3QINA

Crystal structure of hiv-1 rnase h p15 with engineered e. coli loop and pyrimidinol carboxylic acid inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
148
structure length
137
Chain Sequence
MYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIITQWIHNWKVKNVDLVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Binding Analysis of Pyrimidinol Carboxylic Acid and N-Hydroxy Quinazolinedione HIV-1 RNase H Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Transferase, hydrolase/inhibitor
molecule keywords Gag-Pol polyprotein,Ribonuclease HI,Gag-Pol polyprotein
total genus 43
structure length 137
sequence length 148
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3qinA00
1RTIA 3L2WA 4PUOA 3I0RA 3KTQA 3O3GA 4FZYA 4FLUA 3S3OA 1L3VA 3KKSA 3L3UA 4M3WA 1HQEA 4FM2A 2G8UA 3VQBA 4CGFA 1NOYA 3SV4A 1C6VA 1HQUA 3MECA 3VA0A 1GOAA 2D0CA 2A1RA 3C94A 4M3XA 5SZTA 3RWUA 2E6MA 2XY6A 5I3UA 4CGJA 1Q8IA 5KTQA 1REVA 5JS1A 3LAMA 4CF2A 1JXBA 3LZIA 2P51A 3SUOA 1NOZA 2P1JA 2Z1HA 4CE9A 3K57A 4FJMA 2G8HA 4NCAA 2OPQA 1RCHA 4E7JA 3M8QA 4CFBA 3NH1A 1B92A 1JL2A 1WNSA 2DFFA 1L3SA 1IKXA 3TABA 4DU4A 3HL8A 3L2VA 1LW0A 3AA4A 3AVHA 4B08A 3QNNA 1HYVA 2D0BA 4AHTA 4CGIA 4CJ5A 1RTDA 4I7FA 3K5NA 3NHGA 4B9UA 3VQ4A 3NH2A 3VQ8A 3L2RA 2HW3A 3MEDA 5CZ1A 3DOLA 1TKZA 1NK4A 4OLAA 1WSEA 3OVNA 4DLGA 3KLHA 1SV5A 3LP3A 1U48A 2QKBA 4DTNA 4C8KA 4FVMA 4FLXA 2B6AA 1A5XA 1RT5A 3AVGA 4M42A 1VRTA 5KRTA 1FKPA 5KRSA 4FJIA 1NJXA 1BI4A 5HBMA 3NH0A 1RBTA 4DS5A 2YV0X 4LSLA 4DWIA 1S1TA 3E01A 3AO5A 3MXMA 1TK0A 1Q9XA 1WAJA 4K8XA 3V6DA 1RBRA 3ZSRA 3HP6A 3KIOA 3QEVA 2E6LA 4CJRA 1RT7A 3S3MA 4KHYA 4KI4A 5CYMA 2OA8A 3AA2A 4DTRA 1ZYQA 1NJYA 1J53A 1JLAA 4CFDA 4J2AA 4OKKA 3QESA 4LY7A 3L2UA 3V4IA 3OS1A 4Z4FA 3UIQA 3IG1A 4CJ4A 3LAKA 1CLQA 3ZT0A 4CFAA 1WSGA 4J2BA 3P1GA 2QXFA 5E41A 1TV6A 3CFPA 3VQDA 1DTQA 3I0SA 3HT3A 4EP5A 4DQSA 3IAYA 3VQQA 1IO2A 3RMCA 3G0ZA 2JGUA 3HK2A 1RBVA 3O4NA 3RMDA 4CJVA 4KI6A 3CM5A 4CHNA 4KREA 1RTHA 1S5JA 2GUIA 4RW6A 1BQNA 4AHUA 4DFJA 2O4IA 1RDBA 3L2QA 4CF9A 1CXQA 2RPIA 4C8OA 4DSIA 4M3YA 1FKOA 4FJNA 3AVMA 3NGZA 3NE6A 4JRPA 2G8VA 4Q0BA 4EZ6A 3ASMA 2KZZA 2PZSA 1KVAA 3M8PA 4ID1A 3T19A 3ZSWA 2WONA 1B9FA 4DFPA 2PYJA 4IKFA 1HYSA 2HHQA 4DU1A 4OPJA 4G1QA 1BGXT 4KHSA 2QK9A 4ZHRA 3CFRA 1N6QA 4BWJA 4RW4A 3OYCA 1RNHA 5SWMA 4E7HA 3ZSZA 4CF1A 1QSLA 3PUFA 4KAZA 4O5BA 2DY4A 4Z4IA 3QLHA 3KLEA 1G15A 4E3SA 1JLEA 1C1BA 4R5PA 4KRFA 3SYZA 2GV9A 4KTWA 4LSNA 1TK5A 1I3AA 3ISNC 4DLEA 1T05A 3KLGA 4B8AB 3SUQA 3PO5A 2KZMA 3CQ8A 1BCMA 4B8CA 1FXXA 3VQ9A 4E19A 3AO4A 3LPTA 3F9KA 3I8DA 4CJFA 1X9SA 4OGEA 5KGXA 4AHRA 3HM9A 1LAWA 4DTJA 1ASWA 1RTJA 2G8WA 4PY5A 3HVRA 3ZCMA 4CEFA 1BIUA 1S9EA 2EHGA 3KK2A 2IOCA 2D5RA 4ELVA 2BGGA 2GBZA 1A5VA 3U6FA 3TAFA 2FBVA 3OYIA 4NYNA 4FW2A 1XWLA 3H08A 4BDPA 3DMJA 4E1MA 4KPYA 2NUBA 3K5MA 4FLWA 2ETJA 2WOMA 2EX3A 4LD0A 4TSXA 4CEDA 3DLEA 4QCLA 1IG9A 4OKJA 3JYTA 1YTAA 3NF8A 3VQAA 4AILC 3C95A 4ID5A 2F96A 4AHSA 3RTVA 4B9LA 1JLFA 1BCOA 3L3VA 4NYFA 3HYFA 2JLEA 3C6UA 2Y1IA 3SV3A 2Y1JA 1Q9YA 1VSJA 3OJSA 4RW9A 4CJSA 3B6PA 1JL1A 1VSFA 3RMAA 3SCXA 1RDAA 1S1VA 1NK6A 2ZD1A 1IKVA 3SUNA 4F4KA 3ZT2A 4CHPA 4HUFA 3SJJA 1TKXA 4DSJA 4B9TA 1T03A 3LP2A 1JLGA 4CJ3A 1NK9A 3MAQA 3B6OA 4HUGA 2Z1GA 2HMIA 4ELUA 3V9SA 2YNIA 4IDKA 1HJRA 3CFOA 4DTMA 4JRQA 4JLHA 3SUPA 5HRRA 3QEPA 1NK7A 1D9FA 1O1WA 1VSEA 1SL0A 3CYMA 3LPUA 1XHZA 1DTTA 2XO7A 1KCFA 1C0MA 1EXQA 4CEBA 4FZZA 4QOZB 1C0UA 2LSNA 1GOBA 3U3YA 3AA3A 2P5OA 4FK2A 2KQ2A 4H4MA 3EYZA 4ICLA 4KHNA 3DRSA 4CEEA 1JLQA 1VSDA 4CJKA 3V81A 3AO2A 2XY7A 2OPPA 4DMNA 4XIUA 3QETA 4CF8A 2DTUA 4OLBA 2OPSA 1VK0A 1TK8A 1B9DA 3QEXA 3BDPA 4CJWA 1C1CA 4LH5A 2PY5A 1IKYA 3IS9A 3DLKA 1WSHA 4HVJA 4CJPA 2KTQA 4HHTA 1NK0A 3SQ2A 2YHAA 4OKEA 4OPKA 4FJ7A 4E1NA 1EETA 4BWMA 2G8FA 2E4LA 4W5TA 1MU2A 4Z4GA 4Z4EA 3KD5E 4N76A 4CJTA 4IFVA 3DOKA 1Z26A 4O0IA 4CJQA 3QEWA 1S1XA 1UA1A 1LWFA 2XY5A 4BDYA 1VSMA 3HSTB 3T1AA 3WNGA 3F73A 3VQCA 1LAVA 2R7YA 3OYNA 3SQ1A 3OS0A 4W5OA 2VWKA 1UA0A 1GOCA 3ULDA 1SL1A 3VA3A 1HNVA 1EX4A 4E89A 1TKTA 4OVLA 1RDCA 2VWJA 2OZSA 4CIGA 4FJLA 2HVHA 1SKSA 3HPGA 4FLZA 2YNGA 4I9LA 4DQPA 1S6QA 1RT6A 5CYQA 4L8RB 3CG7A 2VG5A 3ZSVA 1D5AA 1U4BA 1ASVA 1TKDA 4EZ9A 4J2DA 1J5OA 4EP4A 2F8SA 4FJ5A 4E7LA 1TL3A 1NJZA 1HPZA 2ATQA 4BE0A 3PV8A 1ASUA 1I39A 4B9NA 4CHZA 2HB5A 3KK3A 4Z0UA 3QERA 4H8KA 4DTUA 5KI6A 1Z25A 1X9MA 3OYDA 3HPOA 4FLVA 3S9HA 1TL1A 2FBYA 2HHWA 3M8RA 1BIZA 4RW7A 2BANA 4Y1CA 3NAEA 3RRGA 3ZSOA 3K5LA 3DRPA 4CGGA 4F3OA 2Z1JA 4PWDA 3ZT3A 1BISA 1VRUA 4F2RA 3ZT1A 5HRNA 4FJXA 2FBTA 1WAFA 1WSJA 3OYLA 3TAEA 2BE2A 4CIFA 4M3ZA 1S6PA 3QNOA 1VSLA 4GMJB 1VSHA 4I2PA 3WNEA 4CGDA 3SNNA 4KB0A 5KGWA 4DSEA 3NGYA 4BE1A 2HNDA 2A1SA 3D45A 3AVIA 3U3GA 1D9DA 4M41A 4FZXC 2AJQA 4W5NA 4DQQA 3PX6A 4DTXA 4M3UA 1ZBUA 1W0HA 4DSFA 4K8ZA 2X6NA 4N5SA 3OYMA 3TARA 3KLFA 3V1OA 1SUQA 4FW1A 4PA1A 3OS2A 3OJUA 3JSMA 4DTSA 5J2PA 4F3TA 2YNHA 2YHBA 3V1QA 4WE1A 1SKWA 3A2FA 3NCIA 3EZ5A 4DTPA 1RDDA 1IKWA 3ZSXA 3K59A 4KFBA 3AVLA 4CECA 3NF9A 5J2MA 3HJFA 3MXIA 4CGHA 4FK4A 1F21A 2VG7A 3RMBA 4LH4A 1KRPA 3SQ0A 3ZSQA 2P5GA 2KFNA 4BACA 4KTZA 4DFKA 4CEAA 1EP4A 5HLFA 2I5JA 4B9VA 2YKNA 2Q3SA 1JLCA 3MEEA 3PO4A 4CCHA 4FXDA 2IC3A 3OYHA 3SI6A 3QIOA 4CERA 1XC9A 4FM1A 3NBPA 3DLBA 1CZBA 4YFUA 3SQ4A 1KLMA 4CHQA 4DQIA 4FJ8A 1RT4A 1JLBA 1WN7A 3SZ2A 3LWLA 4DU3A 4IBNA 3LDSA 3L8BA 3AV9A 1WSIA 3MXJA 1QHTA 1KLNA 5I42A 3VQ6A 5C42A 4JS5A 1R0AA 4CJLA 3TAQA 4ZTJA 1UAXA 3HP9A 5FRMA 4BDZA 1K6YA 2ITGA 3O4QA 1U04A 4B9MA 1LW2A 2RKIA 3DYAA 4IG0A 3AA5X 3CM6A 4DSLA 4KHWA 3AVFA 3O3FA 1S1WA 2X74A 3T3FA 3QINA 2FC0A 2X6SA 3LP1A 3AVKA 5J2NA 3QEIA 3DLGA 1BL3A 3G10A 3IRXA 4RW8A 2O4GA 4M45A 5JS2A 4DF8A 1X9WA 4DSKA 3TR8A 1A5WA 3KLIA 3K5OA 1ITGA 4MFBA 1C1AA 3VQPA 4O44A 4Z4CA 4CK3A 3M8SA 3OYFA 3KD1E 2F8TA 4DQRA 2OYQA 3DI6A 2HNZA 4CK2A 2VG6A 1RBSA 5J1EA 1J54A 3WNHA 4UQGA 3P83D 3AO1A 3AVCA 5CZ2A 3QO9A 3KKRA 1QSYA 3D0PA 1HNIA 3NF7A 2ZE2A 4C8NA 1TGOA 4HTUA 3SPYA 3HO1A 2HVIA 4B3OA 2HHVA 2D0AA 5J2QA 3OYEA 2YNFA 4CEOA 3RRHA 1YT3A 1TAQA 2ZQBA 4KHQA 1UWBA 4NCGA 1D8YA 1S1UA 3K58A 1L3TA 4Q5VA 2B4JA 1NJWA 3P5JA 4MQ3A 3VQEA 4CK1A 3V9XA 2B5JA 3K2PA 4B9SA 3ALYA 1ZBIA 3RR8A 1TAUA 1DLOA 3AO3A 3DM2A 3HXMA 3V9WA 3SPZA 4JS4A 3V9ZA 4DFMA 3VN5A 4FLTA 5C24A 3PY8A 2G8IA 3O3HA 3AVNA 3TWHA 4CFCA 1IH7A 2OZMA 4FJJA 2KFZA 5D3GA 4C8LA 2FBXA 4AHCA 3AVAA 3ITHA 4ZTFA 4I9QA 3V1RA 4J2EA 4M3TA 4RG8A 2IDOA 2DFHA 5HROA 3BGRA 2QKKA 3VQ5A 4KTQA 4NCBA 3FFIA 4AH9A 4GW6A 3KK1A 1CXUA 5HRSA 4W5QA 5C25A 3LZJA 3TAGA 4IG3A 1EKEA 4O55A 3THVA 2RN2A 4KV8A 3AVBA 1J9AA 4C8MA 1KSPA 1KFDA 3V9UA 2HHTA 1VSKA 4FJHA 5CY4A 1SKRA 1UOCA 5FROA 3OYGA 3HVTA 1HRHA 4CIEA 4CJEA 1TVRA 1QTMA 1S9GA 4HCCA 1LWCA 1NK5A 1YVUA 1WSFA 1ZBLA 1RBUA 1KFSA 2OPRA 3NGIA 1CZ9A 1NKBA 3ZT4A 3LWMA 1FK9A 3AVJA 4FK0A 2XHBA 4CJUA 4BE2A 1RT1A 4E7KA 4DTOA 2HHXA 4KKOA 3PX4A 3S3NA 5HP1A 1NK8A 4FCYA 3TAPA 2G8KA 4KO0A 1U45A 4QAGA 1Y97A 1W9HA 1BQMA 1T8EA 4I2QA 3LALA 4FJKA 5FRNA 1WLJA 3DLRA 1HYZA 5HRPA 4ELTA 1RILA 2Z1IA 3C6TA 4OGCA 4CHOA 4GVMA 2HNYA 3OYKA 4FLYA 1BI4B 4H4OA 1L5UA 4FYDA 1NKEA 4W5RA 4HCBA 4O0JA 4DS4A 4PQUA 1T7PA 4AHVA 3TI0A 4O4GA 3VQ7A 1QS4A 1XHXA 4CEZA 4KB1A 4F2SA 2XRIA 4CF0A 1JXEA 2IAJA 4N56A 1X1PA 1NKCA 4CESA 1LV5A 1QSSA 2BDPA 3DRRA 4F8RA 3LANA 4IFYA 1HMVA 3TAMA 3WNFA 1RT2A 3NFAA 1U49A 3OYBA 3OYAA 4KHUA 4FJGA 4CHYA 2DFEA 2IGIA 3NF6A 3RR7A 5FDLA 1KTQA 3ZSYA 4YNQA 5DMRA 1VSIA 1QQCA 4N41A 3DLHA 1QE1A 1JKHA 2X78A 3QIPA 2HHSA 2HHUA 2W42A 4CEQA 5DK5A 1U47A 4DF4A 1SL2A 4OJRA 3MEGA 4FM0A 4FJ9A 1KVCA 4DG1A 3HPHA 3NDKA 2PYLA 3OY9A 1KVBA 1RT3A 1ZBHA 5T7BA 3PX0A 1C0TA 4N47A 4Z4HA 2YKMA 4E7IA 1BHLA 1L3UA 1ZBFA 5K14A 4Y1DA 1XI1A 1LWEA 4M3RA 3LP0A 3KJVA 3OYJA 3EY1A 3TANA 2KW4A 4HUEA 1N5YA 4E0DA 2IS3A 2XY8A 1YTUA 5EU7A 2RF2A
chains in the Genus database with same CATH superfamily
