1QVFM 3V9UA 1JL1A 1OVQA 3THXA 4WQ5C 4JI1K 1NKBA 4PHTX 3CMAN 2YHAA 1WSIA 1QSLA 3I8DA 1VQMN 2Q31A 2EX3A 3KK2A 2HNYA 5JLFA 5M1KA 3UKRA 5DK5A 1GLEG 1YJNN 2HHSA 4FWSA 1NM1A 3WNFA 5GADP 1HLUA 4F2SA 1O13A 1Y64A 4DV6K 3O80A 3FZMA 4CJEA 2Y1IA 2Q0UA 5BPLA 1NK6A 3QFPA 2O8DB 4BE2A 4B1XB 3NMUA 5C24A 1YAGA 4CHQA 2GX9A 3RTVA 1ITGA 3VEZA 1KFSA 3QBWA 2Q0RA 4K42A 4PKIA 4V19S 4G1QA 4M7XA 2VWKA 5CZ1A 1K6YA 2E20A 1VSIA 3V81A 4NCBA 2I5JA 3BF1A 4QS9A 3VQ6A 3DLLL 3MCPA 2CH6A 4QOZB 3VMFB 2LSNA 4BR7A 3TU5A 3CIPA 3CI5A 3O9UA 3AO3A 2F7TA 2YX6A 4E7LA 2A5XA 4M3ZA 3DOLA 4DR1K 1SUQA 1SL0A 4DR7K 4M3YA 4JI7K 4FLXA 3DRSA 4CJRA 4O8UA 4NCAA 1QQCA 1Q18A 4HCCA 3PSFA 3I55N 2QXLA 4MDBA 3NGYA 4EP4A 5LL6Z 2ITMA 2YHBA 3LANA 4GV3A 2ZJQL 3MEGA 1IG9A 4CZEA 4CZLA 4LSNA 3MK6A 2GUPA 1U47A 3LWMA 2A42A 2Q3SA 1ZBFA 3M8QA 3G0ZA 3QEPA 5AQUA 1VSMA 1OH6A 1QHAA 5B8HA 3QLHA 4NB4A 4M63C 4BRKA 1ZYQA 2KZZA 2HSTA 2PYLA 3DJCA 3FZHA 4CF9A 3AVIA 3KWGA 3BUZB 3PY8A 4PY5A 1C0MA 5AQSA 3LZIA 1QSYA 2P5GA 4NYFA 3V1QA 4CZGA 1NWKA 1YIJN 4MQ3A 1D5AA 2VGNA 4GVMA 3RMAA 4C23A 3L2QA 3KLIA 4KH4A 2VG5A 4E3SA 4CJ7A 3F9KA 5H1SQ 4EIAA 3MX5A 4DV0K 3HOTA 4PKHA 1S22A 1WB9A 1VQNN 3VQ8A 4DFPA 4FLWA 3QINA 3HL8A 3FZLA 2DFEA 3QEVA 2VGMA 5J2NA 1KQSM 3QDKA 3ZX3A 3ID8A 3F73A 1IKYA 3NF8A 4L3QA 1IH7A 1S1TA 3DLRA 3CCMN 3VQBA 4L8RB 1WBBA 4CJWA 1SAZA 1SS6A 1BQNA 2QKBA 1BOTO 1KXPA 1RT2A 3OW2M 2QTDA 4CZMA 3AVNA 1BA1A 2YNGA 1ATNA 1GLBG 4C8KA 4CHPA 1QSSA 5JS1A 1JLFA 1HNZK 4GVEA 2F9WA 4H4MA 2VWBA 1TK5A 4EHTA 1MA9B 4A57A 1U48A 1C0FA 1EXQA 1C1BA 4OPJA 1N34K 5LMNK 4DTPA 1Q81O 5HRSA 2E2PA 2VWJA 3MN7A 4H0TB 1N36K 2CGJA 4PQUA 4ELVA 2FC0A 1DGKN 3TABA 2DFFA 2HHUA 1HMVA 3L2VA 4FVUA 4DQRA 4ICLA 4DU4A 4H5NA 3IAYA 1VQON 4RW8A 5J2PA 4LH4A 4PKGA 3ZETB 1RDDA 3CETA 3D2FB 1XUPO 3L3UA 3M5RA 2IS3A 4RW4A 4A62A 1NK9A 4IJNA 1NK7A 4I7FA 4JK7A 4KTQA 3W0LA 1KTQA 1E3MA 4N41A 4LF7K 2G8IA 1CLQA 2CGKA 3CCRN 3MMVA 2Q36A 1RBVA 3UKUA 3CXCM 1J54A 4H5TA 5E41A 3NE6A 4KHWA 1HR0K 1HPMA 2WFBA 4YORA 4O5BA 3O4WA 4KHSA 4LF4K 1JXBA 3SQ1A 1JLQA 2QI2A 1VSHA 3SQ4A 3L0QA 2OA8A 3K5NA 1X1PA 4DU1A 3TSQA 4OPAA 2WONA 4JKHA 2V7YA 3I0RA 1RBSA 4WE1A 1W2BM 5KPZA 3DYAA 4O55A 3C6HA 3KD5E 4JV5K 3MXIA 4CK2A 1VQLN 4ZTFA 1TAQA 4JKCA 1WOQA 5KQDA 3CJ9A 3KHYA 1N6QA 1RNHA 3A5LC 4IEEA 2BTFA 4OGEA 1RTDA 2D0AA 3HP9A 3L4QA 5BN8A 3LP1A 1YHQN 2VQEK 4FYDA 5M1PA 2NRRA 1DLOA 5GINA 3GL1A 4WQ5A 1MDUB 1ZBSA 4LSLA 4B1VA 4YDUC 3A5MC 1HYSA 4FJ8A 2G8WA 2IGIA 4FWQA 3HM9A 4CEEA 4ILHA 5HBMA 2FBTA 1ATSA 2O8FB 4FWMA 4BRPA 4AQYK 3RMBA 1V4SA 3KK1A 1ATRA 5AQXA 4IOCL 1IJJA 2OPRA 4B1YB 3IG1A 4IO9L 4ZHRA 1ZBHA 4HUGA 4U67L 1VQ7N 4CESA 2NRWA 1TV6A 5KI6A 4CFCA 3UB5A 3OJUA 3R9PA 1T44A 3ZT2A 3D7EO 4JI2K 5CY4A 4CJVA 4MO5A 3E1YA 3BP8A 2UUAK 1KAXA 3VTIA 5GAEP 4A5BA 2FLOA 3O9QA 2E2QA 4FXDA 1YF5L 4FLYA 3ZT4A 4DSEA 5AQKA 3CQXA 1TL3A 1KAZA 1LOTB 4OGCA 5MLCQ 4BC3A 1YVNA 3J81O 2OYQA 3N4QA 1KC8O 3DMJA 2D0CA 3TARA 1RTIA 1GLCG 3OYEA 3VOVA 4CHZA 3ENHA 3TSPA 3VENA 2KTQA 3AA5X 5CYMA 4Z4CA 4DUZK 5DM6L 1NKEA 3S41A 4FZXC 4LD0A 3MEDA 4KO0A 3CCSN 2B5JA 4JKGB 1VSFA 4JK8A 3C65A 2OPPA 2QWQA 3ULEB 3B6OA 4CD3A 4B08A 2UXBK 3ZSOA 3SAHA 3LDLA 1GOAA 1J53A 4LF9K 4H0YB 5E26A 4CF0A 2E6MA 3O6WA 1KVBA 3C7NA 4NYNA 1GLDG 4BC5A 4YNQA 4DSIA 5CR4A 4Z4HA 3QO9A 3OY9A 3OYBA 3VEYA 4NXMK 4J2BA 3O08A 2FBXA 4F9OA 1NK5A 3T3FA 1R0AA 4Z4IA 4A61A 4DQIA 2BGGA 4DTOA 2WOMA 3KKSA 2UUCK 1B9DA 3V6DA 4FPAA 1HQUA 3LPUA 4E0DA 4DV4K 1TK8A 3QIOA 2P51A 5SZTA 3PO4A 3SNNA 2KZMA 4JHDB 1ASUA 3H1QA 4JN4A 4XH4A 1DEJA 4LH5A 3WNGA 4B1WB 4FJ7A 4DR3K 3P38A 5EVZA 5M1QA 3VN5A 3B8AX 4KFBA 4FSVA 3O1BA 3EEQA 4QS8A 1NBWA 4UY8O 4ELTA 3QEXA 1NJZA 1YI2N 1YTAA 1QZ6A 4MLEA 2I7NA 1VQ9N 3MN6A 4YDUA 4W5RA 3WEEB 2OTLN 2O8EA 2HHVA 1NU0A 3E9LA 2FF3B 4CGIA 4M41A 4BRFA 3BGRA 3AVJA 5GAGP 3THXB 4KI4A 4QAGA 4KREA 1BHLA 3F2KA 4OKJA 1IKVA 3OYKA 3RMDA 4E7KA 1D4XA 4EZ9A 4KTZA 4A2AA 5AR0A 4M7YA 2HBKA 4K43A 4ID1A 1YITN 1DT9A 4GV6A 3B6PA 5EU7A 1RT7A 3C6UA 2JGUA 3SBGA 4RTFD 2KFZA 1W97L 1RBUA 3NF7A 5AQWA 1P8ZA 3JAMO 1GLFO 3WNHA 1BDGA 4CEDA 3QEIA 1KSPA 3CG7A 4BC4A 4GY2B 4K8XA 1Y97A 4FJKA 1XNQK 5F2RA 1FJGK 1L3UA 3A8YA 3SCXA 4GKKK 1NGIA 5AFUA 3SV3A 1NGBA 3A5OC 3MCAB 3V9WA 3OYFA 2IVOA 4EHUA 1S1XA 4FM2A 1B9FA 2HF3A 4AHVA 3G6EN 4DHYA 3LPTA 2E1ZA 3UKUB 3RR8A 3OBWA 1IV0A 4B1ZA 3SUPA 4O0JA 4FWNA 4HTUA 5AJ3K 4XH1A 4OLAA 3AVGA 4CJKA 4CJTA 4BGAA 2HHXA 3MXMA 2NRHA 1LW0A 1LWEA 3O9SA 3RRHA 3J7AP 1HPZA 3CCUN 3FFIA 1W0HA 1E4GT 4BGBA 3KKRA 4YOVA 2FF6A 4I9QA 4B9MA 1JXEA 4O0IA 4FJIA 2HNDA 1VQKN 3HVTA 3SPYA 2ETJA 3LWLA 4BRHA 5C15A 3V9ZA 5FRNA 4HCBA 3CFPA 3KIOA 2IVNA 1JCGA 4JNEA 3T7ZA 4DR5K 3ZT3A 2V7ZA 4M3RA 1J6ZA 4JS5A 1T05A 3OHRA 2OTJN 1SL2A 3AVKA 1S6PA 4RW7A 3U4LA 4CEOA 4FPBA 4O8KA 4DSJA 3O3HA 1MU2A 4M3XA 5C10A 4A59A 4ISGA 1FK9A 3M6GA 5AQNA 3M1FA 3LDSA 3NCIA 3G10A 1I39A 3ISNC 3K59A 4H5VA 3CCQN 3V1RA 3CJBA 3DXKB 3ZSWA 4DV2K 3HZ6A 1EO1A 5BR9A 4HWIA 3CM6A 2D5RA 4JRPA 4DQ8A 5I3UA 3VQPA 2NRTA 3RSEB 1HJRA 1C1CA 5LJVA 4ID5A 3WXKA 4K0KK 1NOZA 2E88A 1FW6A 3AARA 5M1OA 1VSEA 3CYMA 4E7HA 3UIQA 2D0PA 4W5QA 3CC7N 4F8RA 2HBMA 2DTUA 4FJ5A 4CIGA 1RDAA 3HTVA 3TSUA 3EL2A 2D1KA 4Y1CA 4CF8A 2P9UA 1A5XA 4ZTJA 4BR2A 1ZXOA 1NMDA 3ALYA 4YOTA 4JRQA 3AVAA 4FWLA 3S9HA 3GE1A 2HB5A 1KRPA 2D0BA 1H1VA 3FGUA 2BDPA 4KHQA 1OVYA 3ZSZA 3T1YK 2I7PA 1Q7YO 2G8HA 4DR4K 3BEXA 1J5OA 3ASMA 2IAJA 5A2QO 1W9HA 5SWMA 3ZT1A 3VQ9A 4CHYA 3D2FA 3WUHA 3MWTA 1IBMK 4R79A 4FL9A 3OS2A 1KVAA 2Z1HA 3HYFA 2GV9A 3ENBA 4K25A 1T8EA 2W6KA 2VG7A 3G4SN 4KAZA 2H3GX 4DR6K 4H03B 1S1WA 5LJWA 2Q97A 1NMNA 4E89A 3CFOA 3OYLA 1K8KA 2E2NA 1NJWA 4CJLA 3SMSA 2GWJA 1HKBA 5AQQA 1CZBA 3WQUA 2QW9A 1VSLA 3THYB 1RTJA 1GLLO 2FBYA 3N4PA 4DV3K 3DM2A 3R3LA 3DXMA 3PO5A 2XY5A 3K0SA 3H1VX 4KBOA 1RT4A 3CCJN 1XHZA 2NUBA 1B92A 3WEEA 3WXJA 4K8ZA 4JI4K 1L5UA 4KB1A 3BZCA 4DTRA 1X9JA 2GTDA 2E1YA 3VQEA 1JJ2M 4YOYA 1A5WA 3TAEA 3SJHA 3P5JA 5CZ2A 3V1OA 3EY1A 4HUFA 2A41A 3RSEA 3LDNA 4DFJA 1VRUA 3PSIA 4OKEA 3UE5A 5AQZA 3HI0A 2GEMA 4BWJA 3ZEUA 5EXWA 1OH8A 3KLEA 3QB0A 4FJMA 1IG8A 1NJYA 5BRDA 3TAQA 3NH2A 2QKKA 2V51B 1RT6A 3JXUA 4CZKA 3KLGA 4PUOA 1EP4A 4CGFA 1TVRA 3MN5A 2XHBA 3NGIA 3HSTB 5AQJA 3VQ7A 3OYCA 4J2DA 2QEXN 1BU6O 3O3GA 2RE2A 3DLKA 4QCLA 3ID6A 3CCEN 4CGDA 2W40A 1BQMA 4KRFA 3ZT0A 1LV5A 2ZGYA 4CEBA 3CQ8A 4KH5A 4BG9A 4RWTA 3IS9A 5C25A 2D0OA 3LP0A 4N47A 4LFCK 3OTOK 2OZSA 1JLCA 5GAHP 4KB0A 1QHTA 3K5LA 3DXMB 5FPMA 1QE1A 4CEQA 2A40A 2QK9A 3OA9A 4DSKA 4FLTA 3BZKA 4WCEL 1XMQK 5TKWA 1YXQA 3L2RA 1XC9A 4DMNA 4FW2A 5AQRA 3M8SA 4J2AA 1RT5A 4IG0A 3H45C 4B9LA 4KTWA 2OPQA 1U4BA 4Q5VA 3Q7BA 1RT3A 2YNIA 4X64K 1NK4A 2ZJRL 1TL1A 2O8DA 3U3GA 3WXLA 3D2EB 4U7BA 5AFUH 4CK1A 3SJJA 3A5NC 5FPNA 3OYDA 3QEWA 4IOAL 2P9LA 3LDOA 4MDAA 1NGAA 3OYAA 4K41A 3DRPA 3ULEA 3OS0A 3CERA 3QETA 4E1JA 4JI0K 4GNIA 1T6CA 2P9KB 1U6ZA 4CFAA 2O8CB 5AQGA 3LAMA 3I33A 3OBYA 1RFQA 4KV8A 5KTQA 3HXMA 5LMUK 4Y1DA 2VCPA 4FOEA 1NG9A 5DM7L 4F3OA 4IJAA 5J2MA 1KFDA 1RDBA 4CZIA 3O1WA 2QWNA 5BR8K 1Q8IA 1WBDA 2P9SB 2G8KA 1LW2A 5FROA 4KHPK 2QA4N 3ENOA 1L3TA 4TSXA 3LM2A 5C42A 3AVCA 1LCUA 2IDOA 1JL2A 4RG8A 3BF3A 4DR2K 4HTLA 3MAQA 3VF6A 4KPYA 4FWKA 2Z1GA 2FSJA 2QWRA 3U9ZA 2V52B 3ZSQA 5AQPA 2HBJA 4DTNA 1VSKA 1BIZA 5FLXO 4B9UA 3I0SA 3G25A 5AQHA 5AQFA 3WXIA 1RDCA 3FLCO 5KGWA 1MWKA 1L3VA 4BC2A 1TAUA 3VEWA 3ZSXA 4IKFA 2UUBK 3JSMA 4WFAL 2A6AA 2WC9A 3MEEA 2ZE2A 3HVRA 4DCHA 4YY3K 4DFKA 3CPEA 4CJSA 4W5NA 2O8BB 4JI6K 4J8FA 4M3UA 1LWFA 1Q82O 2P9NA 2Z1IA 3ZCMA 3AA2A 1REVA 2E2OA 4EZ6A 2BUPA 4FZYA 1OKJA 3Q7CA 1T03A 4C8LA 1SV5A 4O44A 2NLXA 4FW1A 3L8BA 1VQ4N 3ZSRA 5EY4A 5AZJA 5M1FA 5T7BA 2YV0X 5BRHA 4JKFA 4QS7A 4CERA 4FM1A 4FOIA 3BY5A 1QS4A 1Q9XA 4IOXA 2P9SA 1GLAG 1RILA 1NGHA 1G15A 2O8EB 3SV4A 4CGGA 1SZ2A 4IFVA 1JLAA 4I6MB 4CFBA 4CBUA 1ZC6A 4WYBA 4FJ9A 4CZFA 3NAEA 2QWPA 3BDPA 4O4GA 4FLVA 3MN9A 2VQFK 3VGKA 1GOCA 4AILC 2Q2RA 2OPSA 2GBZA 2YKNA 3TTDA 3CCLN 1QZ5A 1M90O 4DS5A 4C8OA 3RWUA 1WSFA 3AO1A 4JI5K 3E9OA 4B9VA 4NXNK 1XQSC 3LDQA 5JICA 4CJ3A 4DTXA 5I42A 2FBVA 