3QIOA

Crystal structure of hiv-1 rnase h with engineered e. coli loop and n-hydroxy quinazolinedione inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
148
structure length
136
Chain Sequence
MYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIITQWIHNWKKNVDLVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein,Ribonuclease HI,Gag-Pol polyprotein
publication title Structural and Binding Analysis of Pyrimidinol Carboxylic Acid and N-Hydroxy Quinazolinedione HIV-1 RNase H Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Transferase, hydrolase/inhibitor
total genus 43
structure length 136
sequence length 148
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3qioA00
1LWCA 2JLEA 2IAJA 4O55A 4C8MA 4DFPA 2W42A 4CHPA 1KVCA 4DQQA 4EZ6A 1JLFA 3LANA 4DSEA 1KRPA 2Z1GA 3L2QA 2DFFA 3MAQA 3TR8A 3HVRA 4DTNA 3T3FA 4DLGA 1LV5A 4GW6A 3B6OA 3FFIA 4YFUA 4ELVA 2G8UA 2QKBA 1MU2A 1JKHA 4LSLA 5DK5A 3LDSA 1KSPA 3G0ZA 4H4OA 4CJRA 1RCHA 2OZMA 4BACA 4AHCA 2E4LA 4FZZA 1VSLA 2GBZA 3TANA 1T7PA 4B9SA 4DTRA 1QSSA 1JLBA 1N5YA 1HMVA 2YNIA 3VQAA 4E7IA 3QEPA 4CF2A 3D45A 3DRSA 4KHWA 1BL3A 2OPSA 4NCGA 5KGXA 3H08A 3V1RA 4CGGA 4DFJA 1WSEA 3QNOA 3VQDA 4B8AB 1L3UA 3LWLA 4FM1A 3QESA 4DQRA 2ZQBA 3QO9A 3CG7A 2KW4A 1U47A 1BISA 1CZ9A 1SL2A 1YTUA 3OYCA 4FJ8A 3SI6A 4HHTA 3U3YA 4HCCA 2P5OA 1KFDA 4FLWA 1F21A 4IBNA 1WSIA 4KAZA 3K5MA 3QEVA 1TL1A 3ZSXA 1S1XA 1FXXA 4YNQA 5J2NA 4M3RA 2YV0X 4CIFA 3E01A 3WNGA 1BI4A 4DSFA 1NK5A 4FK0A 2PY5A 4CFBA 1RT2A 3I8DA 1S5JA 3MXIA 3L2RA 2B4JA 5J2PA 3AVJA 2HMIA 1CLQA 5E41A 4OPKA 2DFEA 5FRMA 3T1AA 4J2DA 3VQ8A 4E19A 2G8KA 1FKPA 4L8RB 1L3TA 1L3VA 1Q9XA 5I3UA 4CFAA 4DLEA 4CEOA 1NJXA 4KTWA 3QEIA 4Z4EA 4H4MA 4AHRA 1TKXA 1UWBA 4JS4A 4CHYA 4W5RA 1SL0A 3SJJA 2OA8A 2GUIA 