3S3OA 2JWLA 1S72N 1IG8A 3SV4A 1GOAA 2D0CA 2A1RA 3RWUA 2E6MA 3O80A 4CGJA 2E2OA 5AZJB 5JS1A 3CIPA 3LZIA 3GDQA 4J8FA 3K57A 4DV3K 4NCAA 3M8QA 4MDBA 4DR5K 1L3SA 1JL2A 1WNSA 4X62K 3HL8A 3QFPA 4DU4A 1LW0A 3AVHA 4CZIA 4DV2K 1W7AA 3J80O 4AHTA 3L4IA 3CXCM 4NXNK 3NH2A 1M1KO 4OLAA 1WSEA 2OTLN 3VF4A 4DTNA 4YY3K 1OH7A 4IOCL 4BRCA 4JI7K 4FJIA 5HBMA 3KK7A 1QQNA 2ZJPL 4FWPA 5BRHA 3KIOA 5TKWA 5LL6Z 1RT7A 5CYMA 2OA8A 4DTRA 3WXIA 4J2AA 1J53A 5F0XA 4KH6A 1CLQA 2P9NA 1HX1A 3I0SA 3AAPA 3RMCA 3CCUN 3G0ZA 3ZYYX 2JGUA 5AQIA 3RMDA 3THWB 4KI6A 1NGHA 4CHNA 1RTHA 3HTVA 4RW6A 4DFJA 2O4IA 4O8KA 2D0OA 1GLEG 3ZX3A 3AVMA 3NE6A 1DT9A 4EZ6A 4WCEL 2YJEA 3ZSWA 1HYSA 4JI5K 4DU1A 4OPJA 1HKBA 1BGXT 4KHSA 3QB0A 4BRAA 3FGUA 3CFRA 1N6QA 4NO7A 3IKMA 3OYCA 1RNHA 4B1UB 5SWMA 3ZSZA 5LJVA 3PUFA 2AP1A 3CCVN 5AQJA 4KAZA 4O5BA 5F1XA 4Z4IA 3QLHA 4M63C 3CC4N 4R5PA 1C1BA 1ESVA 4H5TA 1TK5A 4JN4A 5AQKA 5LJWA 3CCRN 1NGBA 4DLEA 3ID6A 3O1WA 2UU9K 5C2DA 2FSNA 5C10A 1ILYA 3CQ8A 1BCMA 1Z05A 3GOIA 1QZ5A 1ASWA 3ID8A 5AQFA 3SJHA 4BC3A 3HVRA 3CJCA 1BIUA 1S9EA 4K41A 3H1VX 3SMPA 4FW2A 4QS8A 3BZKA 4E1MA 2CH5A 3KVGA 1RDWX 1JCFA 3DLEA 4O8UA 4OKJA 3NF8A 3CERA 3TPQA 3HBTA 1HUXA 1VSFA 1RDAA 2ZD1A 4UY8O 4CHPA 3SJJA 3SAGA 1YJ9N 4HWIA 4HUGA 2Z1GA 3R8EA 3V9SA 4CD3A 3CFOA 4DTMA 4JRQA 5AZJA 5BPLA 1RGIA 3WEEB 1KC8O 3LPUA 4QOZB 1C0UA 1GOBA 3U3YA 2RHKA 2PFUA 3DXKB 4H4MA 3DRSA 3Q7CA 4BQLA 2XY7A 3ATVA 4BGAA 4OLBA 1VK0A 1B9DA 1K8KB 3IS9A 3VTHA 1YIJN 3DLKA 3P31A 4CJPA 1NK0A 3DWLA 4OKEA 4OPKA 4E1NA 1EETA 2G8FA 3EN9A 3D2FA 1MU2A 2PBDA 3ZLJA 1YXQA 3A8YA 4BDYA 1VQ8N 2I7NA 2W41A 1CZAN 3SQ1A 4W5OA 2WBNA 2VWKA 1UA0A 3ENOA 1JCGA 1EX4A 2OZSA 4CIGA 1NGIA 4BRKA 1SKSA 3UKUB 3HPGA 5AQWA 4FLZA 4DQPA 2O8DA 3H45C 3KWGA 1ASVA 1TKDA 3JS6A 4EP4A 4JK8A 4FJ5A 1TL3A 3SMSA 4B9NA 2F9WA 3OYDA 4FWSA 1EQYA 3WXJA 2HHWA 1TYQB 4KH5A 3J7ZO 2YHYA 2BANA 3NAEA 1H1VA 3RRGA 3MWPA 3K5LA 1GLBG 2Z1JA 4F2RA 1WAFA 3TAEA 4CIFA 2BUPA 1VSHA 3P38A 4I2PA 3ENBA 4KB0A 3THYA 1OH8A 1HR0K 1V4SA 3NGYA 4DSEA 4DTXA 3TARA 3VEVA 2E2PA 4H5WA 3E66A 2YHBA 3V1QA 1SKWA 3A2FA 3EZ5A 1O13A 1IKWA 4MDAA 4RWTA 3AVLA 3MXIA 4LF9K 3L4QA 3CPEA 1NJIO 3SQ0A 3SAFA 1U2VB 4BACA 4H0YB 4MO5A 4IJAA 2YX6A 2YI1A 3MEEA 3SI6A 4BRMA 1TUYA 3NBPA 4YFUA 4CHQA 4FJ8A 3FFKB 5M1NA 4DU3A 2O8CA 4EFHA 3LDSA 3CCSN 3W0LA 1QHTA 2YCHA 4NLCA 4JS5A 4FWLA 2E5LK 5AQVA 3HP9A 5FRMA 4BDZA 4JK7A 5M1QA 1V4TA 1BDGA 3CM6A 1W2BM 1VHXA 3O3FA 4OPHA 4I6MA 2FC0A 4K43A 3QEIA 5CR4A 5JS2A 4DSKA 1A5WA 1ITGA 3KD1E 1C1AA 3OYFA 2WUSA 2ZWHA 4A2BA 5FLXO 5AQXA 3AO1A 5CZ2A 1OVQA 4FWNA 1HNIA 3NF7A 2ZE2A 2HHVA 1NG9A 1DKGD 3OYEA 1D8YA 1NJWA 3P5JA 4MQ3A 4B9SA 2QWQA 5AFUH 2AA4A 2KKZA 3DM2A 3V9WA 3V9ZA 3VN5A 4CW7B 5C24A 4JKHA 3O3HA 3AVNA 4CFCA 1IH7A 3AARA 2KFZA 3BZCA 4C8LA 4J2EA 2HMPA 3V1RA 4M3TA 4RG8A 5M1PA 5HROA 1HNXK 3VQ5A 4WYBA 1NGAA 5HRSA 1YUWA 4IO9L 5BN8A 5GIOA 4A57A 3THVA 1KSPA 3AVBA 1HPMA 4FJHA 5CY4A 1SKRA 3HVTA 1TVRA 1S9GA 3E9OA 1LWCA 2BH1A 1YVUA 1NK5A 1ZBLA 5AQMA 2QA4N 1KFSA 4JKCA 1OH5A 3ZT4A 3I33A 2E20A 2QWMA 2O8DB 5M1KA 3TAPA 4KO0A 1U45A 1ZC6A 1W9HA 1BQMA 5B8HA 3HOTA 1WLJA 4DB3A 1HYZA 5HRPA 1RILA 2A6AA 2CGJA 4QS7A 1P90A 1BI4B 4H4OA 4DV4K 4PQUA 1HKCA 3TI0A 5BR8K 4BC4A 4CEZA 2XRIA 1NWKA 5BRDA 1JXEA 4N56A 1X1PA 1NKCA 1GLJO 4F8RA 3TAMA 4IFYA 2P9NB 1U49A 3OYAA 2DFEA 5FDLA 2NRTA 1QQCA 4B3MK 2W42A 3VEWA 4DF4A 4FJ9A 4FM0A 3PIOL 3WQUA 4GV9A 3NDKA 1RT3A 4NXMK 3CQXA 2YKMA 1BHLA 1L3UA 1ZBFA 3KHYA 3LP0A 4AM7A 4CZJA 3OYJA 3KJVA 3TANA 4HUEA 1N5YA 2XY8A 5EU7A 3S41A 3L2WA 3O3GA 4FLUA 3L3UA 4DR7K 1HQEA 2W6LA 4FM2A 2G8UA 2NRHA 3AAQA 3ENHA 1C6VA 3A5OC 4M3XA 5SZTA 2XY6A 5FPMA 5KTQA 3IDHA 1JXBA 1NOZA 4CE9A 4FJMA 2OPQA 1RCHA 4BROA 5AQGA 4E7JA 2HOEA 3L2VA 4B08A 1TUUA 4I7FA 3K5NA 3NHGA 5AZIB 3VQ4A 4O5FA 3L2RA 1U6ZA 4X65K 3OVNA 2QKBA 2HBMA 3LP3A 1XNQK 4FLXA 4I6MB 3MDQA 4BG9A 4M42A 1VRTA 2J4RA 4NLBA 3NH0A 1RBTA 3J7AP 3FZFA 4DWIA 5JLHA 3AO5A 1TK0A 2GEMA 3V6DA 4FPBA 5F2RA 2E6LA 4CJRA 3CCEN 4KHYA 1SQKA 4H0PA 4OKKA 5C12A 1VQMN 3QESA 4LY7A 3UIQA 3IG1A 4A62A 3LAKA 2UUBK 4CFAA 4JKGB 1TV6A 3CFPA 2JWKA 1DTQA 1IO2A 3VEYA 1YI2N 1T44A 2KLAA 3TU5A 3CM5A 3WUHA 2GUIA 2FSJA 1BQNA 3L2QA 5AQTA 1LCUA 4CF9A 4EHTA 4LF8K 4FJNA 1IBLK 4DCHA 1B9FA 4IKFA 4G1QA 4C1NK 4BRPA 5CHIA 1S3XA 3O9TA 4RW4A 4IXCA 5AQLA 1VQPN 4JNEA 4KRFA 3SYZA 2GV9A 3P4IA 4KTWA 1I3AA 4YORA 1T05A 1VQLN 4B8AB 3LDPA 2KZMA 3AGKA 3VQ9A 3U8XA 3F9KA 5BREA 4CJFA 3F9MA 4H03B 2HHHK 5KGXA 4AHRA 1KAZA 3CHWA 4YOTA 3ZCMA 2EHGA 3JAMO 1YAGA 1XWLA 3K5MA 4CBWA 1IG9A 4ELUA 3VQAA 4B9LA 2A5XA 3C95A 2F96A 2HF4A 1Q86O 2Y1IA 2QW9A 1Q9YA 2QTDA 1VSJA 3RMAA 1NK6A 2P9PA 4HUFA 4DSJA 3UB5A 5M1OA 4CJ3A 3HM8A 4IDKA 4JLHA 3QEPA 5BPNA 1O1WA 1KCFA 1C0MA 3DXMA 3AA3A 2P5OA 4FK2A 2ZGZA 1JLQA 4CJKA 2OPPA 1C0GA 3QETA 1TK8A 3QEXA 3C6HA 4NB4A 5FPNA 4HVJA 4BG8A 4IOAL 4FJ7A 3VETA 3A5MC 4PKHA 5GAGP 4BWMA 4CJTA 4O0IA 4FVUA 1LWFA 1Z6RA 2XY5A 1VSMA 3WNGA 3F73A 2R7YA 2ZJRL 3WXMB 3FLCO 2CH6A 3ULDA 3CC7N 1HNVA 4OVLA 2VWJA 4FJLA 2HVHA 2E8AA 3BP8A 3CJ7A 1E4GT 3WEEA 4CZGA 4IFEA 3E1YA 1XMOK 2VG5A 3VGMA 4CZKA 1J5OA 4BE0A 2ATQA 3PV8A 1I39A 2HB5A 4Z0UA 2P9SA 5KI6A 2HBJA 2Q0UA 3HPOA 2FBYA 5I9EB 2CGLA 4Y1CA 3EKUA 4B3RK 3N4QA 4JI6K 4CGGA 5JVHL 4F3OA 1LOTB 3ZT3A 1BISA 1ATSA 5HRNA 1VSLA 3BUZB 4GMJB 3SNNA 5KGWA 5AQHA 1EWQA 2A1SA 3AVIA 1D9DA 4M41A 2AJQA 4DQQA 3PX6A 4M3UA 1IV0A 1W0HA 4DSFA 4K8ZA 4N5SA 4AF1A 1X3NA 1SUQA 4PA1A 3OS2A 4F3TA 4JI8K 2YNHA 4WE1A 3NCIA 4DTPA 1RDDA 3ZSXA 4FK4A 4CGHA 1F21A 4BREA 1N34K 3RMBA 4LH4A 1KRPA 3ZSQA 2P5GA 1IBKK 4DFKA 3D2FB 2KHOA 1W97L 3CF5L 5HLFA 2I5JA 3R3LA 4B9VA 5EY4A 4CZFA 2P9IA 4CCHA 4FXDA 2GWJA 3G6EN 4CERA 4FM1A 4DQIA 1WN7A 1GLDG 1BO5O 4C23A 3LWLA 3SZ2A 4IBNA 1WSIA 1KLNA 1ZXOA 1T3VA 4ILJA 5C42A 3TSPA 3U9ZA 4CJLA 5EOYA 3LL3A 1JJ2M 1K6YA 1KAXA 1U04A 1LW2A 2RKIA 1N32K 3CCJN 2X74A 4B1WB 4DV7K 1XUPO 3AVKA 3DLGA 3G10A 3IRXA 4RW8A 3KLIA 4DR4K 3KWIA 2F8TA 1ATNA 4DQRA 4ISGA 2HNZA 3FZLA 1RBSA 5J1EA 2UUAK 1J54A 1KAYA 3KKRA 1QSYA 1U2VA 5MLCQ 3SPYA 1SZ2A 4H5RA 3HO1A 2D0AA 2HF3A 3FR0A 4PKGA 4CEOA 3RRHA 1BU6O 2ZQBA 1UWBA 4NCGA 2Q97A 3K58A 1L3TA 3VQEA 4GV3A 3V9XA 3ALYA 3CJ1A 3WXKA 3QMLA 1Q7YO 1SS6A 3MN6A 2O8BA 4FLTA 5TKYA 2G8IA 3TWHA 3K9KA 2FBXA 4ZTFA 2A41A 2DFHA 3SLCA 4MO4A 3TTFA 3FFIA 4BRIA 2UUCK 4W5QA 3VEZA 1KFDA 2UXCK 3TTCA 5FROA 3OYGA 3T1YK 1WSFA 1OH6A 2NZTA 3NGIA 1CZ9A 4YOUA 4MLHA 1NKBA 3W3DA 1RFQA 4FK0A 1FK9A 3AVJA 3O1BA 4BE2A 2HHXA 1HLUA 4KKOA 3PX4A 3S3NA 5HP1A 1NK8A 2F4VK 4QAGA 1Y97A 3E9PA 1T8EA 5FRNA 4I2QA 4FJKA 2VCPA 3VEOA 2O8EB 3BY5A 3OBYA 4FOEA 1L5UA 4FYDA 3BF3A 4HCBA 1VAZA 4O0JA 4DS4A 1NNEA 4AHVA 1NGFA 3VQ7A 4KB1A 3VESA 1R59O 4CF0A 3C7NB 3EE8A 4C1NI 1Q82O 1QSSA 5AR0A 3DRRA 1HMVA 3EE9A 1RT2A 2O8FB 3NFAA 3OYBA 1VQNN 4FJGA 4CHYA 1P8ZA 4YOWA 1KTQA 4N41A 1BUPA 4FWOA 3QIPA 4DV5K 5BPMA 1U47A 3C7NA 3MEGA 3PLAA 1NM1A 1C0TA 4N47A 5AQUA 4Y1DA 1YTUA 4Y0WA 3R6MA 3OHRA 3I0RA 3KTQA 4FZYA 3DXKA 3KKSA 2FXUA 3L0QA 1MA9B 4JI2K 5AQOA 3VQBA 4CGFA 1NOYA 1HQUA 3MECA 3M6GA 3C94A 4DHYA 3B8AX 4MLEA 1VQ7N 2HBLA 4FWQA 3O9QA 3SUOA 2Z1HA 2G8HA 1E4FT 1HNZK 1YJNN 4LFCK 5GIPA 3AA4A 3QNNA 1HYVA 2D0BA 1MWKA 4B9UA 3CETA 4JI3K 3VQ8A 2HW3A 3IMXA 3MEDA 5CZ1A 3DOLA 1TKZA 1MDUB 2VQEK 4C8KA 4CZHA 1A5XA 4RTFD 2WFBA 5KRTA 2ASPA 4GV6A 1NJXA 1BI4A 3VGLA 2F7TA 2E2QA 4DS5A 2YV0X 4YOVA 1Q9XA 3TTDA 4FPAA 3ZSRA 3UE5A 1S22A 4KI4A 1YVNA 4LF7K 3AA2A 2D0PA 1ZYQA 1NJYA 1JLAA 4CFDA 3C65A 1ZBSA 3OA9A 4QS9A 3OS1A 3L2UA 3V4IA 3C6AA 4DR6K 4K25A 4OO1J 3ULEA 3P1GA 5E41A 3MCPA 3VQDA 2P9PB 4AM6A 3HT3A 4EP5A 2VGNA 3VQQA 2OCEA 1WB9A 4CJVA 4KREA 1S5JA 4AHUA 4FL9A 3L6QA 3CMEN 1RDBA 2ITMA 3EZWA 3MN5A 1CXQA 2RPIA 4C8OA 4DSIA 4M3YA 3ZEUA 3HZ6A 3NGZA 3M5RA 3IUCA 4BRQA 1HJOA 2KZZA 2YHWA 3HI0A 3M8PA 4DFPA 5C0YA 5KQ8A 2ZGYA 2P9UA 4A59A 5HOOA 5ADXH 2NRWA 3E9LA 4E7HA 2V7ZA 4CF1A 1NGEA 2W40A 1YITN 1X9JA 2GELA 5LMNK 2DY4A 3KLEA 1G15A 4KHPK 1JLEA 4LSNA 3CC2N 4DR1K 3KLGA 1NLVA 4EIAA 5JICA 3G4SN 2Q31A 3SUQA 1C0FA 4CZEA 3DLLL 3FZMA 4LF6K 4B9QA 1X9SA 3H3OB 4PY5A 1N8RO 4DTJA 1LAWA 1RTJA 5AQQA 1BG3A 3U9DA 3KK2A 4DKWA 2IOCA 2FSKA 2D5RA 4ELVA 2GBZA 4X64K 4B1ZA 3TAFA 1I94K 3O08A 2NRXA 4EAHD 3OYIA 2WTUA 4XEIA 4WQ4C 4BDPA 4KPYA 2NUBA 4BR7A 2ETJA 2O8EA 4M7XA 4LD0A 4TSXA 3QFUA 2O8CB 4AILC 4ID5A 3RTVA 4AHSA 1JLFA 4XH1A 4NYFA 3HYFA 2JLEA 3C6UA 3SV3A 3CJ9A 1OKJA 4RW9A 3B6PA 4CJSA 3PSIA 3HSCA 4PL7A 1S1VA 3SUNA 1IKVA 3P39A 3ZT2A 4F4KA 1TKXA 4B9TA 1DGKN 3J8AA 5CE3A 2HMIA 3MAQA 1VQON 2YNIA 1J6ZA 4BVPA 5HRRA 1VSEA 1SL0A 5BR9A 4H0VB 2XO7A 4AQYK 1J5EK 1EXQA 4CEBA 2LSNA 1QQMA 3K0SA 4JD2B 2KQ2A 4K42A 3EYZA 2HBKA 1ATRA 4CEEA 4JI0K 4DR2K 3V81A 3AO2A 2NRZA 1HNWK 4CF8A 2OPSA 3U4LA 1JCEA 4LH5A 3CPWM 1WSHA 5AQPA 4GY2B 1GLCG 3SQ2A 2YHAA 3O9UA 4BRLA 2E4LA 4W5TA 1BOTO 4Z4GA 2RE2A 4IFVA 1NU0A 4CJQA 3QEWA 1S1XA 5KPTA 3HSTB 3T1AA 3VQCA 4IOXA 1DEJA 4DUYK 1GOCA 2H3GX 1SL1A 3VA3A 1TKTA 2YNGA 2IVOA 1S6QA 1RT6A 4L8RB 3CG7A 3ZSVA 1U4BA 4LF4K 3I8BA 2VWBA 5JLFA 1ASUA 5LY3A 5LMUK 4CHZA 3KK3A 3MN9A 3QERA 1Z25A 1X9MA 1HKGA 4BVOA 4FLVA 4IEEA 4RW7A 1YJWN 3AGRA 2NNWA 3CCLN 4FWKA 1RDUA 3SBTA 3ZSOA 2E1YA 3QBWA 4PWDA 1D4XA 1VRUA 3ZT1A 1QVGM 1QHAA 2FF3B 4FJXA 3OYLA 2BE2A 3LM2A 3QNOA 3VENA 1VQ4N 3ULEB 4ISFA 4A2AA 1NBWA 5C2FA 3I55N 4F9OA 2HNDA 3U3GA 4W5NA 5KPZA 4JI4K 1GLLO 3EO3A 3OYMA 2IIRA 2QM1A 4JK9A 4KFBA 4CECA 3NF9A 3HJFA 3ZEUB 4BR4A 1QQOA 2WC9A 2VG7A 3D6RA 1VQ5N 4CEAA 1EP4A 5EX5A 4DR3K 5AZIA 1OVYA 3PO4A 4FWMA 3LDOA 3LDQA 3OYHA 4BRGA 3D2EB 1GLAG 5BRFA 1KLMA 1RT4A 5EVZA 3CJAA 4G9ZA 3VQ6A 5AQZA 3SK3A 4ZTJA 1FW6A 3AVFA 1S1WA 3QINA 3ZX2A 3LP1A 3OTOK 1BL3A 1BA0A 2O4GA 4M45A 4GKJK 4Z4CA 2IVNA 4CK3A 3UKRA 2PAVA 2OYQA 2E88A 3DI6A 3ATUA 4GKKK 3D7EO 4FSVA 3P83D 4CZLA 4EHUA 3AVCA 3QO9A 3D0PA 4X66K 4IDHA 2KFNA 4HTUA 4WQ5A 3SAHA 5J2QA 4A5AA 5KPRA 1S1UA 4JKBA 2B5JA 3K2PA 1ZBIA 3RR8A 1TAUA 1DLOA 3HXMA 2A40A 4ISEA 2D4WA 1T6DA 5D3GA 4AHCA 3AVAA 3ITHA 5EXWA 3BGRA 2QKKA 1SAZA 3LZJA 3A0IX 3O9RA 4IG3A 1EKEA 2RN2A 2P9KA 1J9AA 3GL1A 3V9UA 1VSKA 1WBDA 2OTJN 2UXBK 2V7YA 4CIEA 1HRHA 3TSUA 1QTMA 4HCCA 3CCQN 1YF5L 2OPRA 3LWMA 4E7KA 4CJUA 5ELZA 5M1FA 4CI6A 2QEXN 2P9KB 4CBUA 4YOXA 2P9LB 3LALA 