1SKRA 5AQLA 1LAVA 4LY7A 3EN9A 1S1VA 2XY7A 4MO4A 1BUPA 2YHWA 3SK3A 3CQYA 4BVPA 4CEAA 1ILYA 2AP1A 4NCGA 4B1UB 2O4GA 3PV8A 1WN7A 3LDPA 5AZJB 1TK0A 4AHCA 5AQTA 4B3SK 4JHDA 4F4KA 4FWOA 3AVLA 3QERA 2ZJPL 3M8RA 3O8MA 5I9EB 3T1AA 1TYQA 5BPMA 5ADXH 4BRAA 1Z6RA 4FLUA 3R8EA 4B3OA 3FZFA 2P9NB 1X9WA 4BVOA 4B9SA 5IWAK 1NGJA 5TKYA 2R7YA 2PBDA 5AZIB 4DQQA 3VEXA 4DV7K 3CHWA 1C1AA 4Y0WA 2KLAA 3QMLA 5JMVA 1UA1A 1BCOA 1TKXA 3A0IX 2PY5A 2A3ZA 3THVA 2YHYA 5BREA 1Q86O 1T7PA 1ESVA 1C0TA 3MECA 4OPHA 3AO4A 4FK2A 3VQCA 1SQKA 3PUFA 3VEVA 3SBTA 4IZ9A 4DV1K 3SAFA 1HNIA 3AO2A 3HK2A 3R1XA 4JI3K 3RVCA 4CIEA 4JYAK 1YJWN 3D2EA 3TR8A 3HPGA 4M3TA 4FJHA 5HROA 1YJ9N 4X66K 2UXDK 4OPKA 4OO1J 4CW7B 1NK0A 1XWLA 4IFEA 2NNWA 1QVGM 4PL8A 3J7ZO 4OX9K 2EHGA 4AHTA 4BDZA 1TUUA 1NGCA 4FWPA 5GIOA 3MWPA 1OH7A 5KGXA 2X78A 1RBRA 2JWLA 4ELUA 3HJFA 3GG4A 3VERA 3CC4N 1N32K 3OS1A 3F5TA 1S6QA 3AVBA 1SKSA 2RHKA 3WT0A 4X65K 5J2QA 3KK7A 2P9LB 4E1NA 4CVNE 4FM0A 3CMEN 3EYZA 3DLHA 3QNOA 1IKXA 1U49A 4B3TK 1EWRA 4BRCA 3HSCA 4RW9A 4ISEA 3KLFA 3V9XA 3HOSA 3U6FA 1FKOA 3IRXA 3ZETA 5LY3A 2Q1NA 3LALA 3DOKA 3QESA 4BRGA 4C1NI 1CZ9A 3S3NA 5AQYA 1K9MO 4A2BA 1NJIO 2PAVA 1BA0A 4DUYK 4LF5K 3KZBA 3IKMA 1YTUA 3DLGA 3QFUA 5HRRA 4EFHA 3K9JA 1O1WA 3CC2N 2OANA 4OKKA 1U45A 1TKTA 4CF1A 2JLEA 4BY9C 1VQ8N 4AHRA 1SKWA 2P9IB 1WSGA 1T3VA 2ZF5O 3VQDA 4H5WA 2NRZA 4BACA 4KHYA 4Z4GA 1R59O 2EWSA 1K8KB 5BRFA 4BRIA 3MXJA 3DAWA 2AJQA 1XHXA 4N76A 4CZJA 1WSEA 4BR4A 2YJFA 1V4TA 3PX0A 2ZWHA 3FR0A 1IBLK 3K5MA 1S9EA 1JLGA 5CHIA 5CE3A 1XMOK 4DKWA 3CJ7A 1NGGA 2AA4A 4NO7A 2HHHK 4CBWA 1DTQA 2YJEA 2B4JA 4I2QA 3SQ0A 4FCYA 1D9DA 4AM7A 3TAGA 1IBKK 3VETA 4CK3A 3OYGA 4OJRA 3RRGA 1N5YA 3DRRA 4JEPA 1BI4A 1VRTA 3AA4A 2A1SA 1KLMA 3OYIA 3J8AA 2UXCK 1VK0A 4FJXA 4FJLA 3H3NO 4FZZA 4WF9L 1L3SA 4KHNA 4AM6A 1C6VA 3KWIA 4E19A 2QXFA 4NLBA 5JS2A 3L2UA 3QNNA 3T19A 3HRGA 4BWMA 4JKEA 4C1NK 1NGDA 4JKBA 3VQAA 3AAQA 4CHOA 3C94A 4R5PA 2O8FA 3DWLA 5F0XA 1N8RO 3CJAA 3D45A 3PIOL 2W41A 4FJGA 2RF2A 2YI1A 2J4RA 5KPRA 3AV9A 1ASVA 3FZKA 2FSKA 4B8CA 4EP5A 1MWMA 3HO1A 3NF9A 1M1KO 4DTJA 1RGIA 3JS6A 3CJCA 2P9KA 3SLCA 3VQ5A 4EAHD 3NH0A 4HUEA 3TAPA 1VAZA 4KKOA 4FK0A 1HNXK 2X6NA 1QQOA 3VTHA 4FO0A 4CBXA 4BR0A 3C6AA 3O9RA 1HNVA 3UKRB 3P4IA 3EZ5A 2ASPA 3SUQA 1JLEA 4MFBA 4LFBK 1RCHA 3TPQA 3P31A 5AQOA 3U8XA 1KVCA 4H0XB 3OYHA 4DQSA 4CECA 2ZGZA 4AHUA 2B6AA 3VF2A 1RTHA 2NZTA 1WUAA 3DLEA 3THWB 1X9SA 1D9FA 3QBXA 1RBTA 3LL3A 1KLNA 4LC9B 3NGZA 2NRXA 4Z4FA 1C0UA 1IKWA 3AA3A 4ISFA 2HHQA 3U9DA 3U3YA 3SUNA 4RW6A 4W5OA 4J2EA 2E6LA 5HOOA 2F9TA 3GOIA 1VQPN 1K73O 4DB3A 1RDWX 5FRMA 3LM9A 2G8UA 4FLZA 1E4FT 2Y1JA 3J80O 3TI0A 2QWOA 1TUYA 5C0YA 2F8SA 1UAXA 2PFUA 1NK8A 1NGEA 4Z0UA 1HRHA 4IG3A 5FPDA 5IT9O 2O8CA 1P90A 3S3MA 4NLCA 1HNWK 4BREA 4N56A 4LF6K 4E1MA 3AVFA 3AVHA 4B3MK 3P1GA 4DTMA 3PLAA 3I56N 4FJJA 3VPZA 1FKPA 4DF8A 1K8AO 4N5SA 4CD1A 4IBNA 4KH6A 3VESA 4BDPA 1HYZA 2HF4A 2KW4A 4M42A 4ILGB 3OVNA 4OLBA 2VYPA 4H0OA 1N33K 3ZX0A 1JLBA 4UQGA 5AQMA 2RPIA 4M45A 2O8BA 2OCEA 3SZ2A 3ZEUB 4BRNA 5AQIA 4GW6A 3T69A 4CI6A 3F9MA 3OYMA 4WQ4C 4BR9A 5AQVA 1EETA 1EQYA 2HW3A 1RT1A 2BE2A 2FSNA 1ZBIA 4BG8A 2HHTA 3O3FA 3AAPA 3PX4A 1XNRK 1ZBUA 5HL7L 1HJOA 2QWLA 4FVMA 3TWHA 1VQ5N 3L6QA 3ITHA 3OJSA 3HT3A 4DF4A 2GELA 3M8PA 3ZSYA 5C2FA 2OZMA 5C2DA 4DS4A 5KPTA 4H8KA 2YKMA 5HRNA 1UA0A 3DXKA 5DMRA 3HBTA 2ASOA 4B8AB 1C0GA 1I3AA 2G8VA 2HMPA 3QIPA 1CXUA 1QTMA 3NVKA 1NLVA 4KI6A 2P9IA 4JK9A 4A5AA 2HVHA 2ASMA 3ATUA 2E5LK 5HP1A 1HYVA 2GUIA 3JYTA 3LZJA 4H5RA 3NVMA 3VF4A 4BQZA 3IMXA 3PIPL 4BE1A 3KD1E 2GWKA 1ZBLA 4O5FA 3SUOA 2F96A 2X74A 4DV5K 4OVLA 2P9UB 3KK3A 4I2PA 3IFRA 4H0VB 4FK4A 2XY8A 3OYNA 4JD2A 3MDQA 3H6EA 2G8FA 3LP3A 3CPWM 3QICA 4ILJA 2RN2A 4DTUA 3WXMB 2P9PB 3VEOA 3SMPA 1JCFA 4E7JA 4CCHA 4PWDA 3NF6A 2ZQBA 2DPNA 1F21A 1XI1A 4PA1A 2HMIA 1Z25A 1KD1O 1EWQA 4HVJA 3ATVA 5KRSA 2O4IA 1CZAN 1KAYA 5E84A 4IWVA 1X9MA 2F4VK 4JKAA 4LFAK 4DLGA 1WSHA 3NFAA 1DTTA 2WTUA 4B9QA 1YVUA 3WQTA 3CD6N 1HKGA 2XY6A 3EE8A 3IUCA 4BROA 2HBLA 5C12A 2IVPA 1BO5O 3MX2A 2JWKA 4LF8K 4Z4EA 4YOWA 5FPEA 2KFNA 1D8YA 2RKIA 3E9PA 3GBTA 3L2WA 2YNFA 1HX1A 3C0BA 4H0PA 4IDHA 3CJ1A 3NBPA 3WNEA 4JAXA 3OYJA 1YT3A 2HHWA 4AF1A 5ADXA 4AHSA 4BRMA 4CEFA 3C7NB 1VHXA 4GKJK 2UU9K 3ZYYX 3K58A 4FWRA 2CGLA 1UWBA 3H3OB 4DLEA 1TGOA 1X3NA 3SPZA 3J7YP 1Z05A 2FXUA 3HPHA 4B9NA 3TAMA 3VGMA 2YHXA 1UOCA 3C6TA 3O4QA 4BQLA 5KQ8A 2IC3A 1VSDA 4Z94A 3CM5A 4CJUA 3K57A 3G71N 5FDLA 1BIUA 1VQ6N 3AGKA 2BANA 5ELZA 3VA0A 3TTFA 3T1HK 3AY9A 3KJVA 1G99A 3AGRA 2PYJA 4FJNA 2ZD1A 4CF2A 4CIFA 3NH1A 1QQNA 5BN9A 3L4IA 3EKUA 3VQ4A 2PZSA 3L3VA 1XC3A 5M1NA 1EX4A 3TTCA 3EO3A 4JKDA 3O9TA 3EZWA 2X6SA 4RCHA 3H08A 3P83D 4M3WA 2KHOA 5F1XA 1SL1A 1YUWA 4W5TA 3A2FA 3FFKB 1WAJA 1LAWA 4CJFA 1KCFA 3ZX2A 3SYZA 4B3RK 2P9PA 4GMJB 1WAFA 3D0PA 4XIUA 2XRIA 3TAFA 1RDUA 4DQPA 4IFYA 5HLFA 1U2VB 5BPNA 3THWA 2WUSA 1Q9YA 3NDKA 3I8BA 3E66A 3DI6A 2Z1JA 4B9TA 1BL3A 1S1UA 2VG6A 4YOXA 1QQMA 3HPOA 1NOYA 1CXQA 3H46O 1A5VA 4BDYA 4XEIA 1TKDA 3IDHA 2HNZA 4JLHA 4MLHA 4CGJA 4CHNA 4DSLA 2UYTA 4PL7A 1BI4B 4BRLA 2DFHA 3HM8A 3KLHA 1S72N 3VA3A 2W6LA 1W7AA 2ATQA 5HRPA 5JVHL 2WBNA 1JCEA 3TANA 4JS4A 5EOYA 4F2RA 4IEIA 3ZSVA 2ITGA 2P1JA 2A1RA 3O5BA 1TKZA 4I9LA 2HVIA 4JI8K 3SAGA 4CE9A 3K9KA 3EE9A 3CCVN 3M3ZA 1GOBA 1WNSA 2YNHA 3GDQA 3NHGA 1BWFO 4DU3A 4DTSA 4G9ZA 1VSJA 3CFRA 1HUXA 2HOEA 3THYA 1X3MA 1DKGD 3DLBA 3K2PA 3ZLJA 1NJXA 3R6MA 4AH9A 4E7IA 2W42A 2NRVA 2BH1A 2QM1A 1S3XA 4YOUA 2F8TA 5J1EA 1HQEA 5KRTA 1NNEA 1TYQB 4C8NA 4CJQA 1T6DA 1EKEA 1OH5A 4WFBL 4BRQA 3SI6A 1JKHA 4H4OA 4CGHA 3KTQA 2CH5A 1U2VA 1BCMA 5JLHA 2P5OA 3EKSA 5EX5A 4BRDA 4DG1A 2QWMA 4C8MA 5AZIA 1J5EK 1BG3A 1J9AA 3SQ2A 4F3TA 2D4WA 4DFMA 3PX6A 3S3OA 4KHUA 1WLJA 3CF5L 3C95A 3E01A 1WSJA 4BE0A 5K14A 2E8AA 3FE1A 4GV9A 4Q0BA 3VQQA 4CEZA 1BISA 3AO5A 4WFNL 1LWCA 1S9GA 2ZM6K 3P39A 1S5JA 3LAKA 2IIRA 3O4NA 4IXCA 4IDKA 2IOCA 4DSFA 1HKCA 2YCHA 2XO7A 1U04A 4JD2B 4X62K 1IO2A 3W3DA 3V4IA 3ULDA 5D3GA 5JVGL 3KVGA 4CJPA 4CZHA 1NGFA 3VGLA 4YHHK 2KQ2A 4DWIA 1I94K 4CJ5A 2DY4A 4I6MA 3RMCA 3RR7A 4CFDA 3K5OA 3V9SA 5GIPA
chains in the Genus database with same CATH topology
1RCHA 4CFAA 4J2BA 3LAMA 3LP2A 2FBXA 1NK5A 1BGXT 3T3FA 3HP6A 1KVCA 4KV8A 5CYQA 5KTQA 4YFUA 3OYHA 3HXMA 4HHTA 4DQSA 1Z26A 4Y1DA 3AVMA 4CECA 4DQIA 2BGGA 1ASWA 4AHUA 2WOMA 2B6AA 3KKSA 1RTHA 3DLEA 4CJ4A 1B9DA 4DTOA 4F3OA 3V6DA 5J2MA 1X9SA 2E4LA 1D9FA 1KFDA 1RDBA 1RBTA 1NKCA 1FXXA 1KLNA 1Q8IA 1HQUA 3LPUA 4E0DA 3NGZA 1TK8A 3V9UA 1JL1A 1LW2A 3QIOA 2P51A 5SZTA 2G8KA 3PO4A 5FROA 3SNNA 4Z4FA 1C0UA 2KZMA 1IKWA 3AA3A 1ASUA 2HHQA 1NKBA 1L3TA 3U3YA 4TSXA 3SUNA 4RW6A 5C42A 4W5OA 4J2EA 2YHAA 3AVCA 1WSIA 4LH5A 2IDOA 3WNGA 1QSLA 2E6LA 4FJ7A 1JL2A 4RG8A 3I8DA 2EX3A 3KK2A 3MAQA 2HNYA 3VN5A 5FRMA 2G8UA 4KFBA 4KPYA 4FLZA 2Z1GA 5DK5A 2Y1JA 3TI0A 2F8SA 3ZSQA 1UAXA 4ELTA 3QEXA 1NK8A 1NJZA 1YTAA 4Z0UA 2HHSA 1HRHA 4IG3A 3WNFA 4DTNA 1VSKA 4F2SA 1BIZA 3S3MA 4B9UA 3I0SA 4N56A 4CJEA 2Y1IA 4W5RA 4E1MA 1RDCA 5KGWA 3AVFA 3AVHA 2HHVA 1NK6A 1L3VA 4CGIA 3P1GA 4BE2A 4DTMA 4M41A 1TAUA 3BGRA 3AVJA 3ZSXA 4IKFA 3JSMA 4FJJA 5C24A 4CHQA 3MEEA 1FKPA 2ZE2A 3HVRA 3RTVA 4DF8A 1ITGA 4KI4A 4DFKA 4QAGA 4KREA 4CJSA 1BHLA 4OKJA 4N5SA 1XC9A 1KFSA 4W5NA 1IKVA 4IBNA 3OYKA 4BDPA 3RMDA 1HYZA 4G1QA 4E7KA 4M3UA 2KW4A 4M42A 1LWFA 2VWKA 4EZ9A 3OVNA 4KTZA 1NOYA 5CZ1A 1K6YA 2Z1IA 3ZCMA 4OLBA 3AA2A 1REVA 4EZ6A 1VSIA 4KHNA 3V81A 4ID1A 2I5JA 4FZYA 4NCBA 1JLBA 1T03A 3VQ6A 4C8LA 1SV5A 4O44A 3B6PA 4UQGA 5EU7A 1RT7A 2RPIA 2LSNA 4FW1A 4M45A 3L8BA 4QOZB 3ZSRA 3C6UA 2JGUA 3AO3A 3SZ2A 4E7LA 5T7BA 2YV0X 2KFZA 1RBUA 4M3ZA 4GW6A 3NF7A 3DOLA 1SUQA 4CERA 3OYMA 4FM1A 3WNHA 1SL0A 1QS4A 4CEDA 1EETA 3QEIA 1R0AA 1KSPA 3CG7A 4M3YA 2HW3A 1Q9XA 1RT1A 1Y97A 2BE2A 3DRSA 4FLXA 4CJRA 4K8XA 4FJKA 1L3UA 1ZBIA 1RILA 3O3FA 2HHTA 1G15A 3PX4A 3SCXA 4NCAA 1ZBUA 1QQCA 3SV4A 4CGGA 4IFVA 4HCCA 1JLAA 4FVMA 3TWHA 3OJSA 3ITHA 3HT3A 3SV3A 4DF4A 4CFBA 4Z4HA 3M8PA 3ZSYA 3NGYA 3OYFA 3V9WA 4EP4A 2OZMA 4FJ9A 