3ZT2A 3F73A 4DSJA 4KI4A 4PQUA 3QERA 2XRIA 3IAYA 4M3UA 4M3ZA 2QKKA 4Y1CA 1JLCA 1S1WA 2D5RA 4F4KA 4FJLA 2AJQA 4F3OA 3AVNA 1QE1A 3O4QA 3SPZA 1TKDA 3QIOA 3L8BA 4KHQA 1RTIA 3V6DA 3PO4A 4FYDA 1TKZA 3HPHA 4AHSA 1GOBA 3K5NA 1XHXA 4HUEA 4RW4A 3HP6A 3DI6A 4KB0A 2XY5A 1VRUA 2OZSA 3SUPA 3OYBA 3LP2A 3V1QA 4CJQA 4C8LA 4LH5A 4CJLA 1RT6A 4DTPA 5KTQA 1RBVA 3JSMA 3VA3A 4DMNA 1HYZA 2E6LA 3RRHA 3A2FA 3VQEA 4CEQA 2YHAA 3NFAA 4O44A 4OPJA 1T05A 4C8OA 1QHTA 3OS2A 3KK2A 4O5BA 1JLQA 3RR8A 3TARA 1S1TA 3LP3A 3L3VA 2I5JA 4E89A 1VSKA 3SZ2A 2G8WA 1FK9A 4ZHRA 3QNNA 4XIUA 1NKCA 2B5JA 5DMRA 1GOAA 2BANA 1J53A 4IG3A 3LWMA 3AVMA 3CQ8A 3TAEA 4OGEA 2HHWA 3AV9A 5SWMA 3AA2A 3M8QA 3HK2A 2B6AA 2HNZA 1D5AA 4FM0A 2X6SA 4CJPA 2PYJA 4FJGA 2IGIA 1FKOA 3LAKA 5D3GA 1SL1A 1BIUA 3JYTA 3WNEA 2RN2A 4FJKA 1TAUA 2D0CA 3U3GA 3CM5A 1Q9YA 1KLNA 2P1JA 4FW1A 4W5QA 1JL2A 4IG0A 1VSMA 3M8PA 1TVRA 1RDAA 4DTUA 4FLTA 3ULDA 1UA1A 1YTAA 4IFVA 1T03A 3OYFA 4CFDA 1DTQA 4EP4A 1NK9A 5J2MA 4H8KA 1KTQA 4KTQA 4JRPA 1VRTA 4MQ3A 3HSTB 1SV5A 4FJXA 3QEXA 4Z4CA 3KLGA 3NGZA 3KLIA 1TK5A 3NF7A 3TAMA 1ZYQA 2HNYA 1HPZA 2WOMA 4M45A 3RMBA 4GVMA 3AVLA 4CECA 4FLYA 3V9SA 1IH7A 3L2WA 4BE1A 4CHZA 1RBTA 1J54A 4OKKA 3K59A 3SPYA 1S1UA 3V1OA 2VWJA 1EXQA 4DWIA 3AO3A 4E3SA 4PUOA 2OYQA 4N41A 4ID1A 3I0SA 4J2BA 2HVHA 4I7FA 1QS4A 1WN7A 4CJFA 3S9HA 3HPOA 3OJUA 2ZD1A 1RTJA 3ZCMA 2HHTA 3HT3A 4E7HA 4I9LA 4C8NA 1RDCA 3DLRA 4BWJA 4WE1A 4FZXC 3PX0A 3CFRA 3RWUA 4PWDA 3AO2A 3ZSOA 3O3GA 1RTHA 3S3MA 2HHQA 4CFCA 2YKNA 3RMCA 1LW2A 2GV9A 3MEEA 3AVBA 3AO5A 1NKEA 1ZBLA 1TK0A 4B08A 4HVJA 4CHQA 3DM2A 3EZ5A 3RRGA 1J9AA 3QIPA 3RMDA 4FJNA 2Y1JA 3PX4A 4Q5VA 2KFZA 4CIGA 1X9SA 3SQ1A 3AVCA 1RBSA 2ETJA 2FBXA 4CGJA 4AHVA 4CERA 4CJVA 3SUOA 4B9TA 1LWEA 2OPPA 3UIQA 1SKSA 4KPYA 1VSHA 