4A5BA 3T1HK 1M90O 3LDLA 3DLRA 3C6TA 4GVMA 2HNYA 2O8BB 3QDKA 1KXPA 3O9SA 3WT0A 4W5RA 4BR2A 3UKUA 4R79A 4F2SA 2P9LA 3H6EA 3O8MA 4L3QA 2BDPA 4H0TB 3K9JA 4JKDA 3LANA 4BRFA 3RR7A 3MX5A 3NF6A 3ZSYA 5DMRA 1VSIA 4BR0A 3M3ZA 4H0XB 3DLHA 4CBXA 1QE1A 1JKHA 3H46O 2QWPA 2HHSA 2HHUA 1BA1A 4FWRA 1SL2A 4GVEA 5E26A 1KVCA 4DG1A 3HPHA 2CGKA 3OY9A 5T7BA 3PX0A 4Z4HA 4E7IA 3CI5A 3CQYA 3HOSA 1XI1A 4M3RA 2GUPA 2KW4A 2IS3A 1RTIA 4PUOA 1L3VA 4M3WA 3F5TA 3WXLA 2P9UB 4FO0A 3EKSA 3VA0A 5I3UA 1Q8IA 3D2EA 1REVA 3LAMA 4CF2A 2EWSA 2P51A 3MWTA 3NVMA 2P1JA 3NH1A 4CFBA 3WQTA 1B92A 2DFFA 2HHTA 1IKXA 3TABA 2ASOA 1RTDA 4CJ5A 2NRVA 4CGIA 3THWA 1XNRK 3NMUA 4HTLA 4JHDA 1NMNA 1NK4A 3VF6A 4DLGA 3KLHA 1SV5A 5FPDA 1U48A 4FVMA 2B6AA 1RT5A 3AVGA 3GE1A 1VQ9N 2IVPA 1FKPA 5KRSA 1N36K 4PL8A 4LSLA 1S1TA 3J7YP 3E01A 4B1YB 3MXMA 3IFRA 4K8XA 1WAJA 5GINA 1RBRA 3HP6A 2I7PA 1Q81O 3QEVA 3S3MA 3G71N 4DV6K 3FZKA 3J81O 4Z4FA 4IWVA 4CJ4A 3JXUA 4CD1A 3ZT0A 1WSGA 4J2BA 2QXFA 2ZF5O 4BC2A 4B3TK 4DV1K 4BY9C 4DQSA 4BQZA 3IAYA 2ASMA 5FPEA 2YJFA 3UKRB 3HK2A 1RBVA 3O4NA 1EWRA 3CCMN 1QVFM 4K0KK 3EEQA 5GADP 3ZX0A 4JAXA 1XQSC 4JV5K 1FKOA 4JRPA 2G8VA 4Q0BA 3ASMA 4JD2A 2PZSA 1KVAA 4ID1A 3T19A 3VMFB 2WONA 5E84A 2PYJA 2HHQA 4PKIA 4JYAK 3DAWA 3T69A 2QK9A 3QBXA 4ZHRA 4BWJA 1QSLA 3PSFA 4YHHK 1XMQK 1GLFO 4LC9B 2P9IB 4E3SA 4BC5A 3VTIA 1K8KA 3ISNC 3PO5A 1FJGK 2Q0RA 1NGJA 4LFBK 4A61A 1FXXA 1WUAA 4H0OA 3AO4A 3LPTA 4B8CA 4E19A 3I8DA 1YHQN 4LF5K 4CVNE 4OGEA 3HM9A 2G8WA 4PHTX 4XH5A 4CEFA 4E1JA 2Q2RA 3GG4A 3M1FA 2BGGA 1A5VA 3FZHA 3MCAB 4DV0K 3U6FA 2FBVA 4NYNA 3R9PA 4JEPA 3H08A 3DMJA 4U67L 4FLWA 3SBGA 2WOMA 2GWKA 2EX3A 2Q36A 3QICA 3TSQA 4ILHA 4CEDA 4QCLA 3JYTA 1YTAA 4BR9A 2UYTA 1BCOA 3L3VA 2Y1JA 3OJSA 1JL1A 3SCXA 4JI1K 1NMDA 1T03A 3LP2A 1JLGA 1NK9A 3B6OA 1HJRA 4BR5A 3SUPA 1D9FA 1NK7A 2F9TA 3CYMA 4RCHA 1XHZA 2DPNA 1DTTA 2V52B 4FZZA 1IJJA 3THYB 4DQ8A 3C0BA 3O4WA 4ICLA 4KHNA 3EL2A 1VSDA 3FE1A 3OW2M 4JHDB 5H1SQ 4DMNA 2DTUA 4XIUA 3BDPA 4CJWA 1C1CA 3THXB 2PY5A 4IO8A 1IKYA 2KTQA 4HHTA 3VOVA 2QI2A 2ZM6K 2FLOA 3A5LC 2Q1NA 1WBBA 4Z4EA 3KD5E 4N76A 1NGGA 1Z26A 3DOKA 4ILGB 3H3NO 1UA1A 2GX9A 2NLXA 1LAVA 3OYNA 3THXA 3T7ZA 3OS0A 1E3MA 2QWLA 4E89A 4YDUC 3CJBA 3Q7BA 1RDCA 2GTDA 3LM9A 4I9LA 5CYQA 1D5AA 5AQSA 4J2DA 4EZ9A 4FOIA 2F8SA 3HRGA 4E7LA 1NJZA 1HPZA 4JKFA 2E2NA 4V19S 4IEIA 4H8KA 4DTUA 4B1VA 3S9HA 1TL1A 2A42A 5DM6L 3M8RA 1BIZA 2YHXA 3BEXA 1K8AO 1K9MO 3DJCA 2ZJQL 5KQDA 5GAHP 4OX9K 4LFAK 3DRPA 5BN9A 3RVCA 1T6CA 5A2QO 2QWRA 1BWFO 2FBTA 1WSJA 2VYPA 2V51B 4M3ZA 1S6PA 4WFAL 4CGDA 3WNEA 3RSEB 4BE1A 4FZXC 3D45A 2O8FA 1ZBUA 5HL7L 2X6NA 1Q18A 3KLFA 1Y64A 3V1OA 3OJUA 4FW1A 5J2PA 1WOQA 3JSMA 4DTSA 3VERA 3RSEA 3K59A 5J2MA 1KD1O 2BTFA 4KBOA 4WQ4A 4KTZA 2YKNA 4CJ7A 2Q3SA 3VGKA 1JLCA 4IZ9A 2IC3A 2A3ZA 3QIOA 1XC9A 3DLBA 1CZBA 3SQ4A 1JLBA 2VGMA 4BRNA 3CMAN 3L8BA 3AV9A 3MXJA 5I42A 1R0AA 3TAQA 1UAXA 2HSTA 5AQRA 2ITGA 3O4QA 4B9MA 3DYAA 4IG0A 3AA5X 4DSLA 4BRHA 5C15A 1VQKN 4KHWA 3T3FA 2UXDK 2X6SA 5J2NA 1X9WA 1XC3A 4DF8A 3TR8A 3R1XA 3K5OA 4MFBA 3M8SA 3VQPA 4O44A 4CK2A 2VG6A 3WNHA 4UQGA 3MX2A 1KQSM 1X3MA 4C8NA 1NGCA 2HVIA 1TYQA 1TGOA 3LDNA 3O6WA 4B3OA 1EO1A 2OANA 2YNFA 5JMVA 1YT3A 1TAQA 4KHQA 3H1QA 4YDUA 2E1ZA 4Q5VA 2B4JA 4JKEA 5ADXA 4CK1A 3F2KA 3AO3A 2FF6A 4DUZK 3SPZA 4JS4A 4M7YA 4WFBL 4DFMA 3PY8A 2D1KA 2OZMA 4FJJA 5AQYA 3MK6A 4H5NA 4I9QA 1QZ6A 4IJNA 4WQ5C 4BRDA 3DXMB 2IDOA 4Z94A 4YOYA 4KTQA 4NCBA 3ZETB 4AH9A 4GW6A 3KK1A 1CXUA 5C25A 3TAGA 5AFUA 4O55A 1IBMK 5JVGL 4KV8A 4C8MA 1NGDA 3AY9A 3VPZA 1N33K 1UOCA 4CJEA 4GNIA 4BGBA 4XH4A 1RBUA 5AQNA 3ZETA 2XHBA 4DTOA 1RT1A 2QWNA 4FCYA 3MN7A 2G8KA 4H5VA 5AJ3K 3I56N 4ELTA 2Z1IA 3CD6N 4OGCA 4CHOA 2VQFK 3OYKA 4FLYA 4WF9L 3MMVA 1NKEA 3A5NC 1T7PA 4O4GA 1G99A 1QS4A 1XHXA 4JKAA 1MWMA 3O5BA 2IAJA 5GAEP 1K73O 4KH4A 1LV5A 4CESA 3WNFA 3PIPL 4OPAA 3VEXA 5DM7L 3N4PA 4KHUA 3GBTA 1VQ6N 5IT9O 2IGIA 2QXLA 4YNQA 2P9SB 4B3SK 3G25A 2X78A 3BF1A 4JKGA 5IWAK 2W6KA 4CEQA 5DK5A 3NVKA 4U7BA 4OJRA 2NRRA 2QWOA 4B1XB 2PYLA 4CZMA 1KVBA 1ZBHA 3KZBA 3OBWA 3VF2A 5K14A 1LWEA 3EY1A 4E0DA 4WFNL 2RF2A
chains in the Genus database with same CATH topology
1RTIA 3L2WA 4PUOA 3I0RA 3KTQA 3O3GA 4FZYA 4FLUA 3S3OA 1L3VA 3KKSA 3L3UA 4M3WA 1HQEA 4FM2A 2G8UA 3VQBA 4CGFA 1NOYA 3SV4A 1C6VA 1HQUA 3MECA 3VA0A 1GOAA 2D0CA 2A1RA 3C94A 4M3XA 5SZTA 3RWUA 2E6MA 2XY6A 5I3UA 4CGJA 1Q8IA 5KTQA 1REVA 5JS1A 3LAMA 4CF2A 1JXBA 3LZIA 2P51A 3SUOA 1NOZA 2P1JA 2Z1HA 4CE9A 3K57A 4FJMA 2G8HA 4NCAA 2OPQA 1RCHA 4E7JA 3M8QA 4CFBA 3NH1A 1B92A 1JL2A 1WNSA 2DFFA 1L3SA 1IKXA 3TABA 4DU4A 3HL8A 3L2VA 1LW0A 3AA4A 3AVHA 4B08A 3QNNA 1HYVA 2D0BA 4AHTA 4CGIA 4CJ5A 1RTDA 4I7FA 3K5NA 3NHGA 4B9UA 3VQ4A 3NH2A 3VQ8A 3L2RA 2HW3A 3MEDA 5CZ1A 3DOLA 1TKZA 1NK4A 4OLAA 1WSEA 3OVNA 4DLGA 3KLHA 1SV5A 3LP3A 1U48A 2QKBA 4DTNA 4C8KA 4FVMA 4FLXA 2B6AA 1A5XA 1RT5A 3AVGA 4M42A 1VRTA 5KRTA 1FKPA 5KRSA 4FJIA 1NJXA 1BI4A 5HBMA 3NH0A 1RBTA 4DS5A 2YV0X 4LSLA 4DWIA 1S1TA 3E01A 3AO5A 3MXMA 1TK0A 1Q9XA 1WAJA 4K8XA 3V6DA 1RBRA 3ZSRA 3HP6A 3KIOA 3QEVA 2E6LA 4CJRA 1RT7A 3S3MA 4KHYA 4KI4A 5CYMA 2OA8A 3AA2A 4DTRA 1ZYQA 1NJYA 1J53A 1JLAA 4CFDA 4J2AA 4OKKA 3QESA 4LY7A 3L2UA 3V4IA 3OS1A 4Z4FA 3UIQA 3IG1A 4CJ4A 3LAKA 1CLQA 3ZT0A 4CFAA 1WSGA 4J2BA 3P1GA 2QXFA 5E41A 1TV6A 3CFPA 3VQDA 1DTQA 3I0SA 3HT3A 4EP5A 4DQSA 3IAYA 3VQQA 1IO2A 3RMCA 3G0ZA 2JGUA 3HK2A 1RBVA 3O4NA 3RMDA 4CJVA 4KI6A 3CM5A 4CHNA 4KREA 1RTHA 1S5JA 2GUIA 4RW6A 1BQNA 4AHUA 4DFJA 2O4IA 1RDBA 3L2QA 4CF9A 1CXQA 2RPIA 4C8OA 4DSIA 4M3YA 1FKOA 4FJNA 3AVMA 3NGZA 3NE6A 4JRPA 2G8VA 4Q0BA 4EZ6A 3ASMA 2KZZA 2PZSA 1KVAA 3M8PA 4ID1A 3T19A 3ZSWA 2WONA 1B9FA 4DFPA 2PYJA 4IKFA 1HYSA 2HHQA 4DU1A 4OPJA 4G1QA 1BGXT 4KHSA 2QK9A 4ZHRA 3CFRA 1N6QA 4BWJA 4RW4A 3OYCA 1RNHA 5SWMA 4E7HA 3ZSZA 4CF1A 1QSLA 3PUFA 4KAZA 4O5BA 2DY4A 4Z4IA 3QLHA 3KLEA 1G15A 4E3SA 1JLEA 1C1BA 4R5PA 4KRFA 3SYZA 2GV9A 4KTWA 4LSNA 1TK5A 1I3AA 3ISNC 4DLEA 1T05A 3KLGA 4B8AB 3SUQA 3PO5A 2KZMA 3CQ8A 1BCMA 4B8CA 1FXXA 3VQ9A 4E19A 3AO4A 3LPTA 3F9KA 3I8DA 4CJFA 1X9SA 4OGEA 5KGXA 4AHRA 3HM9A 1LAWA 4DTJA 1ASWA 1RTJA 2G8WA 4PY5A 3HVRA 3ZCMA 4CEFA 1BIUA 1S9EA 2EHGA 3KK2A 2IOCA 2D5RA 4ELVA 2BGGA 2GBZA 1A5VA 3U6FA 3TAFA 2FBVA 3OYIA 4NYNA 4FW2A 1XWLA 3H08A 4BDPA 3DMJA 4E1MA 4KPYA 2NUBA 3K5MA 4FLWA 2ETJA 2WOMA 2EX3A 4LD0A 4TSXA 4CEDA 3DLEA 4QCLA 1IG9A 4OKJA 3JYTA 1YTAA 3NF8A 3VQAA 4AILC 3C95A 4ID5A 2F96A 4AHSA 3RTVA 4B9LA 1JLFA 1BCOA 3L3VA 4NYFA 3HYFA 2JLEA 3C6UA 2Y1IA 3SV3A 2Y1JA 1Q9YA 1VSJA 3OJSA 4RW9A 4CJSA 3B6PA 1JL1A 1VSFA 3RMAA 3SCXA 1RDAA 1S1VA 1NK6A 2ZD1A 1IKVA 3SUNA 4F4KA 3ZT2A 4CHPA 4HUFA 3SJJA 1TKXA 4DSJA 4B9TA 1T03A 3LP2A 1JLGA 4CJ3A 1NK9A 3MAQA 3B6OA 4HUGA 2Z1GA 2HMIA 4ELUA 3V9SA 2YNIA 4IDKA 1HJRA 3CFOA 4DTMA 4JRQA 4JLHA 3SUPA 5HRRA 3QEPA 1NK7A 1D9FA 1O1WA 1VSEA 1SL0A 3CYMA 3LPUA 1XHZA 1DTTA 2XO7A 1KCFA 1C0MA 1EXQA 4CEBA 4FZZA 4QOZB 1C0UA 2LSNA 1GOBA 3U3YA 3AA3A 2P5OA 4FK2A 2KQ2A 4H4MA 3EYZA 4ICLA 4KHNA 3DRSA 4CEEA 1JLQA 1VSDA 4CJKA 3V81A 3AO2A 2XY7A 2OPPA 4DMNA 4XIUA 3QETA 4CF8A 2DTUA 4OLBA 2OPSA 1VK0A 1TK8A 1B9DA 3QEXA 3BDPA 4CJWA 1C1CA 4LH5A 2PY5A 1IKYA 3IS9A 3DLKA 1WSHA 4HVJA 4CJPA 2KTQA 4HHTA 1NK0A 3SQ2A 2YHAA 4OKEA 4OPKA 4FJ7A 4E1NA 1EETA 4BWMA 2G8FA 2E4LA 4W5TA 1MU2A 4Z4GA 4Z4EA 3KD5E 4N76A 4CJTA 4IFVA 3DOKA 1Z26A 4O0IA 4CJQA 3QEWA 1S1XA 1UA1A 1LWFA 2XY5A 4BDYA 1VSMA 3HSTB 3T1AA 3WNGA 3F73A 3VQCA 1LAVA 2R7YA 3OYNA 3SQ1A 3OS0A 4W5OA 2VWKA 1UA0A 1GOCA 3ULDA 1SL1A 3VA3A 1HNVA 1EX4A 4E89A 1TKTA 4OVLA 1RDCA 2VWJA 2OZSA 4CIGA 4FJLA 2HVHA 1SKSA 3HPGA 4FLZA 2YNGA 4I9LA 4DQPA 1S6QA 1RT6A 5CYQA 4L8RB 3CG7A 2VG5A 3ZSVA 1D5AA 1U4BA 1ASVA 1TKDA 4EZ9A 4J2DA 1J5OA 4EP4A 2F8SA 4FJ5A 4E7LA 1TL3A 1NJZA 1HPZA 2ATQA 4BE0A 3PV8A 1ASUA 1I39A 4B9NA 4CHZA 2HB5A 3KK3A 4Z0UA 3QERA 4H8KA 4DTUA 5KI6A 1Z25A 1X9MA 3OYDA 3HPOA 4FLVA 3S9HA 1TL1A 2FBYA 2HHWA 3M8RA 1BIZA 4RW7A 2BANA 4Y1CA 3NAEA 3RRGA 3ZSOA 3K5LA 3DRPA 4CGGA 4F3OA 2Z1JA 4PWDA 3ZT3A 1BISA 1VRUA 4F2RA 3ZT1A 5HRNA 4FJXA 2FBTA 1WAFA 1WSJA 3OYLA 3TAEA 2BE2A 4CIFA 4M3ZA 1S6PA 3QNOA 1VSLA 4GMJB 1VSHA 4I2PA 3WNEA 4CGDA 3SNNA 4KB0A 5KGWA 4DSEA 3NGYA 4BE1A 2HNDA 2A1SA 3D45A 3AVIA 3U3GA 1D9DA 4M41A 4FZXC 2AJQA 4W5NA 4DQQA 3PX6A 4DTXA 4M3UA 1ZBUA 1W0HA 4DSFA 4K8ZA 2X6NA 4N5SA 3OYMA 3TARA 3KLFA 3V1OA 1SUQA 4FW1A 4PA1A 3OS2A 3OJUA 3JSMA 4DTSA 5J2PA 4F3TA 2YNHA 2YHBA 3V1QA 4WE1A 1SKWA 3A2FA 3NCIA 3EZ5A 4DTPA 1RDDA 1IKWA 3ZSXA 3K59A 4KFBA 3AVLA 4CECA 3NF9A 5J2MA 3HJFA 3MXIA 4CGHA 4FK4A 1F21A 2VG7A 3RMBA 4LH4A 1KRPA 3SQ0A 3ZSQA 2P5GA 2KFNA 4BACA 4KTZA 4DFKA 4CEAA 1EP4A 5HLFA 2I5JA 4B9VA 2YKNA 2Q3SA 1JLCA 3MEEA 3PO4A 4CCHA 4FXDA 2IC3A 3OYHA 3SI6A 3QIOA 4CERA 1XC9A 4FM1A 3NBPA 3DLBA 1CZBA 4YFUA 3SQ4A 1KLMA 4CHQA 4DQIA 4FJ8A 1RT4A 1JLBA 1WN7A 3SZ2A 3LWLA 4DU3A 4IBNA 3LDSA 3L8BA 3AV9A 1WSIA 3MXJA 1QHTA 1KLNA 5I42A 3VQ6A 5C42A 4JS5A 1R0AA 4CJLA 3TAQA 4ZTJA 1UAXA 3HP9A 5FRMA 4BDZA 1K6YA 2ITGA 3O4QA 1U04A 4B9MA 1LW2A 2RKIA 3DYAA 4IG0A 3AA5X 3CM6A 4DSLA 4KHWA 