4DS4A 1S1XA 2YHBA 4FM2A 3LANA 1B9FA 4H8KA 2YKMA 3MEGA 4AHVA 5HRNA 3NAEA 1UA0A 3LPTA 1IG9A 3RR8A 5DMRA 3BDPA 4O4GA 4LSNA 4B8AB 4FLVA 3SUPA 1I3AA 1U47A 3LWMA 3QIPA 4O0JA 1CXUA 1QTMA 2G8VA 1GOCA 4AILC 4HTUA 2Q3SA 4KI6A 1ZBFA 2OPSA 3M8QA 4OLAA 3AVGA 2GBZA 2YKNA 4CJTA 3G0ZA 4CJKA 2HVHA 3QEPA 4DS5A 4C8OA 1VSMA 3RWUA 1WSFA 3AO1A 5HP1A 1HYVA 2GUIA 3JYTA 2HHXA 4B9VA 3QLHA 3LZJA 3MXMA 1LW0A 1ZYQA 2KZZA 4CJ3A 1LWEA 3RRHA 4DTXA 2PYLA 1HPZA 4BE1A 4CF9A 3FFIA 3KD1E 5I42A 1W0HA 2FBVA 3AVIA 1SKRA 1ZBLA 3SUOA 3KKRA 1LAVA 2F96A 4LY7A 2X74A 4OVLA 3PY8A 4I9QA 4PY5A 1C0MA 3KK3A 4I2PA 4B9MA 4FK4A 1JXEA 3LZIA 1S1VA 2XY7A 2XY8A 4O0IA 3OYNA 2HNDA 4NYFA 3V1QA 1QSYA 2P5GA 4FJIA 3HVTA 4MQ3A 3SPYA 1D5AA 2ETJA 3LWLA 4CEAA 4GVMA 3V9ZA 3RMAA 3L2QA 5FRNA 4NCGA 3CFPA 2G8FA 4HCBA 3KLIA 3KIOA 3LP3A 2VG5A 2O4GA 4E3SA 3PV8A 1WN7A 2RN2A 3ZT3A 3F9KA 4DTUA 1TK0A 4M3RA 4AHCA 4JS5A 1T05A 4F4KA 1SL2A 3AVLA 4E7JA 3QERA 3VQ8A 3M8RA 4DFPA 4CCHA 4PWDA 3AVKA 3NF6A 4FLWA 1S6PA 2ZQBA 3QINA 3T1AA 3HL8A 4RW7A 1F21A 4CEOA 1XI1A 4PA1A 2DFEA 3QEVA 5J2NA 2HMIA 1Z25A 4DSJA 4HVJA 2O4IA 5KRSA 3O3HA 1MU2A 4FLUA 4M3XA 4B3OA 3F73A 1FK9A 1IKYA 3NF8A 1IH7A 1S1TA 1X9WA 4B9SA 3DLRA 1X9MA 3VQBA 2R7YA 4L8RB 3LDSA 4CJWA 4DLGA 3NCIA 3G10A 1I39A 3ISNC 1BQNA 3K59A 4DQQA 2QKBA 1WSHA 1RT2A 3NFAA 1DTTA 3V1RA 1C1AA 3AVNA 2YNGA 3ZSWA 4C8KA 4CHPA 1QSSA 5JS1A 1JLFA 3CM6A 2D5RA 4JRPA 1UA1A 4Z4IA 1BCOA 1TKXA 1YVUA 4H4MA 2PY5A 3THVA 5I3UA 3VQPA 1TK5A 2XY6A 1HJRA 1C1CA 1T7PA 4ID5A 4Z4EA 1U48A 1C0TA 1NOZA 3MECA 1EXQA 3AO4A 1C1BA 4FK2A 3VQCA 2KFNA 1D8YA 2RKIA 4OPJA 1VSEA 3PUFA 3CYMA 4E7HA 3UIQA 3L2WA 4W5QA 4DTPA 2YNFA 5HRSA 2VWJA 4F8RA 1HNIA 3AO2A 3HK2A 2DTUA 4PQUA 4ELVA 2FC0A 3TABA 3NBPA 4FJ5A 2DFFA 4CIGA 3WNEA 2HHUA 1HMVA 1RDAA 3OYJA 1YT3A 2HHWA 3L2VA 4DQRA 4AHSA 4CIEA 4ICLA 4DU4A 4Y1CA 4CF8A 3IAYA 4CEFA 3TR8A 3HPGA 1A5XA 4ZTJA 4M3TA 4RW8A 5J2PA 3ALYA 4LH4A 4JRQA 5HROA 4FJHA 1RDDA 3AVAA 4OPKA 3K58A 3S9HA 4DLEA 1UWBA 1TGOA 2HB5A 3SPZA 1KRPA 1NK0A 1XWLA 3L3UA 2IS3A 4RW4A 2D0BA 3HPHA 4B9NA 1NK9A 2EHGA 3TAMA 2BDPA 4AHTA 4KHQA 1UOCA 3C6TA 3O4QA 3ZSZA 4BDZA 2IC3A 1VSDA 1NK7A 2G8HA 1J5OA 3ASMA 2IAJA 3CM5A 1W9HA 4CJUA 4I7FA 3ZT1A 5FDLA 5SWMA 3VQ9A 5KGXA 2X78A 3K57A 4CHYA 4KTQA 1BIUA 1RBRA 1KTQA 4ELUA 2BANA 3VA0A 4N41A 3HJFA 2G8IA 1CLQA 3KJVA 2PYJA 3OS2A 3OS1A 1S6QA 4FJNA 1KVAA 2Z1HA 3HYFA 1RBVA 2ZD1A 3AVBA 4CF2A 1SKSA 1J54A 5E41A 4CIFA 3NH1A 2GV9A 3NE6A 5J2QA 3VQ4A 4KHWA 1T8EA 2PZSA 3L3VA 1EX4A 3OY9A 2VG7A 3OYBA 2X6SA 3H08A 4E1NA 4FM0A 3P83D 3EYZA 3DLHA 4KAZA 3QNOA 4O5BA 4M3WA 4KHSA 1IKXA 1SL1A 1JXBA 3SQ1A 1U49A 1JLQA 1S1WA 1VSHA 3SQ4A 4W5TA 4RW9A 3A2FA 4E89A 2OA8A 1WAJA 1LAWA 3CFOA 4CJFA 3OYLA 3KLFA 1KCFA 3K5NA 1X1PA 3SYZA 3V9XA 1NJWA 4CJLA 4DU1A 4GMJB 3U6FA 1WAFA 2WONA 1FKOA 3D0PA 3IRXA 3I0RA 2XRIA 1RBSA 4WE1A 4XIUA 1CZBA 3TAFA 4DQPA 4IFYA 3DYAA 3DOKA 3LALA 4O55A 3QESA 5HLFA 3KD5E 3MXIA 1CZ9A 4CK2A 3S3NA 1VSLA 1Q9YA 3NDKA 4ZTFA 1RTJA 1TAQA 2FBYA 3DI6A 2Z1JA 4B9TA 1YTUA 3DLGA 1BL3A 5HRRA 1S1UA 4MFBA 3DM2A 1N6QA 2VG6A 3PO5A 1RNHA 1O1WA 2XY5A 3HPOA 4OGEA 1RTDA 2D0AA 1RT4A 3HP9A 1CXQA 4OKKA 1A5VA 1TKTA 2NUBA 4CF1A 1B92A 4BDYA 1XHZA 1U45A 3LP1A 1TKDA 4K8ZA 2JLEA 2HNZA 4JLHA 4CGJA 4CHNA 1L5UA 4DSLA 4FYDA 4AHRA 4KB1A 1BI4B 3KLHA 2DFHA 4DTRA 1SKWA 3VA3A 1DLOA 1WSGA 3VQEA 2ATQA 5HRPA 3TANA 1A5WA 4JS4A 4LSLA 3VQDA 3TAEA 3P5JA 4F2RA 5CZ2A 3V1OA 3ZSVA 2ITGA 3EY1A 4HUFA 4FJ8A 2G8WA 2P1JA 2IGIA 1HYSA 4DFJA 4BACA 2A1RA 4KHYA 1VRUA 4Z4GA 1TKZA 4I9LA 3HM9A 2HVIA 4OKEA 4CEEA 5HBMA 2FBTA 4CE9A 3MXJA 4BWJA 1GOBA 2AJQA 1WNSA 3RMBA 1XHXA 4N76A 1WSEA 2YNHA 3KLEA 3KK1A 3NHGA 3PX0A 4FJMA 2OPRA 4DU3A 4DTSA 1NJYA 3K5MA 1VSJA 3CFRA 1S9EA 3IG1A 1ZBHA 1JLGA 4ZHRA 4HUGA 4CESA 3TAQA 3NH2A 2QKKA 1TV6A 3DLBA 3K2PA 5KI6A 1DTQA 4I2QA 2B4JA 3SQ0A 1RT6A 1NJXA 4FCYA 1D9DA 3KLGA 4AH9A 4CFCA 4E7IA 3TAGA 3OJUA 1EP4A 2W42A 4CGFA 4CK3A 4PUOA 1TVRA 2XHBA 3OYGA 4OJRA 3RRGA 1N5YA 3DRRA 3ZT2A 1BI4A 1VRTA 3AA4A 5CY4A 4CJVA 3NGIA 3HSTB 2A1SA 1KLMA 1HQEA 5J1EA 3OYIA 3VQ7A 3OYCA 4J2DA 2F8TA 1VK0A 5KRTA 3O3GA 4FJXA 4FJLA 3DLKA 4QCLA 4C8NA 4CJQA 1EKEA 4CGDA 1BQMA 4KRFA 4FZZA 3ZT0A 1LV5A 1L3SA 4CEBA 3CQ8A 4FXDA 3SI6A 3KTQA 1C6VA 1JKHA 4H4OA 3IS9A 4CGHA 4E19A 5C25A 4FLYA 2QXFA 1BCMA 3LP0A 3ZT4A 4N47A 2P5OA 5JS2A 3L2UA 4DSEA 3QNNA 4DG1A 3T19A 4BWMA 2OZSA 1TL3A 4C8MA 4OGCA 1JLCA 4KB0A 1QHTA 3VQAA 1J9AA 2OYQA 3SQ2A 4F3TA 3DMJA 3K5LA 4DFMA 3PX6A 2D0CA 4CHOA 3TARA 1RTIA 1QE1A 3C94A 4CEQA 1WLJA 4R5PA 3OYEA 3S3OA 4KHUA 2QK9A 4DSKA 4FLTA 3C95A 4CHZA 2KTQA 3D45A 3AA5X 5CYMA 4Z4CA 3E01A 1NKEA 1WSJA 4BE0A 5K14A 4FZXC 4LD0A 3MEDA 4Q0BA 4KO0A 3VQQA 4CEZA 2B5JA 1BISA 3AO5A 4FW2A 1LWCA 1S9GA 4DMNA 3L2RA 2RF2A 4FJGA 1S5JA 3LAKA 3M8SA 4J2AA 1RT5A 1VSFA 4IG0A 4B9LA 3O4NA 2OPQA 4IDKA 4KTWA 2IOCA 4Q5VA 3AV9A 1RT3A 1ASVA 2YNIA 4DSFA 1U4BA 2OPPA 4B8CA 4EP5A 2XO7A 1NK4A 1U04A 3NF9A 3HO1A 1TL1A 4DTJA 1IO2A 3U3GA 3V4IA 3B6OA 3ULDA 4B08A 3SJJA 4CK1A 3VQ5A 5D3GA 3NH0A 3ZSOA 3OYDA 4CJPA 4KKOA 4HUEA 3QEWA 3TAPA 4FK0A 1GOAA 1J53A 2X6NA 2E6MA 4CF0A 1KVBA 2KQ2A 4NYNA 4DWIA 3OYAA 1HNVA 3DRPA 4CJ5A 2DY4A 4YNQA 3RMCA 3EZ5A 3OS0A 4DSIA 3QETA 3RR7A 4CFDA 3K5OA 3SUQA 1JLEA 3QO9A 3V9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RCH A;  4CFA A;  4J2B A;  3LAM A;  3LP2 A;  2FBX A;  1NK5 A;  1BGX T;  3T3F A;  3HP6 A;  1KVC A;  4KV8 A;  5CYQ A;  5KTQ A;  4YFU A;  3OYH A;  3HXM A;  4HHT A;  4DQS A;  1Z26 A;  4Y1D A;  3AVM A;  4CEC A;  4DQI A;  2BGG A;  1ASW A;  4AHU A;  2WOM A;  2B6A A;  3KKS A;  1RTH A;  3DLE A;  4CJ4 A;  1B9D A;  4DTO A;  4F3O A;  3V6D A;  5J2M A;  1X9S A;  2E4L A;  1D9F A;  1KFD A;  1RDB A;  1RBT A;  1NKC A;  1FXX A;  1KLN A;  1Q8I A;  1HQU A;  3LPU A;  4E0D A;  3NGZ A;  1TK8 A;  3V9U A;  1JL1 A;  1LW2 A;  3QIO A;  2P51 A;  5SZT A;  2G8K A;  3PO4 A;  5FRO A;  3SNN A;  4Z4F A;  1C0U A;  2KZM A;  1IKW A;  3AA3 A;  1ASU A;  2HHQ A;  1NKB A;  1L3T A;  3U3Y A;  4TSX A;  3SUN A;  4RW6 A;  5C42 A;  4W5O A;  4J2E A;  2YHA A;  3AVC A;  1WSI A;  4LH5 A;  2IDO A;  3WNG A;  1QSL A;  2E6L A;  4FJ7 A;  1JL2 A;  4RG8 A;  3I8D A;  2EX3 A;  3KK2 A;  3MAQ A;  2HNY A;  3VN5 A;  5FRM A;  2G8U A;  4KFB A;  4KPY A;  4FLZ A;  2Z1G A;  5DK5 A;  2Y1J A;  3TI0 A;  2F8S A;  3ZSQ A;  1UAX A;  4ELT A;  3QEX A;  1NK8 A;  1NJZ A;  1YTA A;  4Z0U A;  2HHS A;  1HRH A;  4IG3 A;  3WNF A;  4DTN A;  1VSK A;  4F2S A;  1BIZ A;  3S3M A;  4B9U A;  3I0S A;  4N56 A;  4CJE A;  2Y1I A;  4W5R A;  4E1M A;  1RDC A;  5KGW A;  3AVF A;  3AVH A;  2HHV A;  1NK6 A;  1L3V A;  4CGI A;  3P1G A;  4BE2 A;  4DTM A;  4M41 A;  1TAU A;  3BGR A;  3AVJ A;  3ZSX A;  4IKF A;  3JSM A;  4FJJ A;  5C24 A;  4CHQ A;  3MEE A;  1FKP A;  2ZE2 A;  3HVR A;  3RTV A;  4DF8 A;  1ITG A;  4KI4 A;  4DFK A;  4QAG A;  4KRE A;  4CJS A;  1BHL A;  4OKJ A;  4N5S A;  1XC9 A;  1KFS A;  4W5N A;  1IKV A;  4IBN A;  3OYK A;  4BDP A;  3RMD A;  1HYZ A;  4G1Q A;  4E7K A;  4M3U A;  2KW4 A;  4M42 A;  1LWF A;  2VWK A;  4EZ9 A;  3OVN A;  4KTZ A;  1NOY A;  5CZ1 A;  1K6Y A;  2Z1I A;  3ZCM A;  4OLB A;  3AA2 A;  1REV A;  4EZ6 A;  1VSI A;  4KHN A;  3V81 A;  4ID1 A;  2I5J A;  4FZY A;  4NCB A;  1JLB A;  1T03 A;  3VQ6 A;  4C8L A;  1SV5 A;  4O44 A;  3B6P A;  4UQG A;  5EU7 A;  1RT7 A;  2RPI A;  2LSN A;  4FW1 A;  4M45 A;  3L8B A;  4QOZ B;  3ZSR A;  3C6U A;  2JGU A;  3AO3 A;  3SZ2 A;  4E7L A;  5T7B A;  2YV0 X;  2KFZ A;  1RBU A;  4M3Z A;  4GW6 A;  3NF7 A;  3DOL A;  1SUQ A;  4CER A;  3OYM A;  4FM1 A;  3WNH A;  1SL0 A;  1QS4 A;  4CED A;  1EET A;  3QEI A;  1R0A A;  1KSP A;  3CG7 A;  4M3Y A;  2HW3 A;  1Q9X A;  1RT1 A;  1Y97 A;  2BE2 A;  3DRS A;  4FLX A;  4CJR A;  4K8X A;  4FJK A;  1L3U A;  1ZBI A;  1RIL A;  3O3F A;  2HHT A;  1G15 A;  3PX4 A;  3SCX A;  4NCA A;  1ZBU A;  1QQC A;  3SV4 A;  4CGG A;  4IFV A;  4HCC A;  1JLA A;  4FVM A;  3TWH A;  3OJS A;  3ITH A;  3HT3 A;  3SV3 A;  4DF4 A;  4CFB A;  4Z4H A;  3M8P A;  3ZSY A;  3NGY A;  3OYF