1Z26A 3TAGA 4KV8A 1QTMA 1U48A 2HW3A 4FK2A 4LD0A 3ZT4A 2ITGA 2PZSA 4RW6A 5C42A 3NF9A 2Y1IA 4I9QA 4Z4HA 5HRPA 4DSIA 3ZSVA 4HTUA 4ELUA 2HHUA 1D8YA 3V9ZA 2VG7A 1CXQA 4TSXA 3ITHA 1RT4A 3SNNA 1RDDA 2F8TA 4AHUA 4FJ5A 3V9WA 1EX4A 4CCHA 4IKFA 4K8ZA 4BE2A 2X74A 4N47A 1WAFA 2FBYA 2ZE2A 1BGXT 3G10A 3AO1A 2OPQA 3TI0A 4O0IA 4KHUA 3OS1A 4CF9A 2A1RA 4F3TA 4OKEA 1VSEA 3M8RA 3CM6A 4DU3A 3EY1A 1BCMA 1A5VA 3AO4A 4Z0UA 1JL1A 1HNVA 5FDLA 1QSLA 4OLAA 3K5LA 4KREA 1D9DA 1KVBA 4G1QA 4IDKA 4DG1A 3KLFA 4FW2A 3KLHA 3SUNA 4FVMA 5CY4A 1BQNA 4Y1DA 4ICLA 3K5OA 4CGDA 2KFNA 1WLJA 3LP1A 3NF6A 1O1WA 1QQCA 1C0TA 3CFPA 3TAQA 1RDBA 3KD5E 3VQ6A 3OYMA 2YNHA 2O4GA 1ASWA 2A1SA 1Y97A 1W0HA 3DRRA 3PX6A 2RF2A 1N6QA 5J2QA 5KI6A 5C24A 4DFMA 4FLXA 4FK4A 3TABA 1XI1A 4DTMA 2QK9A 3HJFA 3QEWA 2Q3SA 3AA3A 4CGHA 3PY8A 1NK6A 4M41A 4JS5A 3ZSZA 4CJWA 4DS5A 1HQUA 3MEDA 1S1VA 5CYQA 4FZYA 2E6MA 4O4GA 1NK7A 3NCIA 4FJMA 4DTSA 1HRHA 3LPTA 5HLFA 1RTDA 4RW7A 4NYFA 3AVIA 3HXMA 1UOCA 4Z4FA 2YNFA 1KFSA 4NCAA 4N56A 5HBMA 3C94A 1U4BA 1HJRA 4I2QA 3ZSRA 3CYMA 4BWMA 4CGFA 3TAFA 4CESA 4KI6A 5JS1A 4GMJB 4RW8A 3ALYA 1NK0A 4M42A 3OS0A 4OJRA 1K6YA 1U45A 4QCLA 2DFHA 3P1GA 4E7KA 3LP0A 1RBUA 1HYVA 1C1BA 4EZ9A 3PO5A 1X9MA 2Z1JA 1WSFA 4E7LA 2HHXA 3LPUA 1U49A 1JLEA 2XHBA 3VQPA 3LZIA 3AVHA 3NDKA 4CJUA 1TK8A 1ITGA 4DF8A 2IOCA 2DTUA 1A5WA 3BGRA 3OYAA 3OVNA 4CEFA 1SKRA 1BIZA 5HRNA 4CF0A 4CJEA 4O0JA 1ASUA 1YT3A 4QAGA 3ASMA 1S9GA 1RBRA 4DF4A 2DY4A 1IO2A 3OYEA 3O3HA 3OYIA 3OY9A 3TAPA 4DTXA 4KHSA 2Z1IA 4E1NA 5SZTA 3V4IA 3HL8A 5HRSA 4CEDA 3NH1A 2IC3A 3IS9A 1ASVA 3EYZA 4DTJA 4DFKA 1WNSA 3V9XA 1A5XA 4Z4IA 1I39A 4DSLA 3RMAA 4CK1A 4PY5A 3DLHA 5HRRA 3ZSYA 1XHZA 1S6PA 4BDPA 2EX3A 4KHYA 2O4IA 5KRSA 4DSKA 3NE6A 1LWFA 1BHLA 3AVAA 4W5TA 4ID5A 2EHGA 3KIOA 3HP9A 