3AVFA 3O3FA 1S1WA 2X74A 3T3FA 3QINA 2FC0A 2X6SA 3LP1A 3AVKA 5J2NA 3QEIA 3DLGA 1BL3A 3G10A 3IRXA 4RW8A 2O4GA 4M45A 5JS2A 4DF8A 1X9WA 4DSKA 3TR8A 1A5WA 3KLIA 3K5OA 1ITGA 4MFBA 1C1AA 3VQPA 4O44A 4Z4CA 4CK3A 3M8SA 3OYFA 3KD1E 2F8TA 4DQRA 2OYQA 3DI6A 2HNZA 4CK2A 2VG6A 1RBSA 5J1EA 1J54A 3WNHA 4UQGA 3P83D 3AO1A 3AVCA 5CZ2A 3QO9A 3KKRA 1QSYA 3D0PA 1HNIA 3NF7A 2ZE2A 4C8NA 1TGOA 4HTUA 3SPYA 3HO1A 2HVIA 4B3OA 2HHVA 2D0AA 5J2QA 3OYEA 2YNFA 4CEOA 3RRHA 1YT3A 1TAQA 2ZQBA 4KHQA 1UWBA 4NCGA 1D8YA 1S1UA 3K58A 1L3TA 4Q5VA 2B4JA 1NJWA 3P5JA 4MQ3A 3VQEA 4CK1A 3V9XA 2B5JA 3K2PA 4B9SA 3ALYA 1ZBIA 3RR8A 1TAUA 1DLOA 3AO3A 3DM2A 3HXMA 3V9WA 3SPZA 4JS4A 3V9ZA 4DFMA 3VN5A 4FLTA 5C24A 3PY8A 2G8IA 3O3HA 3AVNA 3TWHA 4CFCA 1IH7A 2OZMA 4FJJA 2KFZA 5D3GA 4C8LA 2FBXA 4AHCA 3AVAA 3ITHA 4ZTFA 4I9QA 3V1RA 4J2EA 4M3TA 4RG8A 2IDOA 2DFHA 5HROA 3BGRA 2QKKA 3VQ5A 4KTQA 4NCBA 3FFIA 4AH9A 4GW6A 3KK1A 1CXUA 5HRSA 4W5QA 5C25A 3LZJA 3TAGA 4IG3A 1EKEA 4O55A 3THVA 2RN2A 4KV8A 3AVBA 1J9AA 4C8MA 1KSPA 1KFDA 3V9UA 2HHTA 1VSKA 4FJHA 5CY4A 1SKRA 1UOCA 5FROA 3OYGA 3HVTA 1HRHA 4CIEA 4CJEA 1TVRA 1QTMA 1S9GA 4HCCA 1LWCA 1NK5A 1YVUA 1WSFA 1ZBLA 1RBUA 1KFSA 2OPRA 3NGIA 1CZ9A 1NKBA 3ZT4A 3LWMA 1FK9A 3AVJA 4FK0A 2XHBA 4CJUA 4BE2A 1RT1A 4E7KA 4DTOA 2HHXA 4KKOA 3PX4A 3S3NA 5HP1A 1NK8A 4FCYA 3TAPA 2G8KA 4KO0A 1U45A 4QAGA 1Y97A 1W9HA 1BQMA 1T8EA 4I2QA 3LALA 4FJKA 5FRNA 1WLJA 3DLRA 1HYZA 5HRPA 4ELTA 1RILA 2Z1IA 3C6TA 4OGCA 4CHOA 4GVMA 2HNYA 3OYKA 4FLYA 1BI4B 4H4OA 1L5UA 4FYDA 1NKEA 4W5RA 4HCBA 4O0JA 4DS4A 4PQUA 1T7PA 4AHVA 3TI0A 4O4GA 3VQ7A 1QS4A 1XHXA 4CEZA 4KB1A 4F2SA 2XRIA 4CF0A 1JXEA 2IAJA 4N56A 1X1PA 1NKCA 4CESA 1LV5A 1QSSA 2BDPA 3DRRA 4F8RA 3LANA 4IFYA 1HMVA 3TAMA 3WNFA 1RT2A 3NFAA 1U49A 3OYBA 3OYAA 4KHUA 4FJGA 4CHYA 2DFEA 2IGIA 3NF6A 3RR7A 5FDLA 1KTQA 3ZSYA 4YNQA 5DMRA 1VSIA 1QQCA 4N41A 3DLHA 1QE1A 1JKHA 2X78A 3QIPA 2HHSA 2HHUA 2W42A 4CEQA 5DK5A 1U47A 4DF4A 1SL2A 4OJRA 3MEGA 4FM0A 4FJ9A 1KVCA 4DG1A 3HPHA 3NDKA 2PYLA 3OY9A 1KVBA 1RT3A 1ZBHA 5T7BA 3PX0A 1C0TA 4N47A 4Z4HA 2YKMA 4E7IA 1BHLA 1L3UA 1ZBFA 5K14A 4Y1DA 1XI1A 1LWEA 4M3RA 3LP0A 3KJVA 3OYJA 3EY1A 3TANA 2KW4A 4HUEA 1N5YA 4E0DA 2IS3A 2XY8A 1YTUA 5EU7A 2RF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RTI A;  3L2W A;  4PUO A;  3I0R A;  3KTQ A;  3O3G A;  4FZY A;  4FLU A;  3S3O A;  1L3V A;  3KKS A;  3L3U A;  4M3W A;  1HQE A;  4FM2 A;  2G8U A;  3VQB A;  4CGF A;  1NOY A;  3SV4 A;  1C6V A;  1HQU A;  3MEC A;  3VA0 A;  1GOA A;  2D0C A;  2A1R A;  3C94 A;  4M3X A;  5SZT A;  3RWU A;  2E6M A;  2XY6 A;  5I3U A;  4CGJ A;  1Q8I A;  5KTQ A;  1REV A;  5JS1 A;  3LAM A;  4CF2 A;  1JXB A;  3LZI A;  2P51 A;  3SUO A;  1NOZ A;  2P1J A;  2Z1H A;  4CE9 A;  3K57 A;  4FJM A;  2G8H A;  4NCA A;  2OPQ A;  1RCH A;  4E7J A;  3M8Q A;  4CFB A;  3NH1 A;  1B92 A;  1JL2 A;  1WNS A;  2DFF A;  1L3S A;  1IKX A;  3TAB A;  4DU4 A;  3HL8 A;  3L2V A;  1LW0 A;  3AA4 A;  3AVH A;  4B08 A;  3QNN A;  1HYV A;  2D0B A;  4AHT A;  4CGI A;  4CJ5 A;  1RTD A;  4I7F A;  3K5N A;  3NHG A;  4B9U A;  3VQ4 A;  3NH2 A;  3VQ8 A;  3L2R A;  2HW3 A;  3MED A;  5CZ1 A;  3DOL A;  1TKZ A;  1NK4 A;  4OLA A;  1WSE A;  3OVN A;  4DLG A;  3KLH A;  1SV5 A;  3LP3 A;  1U48 A;  2QKB A;  4DTN A;  4C8K A;  4FVM A;  4FLX A;  2B6A A;  1A5X A;  1RT5 A;  3AVG A;  4M42 A;  1VRT A;  5KRT A;  1FKP A;  5KRS A;  4FJI A;  1NJX A;  1BI4 A;  5HBM A;  3NH0 A;  1RBT A;  4DS5 A;  2YV0 X;  4LSL A;  4DWI A;  1S1T A;  3E01 A;  3AO5 A;  3MXM A;  1TK0 A;  1Q9X A;  1WAJ A;  4K8X A;  3V6D A;  1RBR A;  3ZSR A;  3HP6 A;  3KIO A;  3QEV A;  2E6L A;  4CJR A;  1RT7 A;  3S3M A;  4KHY A;  4KI4 A;  5CYM A;  2OA8 A;  3AA2 A;  4DTR A;  1ZYQ A;  1NJY A;  1J53 A;  1JLA A;  4CFD A;  4J2A A;  4OKK A;  3QES A;  4LY7 A;  3L2U A;  3V4I A;  3OS1 A;  4Z4F A;  3UIQ A;  3IG1 A;  4CJ4 A;  3LAK A;  1CLQ A;  3ZT0 A;  4CFA A;  1WSG A;  4J2B A;  3P1G A;  2QXF A;  5E41 A;  1TV6 A;  3CFP A;  3VQD A;  1DTQ A;  3I0S A;  3HT3 A;  4EP5 A;  4DQS A;  3IAY A;  3VQQ A;  1IO2 A;  3RMC A;  3G0Z A;  2JGU A;  3HK2 A;  1RBV A;  3O4N A;  3RMD A;  4CJV A;  4KI6 A;  3CM5 A;  4CHN A;  4KRE A;  1RTH A;  1S5J A;  2GUI A;  4RW6 A;  1BQN A;  4AHU A;  4DFJ A;  2O4I A;  1RDB A;  3L2Q A;  4CF9 A;  1CXQ A;  2RPI A;  4C8O A;  4DSI A;  4M3Y A;  1FKO A;  4FJN A;  3AVM A;  3NGZ A;  3NE6 A;  4JRP A;  2G8V A;  4Q0B A;  4EZ6 A;  3ASM A;  2KZZ A;  2PZS A;  1KVA A;  3M8P A;  4ID1 A;  3T19 A;  3ZSW A;  2WON A;  1B9F A;  4DFP A;  2PYJ A;  4IKF A;  1HYS A;  2HHQ A;  4DU1 A;  4OPJ A;  4G1Q A;  1BGX T;  4KHS A;  2QK9 A;  4ZHR A;  3CFR A;  1N6Q A;  4BWJ A;  4RW4 A;  3OYC A;  1RNH A;  5SWM A;  4E7H A;  3ZSZ A;  4CF1 A;  1QSL A;  3PUF A;  4KAZ A;  4O5B A;  2DY4 A;  4Z4I A;  3QLH A;  3KLE A;  1G15 A;  4E3S A;  1JLE A;  1C1B A;  4R5P A;  4KRF A;  3SYZ A;  2GV9 A;  4KTW A;  4LSN A;  1TK5 A;  1I3A A;  3ISN C;  4DLE A;  1T05 A;  3KLG A;  4B8A B;  3SUQ A;  3PO5 A;  2KZM A;  3CQ8 A;  1BCM A;  4B8C A;  1FXX A;  3VQ9 A;  4E19 A;  3AO4 A;  3LPT A;  3F9K A;  3I8D A;  4CJF A;  1X9S A;  4OGE A;  5KGX A;  4AHR A;  3HM9 A;  1LAW A;  4DTJ A;  1ASW A;  1RTJ A;  2G8W A;  4PY5 A;  3HVR A;  3ZCM A;  4CEF A;  1BIU A;  1S9E A;  2EHG A;  3KK2 A;  2IOC A;  2D5R A;  4ELV A;  2BGG A;  2GBZ A;  1A5V A;  3U6F A;  3TAF A;  2FBV A;  3OYI A;  4NYN A;  4FW2 A;  1XWL A;  3H08 A;  4BDP A;  3DMJ A;  4E1M A;  4KPY A;  2NUB A;  3K5M A;  4FLW A;  2ETJ A;  2WOM A;  2EX3 A;  4LD0 A;  4TSX A;  4CED A;  3DLE A;  4QCL A;  1IG9 A;  4OKJ A;  3JYT A;  1YTA A;  3NF8 A;  3VQA A;  4AIL C;  3C95 A;  4ID5 A;  2F96 A;  4AHS A;  3RTV A;  4B9L A;  1JLF A;  1BCO A;  3L3V A;  4NYF A;  3HYF A;  2JLE A;  3C6U A;  2Y1I A;  3SV3 A;  2Y1J A;  1Q9Y A;  1VSJ A;  3OJS A;  4RW9 A;  4CJS A;  3B6P A;  1JL1 A;  1VSF A;  3RMA A;  3SCX A;  1RDA A;  1S1V A;  1NK6 A;  2ZD1 A;  1IKV A;  3SUN A;  4F4K A;  3ZT2 A;  4CHP A;  4HUF A;  3SJJ A;  1TKX A;  4DSJ A;  4B9T A;  1T03 A;  3LP2 A;  1JLG A;  4CJ3 A;  1NK9 A;  3MAQ A;  3B6O A;  4HUG A;  2Z1G A;  2HMI A;  4ELU A;  3V9S A;  2YNI A;  4IDK A;  1HJR A;  3CFO A;  4DTM A;  4JRQ A;  4JLH A;  3SUP A;  5HRR A;  3QEP A;  1NK7 A;  1D9F A;  1O1W A;  1VSE A;  1SL0 A;  3CYM A;  3LPU A;  1XHZ A;  1DTT A;  2XO7 A;  1KCF A;  1C0M A;  1EXQ A;  4CEB A;  4FZZ A;  4QOZ B;  1C0U A;  2LSN A;  1GOB A;  3U3Y A;  3AA3 A;  2P5O A;  4FK2 A;  2KQ2 A;  4H4M A;  3EYZ A;  4ICL A;  4KHN A;  3DRS A;  4CEE A;  1JLQ A;  1VSD A;  4CJK A;  3V81 A;  3AO2 A;  2XY7 A;  2OPP A;  4DMN A;  4XIU A;  3QET A;  4CF8 A;  2DTU A;  4OLB A;  2OPS A;  1VK0 A;  1TK8 A;  1B9D A;  3QEX A;  3BDP A;  4CJW A;  1C1C A;  4LH5 A;  2PY5 A;  1IKY A;  3IS9 A;  3DLK A;  1WSH A;  4HVJ A;  4CJP A;  2KTQ A;  4HHT A;  1NK0 A;  3SQ2 A;  2YHA A;  4OKE A;  4OPK A;  4FJ7 A;  4E1N A;  1EET A;  4BWM A;  2G8F A;  2E4L A;  4W5T A;  1MU2 A;  4Z4G A;  4Z4E A;  3KD5 E;  4N76 A;  4CJT A;  4IFV A;  3DOK A;  1Z26 A;  4O0I A;  4CJQ A;  3QEW A;  1S1X A;  1UA1 A;  1LWF A;  2XY5 A;  4BDY A;  1VSM A;  3HST B;  3T1A A;  3WNG A;  3F73 A;  3VQC A;  1LAV A;  2R7Y A;  3OYN A;  3SQ1 A;  3OS0 A;  4W5O A;  2VWK A;  1UA0 A;  1GOC A;  3ULD A;  1SL1 A;  3VA3 A;  1HNV A;  1EX4 A;  4E89 A;  1TKT A;  4OVL A;  1RDC A;  2VWJ A;  2OZS A;  4CIG A;  4FJL A;  2HVH A;  1SKS A;  3HPG A;  4FLZ A;  2YNG A;  4I9L A;  4DQP A;  1S6Q A;  1RT6 A;  5CYQ A;  4L8R B;  3CG7 A;  2VG5 A;  3ZSV A;  1D5A A;  1U4B A;  1ASV A;  1TKD A;  4EZ9 A;  4J2D A;  1J5O A;  4EP4 A;  2F8S A;  4FJ5 A;  4E7L A;  1TL3 A;  1NJZ A;  1HPZ A;  2ATQ A;  4BE0 A;  3PV8 A;  1ASU A;  1I39 A;  4B9N A;  4CHZ A;  2HB5 A;  3KK3 A;  4Z0U A;  3QER A;  4H8K A;  4DTU A;  5KI6 A;  1Z25 A;  1X9M A;  3OYD A;  3HPO A;  4FLV A;  3S9H A;  1TL1 A;  2FBY A;  2HHW A;  3M8R A;  1BIZ A;  4RW7 A;  2BAN A;  4Y1C A;  3NAE A;  3RRG A;  3ZSO A;  3K5L A;  3DRP A;  4CGG A;  4F3O A;  2Z1J A;  4PWD A;  3ZT3 A;  1BIS A;  1VRU A;  4F2R A;  3ZT1 A;  5HRN A;  4FJX A;  2FBT A;  1WAF A;  1WSJ A;  3OYL A;  3TAE A;  2BE2 A;  4CIF A;  4M3Z A;  1S6P A;  3QNO A;  1VSL A;  4GMJ B;  1VSH A;  4I2P A;  3WNE A;  4CGD A;  3SNN A;  4KB0 A;  5KGW A;  4DSE A;  3NGY A;  4BE1 A;  2HND A;  2A1S A;  3D45 A;  3AVI A;  3U3G A;  1D9D A;  4M41 A;  4FZX C;  2AJQ A;  4W5N A;  4DQQ A;  3PX6 A;  4DTX A;  4M3U A;  1ZBU A;  1W0H A;  4DSF A;  4K8Z A;  2X6N A;  4N5S A;  3OYM A;  3TAR A;  3KLF A;  3V1O A;  1SUQ A;  4FW1 A;  4PA1 A;  3OS2 A;  3OJU A;  3JSM A;  4DTS A;  5J2P A;  4F3T A;  2YNH A;  2YHB A;  3V1Q A;  4WE1 A;  1SKW A;  3A2F A;  3NCI A;  3EZ5 A;  4DTP A;  1RDD A;  1IKW A;  3ZSX A;  3K59 A;  4KFB A;  3AVL A;  4CEC A;  3NF9 A;  5J2M A;  3HJF A;  3MXI A;  4CGH A;  4FK4 A;  1F21 A;  2VG7 A;  3RMB A;  4LH4 A;  1KRP A;  3SQ0 A;  3ZSQ A;  2P5G A;  2KFN A;  4BAC A;  4KTZ A;  4DFK A;  4CEA A;  1EP4 A;  5HLF A;  2I5J A;  4B9V A;  2YKN A;  2Q3S A;  1JLC A;  3MEE A;  3PO4 A;  4CCH A;  