A;  3V9W A;  4EP4 A;  2OZM A;  4FJ9 A;  4DS4 A;  1S1X A;  2YHB A;  4FM2 A;  3LAN A;  1B9F A;  4H8K A;  2YKM A;  3MEG A;  4AHV A;  5HRN A;  3NAE A;  1UA0 A;  3LPT A;  1IG9 A;  3RR8 A;  5DMR A;  3BDP A;  4O4G A;  4LSN A;  4B8A B;  4FLV A;  3SUP A;  1I3A A;  1U47 A;  3LWM A;  3QIP A;  4O0J A;  1CXU A;  1QTM A;  2G8V A;  1GOC A;  4AIL C;  4HTU A;  2Q3S A;  4KI6 A;  1ZBF A;  2OPS A;  3M8Q A;  4OLA A;  3AVG A;  2GBZ A;  2YKN A;  4CJT A;  3G0Z A;  4CJK A;  2HVH A;  3QEP A;  4DS5 A;  4C8O A;  1VSM A;  3RWU A;  1WSF A;  3AO1 A;  5HP1 A;  1HYV A;  2GUI A;  3JYT A;  2HHX A;  4B9V A;  3QLH A;  3LZJ A;  3MXM A;  1LW0 A;  1ZYQ A;  2KZZ A;  4CJ3 A;  1LWE A;  3RRH A;  4DTX A;  2PYL A;  1HPZ A;  4BE1 A;  4CF9 A;  3FFI A;  3KD1 E;  5I42 A;  1W0H A;  2FBV A;  3AVI A;  1SKR A;  1ZBL A;  3SUO A;  3KKR A;  1LAV A;  2F96 A;  4LY7 A;  2X74 A;  4OVL A;  3PY8 A;  4I9Q A;  4PY5 A;  1C0M A;  3KK3 A;  4I2P A;  4B9M A;  4FK4 A;  1JXE A;  3LZI A;  1S1V A;  2XY7 A;  2XY8 A;  4O0I A;  3OYN A;  2HND A;  4NYF A;  3V1Q A;  1QSY A;  2P5G A;  4FJI A;  3HVT A;  4MQ3 A;  3SPY A;  1D5A A;  2ETJ A;  3LWL A;  4CEA A;  4GVM A;  3V9Z A;  3RMA A;  3L2Q A;  5FRN A;  4NCG A;  3CFP A;  2G8F A;  4HCB A;  3KLI A;  3KIO A;  3LP3 A;  2VG5 A;  2O4G A;  4E3S A;  3PV8 A;  1WN7 A;  2RN2 A;  3ZT3 A;  3F9K A;  4DTU A;  1TK0 A;  4M3R A;  4AHC A;  4JS5 A;  1T05 A;  4F4K A;  1SL2 A;  3AVL A;  4E7J A;  3QER A;  3VQ8 A;  3M8R A;  4DFP A;  4CCH A;  4PWD A;  3AVK A;  3NF6 A;  4FLW A;  1S6P A;  2ZQB A;  3QIN A;  3T1A A;  3HL8 A;  4RW7 A;  1F21 A;  4CEO A;  1XI1 A;  4PA1 A;  2DFE A;  3QEV A;  5J2N A;  2HMI A;  1Z25 A;  4DSJ A;  4HVJ A;  2O4I A;  5KRS A;  3O3H A;  1MU2 A;  4FLU A;  4M3X A;  4B3O A;  3F73 A;  1FK9 A;  1IKY A;  3NF8 A;  1IH7 A;  1S1T A;  1X9W A;  4B9S A;  3DLR A;  1X9M A;  3VQB A;  2R7Y A;  4L8R B;  3LDS A;  4CJW A;  4DLG A;  3NCI A;  3G10 A;  1I39 A;  3ISN C;  1BQN A;  3K59 A;  4DQQ A;  2QKB A;  1WSH A;  1RT2 A;  3NFA A;  1DTT A;  3V1R A;  1C1A A;  3AVN A;  2YNG A;  3ZSW A;  4C8K A;  4CHP A;  1QSS A;  5JS1 A;  1JLF A;  3CM6 A;  2D5R A;  4JRP A;  1UA1 A;  4Z4I A;  1BCO A;  1TKX A;  1YVU A;  4H4M A;  2PY5 A;  3THV A;  5I3U A;  3VQP A;  1TK5 A;  2XY6 A;  1HJR A;  1C1C A;  1T7P A;  4ID5 A;  4Z4E A;  1U48 A;  1C0T A;  1NOZ A;  3MEC A;  1EXQ A;  3AO4 A;  1C1B A;  4FK2 A;  3VQC A;  2KFN A;  1D8Y A;  2RKI A;  4OPJ A;  1VSE A;  3PUF A;  3CYM A;  4E7H A;  3UIQ A;  3L2W A;  4W5Q A;  4DTP A;  2YNF A;  5HRS A;  2VWJ A;  4F8R A;  1HNI A;  3AO2 A;  3HK2 A;  2DTU A;  4PQU A;  4ELV A;  2FC0 A;  3TAB A;  3NBP A;  4FJ5 A;  2DFF A;  4CIG A;  3WNE A;  2HHU A;  1HMV A;  1RDA A;  3OYJ A;  1YT3 A;  2HHW A;  3L2V A;  4DQR A;  4AHS A;  4CIE A;  4ICL A;  4DU4 A;  4Y1C A;  4CF8 A;  3IAY A;  4CEF A;  3TR8 A;  3HPG A;  1A5X A;  4ZTJ A;  4M3T A;  4RW8 A;  5J2P A;  3ALY A;  4LH4 A;  4JRQ A;  5HRO A;  4FJH A;  1RDD A;  3AVA A;  4OPK A;  3K58 A;  3S9H A;  4DLE A;  1UWB A;  1TGO A;  2HB5 A;  3SPZ A;  1KRP A;  1NK0 A;  1XWL A;  3L3U A;  2IS3 A;  4RW4 A;  2D0B A;  3HPH A;  4B9N A;  1NK9 A;  2EHG A;  3TAM A;  2BDP A;  4AHT A;  4KHQ A;  1UOC A;  3C6T A;  3O4Q A;  3ZSZ A;  4BDZ A;  2IC3 A;  1VSD A;  1NK7 A;  2G8H A;  1J5O A;  3ASM A;  2IAJ A;  3CM5 A;  1W9H A;  4CJU A;  4I7F A;  3ZT1 A;  5FDL A;  5SWM A;  3VQ9 A;  5KGX A;  2X78 A;  3K57 A;  4CHY A;  4KTQ A;  1BIU A;  1RBR A;  1KTQ A;  4ELU A;  2BAN A;  3VA0 A;  4N41 A;  3HJF A;  2G8I A;  1CLQ A;  3KJV A;  2PYJ A;  3OS2 A;  3OS1 A;  1S6Q A;  4FJN A;  1KVA A;  2Z1H A;  3HYF A;  1RBV A;  2ZD1 A;  3AVB A;  4CF2 A;  1SKS A;  1J54 A;  5E41 A;  4CIF A;  3NH1 A;  2GV9 A;  3NE6 A;  5J2Q A;  3VQ4 A;  4KHW A;  1T8E A;  2PZS A;  3L3V A;  1EX4 A;  3OY9 A;  2VG7 A;  3OYB A;  2X6S A;  3H08 A;  4E1N A;  4FM0 A;  3P83 D;  3EYZ A;  3DLH A;  4KAZ A;  3QNO A;  4O5B A;  4M3W A;  4KHS A;  1IKX A;  1SL1 A;  1JXB A;  3SQ1 A;  1U49 A;  1JLQ A;  1S1W A;  1VSH A;  3SQ4 A;  4W5T A;  4RW9 A;  3A2F A;  4E89 A;  2OA8 A;  1WAJ A;  1LAW A;  3CFO A;  4CJF A;  3OYL A;  3KLF A;  1KCF A;  3K5N A;  1X1P A;  3SYZ A;  3V9X A;  1NJW A;  4CJL A;  4DU1 A;  4GMJ B;  3U6F A;  1WAF A;  2WON A;  1FKO A;  3D0P A;  3IRX A;  3I0R A;  2XRI A;  1RBS A;  4WE1 A;  4XIU A;  1CZB A;  3TAF A;  4DQP A;  4IFY A;  3DYA A;  3DOK A;  3LAL A;  4O55 A;  3QES A;  5HLF A;  3KD5 E;  3MXI A;  1CZ9 A;  4CK2 A;  3S3N A;  1VSL A;  1Q9Y A;  3NDK A;  4ZTF A;  1RTJ A;  1TAQ A;  2FBY A;  3DI6 A;  2Z1J A;  4B9T A;  1YTU A;  3DLG A;  1BL3 A;  5HRR A;  1S1U A;  4MFB A;  3DM2 A;  1N6Q A;  2VG6 A;  3PO5 A;  1RNH A;  1O1W A;  2XY5 A;  3HPO A;  4OGE A;  1RTD A;  2D0A A;  1RT4 A;  3HP9 A;  1CXQ A;  4OKK A;  1A5V A;  1TKT A;  2NUB A;  4CF1 A;  1B92 A;  4BDY A;  1XHZ A;  1U45 A;  3LP1 A;  1TKD A;  4K8Z A;  2JLE A;  2HNZ A;  4JLH A;  4CGJ A;  4CHN A;  1L5U A;  4DSL A;  4FYD A;  4AHR A;  4KB1 A;  1BI4 B;  3KLH A;  2DFH A;  4DTR A;  1SKW A;  3VA3 A;  1DLO A;  1WSG A;  3VQE A;  2ATQ A;  5HRP A;  3TAN A;  1A5W A;  4JS4 A;  4LSL A;  3VQD A;  3TAE A;  3P5J A;  4F2R A;  5CZ2 A;  3V1O A;  3ZSV A;  2ITG A;  3EY1 A;  4HUF A;  4FJ8 A;  2G8W A;  2P1J A;  2IGI A;  1HYS A;  4DFJ A;  4BAC A;  2A1R A;  4KHY A;  1VRU A;  4Z4G A;  1TKZ A;  4I9L A;  3HM9 A;  2HVI A;  4OKE A;  4CEE A;  5HBM A;  2FBT A;  4CE9 A;  3MXJ A;  4BWJ A;  1GOB A;  2AJQ A;  1WNS A;  3RMB A;  1XHX A;  4N76 A;  1WSE A;  2YNH A;  3KLE A;  3KK1 A;  3NHG A;  3PX0 A;  4FJM A;  2OPR A;  4DU3 A;  4DTS A;  1NJY A;  3K5M A;  1VSJ A;  3CFR A;  1S9E A;  3IG1 A;  1ZBH A;  1JLG A;  4ZHR A;  4HUG A;  4CES A;  3TAQ A;  3NH2 A;  2QKK A;  1TV6 A;  3DLB A;  3K2P A;  5KI6 A;  1DTQ A;  4I2Q A;  2B4J A;  3SQ0 A;  1RT6 A;  1NJX A;  4FCY A;  1D9D A;  3KLG A;  4AH9 A;  4CFC A;  4E7I A;  3TAG A;  3OJU A;  1EP4 A;  2W42 A;  4CGF A;  4CK3 A;  4PUO A;  1TVR A;  2XHB A;  3OYG A;  4OJR A;  3RRG A;  1N5Y A;  3DRR A;  3ZT2 A;  1BI4 A;  1VRT A;  3AA4 A;  5CY4 A;  4CJV A;  3NGI A;  3HST B;  2A1S A;  1KLM A;  1HQE A;  5J1E A;  3OYI A;  3VQ7 A;  3OYC A;  4J2D A;  2F8T A;  1VK0 A;  5KRT A;  3O3G A;  4FJX A;  4FJL A;  3DLK A;  4QCL A;  4C8N A;  4CJQ A;  1EKE A;  4CGD A;  1BQM A;  4KRF A;  4FZZ A;  3ZT0 A;  1LV5 A;  1L3S A;  4CEB A;  3CQ8 A;  4FXD A;  3SI6 A;  3KTQ A;  1C6V A;  1JKH A;  4H4O A;  3IS9 A;  4CGH A;  4E19 A;  5C25 A;  4FLY A;  2QXF A;  1BCM A;  3LP0 A;  3ZT4 A;  4N47 A;  2P5O A;  5JS2 A;  3L2U A;  4DSE A;  3QNN A;  4DG1 A;  3T19 A;  4BWM A;  2OZS A;  1TL3 A;  4C8M A;  4OGC A;  1JLC A;  4KB0 A;  1QHT A;  3VQA A;  1J9A A;  2OYQ A;  3SQ2 A;  4F3T A;  3DMJ A;  3K5L A;  4DFM A;  3PX6 A;  2D0C A;  4CHO A;  3TAR A;  1RTI A;  1QE1 A;  3C94 A;  4CEQ A;  1WLJ A;  4R5P A;  3OYE A;  3S3O A;  4KHU A;  2QK9 A;  4DSK A;  4FLT A;  3C95 A;  4CHZ A;  2KTQ A;  3D45 A;  3AA5 X;  5CYM A;  4Z4C A;  3E01 A;  1NKE A;  1WSJ A;  4BE0 A;  5K14 A;  4FZX C;  4LD0 A;  3MED A;  4Q0B A;  4KO0 A;  3VQQ A;  4CEZ A;  2B5J A;  1BIS A;  3AO5 A;  4FW2 A;  1LWC A;  1S9G A;  4DMN A;  3L2R A;  2RF2 A;  4FJG A;  1S5J A;  3LAK A;  3M8S A;  4J2A A;  1RT5 A;  1VSF A;  4IG0 A;  4B9L A;  3O4N A;  2OPQ A;  4IDK A;  4KTW A;  2IOC A;  4Q5V A;  3AV9 A;  1RT3 A;  1ASV A;  2YNI A;  4DSF A;  1U4B A;  2OPP A;  4B8C A;  4EP5 A;  2XO7 A;  1NK4 A;  1U04 A;  3NF9 A;  3HO1 A;  1TL1 A;  4DTJ A;  1IO2 A;  3U3G A;  3V4I A;  3B6O A;  3ULD A;  4B08 A;  3SJJ A;  4CK1 A;  3VQ5 A;  5D3G A;  3NH0 A;  3ZSO A;  3OYD A;  4CJP A;  4KKO A;  4HUE A;  3QEW A;  3TAP A;  4FK0 A;  1GOA A;  1J53 A;  2X6N A;  2E6M A;  4CF0 A;  1KVB A;  2KQ2 A;  4NYN A;  4DWI A;  3OYA A;  1HNV A;  3DRP A;  4CJ5 A;  2DY4 A;  4YNQ A;  3RMC A;  3EZ5 A;  3OS0 A;  4DSI A;  3QET A;  3RR7 A;  4CFD A;  3K5O A;  3SUQ A;  1JLE A;  3QO9 A;  3V9S A; 
#chains in the Genus database with same CATH topology