4FXD A;  2IC3 A;  3OYH A;  3SI6 A;  3QIO A;  4CER A;  1XC9 A;  4FM1 A;  3NBP A;  3DLB A;  1CZB A;  4YFU A;  3SQ4 A;  1KLM A;  4CHQ A;  4DQI A;  4FJ8 A;  1RT4 A;  1JLB A;  1WN7 A;  3SZ2 A;  3LWL A;  4DU3 A;  4IBN A;  3LDS A;  3L8B A;  3AV9 A;  1WSI A;  3MXJ A;  1QHT A;  1KLN A;  5I42 A;  3VQ6 A;  5C42 A;  4JS5 A;  1R0A A;  4CJL A;  3TAQ A;  4ZTJ A;  1UAX A;  3HP9 A;  5FRM A;  4BDZ A;  1K6Y A;  2ITG A;  3O4Q A;  1U04 A;  4B9M A;  1LW2 A;  2RKI A;  3DYA A;  4IG0 A;  3AA5 X;  3CM6 A;  4DSL A;  4KHW A;  3AVF A;  3O3F A;  1S1W A;  2X74 A;  3T3F A;  3QIN A;  2FC0 A;  2X6S A;  3LP1 A;  3AVK A;  5J2N A;  3QEI A;  3DLG A;  1BL3 A;  3G10 A;  3IRX A;  4RW8 A;  2O4G A;  4M45 A;  5JS2 A;  4DF8 A;  1X9W A;  4DSK A;  3TR8 A;  1A5W A;  3KLI A;  3K5O A;  1ITG A;  4MFB A;  1C1A A;  3VQP A;  4O44 A;  4Z4C A;  4CK3 A;  3M8S A;  3OYF A;  3KD1 E;  2F8T A;  4DQR A;  2OYQ A;  3DI6 A;  2HNZ A;  4CK2 A;  2VG6 A;  1RBS A;  5J1E A;  1J54 A;  3WNH A;  4UQG A;  3P83 D;  3AO1 A;  3AVC A;  5CZ2 A;  3QO9 A;  3KKR A;  1QSY A;  3D0P A;  1HNI A;  3NF7 A;  2ZE2 A;  4C8N A;  1TGO A;  4HTU A;  3SPY A;  3HO1 A;  2HVI A;  4B3O A;  2HHV A;  2D0A A;  5J2Q A;  3OYE A;  2YNF A;  4CEO A;  3RRH A;  1YT3 A;  1TAQ A;  2ZQB A;  4KHQ A;  1UWB A;  4NCG A;  1D8Y A;  1S1U A;  3K58 A;  1L3T A;  4Q5V A;  2B4J A;  1NJW A;  3P5J A;  4MQ3 A;  3VQE A;  4CK1 A;  3V9X A;  2B5J A;  3K2P A;  4B9S A;  3ALY A;  1ZBI A;  3RR8 A;  1TAU A;  1DLO A;  3AO3 A;  3DM2 A;  3HXM A;  3V9W A;  3SPZ A;  4JS4 A;  3V9Z A;  4DFM A;  3VN5 A;  4FLT A;  5C24 A;  3PY8 A;  2G8I A;  3O3H A;  3AVN A;  3TWH A;  4CFC A;  1IH7 A;  2OZM A;  4FJJ A;  2KFZ A;  5D3G A;  4C8L A;  2FBX A;  4AHC A;  3AVA A;  3ITH A;  4ZTF A;  4I9Q A;  3V1R A;  4J2E A;  4M3T A;  4RG8 A;  2IDO A;  2DFH A;  5HRO A;  3BGR A;  2QKK A;  3VQ5 A;  4KTQ A;  4NCB A;  3FFI A;  4AH9 A;  4GW6 A;  3KK1 A;  1CXU A;  5HRS A;  4W5Q A;  5C25 A;  3LZJ A;  3TAG A;  4IG3 A;  1EKE A;  4O55 A;  3THV A;  2RN2 A;  4KV8 A;  3AVB A;  1J9A A;  4C8M A;  1KSP A;  1KFD A;  3V9U A;  2HHT A;  1VSK A;  4FJH A;  5CY4 A;  1SKR A;  1UOC A;  5FRO A;  3OYG A;  3HVT A;  1HRH A;  4CIE A;  4CJE A;  1TVR A;  1QTM A;  1S9G A;  4HCC A;  1LWC A;  1NK5 A;  1YVU A;  1WSF A;  1ZBL A;  1RBU A;  1KFS A;  2OPR A;  3NGI A;  1CZ9 A;  1NKB A;  3ZT4 A;  3LWM A;  1FK9 A;  3AVJ A;  4FK0 A;  2XHB A;  4CJU A;  4BE2 A;  1RT1 A;  4E7K A;  4DTO A;  2HHX A;  4KKO A;  3PX4 A;  3S3N A;  5HP1 A;  1NK8 A;  4FCY A;  3TAP A;  2G8K A;  4KO0 A;  1U45 A;  4QAG A;  1Y97 A;  1W9H A;  1BQM A;  1T8E A;  4I2Q A;  3LAL A;  4FJK A;  5FRN A;  1WLJ A;  3DLR A;  1HYZ A;  5HRP A;  4ELT A;  1RIL A;  2Z1I A;  3C6T A;  4OGC A;  4CHO A;  4GVM A;  2HNY A;  3OYK A;  4FLY A;  1BI4 B;  4H4O A;  1L5U A;  4FYD A;  1NKE A;  4W5R A;  4HCB A;  4O0J A;  4DS4 A;  4PQU A;  1T7P A;  4AHV A;  3TI0 A;  4O4G A;  3VQ7 A;  1QS4 A;  1XHX A;  4CEZ A;  4KB1 A;  4F2S A;  2XRI A;  4CF0 A;  1JXE A;  2IAJ A;  4N56 A;  1X1P A;  1NKC A;  4CES A;  1LV5 A;  1QSS A;  2BDP A;  3DRR A;  4F8R A;  3LAN A;  4IFY A;  1HMV A;  3TAM A;  3WNF A;  1RT2 A;  3NFA A;  1U49 A;  3OYB A;  3OYA A;  4KHU A;  4FJG A;  4CHY A;  2DFE A;  2IGI A;  3NF6 A;  3RR7 A;  5FDL A;  1KTQ A;  3ZSY A;  4YNQ A;  5DMR A;  1VSI A;  1QQC A;  4N41 A;  3DLH A;  1QE1 A;  1JKH A;  2X78 A;  3QIP A;  2HHS A;  2HHU A;  2W42 A;  4CEQ A;  5DK5 A;  1U47 A;  4DF4 A;  1SL2 A;  4OJR A;  3MEG A;  4FM0 A;  4FJ9 A;  1KVC A;  4DG1 A;  3HPH A;  3NDK A;  2PYL A;  3OY9 A;  1KVB A;  1RT3 A;  1ZBH A;  5T7B A;  3PX0 A;  1C0T A;  4N47 A;  4Z4H A;  2YKM A;  4E7I A;  1BHL A;  1L3U A;  1ZBF A;  5K14 A;  4Y1D A;  1XI1 A;  1LWE A;  4M3R A;  3LP0 A;  3KJV A;  3OYJ A;  3EY1 A;  3TAN A;  2KW4 A;  4HUE A;  1N5Y A;  4E0D A;  2IS3 A;  2XY8 A;  1YTU A;  5EU7 A;  2RF2 A; 
#chains in the Genus database with same CATH topology
 3S3O A;  2JWL A;  1S72 N;  1IG8 A;  3SV4 A;  1GOA A;  2D0C A;  2A1R A;  3RWU A;  2E6M A;  3O80 A;  4CGJ A;  2E2O A;  5AZJ B;  5JS1 A;  3CIP A;  3LZI A;  3GDQ A;  4J8F A;  3K57 A;  4DV3 K;  4NCA A;  3M8Q A;  4MDB A;  4DR5 K;  1L3S A;  1JL2 A;  1WNS A;  4X62 K;  3HL8 A;  3QFP A;  4DU4 A;  1LW0 A;  3AVH A;  4CZI A;  4DV2 K;  1W7A A;  3J80 O;  4AHT A;  3L4I A;  3CXC M;  4NXN K;  3NH2 A;  1M1K O;  4OLA A;  1WSE A;  2OTL N;  3VF4 A;  4DTN A;  4YY3 K;  1OH7 A;  4IOC L;  4BRC A;  4JI7 K;  4FJI A;  5HBM A;  3KK7 A;  1QQN A;  2ZJP L;  4FWP A;  5BRH A;  3KIO A;  5TKW A;  5LL6 Z;  1RT7 A;  5CYM A;  2OA8 A;  4DTR A;  3WXI A;  4J2A A;  1J53 A;  5F0X A;  4KH6 A;  1CLQ A;  2P9N A;  1HX1 A;  3I0S A;  3AAP A;  3RMC A;  3CCU N;  3G0Z A;  3ZYY X;  2JGU A;  5AQI A;  3RMD A;  3THW B;  4KI6 A;  1NGH A;  4CHN A;  1RTH A;  3HTV A;  4RW6 A;  4DFJ A;  2O4I A;  4O8K A;  2D0O A;  1GLE G;  3ZX3 A;  3AVM A;  3NE6 A;  1DT9 A;  4EZ6 A;  4WCE L;  2YJE A;  3ZSW A;  1HYS A;  4JI5 K;  4DU1 A;  4OPJ A;  1HKB A;  1BGX T;  4KHS A;  3QB0 A;  4BRA A;  3FGU A;  3CFR A;  1N6Q A;  4NO7 A;  3IKM A;  3OYC A;  1RNH A;  4B1U B;  5SWM A;  3ZSZ A;  5LJV A;  3PUF A;  2AP1 A;  3CCV N;  5AQJ A;  4KAZ A;  4O5B A;  5F1X A;  4Z4I A;  3QLH A;  4M63 C;  3CC4 N;  4R5P A;  1C1B A;  1ESV A;  4H5T A;  1TK5 A;  4JN4 A;  5AQK A;  5LJW A;  3CCR N;  1NGB A;  4DLE A;  3ID6 A;  3O1W A;  2UU9 K;  5C2D A;  2FSN A;  5C10 A;  1ILY A;  3CQ8 A;  1BCM A;  1Z05 A;  3GOI A;  1QZ5 A;  1ASW A;  3ID8 A;  5AQF A;  3SJH A;  4BC3 A;  3HVR A;  3CJC A;  1BIU A;  1S9E A;  4K41 A;  3H1V X;  3SMP A;  4FW2 A;  4QS8 A;  3BZK A;  4E1M A;  2CH5 A;  3KVG A;  1RDW X;  1JCF A;  3DLE A;  4O8U A;  4OKJ A;  3NF8 A;  3CER A;  3TPQ A;  3HBT A;  1HUX A;  1VSF A;  1RDA A;  2ZD1 A;  4UY8 O;  4CHP A;  3SJJ A;  3SAG A;  1YJ9 N;  4HWI A;  4HUG A;  2Z1G A;  3R8E A;  3V9S A;  4CD3 A;  3CFO A;  4DTM A;  4JRQ A;  5AZJ A;  5BPL A;  1RGI A;  3WEE B;  1KC8 O;  3LPU A;  4QOZ B;  1C0U A;  1GOB A;  3U3Y A;  2RHK A;  2PFU A;  3DXK B;  4H4M A;  3DRS A;  3Q7C A;  4BQL A;  2XY7 A;  3ATV A;  4BGA A;  4OLB A;  1VK0 A;  1B9D A;  1K8K B;  3IS9 A;  3VTH A;  1YIJ N;  3DLK A;  3P31 A;  4CJP A;  1NK0 A;  3DWL A;  4OKE A;  4OPK A;  4E1N A;  1EET A;  2G8F A;  3EN9 A;  3D2F A;  1MU2 A;  2PBD A;  3ZLJ A;  1YXQ A;  3A8Y A;  4BDY A;  1VQ8 N;  2I7N A;  2W41 A;  1CZA N;  3SQ1 A;  4W5O A;  2WBN A;  2VWK A;  1UA0 A;  3ENO A;  1JCG A;  1EX4 A;  2OZS A;  4CIG A;  1NGI A;  4BRK A;  1SKS A;  3UKU B;  3HPG A;  5AQW A;  4FLZ A;  4DQP A;  2O8D A;  3H45 C;  3KWG A;  1ASV A;  1TKD A;  3JS6 A;  4EP4 A;  4JK8 A;  4FJ5 A;  1TL3 A;  3SMS A;  4B9N A;  2F9W A;  3OYD A;  4FWS A;  1EQY A;  3WXJ A;  2HHW A;  1TYQ B;  4KH5 A;  3J7Z O;  2YHY A;  2BAN A;  3NAE A;  1H1V A;  3RRG A;  3MWP A;  3K5L A;  1GLB G;  2Z1J A;  4F2R A;  1WAF A;  3TAE A;  4CIF A;  2BUP A;  1VSH A;  3P38 A;  4I2P A;  3ENB A;  4KB0 A;  3THY A;  1OH8 A;  1HR0 K;  1V4S A;  3NGY A;  4DSE A;  4DTX A;  3TAR A;  3VEV A;  2E2P A;  4H5W A;  3E66 A;  2YHB A;  3V1Q A;  1SKW A;  3A2F A;  3EZ5 A;  1O13 A;  1IKW A;  4MDA A;  4RWT A;  3AVL A;  3MXI A;  4LF9 K;  3L4Q A;  3CPE A;  1NJI O;  3SQ0 A;  3SAF A;  1U2V B;  4BAC A;  4H0Y B;  4MO5 A;  4IJA A;  2YX6 A;  2YI1 A;  3MEE A;  3SI6 A;  4BRM A;  1TUY A;  3NBP A;  4YFU A;  4CHQ A;  4FJ8 A;  3FFK B;  5M1N A;  4DU3 A;  2O8C A;  4EFH A;  3LDS A;  3CCS N;  3W0L A;  1QHT A;  2YCH A;  4NLC A;  4JS5 A;  4FWL A;  2E5L K;  5AQV A;  3HP9 A;  5FRM A;  4BDZ A;  4JK7 A;  5M1Q A;  1V4T A;  1BDG A;  3CM6 A;  1W2B M;  1VHX A;  3O3F A;  4OPH A;  4I6M A;  2FC0 A;  4K43 A;  3QEI A;  5CR4 A;  5JS2 A;  4DSK A;  1A5W A;  1ITG A;  3KD1 E;  1C1A A;  3OYF A;  2WUS A;  2ZWH A;  4A2B A;  5FLX O;  5AQX A;  3AO1 A;  5CZ2 A;  1OVQ A;  4FWN A;  1HNI A;  3NF7 A;  2ZE2 A;  2HHV A;  1NG9 A;  1DKG D;  3OYE A;  1D8Y A;  1NJW A;  3P5J A;  4MQ3 A;  4B9S A;  2QWQ A;  5AFU H;  2AA4 A;  2KKZ A;  3DM2 A;  3V9W A;  3V9Z A;  3VN5 A;  4CW7 B;  5C24 A;  4JKH A;  3O3H A;  3AVN A;  4CFC A;  1IH7 A;  3AAR A;  2KFZ A;  3BZC A;  4C8L A;  4J2E A;  2HMP A;  3V1R A;  4M3T A;  4RG8 A;  5M1P A;  5HRO A;  1HNX K;  3VQ5 A;  4WYB A;  1NGA A;  5HRS A;  1YUW A;  4IO9 L;  5BN8 A;  5GIO A;  4A57 A;  3THV A;  1KSP A;  3AVB A;  1HPM A;  4FJH A;  5CY4 A;  1SKR A;  3HVT A;  1TVR A;  1S9G A;  3E9O A;  1LWC A;  2BH1 A;  1YVU A;  1NK5 A;  1ZBL A;  5AQM A;  2QA4 N;  1KFS A;  4JKC A;  1OH5 A;  3ZT4 A;  3I33 A;  2E20 A;  2QWM A;  2O8D B;  5M1K A;  3TAP A;  4KO0 A;  1U45 A;  1ZC6 A;  1W9H A;  1BQM A;  5B8H A;  3HOT A;  1WLJ A;  4DB3 A;  1HYZ A;  5HRP A;  1RIL A;  2A6A A;  2CGJ A;  4QS7 A;  1P90 A;  1BI4 B;  4H4O A;  4DV4 K;  4PQU A;  1HKC A;  3TI0 A;  5BR8 K;  4BC4 A;  4CEZ A;  2XRI A;  1NWK A;  5BRD A;  1JXE A;  4N56 A;  1X1P A;  1NKC A;  1GLJ O;  4F8R A;  3TAM A;  4IFY A;  2P9N B;  1U49 A;  3OYA A;  2DFE A;  5FDL A;  2NRT A;  1QQC A;  4B3M K;  2W42 A;  3VEW A;  4DF4 A;  4FJ9 A;  4FM0 