 4XH5 A;  2KKZ A;  3LP2 A;  4BR5 A;  1BGX T;  3HP6 A;  5CYQ A;  4HHT A;  4YFU A;  1GLJ O;  1Z26 A;  3AVM A;  1ASW A;  4CJ4 A;  4IO8 A;  2E4L A;  3D6R A;  1NKC A;  1FXX A;  4WQ4 A;  4JKG A;  1QVF M;  3V9U A;  1JL1 A;  1OVQ A;  3THX A;  4WQ5 C;  4JI1 K;  1NKB A;  4PHT X;  3CMA N;  2YHA A;  1WSI A;  1QSL A;  3I8D A;  1VQM N;  2Q31 A;  2EX3 A;  3KK2 A;  2HNY A;  5JLF A;  5M1K A;  3UKR A;  5DK5 A;  1GLE G;  1YJN N;  2HHS A;  4FWS A;  1NM1 A;  3WNF A;  5GAD P;  1HLU A;  4F2S A;  1O13 A;  1Y64 A;  4DV6 K;  3O80 A;  3FZM A;  4CJE A;  2Y1I A;  2Q0U A;  5BPL A;  1NK6 A;  3QFP A;  2O8D B;  4BE2 A;  4B1X B;  3NMU A;  5C24 A;  1YAG A;  4CHQ A;  2GX9 A;  3RTV A;  1ITG A;  3VEZ A;  1KFS A;  3QBW A;  2Q0R A;  4K42 A;  4PKI A;  4V19 S;  4G1Q A;  4M7X A;  2VWK A;  5CZ1 A;  1K6Y A;  2E20 A;  1VSI A;  3V81 A;  4NCB A;  2I5J A;  3BF1 A;  4QS9 A;  3VQ6 A;  3DLL L;  3MCP A;  2CH6 A;  4QOZ B;  3VMF B;  2LSN A;  4BR7 A;  3TU5 A;  3CIP A;  3CI5 A;  3O9U A;  3AO3 A;  2F7T A;  2YX6 A;  4E7L A;  2A5X A;  4M3Z A;  3DOL A;  4DR1 K;  1SUQ A;  1SL0 A;  4DR7 K;  4M3Y A;  4JI7 K;  4FLX A;  3DRS A;  4CJR A;  4O8U A;  4NCA A;  1QQC A;  1Q18 A;  4HCC A;  3PSF A;  3I55 N;  2QXL A;  4MDB A;  3NGY A;  4EP4 A;  5LL6 Z;  2ITM A;  2YHB A;  3LAN A;  4GV3 A;  2ZJQ L;  3MEG A;  1IG9 A;  4CZE A;  4CZL A;  4LSN A;  3MK6 A;  2GUP A;  1U47 A;  3LWM A;  2A42 A;  2Q3S A;  1ZBF A;  3M8Q A;  3G0Z A;  3QEP A;  5AQU A;  1VSM A;  1OH6 A;  1QHA A;  5B8H A;  3QLH A;  4NB4 A;  4M63 C;  4BRK A;  1ZYQ A;  2KZZ A;  2HST A;  2PYL A;  3DJC A;  3FZH A;  4CF9 A;  3AVI A;  3KWG A;  3BUZ B;  3PY8 A;  4PY5 A;  1C0M A;  5AQS A;  3LZI A;  1QSY A;  2P5G A;  4NYF A;  3V1Q A;  4CZG A;  1NWK A;  1YIJ N;  4MQ3 A;  1D5A A;  2VGN A;  4GVM A;  3RMA A;  4C23 A;  3L2Q A;  3KLI A;  4KH4 A;  2VG5 A;  4E3S A;  4CJ7 A;  3F9K A;  5H1S Q;  4EIA A;  3MX5 A;  4DV0 K;  3HOT A;  4PKH A;  1S22 A;  1WB9 A;  1VQN N;  3VQ8 A;  4DFP A;  4FLW A;  3QIN A;  3HL8 A;  3FZL A;  2DFE A;  3QEV A;  2VGM A;  5J2N A;  1KQS M;  3QDK A;  3ZX3 A;  3ID8 A;  3F73 A;  1IKY A;  3NF8 A;  4L3Q A;  1IH7 A;  1S1T A;  3DLR A;  3CCM N;  3VQB A;  4L8R B;  1WBB A;  4CJW A;  1SAZ A;  1SS6 A;  1BQN A;  2QKB A;  1BOT O;  1KXP A;  1RT2 A;  3OW2 M;  2QTD A;  4CZM A;  3AVN A;  1BA1 A;  2YNG A;  1ATN A;  1GLB G;  4C8K A;  4CHP A;  1QSS A;  5JS1 A;  1JLF A;  1HNZ K;  4GVE A;  2F9W A;  4H4M A;  2VWB A;  1TK5 A;  4EHT A;  1MA9 B;  4A57 A;  1U48 A;  1C0F A;  1EXQ A;  1C1B A;  4OPJ A;  1N34 K;  5LMN K;  4DTP A;  1Q81 O;  5HRS A;  2E2P A;  2VWJ A;  3MN7 A;  4H0T B;  1N36 K;  2CGJ A;  4PQU A;  4ELV A;  2FC0 A;  1DGK N;  3TAB A;  2DFF A;  2HHU A;  1HMV A;  3L2V A;  4FVU A;  4DQR A;  4ICL A;  4DU4 A;  4H5N A;  3IAY A;  1VQO N;  4RW8 A;  5J2P A;  4LH4 A;  4PKG A;  3ZET B;  1RDD A;  3CET A;  3D2F B;  1XUP O;  3L3U A;  3M5R A;  2IS3 A;  4RW4 A;  4A62 A;  1NK9 A;  4IJN A;  1NK7 A;  4I7F A;  4JK7 A;  4KTQ A;  3W0L A;  1KTQ A;  1E3M A;  4N41 A;  4LF7 K;  2G8I A;  1CLQ A;  2CGK A;  3CCR N;  3MMV A;  2Q36 A;  1RBV A;  3UKU A;  3CXC M;  1J54 A;  4H5T A;  5E41 A;  3NE6 A;  4KHW A;  1HR0 K;  1HPM A;  2WFB A;  4YOR A;  4O5B A;  3O4W A;  4KHS A;  4LF4 K;  1JXB A;  3SQ1 A;  1JLQ A;  2QI2 A;  1VSH A;  3SQ4 A;  3L0Q A;  2OA8 A;  3K5N A;  1X1P A;  4DU1 A;  3TSQ A;  4OPA A;  2WON A;  4JKH A;  2V7Y A;  3I0R A;  1RBS A;  4WE1 A;  1W2B M;  5KPZ A;  3DYA A;  4O55 A;  3C6H A;  3KD5 E;  4JV5 K;  3MXI A;  4CK2 A;  1VQL N;  4ZTF A;  1TAQ A;  4JKC A;  1WOQ A;  5KQD A;  3CJ9 A;  3KHY A;  1N6Q A;  1RNH A;  3A5L C;  4IEE A;  2BTF A;  4OGE A;  1RTD A;  2D0A A;  3HP9 A;  3L4Q A;  5BN8 A;  3LP1 A;  1YHQ N;  2VQE K;  4FYD A;  5M1P A;  2NRR A;  1DLO A;  5GIN A;  3GL1 A;  4WQ5 A;  1MDU B;  1ZBS A;  4LSL A;  4B1V A;  4YDU C;  3A5M C;  1HYS A;  4FJ8 A;  2G8W A;  2IGI A;  4FWQ A;  3HM9 A;  4CEE A;  4ILH A;  5HBM A;  2FBT A;  1ATS A;  2O8F B;  4FWM A;  4BRP A;  4AQY K;  3RMB A;  1V4S A;  3KK1 A;  1ATR A;  5AQX A;  4IOC L;  1IJJ A;  2OPR A;  4B1Y B;  3IG1 A;  4IO9 L;  4ZHR A;  1ZBH A;  4HUG A;  4U67 L;  1VQ7 N;  4CES A;  2NRW A;  1TV6 A;  5KI6 A;  4CFC A;  3UB5 A;  3OJU A;  3R9P A;  1T44 A;  3ZT2 A;  3D7E O;  4JI2 K;  5CY4 A;  4CJV A;  4MO5 A;  3E1Y A;  3BP8 A;  2UUA K;  1KAX A;  3VTI A;  5GAE P;  4A5B A;  2FLO A;  3O9Q A;  2E2Q A;  4FXD A;  1YF5 L;  4FLY A;  3ZT4 A;  4DSE A;  5AQK A;  3CQX A;  1TL3 A;  1KAZ A;  1LOT B;  4OGC A;  5MLC Q;  4BC3 A;  1YVN A;  3J81 O;  2OYQ A;  3N4Q A;  1KC8 O;  3DMJ A;  2D0C A;  3TAR A;  1RTI A;  1GLC G;  3OYE A;  3VOV A;  4CHZ A;  3ENH A;  3TSP A;  3VEN A;  2KTQ A;  3AA5 X;  5CYM A;  4Z4C A;  4DUZ K;  5DM6 L;  1NKE A;  3S41 A;  4FZX C;  4LD0 A;  3MED A;  4KO0 A;  3CCS N;  2B5J A;  4JKG B;  1VSF A;  4JK8 A;  3C65 A;  2OPP A;  2QWQ A;  3ULE B;  3B6O A;  4CD3 A;  4B08 A;  2UXB K;  3ZSO A;  3SAH A;  3LDL A;  1GOA A;  1J53 A;  4LF9 K;  4H0Y B;  5E26 A;  4CF0 A;  2E6M A;  3O6W A;  1KVB A;  3C7N A;  4NYN A;  1GLD G;  4BC5 A;  4YNQ A;  4DSI A;  5CR4 A;  4Z4H A;  3QO9 A;  3OY9 A;  3OYB A;  3VEY A;  4NXM K;  4J2B A;  3O08 A;  2FBX A;  4F9O A;  1NK5 A;  3T3F A;  1R0A A;  4Z4I A;  4A61 A;  4DQI A;  2BGG A;  4DTO A;  2WOM A;  3KKS A;  2UUC K;  1B9D A;  3V6D A;  4FPA A;  1HQU A;  3LPU A;  4E0D A;  4DV4 K;  1TK8 A;  3QIO A;  2P51 A;  5SZT A;  3PO4 A;  3SNN A;  2KZM A;  4JHD B;  1ASU A;  3H1Q A;  4JN4 A;  4XH4 A;  1DEJ A;  4LH5 A;  3WNG A;  4B1W B;  4FJ7 A;  4DR3 K;  3P38 A;  5EVZ A;  5M1Q A;  3VN5 A;  3B8A X;  4KFB A;  4FSV A;  3O1B A;  3EEQ A;  4QS8 A;  1NBW A;  4UY8 O;  4ELT A;  3QEX A;  1NJZ A;  1YI2 N;  1YTA A;  1QZ6 A;  4MLE A;  2I7N A;  1VQ9 N;  3MN6 A;  4YDU A;  4W5R A;  3WEE B;  2OTL N;  2O8E A;  2HHV A;  1NU0 A;  3E9L A;  2FF3 B;  4CGI A;  4M41 A;  4BRF A;  3BGR A;  3AVJ A;  5GAG P;  3THX B;  4KI4 A;  4QAG A;  4KRE A;  1BHL A;  3F2K A;  4OKJ A;  1IKV A;  3OYK A;  3RMD A;  4E7K A;  1D4X A;  4EZ9 A;  4KTZ A;  4A2A A;  5AR0 A;  4M7Y A;  2HBK A;  4K43 A;  4ID1 A;  1YIT N;  1DT9 A;  4GV6 A;  3B6P A;  5EU7 A;  1RT7 A;  3C6U A;  2JGU A;  3SBG A;  4RTF D;  2KFZ A;  1W97 L;  1RBU A;  3NF7 A;  5AQW A;  1P8Z A;  3JAM O;  1GLF O;  3WNH A;  1BDG A;  4CED A;  3QEI A;  1KSP A;  3CG7 A;  4BC4 A;  4GY2 B;  4K8X A;  1Y97 A;  4FJK A;  1XNQ K;  5F2R A;  1FJG K;  1L3U A;  3A8Y A;  3SCX A;  4GKK K;  1NGI A;  5AFU A;  3SV3 A;  1NGB A;  3A5O C;  3MCA B;  3V9W A;  3OYF A;  2IVO A;  4EHU A;  1S1X A;  4FM2 A;  1B9F A;  2HF3 A;  4AHV A;  3G6E N;  4DHY A;  3LPT A;  2E1Z A;  3UKU B;  3RR8 A;  3OBW A;  1IV0 A;  4B1Z A;  3SUP A;  4O0J A;  4FWN A;  4HTU A;  5AJ3 K;  4XH1 A;  4OLA A;  3AVG A;  4CJK A;  4CJT A;  4BGA A;  2HHX A;  3MXM A;  2NRH A;  1LW0 A;  1LWE A;  3O9S A;  3RRH A;  3J7A P;  1HPZ A;  3CCU N;  3FFI A;  1W0H A;  1E4G T;  4BGB A;  3KKR A;  4YOV A;  2FF6 A;  4I9Q A;  4B9M A;  1JXE A;  4O0I A;  4FJI A;  2HND A;  1VQK N;  3HVT A;  3SPY A;  2ETJ A;  3LWL A;  4BRH A;  5C15 A;  3V9Z A;  5FRN A;  4HCB A;  3CFP A;  3KIO A;  2IVN A;  1JCG A;  4JNE A;  3T7Z A;  4DR5 K;  3ZT3 A;  2V7Z A;  4M3R A;  1J6Z A;  4JS5 A;  1T05 A;  3OHR A;  2OTJ N;  1SL2 A;  3AVK A;  1S6P A;  4RW7 A;  3U4L A;  4CEO A;  4FPB A;  4O8K A;  4DSJ A;  3O3H A;  1MU2 A;  4M3X A;  5C10 A;  4A59 A;  4ISG A;  1FK9 A;  3M6G A;  5AQN A;  3M1F A;  3LDS A;  3NCI A;  3G10 A;  1I39 A;  3ISN C;  3K59 A;  4H5V A;  3CCQ N;  3V1R A;  3CJB A;  3DXK B;  3ZSW A;  4DV2 K;  3HZ6 A;  1EO1 A;  5BR9 A;  4HWI A;  3CM6 A;  2D5R A;  4JRP A;  4DQ8 A;  5I3U A;  3VQP A;  2NRT A;  3RSE B;  1HJR A;  1C1C A;  5LJV A;  4ID5 A;  3WXK A;  4K0K K;  1NOZ A;  2E88 A;  1FW6 A;  3AAR A;  5M1O A;  1VSE A;  3CYM A;  4E7H A;  3UIQ A;  2D0P A;  4W5Q A;  3CC7 N;  4F8R A;  2HBM A;  2DTU A;  4FJ5 A;  4CIG A;  1RDA A;  3HTV A;  3TSU A;  3EL2 A;  2D1K A;  4Y1C A;  4CF8 A;  2P9U A;  1A5X A;  4ZTJ A;  4BR2 A;  1ZXO A;  1NMD A;  3ALY A;  4YOT A;  4JRQ A;  3AVA A;  4FWL A;  3S9H A;  3GE1 A;  2HB5 A;  1KRP A;  2D0B A;  1H1V A;  3FGU A;  2BDP A;  4KHQ A;  1OVY A;  3ZSZ A;  3T1Y K;  2I7P A;  1Q7Y O;  2G8H A;  4DR4 K;  3BEX A;  1J5O A;  3ASM A;  2IAJ A;  5A2Q O;  1W9H A;  5SWM A;  3ZT1 A;  3VQ9 A;  4CHY A;  3D2F A;  3WUH A;  3MWT A;  1IBM K;  4R79 A;  4FL9 A;  3OS2 A;  1KVA A;  2Z1H A;  3HYF A;  2GV9 A;  3ENB A;  4K25 A;  1T8E A;  2W6K A;  2VG7 A;  3G4S N;  4KAZ A;  2H3G X;  4DR6 K;  4H03 B;  1S1W A;  5LJW A;  2Q97 A;  1NMN A;  4E89 A;  3CFO A;  3OYL A;  1K8K A;  2E2N A;  1NJW A;  4CJL A;  3SMS A;  2GWJ A;  1HKB A;  5AQQ A;  1CZB A;  3WQU A;  2QW9 A;  1VSL A;  3THY B;  1RTJ A;  1GLL O;  2FBY A;  3N4P A;  4DV3 K;  3DM2 A;  3R3L A;  3DXM A;  3PO5 A;  2XY5 A;  3K0S A;  3H1V X;  4KBO A;  1RT4 A;  3CCJ N;  1XHZ A;  2NUB A;  1B92 A;  3WEE A;  3WXJ A;  4K8Z A;  4JI4 K;  1L5U A;  4KB1 A;  3BZC A;  4DTR A;  1X9J A;  2GTD A;  2E1Y A;  3VQE A;  1JJ2 M;  4YOY A;  1A5W A;  3TAE A;  3SJH A;  3P5J A;  5CZ2 A;  3V1O A;  3EY1 A;  4HUF A;  2A41 A;  3RSE A;  3LDN A;  4DFJ A;  1VRU A;  3PSI A;  4OKE A;  3UE5 A;  5AQZ A;  3HI0 A;  2GEM A;  4BWJ A;  3ZEU A;  5EXW A;  1OH8 A;  3KLE A;  3QB0 A;  4FJM A;  1IG8 A;  1NJY A;  5BRD A;  3TAQ A;  3NH2 A;  2QKK A;  2V51 B;  1RT6 A;  3JXU A;  4CZK A;  3KLG A;  4PUO A;  1EP4 A;  4CGF A;  1TVR A;  3MN5 A;  2XHB A;  3NGI A;  3HST B;  5AQJ A;  3VQ7 A;  3OYC A;  4J2D A;  2QEX N;  1BU6 O;  3O3G A;  2RE2 A;  3DLK A;  4QCL A;  3ID6 A;  3CCE N;  4CGD A;  2W40 A;  1BQM A;  4KRF A;  3ZT0 A;  1LV5 A;  2ZGY A;  4CEB A;  3CQ8 A;  4KH5 A;  4BG9 A;  4RWT A;  3IS9 A;  5C25 A;  2D0O A;  3LP0 A;  4N47 A;  4LFC K;  3OTO K;  2OZS A;  1JLC A;  5GAH P;  4KB0 A;  1QHT A;  3K5L A;  3DXM B;  5FPM A;  1QE1 A;  4CEQ A;  2A40 A;  2QK9 A;  3OA9 A;  4DSK A;  4FLT A;  3BZK A;  4WCE L;  1XMQ K;  5TKW A;  1YXQ A;  3L2R A;  1XC9 A;  4DMN A;  4FW2 A;  5AQR A;  3M8S A;  4J2A A;  1RT5 A;  4IG0 A;  3H45 C;  4B9L A;  4KTW A;  2OPQ A;  1U4B A;  4Q5V A;  3Q7B A;  1RT3 A;  2YNI A;  4X64 K;  1NK4 A;  2ZJR L;  1TL1 A;  2O8D A;  3U3G A;  3WXL A;  3D2E B;  4U7B A;  5AFU H;  4CK1 A;  3SJJ A;  3A5N C;  5FPN A;  3OYD A;  3QEW A;  4IOA L;  2P9L A;  3LDO A;  4MDA A;  1NGA A;  3OYA A;  4K41 A;  3DRP A;  3ULE A;  3OS0 A;  3CER A;  3QET A;  4E1J A;  4JI0 K;  4GNI A;  1T6C A;  2P9K B;  1U6Z A;  4CFA A;  2O8C B;  5AQG A;  3LAM A;  3I33 A;  3OBY A;  1RFQ A;  4KV8 A;  5KTQ A;  3HXM A;  5LMU K;  4Y1D A;  2VCP A;  4FOE A;  1NG9 A;  5DM7 L;  4F3O A;  4IJA A;  5J2M A;  1KFD A;  1RDB A;  4CZI A;  3O1W A;  2QWN A;  5BR8 K;  1Q8I A;  1WBD A;  2P9S B;  2G8K A;  1LW2 A;  5FRO A;  4KHP K;  2QA4 N;  3ENO A;  1L3T A;  4TSX A;  3LM2 A;  5C42 A;  3AVC A;  1LCU A;  2IDO A;  1JL2 A;  4RG8 A;  3BF3 A;  4DR2 K;  4HTL A;  3MAQ A;  3VF6 A;  4KPY A;  4FWK A;  2Z1G A;  2FSJ A;  2QWR A;  3U9Z A;  2V52 B;  3ZSQ A;  5AQP A;  2HBJ A;  4DTN A;  1VSK A;  1BIZ A;  5FLX O;  4B9U A;  3I0S A;  3G25 A;  5AQH A;  5AQF A;  3WXI A;  1RDC A;  3FLC O;  5KGW A;  1MWK A;  1L3V A;  4BC2 A;  1TAU A;  3VEW A;  3ZSX A;  4IKF A;  2UUB K;  3JSM A;  4WFA L;  2A6A A;  2WC9 A;  3MEE A;  2ZE2 A;  3HVR A;  4DCH A;  4YY3 K;  4DFK A;  3CPE A;  4CJS A;  4W5N A;  2O8B B;  4JI6 K;  4J8F A;  4M3U A;  1LWF A;  1Q82 O;  2P9N A;  2Z1I A;  3ZCM A;  3AA2 A;  1REV A;  2E2O A;  4EZ6 A;  2BUP A;  4FZY A;  1OKJ A;  3Q7C A;  1T03 A;  4C8L A;  1SV5 A;  4O44 A;  2NLX A;  4FW1 A;  3L8B A;  1VQ4 N;  3ZSR A;  5EY4 A;  5AZJ A;  5M1F A;  5T7B A;  2YV0 X;  5BRH A;  4JKF A;  4QS7 A;  4CER A;  4FM1 A;  4FOI A;  3BY5 A;  1QS4 A;  1Q9X A;  4IOX A;  2P9S A;  1GLA G;  1RIL A;  1NGH A;  1G15 A;  2O8E B;  3SV4 A;  4CGG A;  1SZ2 A;  4IFV A;  1JLA A;  4I6M B;  4CFB A;  4CBU A;  1ZC6 A;  4WYB A;  4FJ9 A;  4CZF A;  3NAE A;  2QWP A;  3BDP A;  4O4G A;  4FLV A;  3MN9 A;  2VQF K;  3VGK A;  1GOC A;  4AIL C;  2Q2R A;  2OPS A;  2GBZ A;  2YKN A;  3TTD A;  3CCL N;  1QZ5 A;  1M90 O;  4DS5 A;  4C8O A;  3RWU A;  1WSF A;  3AO1 A;  4JI5 K;  3E9O A;  4B9V A;  4NXN K;  1XQS C;  3LDQ A;  5JIC A;  4CJ3 A;  4DTX A;  5I42 A;  2FBV A;  1SKR A;  5AQL A;  1LAV A;  4LY7 A;  3EN9 A;  1S1V A;  2XY7 A;  4MO4 A;  1BUP A;  2YHW A;  3SK3 A;  3CQY A;  4BVP A;  4CEA A;  1ILY A;  2AP1 A;  4NCG A;  4B1U B;  2O4G A;  3PV8 A;  1WN7 A;  3LDP A;  5AZJ B;  1TK0 A;  4AHC A;  5AQT A;  4B3S K;  4JHD A;  4F4K A;  4FWO A;  3AVL A;  3QER A;  2ZJP L;  3M8R A;  3O8M A;  5I9E B;  3T1A A;  1TYQ A;  5BPM A;  5ADX H;  4BRA A;  1Z6R A;  4FLU A;  3R8E A;  4B3O A;  3FZF A;  2P9N B;  1X9W A;  4BVO A;  4B9S A;  5IWA K;  1NGJ A;  5TKY A;  2R7Y A;  2PBD A;  5AZI B;  4DQQ A;  3VEX A;  4DV7 K;  3CHW A;  1C1A A;  4Y0W A;  2KLA A;  3QML A;  5JMV A;  1UA1 A;  1BCO A;  1TKX A;  3A0I X;  2PY5 A;  2A3Z A;  3THV A;  2YHY A;  5BRE A;  1Q86 O;  1T7P A;  1ESV A;  1C0T A;  3MEC A;  4OPH A;  3AO4 A;  4FK2 A;  3VQC A;  1SQK A;  3PUF A;  3VEV A;  3SBT A;  4IZ9 A;  4DV1 K;  3SAF A;  1HNI A;  3AO2 A;  3HK2 A;  3R1X A;  4JI3 K;  3RVC A;  4CIE A;  4JYA K;  1YJW N;  3D2E A;  3TR8 A;  3HPG A;  4M3T A;  4FJH A;  5HRO A;  1YJ9 N;  4X66 K;  2UXD K;  4OPK A;  4OO1 J;  4CW7 B;  1NK0 A;  1XWL A;  4IFE A;  2NNW A;  1QVG M;  4PL8 A;  3J7Z O;  4OX9 K;  2EHG A;  4AHT A;  4BDZ A;  1TUU A;  1NGC A;  4FWP A;  5GIO A;  3MWP A;  1OH7 A;  5KGX A;  2X78 A;  1RBR A;  2JWL A;  4ELU A;  3HJF A;  3GG4 A;  3VER A;  3CC4 N;  1N32 K;  3OS1 A;  3F5T A;  1S6Q A;  3AVB A;  1SKS A;  2RHK A;  3WT0 A;  4X65 K;  5J2Q A;  3KK7 A;  2P9L B;  4E1N A;  4CVN E;  4FM0 A;  3CME N;  3EYZ A;  3DLH A;  3QNO A;  1IKX A;  1U49 A;  4B3T K;  1EWR A;  4BRC A;  3HSC A;  4RW9 A;  4ISE A;  3KLF A;  3V9X A;  3HOS A;  3U6F A;  1FKO A;  3IRX A;  3ZET A;  5LY3 A;  2Q1N A;  3LAL A;  3DOK A;  3QES A;  4BRG A;  4C1N I;  1CZ9 A;  3S3N A;  5AQY A;  1K9M O;  4A2B A;  1NJI O;  2PAV A;  1BA0 A;  4DUY K;  4LF5 K;  3KZB A;  3IKM A;  1YTU A;  3DLG A;  3QFU A;  5HRR A;  4EFH A;  3K9J A;  1O1W A;  3CC2 N;  2OAN A;  4OKK A;  1U45 A;  1TKT A;  4CF1 A;  2JLE A;  4BY9 C;  1VQ8 N;  4AHR A;  1SKW A;  2P9I B;  1WSG A;  1T3V A;  2ZF5 O;  3VQD A;  4H5W A;  2NRZ A;  4BAC A;  4KHY A;  4Z4G A;  1R59 O;  2EWS A;  1K8K B;  5BRF A;  4BRI A;  3MXJ A;  3DAW A;  2AJQ A;  1XHX A;  4N76 A;  4CZJ A;  1WSE A;  4BR4 A;  2YJF A;  1V4T A;  3PX0 A;  2ZWH A;  3FR0 A;  1IBL K;  3K5M A;  1S9E A;  1JLG A;  5CHI A;  5CE3 A;  1XMO K;  4DKW A;  3CJ7 A;  1NGG A;  2AA4 A;  4NO7 A;  2HHH K;  4CBW A;  1DTQ A;  2YJE A;  2B4J A;  4I2Q A;  3SQ0 A;  4FCY A;  1D9D A;  4AM7 A;  3TAG A;  1IBK K;  3VET A;  4CK3 A;  3OYG A;  4OJR A;  3RRG A;  1N5Y A;  3DRR A;  4JEP A;  1BI4 A;  1VRT A;  3AA4 A;  2A1S A;  1KLM A;  3OYI A;  3J8A A;  2UXC K;  1VK0 A;  4FJX A;  4FJL A;  3H3N O;  4FZZ A;  4WF9 L;  1L3S A;  4KHN A;  4AM6 A;  1C6V A;  3KWI A;  4E19 A;  2QXF A;  4NLB A;  5JS2 A;  3L2U A;  3QNN A;  3T19 A;  3HRG A;  4BWM A;  4JKE A;  4C1N K;  1NGD A;  4JKB A;  3VQA A;  3AAQ A;  4CHO A;  3C94 A;  4R5P A;  2O8F A;  3DWL A;  5F0X A;  1N8R O;  3CJA A;  3D45 A;  3PIO L;  2W41 A;  4FJG A;  2RF2 A;  2YI1 A;  2J4R A;  5KPR A;  3AV9 A;  1ASV A;  3FZK A;  2FSK A;  4B8C A;  4EP5 A;  1MWM A;  3HO1 A;  3NF9 A;  1M1K O;  4DTJ A;  1RGI A;  3JS6 A;  3CJC A;  2P9K A;  3SLC A;  3VQ5 A;  4EAH D;  3NH0 A;  4HUE A;  3TAP A;  1VAZ A;  4KKO A;  4FK0 A;  1HNX K;  2X6N A;  1QQO A;  3VTH A;  4FO0 A;  4CBX A;  4BR0 A;  3C6A A;  3O9R A;  1HNV A;  3UKR B;  3P4I A;  3EZ5 A;  2ASP A;  3SUQ A;  1JLE A;  4MFB A;  4LFB K;  1RCH A;  3TPQ A;  3P31 A;  5AQO A;  3U8X A;  1KVC A;  4H0X B;  3OYH A;  4DQS A;  4CEC A;  2ZGZ A;  4AHU A;  2B6A A;  3VF2 A;  1RTH A;  2NZT A;  1WUA A;  3DLE A;  3THW B;  1X9S A;  1D9F A;  3QBX A;  1RBT A;  3LL3 A;  1KLN A;  4LC9 B;  3NGZ A;  2NRX A;  4Z4F A;  1C0U A;  1IKW A;  3AA3 A;  4ISF A;  2HHQ A;  3U9D A;  3U3Y A;  3SUN A;  4RW6 A;  4W5O A;  4J2E A;  2E6L A;  5HOO A;  