A;  3PIO L;  3WQU A;  4GV9 A;  3NDK A;  1RT3 A;  4NXM K;  3CQX A;  2YKM A;  1BHL A;  1L3U A;  1ZBF A;  3KHY A;  3LP0 A;  4AM7 A;  4CZJ A;  3OYJ A;  3KJV A;  3TAN A;  4HUE A;  1N5Y A;  2XY8 A;  5EU7 A;  3S41 A;  3L2W A;  3O3G A;  4FLU A;  3L3U A;  4DR7 K;  1HQE A;  2W6L A;  4FM2 A;  2G8U A;  2NRH A;  3AAQ A;  3ENH A;  1C6V A;  3A5O C;  4M3X A;  5SZT A;  2XY6 A;  5FPM A;  5KTQ A;  3IDH A;  1JXB A;  1NOZ A;  4CE9 A;  4FJM A;  2OPQ A;  1RCH A;  4BRO A;  5AQG A;  4E7J A;  2HOE A;  3L2V A;  4B08 A;  1TUU A;  4I7F A;  3K5N A;  3NHG A;  5AZI B;  3VQ4 A;  4O5F A;  3L2R A;  1U6Z A;  4X65 K;  3OVN A;  2QKB A;  2HBM A;  3LP3 A;  1XNQ K;  4FLX A;  4I6M B;  3MDQ A;  4BG9 A;  4M42 A;  1VRT A;  2J4R A;  4NLB A;  3NH0 A;  1RBT A;  3J7A P;  3FZF A;  4DWI A;  5JLH A;  3AO5 A;  1TK0 A;  2GEM A;  3V6D A;  4FPB A;  5F2R A;  2E6L A;  4CJR A;  3CCE N;  4KHY A;  1SQK A;  4H0P A;  4OKK A;  5C12 A;  1VQM N;  3QES A;  4LY7 A;  3UIQ A;  3IG1 A;  4A62 A;  3LAK A;  2UUB K;  4CFA A;  4JKG B;  1TV6 A;  3CFP A;  2JWK A;  1DTQ A;  1IO2 A;  3VEY A;  1YI2 N;  1T44 A;  2KLA A;  3TU5 A;  3CM5 A;  3WUH A;  2GUI A;  2FSJ A;  1BQN A;  3L2Q A;  5AQT A;  1LCU A;  4CF9 A;  4EHT A;  4LF8 K;  4FJN A;  1IBL K;  4DCH A;  1B9F A;  4IKF A;  4G1Q A;  4C1N K;  4BRP A;  5CHI A;  1S3X A;  3O9T A;  4RW4 A;  4IXC A;  5AQL A;  1VQP N;  4JNE A;  4KRF A;  3SYZ A;  2GV9 A;  3P4I A;  4KTW A;  1I3A A;  4YOR A;  1T05 A;  1VQL N;  4B8A B;  3LDP A;  2KZM A;  3AGK A;  3VQ9 A;  3U8X A;  3F9K A;  5BRE A;  4CJF A;  3F9M A;  4H03 B;  2HHH K;  5KGX A;  4AHR A;  1KAZ A;  3CHW A;  4YOT A;  3ZCM A;  2EHG A;  3JAM O;  1YAG A;  1XWL A;  3K5M A;  4CBW A;  1IG9 A;  4ELU A;  3VQA A;  4B9L A;  2A5X A;  3C95 A;  2F96 A;  2HF4 A;  1Q86 O;  2Y1I A;  2QW9 A;  1Q9Y A;  2QTD A;  1VSJ A;  3RMA A;  1NK6 A;  2P9P A;  4HUF A;  4DSJ A;  3UB5 A;  5M1O A;  4CJ3 A;  3HM8 A;  4IDK A;  4JLH A;  3QEP A;  5BPN A;  1O1W A;  1KCF A;  1C0M A;  3DXM A;  3AA3 A;  2P5O A;  4FK2 A;  2ZGZ A;  1JLQ A;  4CJK A;  2OPP A;  1C0G A;  3QET A;  1TK8 A;  3QEX A;  3C6H A;  4NB4 A;  5FPN A;  4HVJ A;  4BG8 A;  4IOA L;  4FJ7 A;  3VET A;  3A5M C;  4PKH A;  5GAG P;  4BWM A;  4CJT A;  4O0I A;  4FVU A;  1LWF A;  1Z6R A;  2XY5 A;  1VSM A;  3WNG A;  3F73 A;  2R7Y A;  2ZJR L;  3WXM B;  3FLC O;  2CH6 A;  3ULD A;  3CC7 N;  1HNV A;  4OVL A;  2VWJ A;  4FJL A;  2HVH A;  2E8A A;  3BP8 A;  3CJ7 A;  1E4G T;  3WEE A;  4CZG A;  4IFE A;  3E1Y A;  1XMO K;  2VG5 A;  3VGM A;  4CZK A;  1J5O A;  4BE0 A;  2ATQ A;  3PV8 A;  1I39 A;  2HB5 A;  4Z0U A;  2P9S A;  5KI6 A;  2HBJ A;  2Q0U A;  3HPO A;  2FBY A;  5I9E B;  2CGL A;  4Y1C A;  3EKU A;  4B3R K;  3N4Q A;  4JI6 K;  4CGG A;  5JVH L;  4F3O A;  1LOT B;  3ZT3 A;  1BIS A;  1ATS A;  5HRN A;  1VSL A;  3BUZ B;  4GMJ B;  3SNN A;  5KGW A;  5AQH A;  1EWQ A;  2A1S A;  3AVI A;  1D9D A;  4M41 A;  2AJQ A;  4DQQ A;  3PX6 A;  4M3U A;  1IV0 A;  1W0H A;  4DSF A;  4K8Z A;  4N5S A;  4AF1 A;  1X3N A;  1SUQ A;  4PA1 A;  3OS2 A;  4F3T A;  4JI8 K;  2YNH A;  4WE1 A;  3NCI A;  4DTP A;  1RDD A;  3ZSX A;  4FK4 A;  4CGH A;  1F21 A;  4BRE A;  1N34 K;  3RMB A;  4LH4 A;  1KRP A;  3ZSQ A;  2P5G A;  1IBK K;  4DFK A;  3D2F B;  2KHO A;  1W97 L;  3CF5 L;  5HLF A;  2I5J A;  3R3L A;  4B9V A;  5EY4 A;  4CZF A;  2P9I A;  4CCH A;  4FXD A;  2GWJ A;  3G6E N;  4CER A;  4FM1 A;  4DQI A;  1WN7 A;  1GLD G;  1BO5 O;  4C23 A;  3LWL A;  3SZ2 A;  4IBN A;  1WSI A;  1KLN A;  1ZXO A;  1T3V A;  4ILJ A;  5C42 A;  3TSP A;  3U9Z A;  4CJL A;  5EOY A;  3LL3 A;  1JJ2 M;  1K6Y A;  1KAX A;  1U04 A;  1LW2 A;  2RKI A;  1N32 K;  3CCJ N;  2X74 A;  4B1W B;  4DV7 K;  1XUP O;  3AVK A;  3DLG A;  3G10 A;  3IRX A;  4RW8 A;  3KLI A;  4DR4 K;  3KWI A;  2F8T A;  1ATN A;  4DQR A;  4ISG A;  2HNZ A;  3FZL A;  1RBS A;  5J1E A;  2UUA K;  1J54 A;  1KAY A;  3KKR A;  1QSY A;  1U2V A;  5MLC Q;  3SPY A;  1SZ2 A;  4H5R A;  3HO1 A;  2D0A A;  2HF3 A;  3FR0 A;  4PKG A;  4CEO A;  3RRH A;  1BU6 O;  2ZQB A;  1UWB A;  4NCG A;  2Q97 A;  3K58 A;  1L3T A;  3VQE A;  4GV3 A;  3V9X A;  3ALY A;  3CJ1 A;  3WXK A;  3QML A;  1Q7Y O;  1SS6 A;  3MN6 A;  2O8B A;  4FLT A;  5TKY A;  2G8I A;  3TWH A;  3K9K A;  2FBX A;  4ZTF A;  2A41 A;  2DFH A;  3SLC A;  4MO4 A;  3TTF A;  3FFI A;  4BRI A;  2UUC K;  4W5Q A;  3VEZ A;  1KFD A;  2UXC K;  3TTC A;  5FRO A;  3OYG A;  3T1Y K;  1WSF A;  1OH6 A;  2NZT A;  3NGI A;  1CZ9 A;  4YOU A;  4MLH A;  1NKB A;  3W3D A;  1RFQ A;  4FK0 A;  1FK9 A;  3AVJ A;  3O1B A;  4BE2 A;  2HHX A;  1HLU A;  4KKO A;  3PX4 A;  3S3N A;  5HP1 A;  1NK8 A;  2F4V K;  4QAG A;  1Y97 A;  3E9P A;  1T8E A;  5FRN A;  4I2Q A;  4FJK A;  2VCP A;  3VEO A;  2O8E B;  3BY5 A;  3OBY A;  4FOE A;  1L5U A;  4FYD A;  3BF3 A;  4HCB A;  1VAZ A;  4O0J A;  4DS4 A;  1NNE A;  4AHV A;  1NGF A;  3VQ7 A;  4KB1 A;  3VES A;  1R59 O;  4CF0 A;  3C7N B;  3EE8 A;  4C1N I;  1Q82 O;  1QSS A;  5AR0 A;  3DRR A;  1HMV A;  3EE9 A;  1RT2 A;  2O8F B;  3NFA A;  3OYB A;  1VQN N;  4FJG A;  4CHY A;  1P8Z A;  4YOW A;  1KTQ A;  4N41 A;  1BUP A;  4FWO A;  3QIP A;  4DV5 K;  5BPM A;  1U47 A;  3C7N A;  3MEG A;  3PLA A;  1NM1 A;  1C0T A;  4N47 A;  5AQU A;  4Y1D A;  1YTU A;  4Y0W A;  3R6M A;  3OHR A;  3I0R A;  3KTQ A;  4FZY A;  3DXK A;  3KKS A;  2FXU A;  3L0Q A;  1MA9 B;  4JI2 K;  5AQO A;  3VQB A;  4CGF A;  1NOY A;  1HQU A;  3MEC A;  3M6G A;  3C94 A;  4DHY A;  3B8A X;  4MLE A;  1VQ7 N;  2HBL A;  4FWQ A;  3O9Q A;  3SUO A;  2Z1H A;  2G8H A;  1E4F T;  1HNZ K;  1YJN N;  4LFC K;  5GIP A;  3AA4 A;  3QNN A;  1HYV A;  2D0B A;  1MWK A;  4B9U A;  3CET A;  4JI3 K;  3VQ8 A;  2HW3 A;  3IMX A;  3MED A;  5CZ1 A;  3DOL A;  1TKZ A;  1MDU B;  2VQE K;  4C8K A;  4CZH A;  1A5X A;  4RTF D;  2WFB A;  5KRT A;  2ASP A;  4GV6 A;  1NJX A;  1BI4 A;  3VGL A;  2F7T A;  2E2Q A;  4DS5 A;  2YV0 X;  4YOV A;  1Q9X A;  3TTD A;  4FPA A;  3ZSR A;  3UE5 A;  1S22 A;  4KI4 A;  1YVN A;  4LF7 K;  3AA2 A;  2D0P A;  1ZYQ A;  1NJY A;  1JLA A;  4CFD A;  3C65 A;  1ZBS A;  3OA9 A;  4QS9 A;  3OS1 A;  3L2U A;  3V4I A;  3C6A A;  4DR6 K;  4K25 A;  4OO1 J;  3ULE A;  3P1G A;  5E41 A;  3MCP A;  3VQD A;  2P9P B;  4AM6 A;  3HT3 A;  4EP5 A;  2VGN A;  3VQQ A;  2OCE A;  1WB9 A;  4CJV A;  4KRE A;  1S5J A;  4AHU A;  4FL9 A;  3L6Q A;  3CME N;  1RDB A;  2ITM A;  3EZW A;  3MN5 A;  1CXQ A;  2RPI A;  4C8O A;  4DSI A;  4M3Y A;  3ZEU A;  3HZ6 A;  3NGZ A;  3M5R A;  3IUC A;  4BRQ A;  1HJO A;  2KZZ A;  2YHW A;  3HI0 A;  3M8P A;  4DFP A;  5C0Y A;  5KQ8 A;  2ZGY A;  2P9U A;  4A59 A;  5HOO A;  5ADX H;  2NRW A;  3E9L A;  4E7H A;  2V7Z A;  4CF1 A;  1NGE A;  2W40 A;  1YIT N;  1X9J A;  2GEL A;  5LMN K;  2DY4 A;  3KLE A;  1G15 A;  4KHP K;  1JLE A;  4LSN A;  3CC2 N;  4DR1 K;  3KLG A;  1NLV A;  4EIA A;  5JIC A;  3G4S N;  2Q31 A;  3SUQ A;  1C0F A;  4CZE A;  3DLL L;  3FZM A;  4LF6 K;  4B9Q A;  1X9S A;  3H3O B;  4PY5 A;  1N8R O;  4DTJ A;  1LAW A;  1RTJ A;  5AQQ A;  1BG3 A;  3U9D A;  3KK2 A;  4DKW A;  2IOC A;  2FSK A;  2D5R A;  4ELV A;  2GBZ A;  4X64 K;  4B1Z A;  3TAF A;  1I94 K;  3O08 A;  2NRX A;  4EAH D;  3OYI A;  2WTU A;  4XEI A;  4WQ4 C;  4BDP A;  4KPY A;  2NUB A;  4BR7 A;  2ETJ A;  2O8E A;  4M7X A;  4LD0 A;  4TSX A;  3QFU A;  2O8C B;  4AIL C;  4ID5 A;  3RTV A;  4AHS A;  1JLF A;  4XH1 A;  4NYF A;  3HYF A;  2JLE A;  3C6U A;  3SV3 A;  3CJ9 A;  1OKJ A;  4RW9 A;  3B6P A;  4CJS A;  3PSI A;  3HSC A;  4PL7 A;  1S1V A;  3SUN A;  1IKV A;  3P39 A;  3ZT2 A;  4F4K A;  1TKX A;  4B9T A;  1DGK N;  3J8A A;  5CE3 A;  2HMI A;  3MAQ A;  1VQO N;  2YNI A;  1J6Z A;  4BVP A;  5HRR A;  1VSE A;  1SL0 A;  5BR9 A;  4H0V B;  2XO7 A;  4AQY K;  1J5E K;  1EXQ A;  4CEB A;  2LSN A;  1QQM A;  3K0S A;  4JD2 B;  2KQ2 A;  4K42 A;  3EYZ A;  2HBK A;  1ATR A;  4CEE A;  4JI0 K;  4DR2 K;  3V81 A;  3AO2 A;  2NRZ A;  1HNW K;  4CF8 A;  2OPS A;  3U4L A;  1JCE A;  4LH5 A;  3CPW M;  1WSH A;  5AQP A;  4GY2 B;  1GLC G;  3SQ2 A;  2YHA A;  3O9U A;  4BRL A;  2E4L A;  4W5T A;  1BOT O;  4Z4G A;  2RE2 A;  4IFV A;  1NU0 A;  4CJQ A;  3QEW A;  1S1X A;  5KPT A;  3HST B;  3T1A A;  3VQC A;  4IOX A;  1DEJ A;  4DUY K;  1GOC A;  2H3G X;  1SL1 A;  3VA3 A;  1TKT A;  2YNG A;  2IVO A;  1S6Q A;  1RT6 A;  4L8R B;  3CG7 A;  3ZSV A;  1U4B A;  4LF4 K;  3I8B A;  2VWB A;  5JLF A;  1ASU A;  5LY3 A;  5LMU K;  4CHZ A;  3KK3 A;  3MN9 A;  3QER A;  1Z25 A;  1X9M A;  1HKG A;  4BVO A;  4FLV A;  4IEE A;  4RW7 A;  1YJW N;  3AGR A;  2NNW A;  3CCL N;  4FWK A;  1RDU A;  3SBT A;  3ZSO A;  2E1Y A;  3QBW A;  4PWD A;  1D4X A;  1VRU A;  3ZT1 A;  1QVG M;  1QHA A;  2FF3 B;  4FJX A;  3OYL A;  2BE2 A;  3LM2 A;  3QNO A;  3VEN A;  1VQ4 N;  3ULE B;  4ISF A;  4A2A A;  1NBW A;  5C2F A;  3I55 N;  4F9O A;  2HND A;  3U3G A;  4W5N A;  5KPZ A;  4JI4 K;  1GLL O;  3EO3 A;  3OYM A;  2IIR A;  2QM1 A;  4JK9 A;  4KFB A;  4CEC A;  3NF9 A;  3HJF A;  3ZEU B;  4BR4 A;  1QQO A;  2WC9 A;  2VG7 A;  3D6R A;  1VQ5 N;  4CEA A;  1EP4 A;  5EX5 A;  4DR3 K;  5AZI A;  1OVY A;  3PO4 A;  4FWM A;  3LDO A;  3LDQ A;  3OYH A;  4BRG A;  3D2E B;  1GLA G;  5BRF A;  1KLM A;  1RT4 A;  5EVZ A;  3CJA A;  4G9Z A;  3VQ6 A;  5AQZ A;  3SK3 A;  4ZTJ A;  1FW6 A;  3AVF A;  1S1W A;  3QIN A;  3ZX2 A;  3LP1 A;  3OTO K;  1BL3 A;  1BA0 A;  2O4G A;  4M45 A;  4GKJ K;  4Z4C A;  2IVN A;  4CK3 A;  3UKR A;  2PAV A;  2OYQ A;  2E88 A;  3DI6 A;  3ATU A;  4GKK K;  3D7E O;  4FSV A;  3P83 D;  4CZL A;  4EHU A;  3AVC A;  3QO9 A;  3D0P A;  4X66 K;  4IDH A;  2KFN A;  4HTU A;  4WQ5 A;  3SAH A;  5J2Q A;  4A5A A;  5KPR A;  1S1U A;  4JKB A;  2B5J A;  3K2P A;  1ZBI A;  3RR8 A;  1TAU A;  1DLO A;  3HXM A;  2A40 A;  4ISE A;  2D4W A;  1T6D A;  5D3G A;  4AHC A;  3AVA A;  3ITH A;  5EXW A;  3BGR A;  2QKK A;  1SAZ A;  3LZJ A;  3A0I X;  3O9R A;  4IG3 A;  1EKE A;  2RN2 A;  2P9K A;  1J9A A;  3GL1 A;  3V9U A;  1VSK A;  1WBD A;  2OTJ N;  2UXB K;  2V7Y A;  4CIE A;  1HRH A;  3TSU A;  1QTM A;  4HCC A;  3CCQ N;  1YF5 L;  2OPR A;  3LWM A;  4E7K A;  4CJU A;  5ELZ A;  5M1F A;  4CI6 A;  2QEX N;  2P9K B;  4CBU A;  4YOX A;  2P9L B;  3LAL A;  4A5B A;  3T1H K;  1M90 O;  3LDL A;  3DLR A;  3C6T A;  4GVM A;  2HNY A;  2O8B B;  3QDK A;  1KXP A;  3O9S A;  3WT0 A;  4W5R A;  4BR2 A;  3UKU A;  4R79 A;  4F2S A;  2P9L A;  3H6E A;  3O8M A;  4L3Q A;  2BDP A;  4H0T B;  3K9J A;  4JKD A;  3LAN A;  4BRF A;  3RR7 A;  3MX5 A;  3NF6 A;  3ZSY A;  5DMR A;  1VSI A;  4BR0 A;  3M3Z A;  4H0X B;  3DLH A;  4CBX A;  1QE1 A;  1JKH A;  3H46 O;  2QWP A;  2HHS A;  2HHU A;  1BA1 A;  4FWR A;  1SL2 A;  4GVE A;  5E26 A;  1KVC A;  4DG1 A;  3HPH A;  2CGK A;  3OY9 A;  5T7B A;  3PX0 A;  4Z4H A;  4E7I A;  3CI5 A;  3CQY A;  3HOS A;  1XI1 A;  4M3R A;  2GUP A;  2KW4 A;  2IS3 A;  1RTI A;  4PUO A;  1L3V A;  4M3W A;  3F5T A;  3WXL A;  2P9U B;  4FO0 A;  3EKS A;  3VA0 A;  5I3U A;  1Q8I A;  3D2E A;  1REV A;  3LAM A;  4CF2 A;  2EWS A;  2P51 A;  3MWT A;  3NVM A;  2P1J A;  3NH1 A;  4CFB A;  3WQT A;  1B92 A;  2DFF A;  2HHT A;  1IKX A;  3TAB A;  2ASO A;  1RTD A;  4CJ5 A;  2NRV A;  4CGI A;  3THW A;  1XNR K;  3NMU A;  4HTL A;  4JHD A;  1NMN A;  1NK4 A;  3VF6 A;  4DLG A;  3KLH A;  1SV5 A;  5FPD A;  1U48 A;  4FVM A;  2B6A A;  1RT5 A;  3AVG A;  3GE1 A;  1VQ9 N;  2IVP A;  1FKP A;  5KRS A;  1N36 K;  4PL8 A;  4LSL A;  1S1T A;  3J7Y P;  3E01 A;  4B1Y B;  3MXM A;  3IFR A;  4K8X A;  1WAJ A;  5GIN A;  1RBR A;  3HP6 A;  2I7P A;  1Q81 O;  3QEV A;  3S3M A;  3G71 N;  4DV6 K;  3FZK A;  3J81 O;  4Z4F A;  4IWV A;  4CJ4 A;  3JXU A;  4CD1 A;  3ZT0 A;  1WSG A;  4J2B A;  2QXF A;  2ZF5 O;  4BC2 A;  4B3T K;  4DV1 K;  4BY9 C;  4DQS A;  4BQZ A;  3IAY A;  2ASM A;  5FPE A;  2YJF A;  3UKR B;  3HK2 A;  1RBV A;  3O4N A;  1EWR A;  3CCM N;  1QVF M;  4K0K K;  3EEQ A;  5GAD P;  3ZX0 A;  4JAX A;  1XQS C;  4JV5 K;  1FKO A;  4JRP A;  2G8V A;  4Q0B A;  3ASM A;  4JD2 A;  2PZS A;  1KVA A;  4ID1 A;  3T19 A;  3VMF B;  2WON A;  5E84 A;  2PYJ A;  2HHQ A;  4PKI A;  4JYA K;  3DAW A;  3T69 A;  2QK9 A;  3QBX A;  4ZHR A;  4BWJ A;  1QSL A;  3PSF A;  4YHH K;  1XMQ K;  1GLF O;  4LC9 B;  2P9I B;  4E3S A;  4BC5 A;  3VTI A;  1K8K A;  3ISN C;  3PO5 A;  1FJG K;  2Q0R A;  1NGJ A;  4LFB K;  4A61 A;  1FXX A;  1WUA A;  4H0O A;  3AO4 A;  3LPT A;  4B8C A;  4E19 A;  3I8D A;  1YHQ N;  4LF5 K;  4CVN E;  4OGE A;  3HM9 A;  2G8W A;  4PHT X;  4XH5 A;  4CEF A;  4E1J A;  2Q2R A;  3GG4 A;  3M1F A;  2BGG A;  1A5V A;  3FZH A;  3MCA B;  4DV0 K;  3U6F A;  2FBV A;  4NYN A;  3R9P A;  4JEP A;  3H08 A;  3DMJ A;  4U67 L;  4FLW A;  3SBG A;  2WOM A;  2GWK A;  2EX3 A;  2Q36 A;  3QIC A;  3TSQ A;  4ILH A;  4CED A;  4QCL A;  3JYT A;  1YTA A;  4BR9 A;  2UYT A;  1BCO A;  3L3V A;  2Y1J A;  3OJS A;  1JL1 A;  3SCX A;  4JI1 K;  1NMD A;  1T03 A;  3LP2 A;  1JLG A;  1NK9 A;  3B6O A;  1HJR A;  4BR5 A;  3SUP A;  1D9F A;  1NK7 A;  2F9T A;  3CYM A;  4RCH A;  1XHZ A;  2DPN A;  1DTT A;  2V52 B;  4FZZ A;  1IJJ A;  3THY B;  4DQ8 A;  3C0B A;  3O4W A;  4ICL A;  4KHN A;  3EL2 A;  1VSD A;  3FE1 A;  3OW2 M;  4JHD B;  5H1S Q;  4DMN A;  2DTU A;  4XIU A;  3BDP A;  4CJW A;  1C1C A;  3THX B;  2PY5 A;  4IO8 A;  1IKY A;  2KTQ A;  4HHT A;  3VOV A;  2QI2 A;  2ZM6 K;  2FLO A;  3A5L C;  2Q1N A;  1WBB A;  4Z4E A;  3KD5 E;  4N76 A;  1NGG A;  1Z26 A;  3DOK A;  4ILG B;  3H3N O;  1UA1 A;  2GX9 A;  2NLX A;  1LAV A;  3OYN A;  3THX A;  3T7Z A;  3OS0 A;  1E3M A;  2QWL A;  4E89 A;  4YDU C;  3CJB A;  3Q7B A;  1RDC A;  2GTD A;  3LM9 A;  4I9L A;  5CYQ A;  1D5A A;  5AQS A;  4J2D A;  4EZ9 A;  4FOI A;  2F8S A;  3HRG A;  4E7L A;  1NJZ A;  1HPZ A;  4JKF A;  2E2N A;  4V19 S;  4IEI A;  4H8K A;  4DTU A;  4B1V A;  3S9H A;  1TL1 A;  2A42 A;  5DM6 L;  3M8R A;  1BIZ A;  2YHX A;  3BEX A;  1K8A O;  1K9M O;  3DJC A;  2ZJQ L;  5KQD A;  5GAH P;  4OX9 K;  4LFA K;  3DRP A;  5BN9 A;  3RVC A;  1T6C A;  5A2Q O;  2QWR A;  1BWF O;  2FBT A;  1WSJ A;  2VYP A;  2V51 B;  4M3Z A;  1S6P A;  4WFA L;  4CGD A;  3WNE A;  3RSE B;  4BE1 A;  4FZX C;  3D45 A;  2O8F A;  1ZBU A;  5HL7 L;  2X6N A;  1Q18 A;  3KLF A;  1Y64 A;  3V1O A;  3OJU A;  4FW1 A;  5J2P A;  1WOQ A;  3JSM A;  4DTS A;  3VER A;  3RSE A;  3K59 A;  5J2M A;  1KD1 O;  2BTF A;  4KBO A;  4WQ4 A;  4KTZ A;  2YKN A;  4CJ7 A;  2Q3S A;  3VGK A;  1JLC A;  4IZ9 A;  2IC3 A;  2A3Z A;  3QIO A;  1XC9 A;  3DLB A;  1CZB A;  3SQ4 A;  1JLB A;  2VGM A;  4BRN A;  3CMA N;  3L8B A;  3AV9 A;  3MXJ A;  5I42 A;  1R0A A;  3TAQ A;  1UAX A;  2HST A;  5AQR A;  2ITG A;  3O4Q A;  4B9M A;  3DYA A;  4IG0 A;  3AA5 X;  4DSL A;  4BRH A;  5C15 A;  1VQK N;  4KHW A;  3T3F A;  2UXD K;  2X6S A;  5J2N A;  1X9W A;  1XC3 A;  4DF8 A;  3TR8 A;  3R1X A;  3K5O A;  4MFB A;  3M8S A;  3VQP A;  4O44 A;  4CK2 A;  2VG6 A;  3WNH A;  4UQG A;  3MX2 A;  1KQS M;  1X3M A;  4C8N A;  1NGC A;  2HVI A;  1TYQ A;  1TGO A;  3LDN A;  3O6W A;  4B3O A;  1EO1 A;  2OAN A;  2YNF A;  5JMV A;  1YT3 A;  1TAQ A;  4KHQ A;  3H1Q A;  4YDU A;  2E1Z A;  4Q5V A;  2B4J A;  4JKE A;  5ADX A;  4CK1 A;  3F2K A;  3AO3 A;  2FF6 A;  4DUZ K;  3SPZ A;  4JS4 A;  4M7Y A;  4WFB L;  4DFM A;  3PY8 A;  2D1K A;  2OZM A;  4FJJ A;  5AQY A;  3MK6 A;  4H5N A;  4I9Q A;  1QZ6 A;  4IJN A;  4WQ5 C;  4BRD A;  3DXM B;  2IDO A;  4Z94 A;  4YOY A;  4KTQ A;  4NCB A;  3ZET B;  4AH9 A;  4GW6 A;  3KK1 A;  1CXU A;  5C25 A;  3TAG A;  5AFU A;  4O55 A;  1IBM K;  5JVG L;  4KV8 A;  4C8M A;  1NGD A;  3AY9 A;  3VPZ A;  1N33 K;  1UOC A;  4CJE A;  4GNI A;  4BGB A;  4XH4 A;  1RBU A;  5AQN A;  3ZET A;  2XHB A;  4DTO A;  1RT1 A;  2QWN A;  4FCY A;  3MN7 A;  2G8K A;  4H5V A;  5AJ3 K;  3I56 N;  4ELT A;  2Z1I A;  3CD6 N;  4OGC A;  4CHO A;  2VQF K;  3OYK A;  4FLY A;  4WF9 L;  3MMV A;  1NKE A;  3A5N C;  1T7P A;  4O4G A;  1G99 A;  1QS4 A;  1XHX A;  4JKA A;  1MWM A;  3O5B A;  2IAJ A;  5GAE P;  1K73 O;  4KH4 A;  1LV5 A;  4CES A;  3WNF A;  3PIP L;  4OPA A;  3VEX A;  5DM7 L;  3N4P A;  4KHU A;  3GBT A;  1VQ6 N;  5IT9 O;  2IGI A;  2QXL A;  4YNQ A;  2P9S B;  4B3S K;  3G25 A;  2X78 A;  3BF1 A;  4JKG A;  5IWA K;  2W6K A;  4CEQ A;  5DK5 A;  3NVK A;  4U7B A;  4OJR A;  2NRR A;  2QWO A;  4B1X B;  2PYL A;  4CZM A;  1KVB A;  1ZBH A;  3KZB A;  3OBW A;  3VF2 A;  5K14 A;  1LWE A;  3EY1 A;  4E0D A;  4WFN L;  2RF2 A; 
#chains in the Genus database with same CATH homology
 1RTI A;  3L2W A;  4PUO A;  3I0R A;  3KTQ A;  3O3G A;  4FZY A;  4FLU A;  3S3O A;  1L3V A;  3KKS A;  3L3U A;  4M3W A;  1HQE A;  4FM2 A;  2G8U A;  3VQB A;  4CGF A;  1NOY A;  3SV4 A;  1C6V A;  1HQU A;  3MEC A;  3VA0 A;  1GOA A;  2D0C A;  2A1R A;  3C94 A;  4M3X A;  5SZT A;  3RWU A;  2E6M A;  2XY6 A;  5I3U A;  4CGJ A;  1Q8I A;  5KTQ A;  1REV A;  5JS1 A;  3LAM A;  4CF2 A;  1JXB A;  3LZI A;  2P51 A;  3SUO A;  1NOZ A;  2P1J A;  2Z1H A;  4CE9 A;  3K57 A;  4FJM A;  2G8H A;  4NCA A;  2OPQ A;  1RCH A;  4E7J A;  3M8Q A;  4CFB A;  3NH1 A;  1B92 A;  1JL2 A;  1WNS A;  2DFF A;  1L3S A;  1IKX A;  3TAB A;  4DU4 A;  3HL8 A;  3L2V A;  1LW0 A;  3AA4 A;  3AVH A;  4B08 A;  3QNN A;  1HYV A;  2D0B A;  4AHT A;  4CGI A;  4CJ5 A;  1RTD A;  4I7F A;  3K5N A;  3NHG A;  4B9U A;  3VQ4 A;  3NH2 A;  3VQ8 A;  3L2R A;  2HW3 A;  3MED A;  5CZ1 A;  3DOL A;  1TKZ A;  1NK4 A;  4OLA A;  1WSE A;  3OVN A;  4DLG A;  3KLH A;  1SV5 A;  3LP3 A;  1U48 A;  2QKB A;  4DTN A;  4C8K A;  4FVM A;  4FLX A;  2B6A A;  1A5X A;  1RT5 A;  3AVG A;  4M42 A;  1VRT A;  5KRT A;  1FKP A;  5KRS A;  4FJI A;  1NJX A;  1BI4 A;  5HBM A;  3NH0 A;  1RBT A;  4DS5 A;  2YV0 X;  4LSL A;  4DWI A;  1S1T A;  3E01 A;  3AO5 A;  3MXM A;  1TK0 A;  1Q9X A;  1WAJ A;  4K8X A;  3V6D A;  1RBR A;  3ZSR A;  3HP6 A;  3KIO A;  3QEV A;  2E6L A;  4CJR A;  1RT7 A;  3S3M A;  4KHY A;  4KI4 A;  5CYM A;  2OA8 A;  3AA2 A;  4DTR A;  1ZYQ A;  1NJY A;  1J53 A;  1JLA A;  4CFD A;  4J2A A;  4OKK A;  3QES A;  4LY7 A;  3L2U A;  3V4I A;  3OS1 A;  4Z4F A;  3UIQ A;  3IG1 A;  4CJ4 A;  3LAK A;  1CLQ A;  3ZT0 A;  4CFA A;  1WSG A;  4J2B A;  