2F9T A;  3GOI A;  1VQP N;  1K73 O;  4DB3 A;  1RDW X;  5FRM A;  3LM9 A;  2G8U A;  4FLZ A;  1E4F T;  2Y1J A;  3J80 O;  3TI0 A;  2QWO A;  1TUY A;  5C0Y A;  2F8S A;  1UAX A;  2PFU A;  1NK8 A;  1NGE A;  4Z0U A;  1HRH A;  4IG3 A;  5FPD A;  5IT9 O;  2O8C A;  1P90 A;  3S3M A;  4NLC A;  1HNW K;  4BRE A;  4N56 A;  4LF6 K;  4E1M A;  3AVF A;  3AVH A;  4B3M K;  3P1G A;  4DTM A;  3PLA A;  3I56 N;  4FJJ A;  3VPZ A;  1FKP A;  4DF8 A;  1K8A O;  4N5S A;  4CD1 A;  4IBN A;  4KH6 A;  3VES A;  4BDP A;  1HYZ A;  2HF4 A;  2KW4 A;  4M42 A;  4ILG B;  3OVN A;  4OLB A;  2VYP A;  4H0O A;  1N33 K;  3ZX0 A;  1JLB A;  4UQG A;  5AQM A;  2RPI A;  4M45 A;  2O8B A;  2OCE A;  3SZ2 A;  3ZEU B;  4BRN A;  5AQI A;  4GW6 A;  3T69 A;  4CI6 A;  3F9M A;  3OYM A;  4WQ4 C;  4BR9 A;  5AQV A;  1EET A;  1EQY A;  2HW3 A;  1RT1 A;  2BE2 A;  2FSN A;  1ZBI A;  4BG8 A;  2HHT A;  3O3F A;  3AAP A;  3PX4 A;  1XNR K;  1ZBU A;  5HL7 L;  1HJO A;  2QWL A;  4FVM A;  3TWH A;  1VQ5 N;  3L6Q A;  3ITH A;  3OJS A;  3HT3 A;  4DF4 A;  2GEL A;  3M8P A;  3ZSY A;  5C2F A;  2OZM A;  5C2D A;  4DS4 A;  5KPT A;  4H8K A;  2YKM A;  5HRN A;  1UA0 A;  3DXK A;  5DMR A;  3HBT A;  2ASO A;  4B8A B;  1C0G A;  1I3A A;  2G8V A;  2HMP A;  3QIP A;  1CXU A;  1QTM A;  3NVK A;  1NLV A;  4KI6 A;  2P9I A;  4JK9 A;  4A5A A;  2HVH A;  2ASM A;  3ATU A;  2E5L K;  5HP1 A;  1HYV A;  2GUI A;  3JYT A;  3LZJ A;  4H5R A;  3NVM A;  3VF4 A;  4BQZ A;  3IMX A;  3PIP L;  4BE1 A;  3KD1 E;  2GWK A;  1ZBL A;  4O5F A;  3SUO A;  2F96 A;  2X74 A;  4DV5 K;  4OVL A;  2P9U B;  3KK3 A;  4I2P A;  3IFR A;  4H0V B;  4FK4 A;  2XY8 A;  3OYN A;  4JD2 A;  3MDQ A;  3H6E A;  2G8F A;  3LP3 A;  3CPW M;  3QIC A;  4ILJ A;  2RN2 A;  4DTU A;  3WXM B;  2P9P B;  3VEO A;  3SMP A;  1JCF A;  4E7J A;  4CCH A;  4PWD A;  3NF6 A;  2ZQB A;  2DPN A;  1F21 A;  1XI1 A;  4PA1 A;  2HMI A;  1Z25 A;  1KD1 O;  1EWQ A;  4HVJ A;  3ATV A;  5KRS A;  2O4I A;  1CZA N;  1KAY A;  5E84 A;  4IWV A;  1X9M A;  2F4V K;  4JKA A;  4LFA K;  4DLG A;  1WSH A;  3NFA A;  1DTT A;  2WTU A;  4B9Q A;  1YVU A;  3WQT A;  3CD6 N;  1HKG A;  2XY6 A;  3EE8 A;  3IUC A;  4BRO A;  2HBL A;  5C12 A;  2IVP A;  1BO5 O;  3MX2 A;  2JWK A;  4LF8 K;  4Z4E A;  4YOW A;  5FPE A;  2KFN A;  1D8Y A;  2RKI A;  3E9P A;  3GBT A;  3L2W A;  2YNF A;  1HX1 A;  3C0B A;  4H0P A;  4IDH A;  3CJ1 A;  3NBP A;  3WNE A;  4JAX A;  3OYJ A;  1YT3 A;  2HHW A;  4AF1 A;  5ADX A;  4AHS A;  4BRM A;  4CEF A;  3C7N B;  1VHX A;  4GKJ K;  2UU9 K;  3ZYY X;  3K58 A;  4FWR A;  2CGL A;  1UWB A;  3H3O B;  4DLE A;  1TGO A;  1X3N A;  3SPZ A;  3J7Y P;  1Z05 A;  2FXU A;  3HPH A;  4B9N A;  3TAM A;  3VGM A;  2YHX A;  1UOC A;  3C6T A;  3O4Q A;  4BQL A;  5KQ8 A;  2IC3 A;  1VSD A;  4Z94 A;  3CM5 A;  4CJU A;  3K57 A;  3G71 N;  5FDL A;  1BIU A;  1VQ6 N;  3AGK A;  2BAN A;  5ELZ A;  3VA0 A;  3TTF A;  3T1H K;  3AY9 A;  3KJV A;  1G99 A;  3AGR A;  2PYJ A;  4FJN A;  2ZD1 A;  4CF2 A;  4CIF A;  3NH1 A;  1QQN A;  5BN9 A;  3L4I A;  3EKU A;  3VQ4 A;  2PZS A;  3L3V A;  1XC3 A;  5M1N A;  1EX4 A;  3TTC A;  3EO3 A;  4JKD A;  3O9T A;  3EZW A;  2X6S A;  4RCH A;  3H08 A;  3P83 D;  4M3W A;  2KHO A;  5F1X A;  1SL1 A;  1YUW A;  4W5T A;  3A2F A;  3FFK B;  1WAJ A;  1LAW A;  4CJF A;  1KCF A;  3ZX2 A;  3SYZ A;  4B3R K;  2P9P A;  4GMJ B;  1WAF A;  3D0P A;  4XIU A;  2XRI A;  3TAF A;  1RDU A;  4DQP A;  4IFY A;  5HLF A;  1U2V B;  5BPN A;  3THW A;  2WUS A;  1Q9Y A;  3NDK A;  3I8B A;  3E66 A;  3DI6 A;  2Z1J A;  4B9T A;  1BL3 A;  1S1U A;  2VG6 A;  4YOX A;  1QQM A;  3HPO A;  1NOY A;  1CXQ A;  3H46 O;  1A5V A;  4BDY A;  4XEI A;  1TKD A;  3IDH A;  2HNZ A;  4JLH A;  4MLH A;  4CGJ A;  4CHN A;  4DSL A;  2UYT A;  4PL7 A;  1BI4 B;  4BRL A;  2DFH A;  3HM8 A;  3KLH A;  1S72 N;  3VA3 A;  2W6L A;  1W7A A;  2ATQ A;  5HRP A;  5JVH L;  2WBN A;  1JCE A;  3TAN A;  4JS4 A;  5EOY A;  4F2R A;  4IEI A;  3ZSV A;  2ITG A;  2P1J A;  2A1R A;  3O5B A;  1TKZ A;  4I9L A;  2HVI A;  4JI8 K;  3SAG A;  4CE9 A;  3K9K A;  3EE9 A;  3CCV N;  3M3Z A;  1GOB A;  1WNS A;  2YNH A;  3GDQ A;  3NHG A;  1BWF O;  4DU3 A;  4DTS A;  4G9Z A;  1VSJ A;  3CFR A;  1HUX A;  2HOE A;  3THY A;  1X3M A;  1DKG D;  3DLB A;  3K2P A;  3ZLJ A;  1NJX A;  3R6M A;  4AH9 A;  4E7I A;  2W42 A;  2NRV A;  2BH1 A;  2QM1 A;  1S3X A;  4YOU A;  2F8T A;  5J1E A;  1HQE A;  5KRT A;  1NNE A;  1TYQ B;  4C8N A;  4CJQ A;  1T6D A;  1EKE A;  1OH5 A;  4WFB L;  4BRQ A;  3SI6 A;  1JKH A;  4H4O A;  4CGH A;  3KTQ A;  2CH5 A;  1U2V A;  1BCM A;  5JLH A;  2P5O A;  3EKS A;  5EX5 A;  4BRD A;  4DG1 A;  2QWM A;  4C8M A;  5AZI A;  1J5E K;  1BG3 A;  1J9A A;  3SQ2 A;  4F3T A;  2D4W A;  4DFM A;  3PX6 A;  3S3O A;  4KHU A;  1WLJ A;  3CF5 L;  3C95 A;  3E01 A;  1WSJ A;  4BE0 A;  5K14 A;  2E8A A;  3FE1 A;  4GV9 A;  4Q0B A;  3VQQ A;  4CEZ A;  1BIS A;  3AO5 A;  4WFN L;  1LWC A;  1S9G A;  2ZM6 K;  3P39 A;  1S5J A;  3LAK A;  2IIR A;  3O4N A;  4IXC A;  4IDK A;  2IOC A;  4DSF A;  1HKC A;  2YCH A;  2XO7 A;  1U04 A;  4JD2 B;  4X62 K;  1IO2 A;  3W3D A;  3V4I A;  3ULD A;  5D3G A;  5JVG L;  3KVG A;  4CJP A;  4CZH A;  1NGF A;  3VGL A;  4YHH K;  2KQ2 A;  4DWI A;  1I94 K;  4CJ5 A;  2DY4 A;  4I6M A;  3RMC A;  3RR7 A;  4CFD A;  3K5O A;  3V9S A;  5GIP A; 
#chains in the Genus database with same CATH homology
 1RCH A;  4CFA A;  4J2B A;  3LAM A;  3LP2 A;  2FBX A;  1NK5 A;  1BGX T;  3T3F A;  3HP6 A;  1KVC A;  4KV8 A;  5CYQ A;  5KTQ A;  4YFU A;  3OYH A;  3HXM A;  4HHT A;  4DQS A;  1Z26 A;  4Y1D A;  3AVM A;  4CEC A;  4DQI A;  2BGG A;  1ASW A;  4AHU A;  2WOM A;  2B6A A;  3KKS A;  1RTH A;  3DLE A;  4CJ4 A;  1B9D A;  4DTO A;  4F3O A;  3V6D A;  5J2M A;  1X9S A;  2E4L A;  1D9F A;  1KFD A;  1RDB A;  1RBT A;  1NKC A;  1FXX A;  1KLN A;  1Q8I A;  1HQU A;  3LPU A;  4E0D A;  3NGZ A;  1TK8 A;  3V9U A;  1JL1 A;  1LW2 A;  3QIO A;  2P51 A;  5SZT A;  2G8K A;  3PO4 A;  5FRO A;  3SNN A;  4Z4F A;  1C0U A;  2KZM A;  1IKW A;  3AA3 A;  1ASU A;  2HHQ A;  1NKB A;  1L3T A;  3U3Y A;  4TSX A;  3SUN A;  4RW6 A;  5C42 A;  4W5O A;  4J2E A;  2YHA A;  3AVC A;  1WSI A;  4LH5 A;  2IDO A;  3WNG A;  1QSL A;  2E6L A;  4FJ7 A;  1JL2 A;  4RG8 A;  3I8D A;  2EX3 A;  3KK2 A;  3MAQ A;  2HNY A;  3VN5 A;  5FRM A;  2G8U A;  4KFB A;  4KPY A;  4FLZ A;  2Z1G A;  5DK5 A;  2Y1J A;  3TI0 A;  2F8S A;  3ZSQ A;  1UAX A;  4ELT A;  3QEX A;  1NK8 A;  1NJZ A;  1YTA A;  4Z0U A;  2HHS A;  1HRH A;  4IG3 A;  3WNF A;  4DTN A;  1VSK A;  4F2S A;  1BIZ A;  3S3M A;  4B9U A;  3I0S A;  4N56 A;  4CJE A;  2Y1I A;  4W5R A;  4E1M A;  1RDC A;  5KGW A;  3AVF A;  3AVH A;  2HHV A;  1NK6 A;  1L3V A;  4CGI A;  3P1G A;  4BE2 A;  4DTM A;  4M41 A;  1TAU A;  3BGR A;  3AVJ A;  3ZSX A;  4IKF A;  3JSM A;  4FJJ A;  5C24 A;  4CHQ A;  3MEE A;  1FKP A;  2ZE2 A;  3HVR A;  3RTV A;  4DF8 A;  1ITG A;  4KI4 A;  4DFK A;  4QAG A;  4KRE A;  4CJS A;  1BHL A;  4OKJ A;  4N5S A;  1XC9 A;  1KFS A;  4W5N A;  1IKV A;  4IBN A;  3OYK A;  4BDP A;  3RMD A;  1HYZ A;  4G1Q A;  4E7K A;  4M3U A;  2KW4 A;  4M42 A;  1LWF A;  2VWK A;  4EZ9 A;  3OVN A;  4KTZ A;  1NOY A;  5CZ1 A;  1K6Y A;  2Z1I A;  3ZCM A;  4OLB A;  3AA2 A;  1REV A;  4EZ6 A;  1VSI A;  4KHN A;  3V81 A;  4ID1 A;  2I5J A;  4FZY A;  4NCB A;  1JLB A;  1T03 A;  3VQ6 A;  4C8L A;  1SV5 A;  4O44 A;  3B6P A;  4UQG A;  5EU7 A;  1RT7 A;  2RPI A;  2LSN A;  4FW1 A;  4M45 A;  3L8B A;  4QOZ B;  3ZSR A;  3C6U A;  2JGU A;  3AO3 A;  3SZ2 A;  4E7L A;  5T7B A;  2YV0 X;  2KFZ A;  1RBU A;  4M3Z A;  4GW6 A;  3NF7 A;  3DOL A;  1SUQ A;  4CER A;  3OYM A;  4FM1 A;  3WNH A;  1SL0 A;  1QS4 A;  4CED A;  1EET A;  3QEI A;  1R0A A;  1KSP A;  3CG7 A;  4M3Y A;  2HW3 A;  1Q9X A;  1RT1 A;  1Y97 A;  2BE2 A;  3DRS A;  4FLX A;  4CJR A;  4K8X A;  4FJK A;  1L3U A;  1ZBI A;  1RIL A;  3O3F A;  2HHT A;  1G15 A;  3PX4 A;  3SCX A;  4NCA A;  1ZBU A;  1QQC A;  3SV4 A;  4CGG A;  4IFV A;  4HCC A;  1JLA A;  4FVM A;  3TWH A;  3OJS A;  3ITH A;  3HT3 A;  3SV3 