3P1G A;  2QXF A;  5E41 A;  1TV6 A;  3CFP A;  3VQD A;  1DTQ A;  3I0S A;  3HT3 A;  4EP5 A;  4DQS A;  3IAY A;  3VQQ A;  1IO2 A;  3RMC A;  3G0Z A;  2JGU A;  3HK2 A;  1RBV A;  3O4N A;  3RMD A;  4CJV A;  4KI6 A;  3CM5 A;  4CHN A;  4KRE A;  1RTH A;  1S5J A;  2GUI A;  4RW6 A;  1BQN A;  4AHU A;  4DFJ A;  2O4I A;  1RDB A;  3L2Q A;  4CF9 A;  1CXQ A;  2RPI A;  4C8O A;  4DSI A;  4M3Y A;  1FKO A;  4FJN A;  3AVM A;  3NGZ A;  3NE6 A;  4JRP A;  2G8V A;  4Q0B A;  4EZ6 A;  3ASM A;  2KZZ A;  2PZS A;  1KVA A;  3M8P A;  4ID1 A;  3T19 A;  3ZSW A;  2WON A;  1B9F A;  4DFP A;  2PYJ A;  4IKF A;  1HYS A;  2HHQ A;  4DU1 A;  4OPJ A;  4G1Q A;  1BGX T;  4KHS A;  2QK9 A;  4ZHR A;  3CFR A;  1N6Q A;  4BWJ A;  4RW4 A;  3OYC A;  1RNH A;  5SWM A;  4E7H A;  3ZSZ A;  4CF1 A;  1QSL A;  3PUF A;  4KAZ A;  4O5B A;  2DY4 A;  4Z4I A;  3QLH A;  3KLE A;  1G15 A;  4E3S A;  1JLE A;  1C1B A;  4R5P A;  4KRF A;  3SYZ A;  2GV9 A;  4KTW A;  4LSN A;  1TK5 A;  1I3A A;  3ISN C;  4DLE A;  1T05 A;  3KLG A;  4B8A B;  3SUQ A;  3PO5 A;  2KZM A;  3CQ8 A;  1BCM A;  4B8C A;  1FXX A;  3VQ9 A;  4E19 A;  3AO4 A;  3LPT A;  3F9K A;  3I8D A;  4CJF A;  1X9S A;  4OGE A;  5KGX A;  4AHR A;  3HM9 A;  1LAW A;  4DTJ A;  1ASW A;  1RTJ A;  2G8W A;  4PY5 A;  3HVR A;  3ZCM A;  4CEF A;  1BIU A;  1S9E A;  2EHG A;  3KK2 A;  2IOC A;  2D5R A;  4ELV A;  2BGG A;  2GBZ A;  1A5V A;  3U6F A;  3TAF A;  2FBV A;  3OYI A;  4NYN A;  4FW2 A;  1XWL A;  3H08 A;  4BDP A;  3DMJ A;  4E1M A;  4KPY A;  2NUB A;  3K5M A;  4FLW A;  2ETJ A;  2WOM A;  2EX3 A;  4LD0 A;  4TSX A;  4CED A;  3DLE A;  4QCL A;  1IG9 A;  4OKJ A;  3JYT A;  1YTA A;  3NF8 A;  3VQA A;  4AIL C;  3C95 A;  4ID5 A;  2F96 A;  4AHS A;  3RTV A;  4B9L A;  1JLF A;  1BCO A;  3L3V A;  4NYF A;  3HYF A;  2JLE A;  3C6U A;  2Y1I A;  3SV3 A;  2Y1J A;  1Q9Y A;  1VSJ A;  3OJS A;  4RW9 A;  4CJS A;  3B6P A;  1JL1 A;  1VSF A;  3RMA A;  3SCX A;  1RDA A;  1S1V A;  1NK6 A;  2ZD1 A;  1IKV A;  3SUN A;  4F4K A;  3ZT2 A;  4CHP A;  4HUF A;  3SJJ A;  1TKX A;  4DSJ A;  4B9T A;  1T03 A;  3LP2 A;  1JLG A;  4CJ3 A;  1NK9 A;  3MAQ A;  3B6O A;  4HUG A;  2Z1G A;  2HMI A;  4ELU A;  3V9S A;  2YNI A;  4IDK A;  1HJR A;  3CFO A;  4DTM A;  4JRQ A;  4JLH A;  3SUP A;  5HRR A;  3QEP A;  1NK7 A;  1D9F A;  1O1W A;  1VSE A;  1SL0 A;  3CYM A;  3LPU A;  1XHZ A;  1DTT A;  2XO7 A;  1KCF A;  1C0M A;  1EXQ A;  4CEB A;  4FZZ A;  4QOZ B;  1C0U A;  2LSN A;  1GOB A;  3U3Y A;  3AA3 A;  2P5O A;  4FK2 A;  2KQ2 A;  4H4M A;  3EYZ A;  4ICL A;  4KHN A;  3DRS A;  4CEE A;  1JLQ A;  1VSD A;  4CJK A;  3V81 A;  3AO2 A;  2XY7 A;  2OPP A;  4DMN A;  4XIU A;  3QET A;  4CF8 A;  2DTU A;  4OLB A;  2OPS A;  1VK0 A;  1TK8 A;  1B9D A;  3QEX A;  3BDP A;  4CJW A;  1C1C A;  4LH5 A;  2PY5 A;  1IKY A;  3IS9 A;  3DLK A;  1WSH A;  4HVJ A;  4CJP A;  2KTQ A;  4HHT A;  1NK0 A;  3SQ2 A;  2YHA A;  4OKE A;  4OPK A;  4FJ7 A;  4E1N A;  1EET A;  4BWM A;  2G8F A;  2E4L A;  4W5T A;  1MU2 A;  4Z4G A;  4Z4E A;  3KD5 E;  4N76 A;  4CJT A;  4IFV A;  3DOK A;  1Z26 A;  4O0I A;  4CJQ A;  3QEW A;  1S1X A;  1UA1 A;  1LWF A;  2XY5 A;  4BDY A;  1VSM A;  3HST B;  3T1A A;  3WNG A;  3F73 A;  3VQC A;  1LAV A;  2R7Y A;  3OYN A;  3SQ1 A;  3OS0 A;  4W5O A;  2VWK A;  1UA0 A;  1GOC A;  3ULD A;  1SL1 A;  3VA3 A;  1HNV A;  1EX4 A;  4E89 A;  1TKT A;  4OVL A;  1RDC A;  2VWJ A;  2OZS A;  4CIG A;  4FJL A;  2HVH A;  1SKS A;  3HPG A;  4FLZ A;  2YNG A;  4I9L A;  4DQP A;  1S6Q A;  1RT6 A;  5CYQ A;  4L8R B;  3CG7 A;  2VG5 A;  3ZSV A;  1D5A A;  1U4B A;  1ASV A;  1TKD A;  4EZ9 A;  4J2D A;  1J5O A;  4EP4 A;  2F8S A;  4FJ5 A;  4E7L A;  1TL3 A;  1NJZ A;  1HPZ A;  2ATQ A;  4BE0 A;  3PV8 A;  1ASU A;  1I39 A;  4B9N A;  4CHZ A;  2HB5 A;  3KK3 A;  4Z0U A;  3QER A;  4H8K A;  4DTU A;  5KI6 A;  1Z25 A;  1X9M A;  3OYD A;  3HPO A;  4FLV A;  3S9H A;  1TL1 A;  2FBY A;  2HHW A;  3M8R A;  1BIZ A;  4RW7 A;  2BAN A;  4Y1C A;  3NAE A;  3RRG A;  3ZSO A;  3K5L A;  3DRP A;  4CGG A;  4F3O A;  2Z1J A;  4PWD A;  3ZT3 A;  1BIS A;  1VRU A;  4F2R A;  3ZT1 A;  5HRN A;  4FJX A;  2FBT A;  1WAF A;  1WSJ A;  3OYL A;  3TAE A;  2BE2 A;  4CIF A;  4M3Z A;  1S6P A;  3QNO A;  1VSL A;  4GMJ B;  1VSH A;  4I2P A;  3WNE A;  4CGD A;  3SNN A;  4KB0 A;  5KGW A;  4DSE A;  3NGY A;  4BE1 A;  2HND A;  2A1S A;  3D45 A;  3AVI A;  3U3G A;  1D9D A;  4M41 A;  4FZX C;  2AJQ A;  4W5N A;  4DQQ A;  3PX6 A;  4DTX A;  4M3U A;  1ZBU A;  1W0H A;  4DSF A;  4K8Z A;  2X6N A;  4N5S A;  3OYM A;  3TAR A;  3KLF A;  3V1O A;  1SUQ A;  4FW1 A;  4PA1 A;  3OS2 A;  3OJU A;  3JSM A;  4DTS A;  5J2P A;  4F3T A;  2YNH A;  2YHB A;  3V1Q A;  4WE1 A;  1SKW A;  3A2F A;  3NCI A;  3EZ5 A;  4DTP A;  1RDD A;  1IKW A;  3ZSX A;  3K59 A;  4KFB A;  3AVL A;  4CEC A;  3NF9 A;  5J2M A;  3HJF A;  3MXI A;  4CGH A;  4FK4 A;  1F21 A;  2VG7 A;  3RMB A;  4LH4 A;  1KRP A;  3SQ0 A;  3ZSQ A;  2P5G A;  2KFN A;  4BAC A;  4KTZ A;  4DFK A;  4CEA A;  1EP4 A;  5HLF A;  2I5J A;  4B9V A;  2YKN A;  2Q3S A;  1JLC A;  3MEE A;  3PO4 A;  4CCH A;  4FXD A;  2IC3 A;  3OYH A;  3SI6 A;  3QIO A;  4CER A;  1XC9 A;  4FM1 A;  3NBP A;  3DLB A;  1CZB A;  4YFU A;  3SQ4 A;  1KLM A;  4CHQ A;  4DQI A;  4FJ8 A;  1RT4 A;  1JLB A;  1WN7 A;  3SZ2 A;  3LWL A;  4DU3 A;  4IBN A;  3LDS A;  3L8B A;  3AV9 A;  1WSI A;  3MXJ A;  1QHT A;  1KLN A;  5I42 A;  3VQ6 A;  5C42 A;  4JS5 A;  1R0A A;  4CJL A;  3TAQ A;  4ZTJ A;  1UAX A;  3HP9 A;  5FRM A;  4BDZ A;  1K6Y A;  2ITG A;  3O4Q A;  1U04 A;  4B9M A;  1LW2 A;  2RKI A;  3DYA A;  4IG0 A;  3AA5 X;  3CM6 A;  4DSL A;  4KHW A;  3AVF A;  3O3F A;  1S1W A;  2X74 A;  3T3F A;  3QIN A;  2FC0 A;  2X6S A;  3LP1 A;  3AVK A;  5J2N A;  3QEI A;  3DLG A;  1BL3 A;  3G10 A;  3IRX A;  4RW8 A;  2O4G A;  4M45 A;  5JS2 A;  4DF8 A;  1X9W A;  4DSK A;  3TR8 A;  1A5W A;  3KLI A;  3K5O A;  1ITG A;  4MFB A;  1C1A A;  3VQP A;  4O44 A;  4Z4C A;  4CK3 A;  3M8S A;  3OYF A;  3KD1 E;  2F8T A;  4DQR A;  2OYQ A;  3DI6 A;  2HNZ A;  4CK2 A;  2VG6 A;  1RBS A;  5J1E A;  1J54 A;  3WNH A;  4UQG A;  3P83 D;  3AO1 A;  3AVC A;  5CZ2 A;  3QO9 A;  3KKR A;  1QSY A;  3D0P A;  1HNI A;  3NF7 A;  2ZE2 A;  4C8N A;  1TGO A;  4HTU A;  3SPY A;  3HO1 A;  2HVI A;  4B3O A;  2HHV A;  2D0A A;  5J2Q A;  3OYE A;  2YNF A;  4CEO A;  3RRH A;  1YT3 A;  1TAQ A;  2ZQB A;  4KHQ A;  1UWB A;  4NCG A;  1D8Y A;  1S1U A;  3K58 A;  1L3T A;  4Q5V A;  2B4J A;  1NJW A;  3P5J A;  4MQ3 A;  3VQE A;  4CK1 A;  3V9X A;  2B5J A;  3K2P A;  4B9S A;  3ALY A;  1ZBI A;  3RR8 A;  1TAU A;  1DLO A;  3AO3 A;  3DM2 A;  3HXM A;  3V9W A;  3SPZ A;  4JS4 A;  3V9Z A;  4DFM A;  3VN5 A;  4FLT A;  5C24 A;  3PY8 A;  2G8I A;  3O3H A;  3AVN A;  3TWH A;  4CFC A;  1IH7 A;  2OZM A;  4FJJ A;  2KFZ A;  5D3G A;  4C8L A;  2FBX A;  4AHC A;  3AVA A;  3ITH A;  4ZTF A;  4I9Q A;  3V1R A;  4J2E A;  4M3T A;  4RG8 A;  2IDO A;  2DFH A;  5HRO A;  3BGR A;  2QKK A;  3VQ5 A;  4KTQ A;  4NCB A;  3FFI A;  4AH9 A;  4GW6 A;  3KK1 A;  1CXU A;  5HRS A;  4W5Q A;  5C25 A;  3LZJ A;  3TAG A;  4IG3 A;  1EKE A;  4O55 A;  3THV A;  2RN2 A;  4KV8 A;  3AVB A;  1J9A A;  4C8M A;  1KSP A;  1KFD A;  3V9U A;  2HHT A;  1VSK A;  4FJH A;  5CY4 A;  1SKR A;  1UOC A;  5FRO A;  3OYG A;  3HVT A;  1HRH A;  4CIE A;  4CJE A;  1TVR A;  1QTM A;  1S9G A;  4HCC A;  1LWC A;  1NK5 A;  1YVU A;  1WSF A;  1ZBL A;  1RBU A;  1KFS A;  2OPR A;  3NGI A;  1CZ9 A;  1NKB A;  3ZT4 A;  3LWM A;  1FK9 A;  3AVJ A;  4FK0 A;  2XHB A;  4CJU A;  4BE2 A;  1RT1 A;  4E7K A;  4DTO A;  2HHX A;  4KKO A;  3PX4 A;  3S3N A;  5HP1 A;  1NK8 A;  4FCY A;  3TAP A;  2G8K A;  4KO0 A;  1U45 A;  4QAG A;  1Y97 A;  1W9H A;  1BQM A;  1T8E A;  4I2Q A;  3LAL A;  4FJK A;  5FRN A;  1WLJ A;  3DLR A;  1HYZ A;  5HRP A;  4ELT A;  1RIL A;  2Z1I A;  3C6T A;  4OGC A;  4CHO A;  4GVM A;  2HNY A;  3OYK A;  4FLY A;  1BI4 B;  4H4O A;  1L5U A;  4FYD A;  1NKE A;  4W5R A;  4HCB A;  4O0J A;  4DS4 A;  4PQU A;  1T7P A;  4AHV A;  3TI0 A;  4O4G A;  3VQ7 A;  1QS4 A;  1XHX A;  4CEZ A;  4KB1 A;  4F2S A;  2XRI A;  4CF0 A;  1JXE A;  2IAJ A;  4N56 A;  1X1P A;  1NKC A;  4CES A;  1LV5 A;  1QSS A;  2BDP A;  3DRR A;  4F8R A;  3LAN A;  4IFY A;  1HMV A;  3TAM A;  3WNF A;  1RT2 A;  3NFA A;  1U49 A;  3OYB A;  3OYA A;  4KHU A;  4FJG A;  4CHY A;  2DFE A;  2IGI A;  3NF6 A;  3RR7 A;  5FDL A;  1KTQ A;  3ZSY A;  4YNQ A;  5DMR A;  1VSI A;  1QQC A;  4N41 A;  3DLH A;  1QE1 A;  1JKH A;  2X78 A;  3QIP A;  2HHS A;  2HHU A;  2W42 A;  4CEQ A;  5DK5 A;  1U47 A;  4DF4 A;  1SL2 A;  4OJR A;  3MEG A;  4FM0 A;  4FJ9 A;  1KVC A;  4DG1 A;  3HPH A;  3NDK A;  2PYL A;  3OY9 A;  1KVB A;  1RT3 A;  1ZBH A;  5T7B A;  3PX0 A;  1C0T A;  4N47 A;  4Z4H A;  2YKM A;  4E7I A;  1BHL A;  1L3U A;  1ZBF A;  5K14 A;  4Y1D A;  1XI1 A;  1LWE A;  4M3R A;  3LP0 A;  3KJV A;  3OYJ A;  3EY1 A;  3TAN A;  2KW4 A;  4HUE A;  1N5Y A;  4E0D A;  2IS3 A;  2XY8 A;  1YTU A;  5EU7 A;  2RF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...