A;  4DF4 A;  4CFB A;  4Z4H A;  3M8P A;  3ZSY A;  3NGY A;  3OYF A;  3V9W A;  4EP4 A;  2OZM A;  4FJ9 A;  4DS4 A;  1S1X A;  2YHB A;  4FM2 A;  3LAN A;  1B9F A;  4H8K A;  2YKM A;  3MEG A;  4AHV A;  5HRN A;  3NAE A;  1UA0 A;  3LPT A;  1IG9 A;  3RR8 A;  5DMR A;  3BDP A;  4O4G A;  4LSN A;  4B8A B;  4FLV A;  3SUP A;  1I3A A;  1U47 A;  3LWM A;  3QIP A;  4O0J A;  1CXU A;  1QTM A;  2G8V A;  1GOC A;  4AIL C;  4HTU A;  2Q3S A;  4KI6 A;  1ZBF A;  2OPS A;  3M8Q A;  4OLA A;  3AVG A;  2GBZ A;  2YKN A;  4CJT A;  3G0Z A;  4CJK A;  2HVH A;  3QEP A;  4DS5 A;  4C8O A;  1VSM A;  3RWU A;  1WSF A;  3AO1 A;  5HP1 A;  1HYV A;  2GUI A;  3JYT A;  2HHX A;  4B9V A;  3QLH A;  3LZJ A;  3MXM A;  1LW0 A;  1ZYQ A;  2KZZ A;  4CJ3 A;  1LWE A;  3RRH A;  4DTX A;  2PYL A;  1HPZ A;  4BE1 A;  4CF9 A;  3FFI A;  3KD1 E;  5I42 A;  1W0H A;  2FBV A;  3AVI A;  1SKR A;  1ZBL A;  3SUO A;  3KKR A;  1LAV A;  2F96 A;  4LY7 A;  2X74 A;  4OVL A;  3PY8 A;  4I9Q A;  4PY5 A;  1C0M A;  3KK3 A;  4I2P A;  4B9M A;  4FK4 A;  1JXE A;  3LZI A;  1S1V A;  2XY7 A;  2XY8 A;  4O0I A;  3OYN A;  2HND A;  4NYF A;  3V1Q A;  1QSY A;  2P5G A;  4FJI A;  3HVT A;  4MQ3 A;  3SPY A;  1D5A A;  2ETJ A;  3LWL A;  4CEA A;  4GVM A;  3V9Z A;  3RMA A;  3L2Q A;  5FRN A;  4NCG A;  3CFP A;  2G8F A;  4HCB A;  3KLI A;  3KIO A;  3LP3 A;  2VG5 A;  2O4G A;  4E3S A;  3PV8 A;  1WN7 A;  2RN2 A;  3ZT3 A;  3F9K A;  4DTU A;  1TK0 A;  4M3R A;  4AHC A;  4JS5 A;  1T05 A;  4F4K A;  1SL2 A;  3AVL A;  4E7J A;  3QER A;  3VQ8 A;  3M8R A;  4DFP A;  4CCH A;  4PWD A;  3AVK A;  3NF6 A;  4FLW A;  1S6P A;  2ZQB A;  3QIN A;  3T1A A;  3HL8 A;  4RW7 A;  1F21 A;  4CEO A;  1XI1 A;  4PA1 A;  2DFE A;  3QEV A;  5J2N A;  2HMI A;  1Z25 A;  4DSJ A;  4HVJ A;  2O4I A;  5KRS A;  3O3H A;  1MU2 A;  4FLU A;  4M3X A;  4B3O A;  3F73 A;  1FK9 A;  1IKY A;  3NF8 A;  1IH7 A;  1S1T A;  1X9W A;  4B9S A;  3DLR A;  1X9M A;  3VQB A;  2R7Y A;  4L8R B;  3LDS A;  4CJW A;  4DLG A;  3NCI A;  3G10 A;  1I39 A;  3ISN C;  1BQN A;  3K59 A;  4DQQ A;  2QKB A;  1WSH A;  1RT2 A;  3NFA A;  1DTT A;  3V1R A;  1C1A A;  3AVN A;  2YNG A;  3ZSW A;  4C8K A;  4CHP A;  1QSS A;  5JS1 A;  1JLF A;  3CM6 A;  2D5R A;  4JRP A;  1UA1 A;  4Z4I A;  1BCO A;  1TKX A;  1YVU A;  4H4M A;  2PY5 A;  3THV A;  5I3U A;  3VQP A;  1TK5 A;  2XY6 A;  1HJR A;  1C1C A;  1T7P A;  4ID5 A;  4Z4E A;  1U48 A;  1C0T A;  1NOZ A;  3MEC A;  1EXQ A;  3AO4 A;  1C1B A;  4FK2 A;  3VQC A;  2KFN A;  1D8Y A;  2RKI A;  4OPJ A;  1VSE A;  3PUF A;  3CYM A;  4E7H A;  3UIQ A;  3L2W A;  4W5Q A;  4DTP A;  2YNF A;  5HRS A;  2VWJ A;  4F8R A;  1HNI A;  3AO2 A;  3HK2 A;  2DTU A;  4PQU A;  4ELV A;  2FC0 A;  3TAB A;  3NBP A;  4FJ5 A;  2DFF A;  4CIG A;  3WNE A;  2HHU A;  1HMV A;  1RDA A;  3OYJ A;  1YT3 A;  2HHW A;  3L2V A;  4DQR A;  4AHS A;  4CIE A;  4ICL A;  4DU4 A;  4Y1C A;  4CF8 A;  3IAY A;  4CEF A;  3TR8 A;  3HPG A;  1A5X A;  4ZTJ A;  4M3T A;  4RW8 A;  5J2P A;  3ALY A;  4LH4 A;  4JRQ A;  5HRO A;  4FJH A;  1RDD A;  3AVA A;  4OPK A;  3K58 A;  3S9H A;  4DLE A;  1UWB A;  1TGO A;  2HB5 A;  3SPZ A;  1KRP A;  1NK0 A;  1XWL A;  3L3U A;  2IS3 A;  4RW4 A;  2D0B A;  3HPH A;  4B9N A;  1NK9 A;  2EHG A;  3TAM A;  2BDP A;  4AHT A;  4KHQ A;  1UOC A;  3C6T A;  3O4Q A;  3ZSZ A;  4BDZ A;  2IC3 A;  1VSD A;  1NK7 A;  2G8H A;  1J5O A;  3ASM A;  2IAJ A;  3CM5 A;  1W9H A;  4CJU A;  4I7F A;  3ZT1 A;  5FDL A;  5SWM A;  3VQ9 A;  5KGX A;  2X78 A;  3K57 A;  4CHY A;  4KTQ A;  1BIU A;  1RBR A;  1KTQ A;  4ELU A;  2BAN A;  3VA0 A;  4N41 A;  3HJF A;  2G8I A;  1CLQ A;  3KJV A;  2PYJ A;  3OS2 A;  3OS1 A;  1S6Q A;  4FJN A;  1KVA A;  2Z1H A;  3HYF A;  1RBV A;  2ZD1 A;  3AVB A;  4CF2 A;  1SKS A;  1J54 A;  5E41 A;  4CIF A;  3NH1 A;  2GV9 A;  3NE6 A;  5J2Q A;  3VQ4 A;  4KHW A;  1T8E A;  2PZS A;  3L3V A;  1EX4 A;  3OY9 A;  2VG7 A;  3OYB A;  2X6S A;  3H08 A;  4E1N A;  4FM0 A;  3P83 D;  3EYZ A;  3DLH A;  4KAZ A;  3QNO A;  4O5B A;  4M3W A;  4KHS A;  1IKX A;  1SL1 A;  1JXB A;  3SQ1 A;  1U49 A;  1JLQ A;  1S1W A;  1VSH A;  3SQ4 A;  4W5T A;  4RW9 A;  3A2F A;  4E89 A;  2OA8 A;  1WAJ A;  1LAW A;  3CFO A;  4CJF A;  3OYL A;  3KLF A;  1KCF A;  3K5N A;  1X1P A;  3SYZ A;  3V9X A;  1NJW A;  4CJL A;  4DU1 A;  4GMJ B;  3U6F A;  1WAF A;  2WON A;  1FKO A;  3D0P A;  3IRX A;  3I0R A;  2XRI A;  1RBS A;  4WE1 A;  4XIU A;  1CZB A;  3TAF A;  4DQP A;  4IFY A;  3DYA A;  3DOK A;  3LAL A;  4O55 A;  3QES A;  5HLF A;  3KD5 E;  3MXI A;  1CZ9 A;  4CK2 A;  3S3N A;  1VSL A;  1Q9Y A;  3NDK A;  4ZTF A;  1RTJ A;  1TAQ A;  2FBY A;  3DI6 A;  2Z1J A;  4B9T A;  1YTU A;  3DLG A;  1BL3 A;  5HRR A;  1S1U A;  4MFB A;  3DM2 A;  1N6Q A;  2VG6 A;  3PO5 A;  1RNH A;  1O1W A;  2XY5 A;  3HPO A;  4OGE A;  1RTD A;  2D0A A;  1RT4 A;  3HP9 A;  1CXQ A;  4OKK A;  1A5V A;  1TKT A;  2NUB A;  4CF1 A;  1B92 A;  4BDY A;  1XHZ A;  1U45 A;  3LP1 A;  1TKD A;  4K8Z A;  2JLE A;  2HNZ A;  4JLH A;  4CGJ A;  4CHN A;  1L5U A;  4DSL A;  4FYD A;  4AHR A;  4KB1 A;  1BI4 B;  3KLH A;  2DFH A;  4DTR A;  1SKW A;  3VA3 A;  1DLO A;  1WSG A;  3VQE A;  2ATQ A;  5HRP A;  3TAN A;  1A5W A;  4JS4 A;  4LSL A;  3VQD A;  3TAE A;  3P5J A;  4F2R A;  5CZ2 A;  3V1O A;  3ZSV A;  2ITG A;  3EY1 A;  4HUF A;  4FJ8 A;  2G8W A;  2P1J A;  2IGI A;  1HYS A;  4DFJ A;  4BAC A;  2A1R A;  4KHY A;  1VRU A;  4Z4G A;  1TKZ A;  4I9L A;  3HM9 A;  2HVI A;  4OKE A;  4CEE A;  5HBM A;  2FBT A;  4CE9 A;  3MXJ A;  4BWJ A;  1GOB A;  2AJQ A;  1WNS A;  3RMB A;  1XHX A;  4N76 A;  1WSE A;  2YNH A;  3KLE A;  3KK1 A;  3NHG A;  3PX0 A;  4FJM A;  2OPR A;  4DU3 A;  4DTS A;  1NJY A;  3K5M A;  1VSJ A;  3CFR A;  1S9E A;  3IG1 A;  1ZBH A;  1JLG A;  4ZHR A;  4HUG A;  4CES A;  3TAQ A;  3NH2 A;  2QKK A;  1TV6 A;  3DLB A;  3K2P A;  5KI6 A;  1DTQ A;  4I2Q A;  2B4J A;  3SQ0 A;  1RT6 A;  1NJX A;  4FCY A;  1D9D A;  3KLG A;  4AH9 A;  4CFC A;  4E7I A;  3TAG A;  3OJU A;  1EP4 A;  2W42 A;  4CGF A;  4CK3 A;  4PUO A;  1TVR A;  2XHB A;  3OYG A;  4OJR A;  3RRG A;  1N5Y A;  3DRR A;  3ZT2 A;  1BI4 A;  1VRT A;  3AA4 A;  5CY4 A;  4CJV A;  3NGI A;  3HST B;  2A1S A;  1KLM A;  1HQE A;  5J1E A;  3OYI A;  3VQ7 A;  3OYC A;  4J2D A;  2F8T A;  1VK0 A;  5KRT A;  3O3G A;  4FJX A;  4FJL A;  3DLK A;  4QCL A;  4C8N A;  4CJQ A;  1EKE A;  4CGD A;  1BQM A;  4KRF A;  4FZZ A;  3ZT0 A;  1LV5 A;  1L3S A;  4CEB A;  3CQ8 A;  4FXD A;  3SI6 A;  3KTQ A;  1C6V A;  1JKH A;  4H4O A;  3IS9 A;  4CGH A;  4E19 A;  5C25 A;  4FLY A;  2QXF A;  1BCM A;  3LP0 A;  3ZT4 A;  4N47 A;  2P5O A;  5JS2 A;  3L2U A;  4DSE A;  3QNN A;  4DG1 A;  3T19 A;  4BWM A;  2OZS A;  1TL3 A;  4C8M A;  4OGC A;  1JLC A;  4KB0 A;  1QHT A;  3VQA A;  1J9A A;  2OYQ A;  3SQ2 A;  4F3T A;  3DMJ A;  3K5L A;  4DFM A;  3PX6 A;  2D0C A;  4CHO A;  3TAR A;  1RTI A;  1QE1 A;  3C94 A;  4CEQ A;  1WLJ A;  4R5P A;  3OYE A;  3S3O A;  4KHU A;  2QK9 A;  4DSK A;  4FLT A;  3C95 A;  4CHZ A;  2KTQ A;  3D45 A;  3AA5 X;  5CYM A;  4Z4C A;  3E01 A;  1NKE A;  1WSJ A;  4BE0 A;  5K14 A;  4FZX C;  4LD0 A;  3MED A;  4Q0B A;  4KO0 A;  3VQQ A;  4CEZ A;  2B5J A;  1BIS A;  3AO5 A;  4FW2 A;  1LWC A;  1S9G A;  4DMN A;  3L2R A;  2RF2 A;  4FJG A;  1S5J A;  3LAK A;  3M8S A;  4J2A A;  1RT5 A;  1VSF A;  4IG0 A;  4B9L A;  3O4N A;  2OPQ A;  4IDK A;  4KTW A;  2IOC A;  4Q5V A;  3AV9 A;  1RT3 A;  1ASV A;  2YNI A;  4DSF A;  1U4B A;  2OPP A;  4B8C A;  4EP5 A;  2XO7 A;  1NK4 A;  1U04 A;  3NF9 A;  3HO1 A;  1TL1 A;  4DTJ A;  1IO2 A;  3U3G A;  3V4I A;  3B6O A;  3ULD A;  4B08 A;  3SJJ A;  4CK1 A;  3VQ5 A;  5D3G A;  3NH0 A;  3ZSO A;  3OYD A;  4CJP A;  4KKO A;  4HUE A;  3QEW A;  3TAP A;  4FK0 A;  1GOA A;  1J53 A;  2X6N A;  2E6M A;  4CF0 A;  1KVB A;  2KQ2 A;  4NYN A;  4DWI A;  3OYA A;  1HNV A;  3DRP A;  4CJ5 A;  2DY4 A;  4YNQ A;  3RMC A;  3EZ5 A;  3OS0 A;  4DSI A;  3QET A;  3RR7 A;  4CFD A;  3K5O A;  3SUQ A;  1JLE A;  3QO9 A;  3V9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...