4BE0A 3V81A 3BDPA 4CEEA 2VG5A 2FC0A 1NK4A 4F2SA 5T7BA 3KLEA 3KD1E 3AVKA 1WSHA 2RPIA 4CJSA 3OYHA 1HYSA 4ELTA 3V9UA 3VQCA 3MXMA 1S9EA 3IG1A 4KO0A 4OKJA 3SV3A 1QSYA 2IDOA 1BCOA 1VSFA 2YHBA 1U04A 4KFBA 3L2UA 3S3NA 1X1PA 1BQMA 4JLHA 3SYZA 3VQ4A 4N76A 4BDZA 4FJHA 4F8RA 4CK2A 4DQSA 4KHNA 4W5NA 1C0UA 3AA5X 4FLUA 3DLBA 3NBPA 3QETA 2RKIA 1YVUA 1NOYA 3VQQA 1WAJA 3AA4A 1DLOA 3CFOA 4CEZA 4E1MA 3C6UA 2HNDA 4LSNA 1NKBA 1UA0A 4J2AA 4M3TA 4B9UA 1GOCA 1Z25A 2LSNA 1CXUA 4ZTJA 4M3WA 2F8SA 3C6TA 3MXJA 2G8VA 3OYGA 4CHOA 1SUQA 3MECA 2XY8A 5K14A 1VSJA 4CK3A 2XY6A 3S3OA 1IG9A 2G8HA 3VQ5A 3HPGA 5EU7A 3OJSA 1SKWA 4ZTFA 3ISNC 2XY7A 4CJTA 1VSDA 4KKOA 3SCXA 4B9LA 4K8XA 4FM2A 3TWHA 1KLMA 1VK0A 1NJWA 4FJJA 5KGWA 3SQ2A 1BI4B 3P5JA 3HYFA 1HNIA 1TKTA 1LAVA 2NUBA 3ZT1A 3OYDA 3NF8A 4OVLA 3VN5A 2IS3A 4NYNA 1ZBFA 2HB5A 1LAWA 2FBVA 3ZT0A 2XO7A 2G8FA 4FJIA 4DU1A 1JLGA 4FJ7A 4AHTA 2OPRA 3O4NA 3DLGA 3DRPA 4CGIA 2KTQA 3SUQA 4CF8A 4R5PA 3ZSQA 3RTVA 2HHVA 1C6VA 3KJVA 4FCYA 1J5OA 4C8KA 2D0BA 4N5SA 3OYLA 5KRTA 3SQ4A 3KTQA 2P51A 3DOLA 4CJ5A 2YKMA 4AILC 1RT5A 1R0AA 1C1CA 2YNGA 2ATQA 4BDYA 4W5OA 3K2PA 2WONA 3KK3A 3SV4A 1RT3A 3WNHA 4DU4A 1NK8A 3U6FA 4KRFA 3RR7A 4MFBA 4FLZA 3I0RA 3DLEA 3HM9A 4QOZB 1EP4A 3AVGA 1C1AA 4PA1A 4CIEA 1D9FA 3HO1A 3VQ9A 1TGOA 1LW0A 2BGGA 3KK1A 1IKYA 2Z1HA 4FLVA 3KKSA 1RNHA 1JLAA 3KKRA 3NAEA 1XWLA 4Z4GA 3LZJA 3NGYA 1L5UA 3K58A 4KTZA 2HVIA 3NH0A 4M3XA 1RILA 3NHGA 4DQIA 3B6PA 1KVAA 3AVFA 3NH2A 1NJZA 3IRXA 3C95A 3P83D 4RG8A 3D0PA 1X9WA 3PV8A 3K57A 4FXDA 1TL3A 1RT1A 4NCBA 1Q8IA 1IKXA 3OYNA 3M8SA 2FBTA 1CZBA 1REVA 4OGCA 4CEAA 2X78A 4F2RA 3DMJA 5J1EA 5JS2A 4B8CA 4HUFA 2P5GA 4CJ3A 1S6QA 2G8IA 4CF1A 5HROA 2HHSA 1WSJA 3ZT3A 3L2VA 4M3YA 4UQGA 1IKVA 2KZMA 4CE9A 1RT7A 2KQ2A 3VA0A 1B92A 1ZBUA 3HVTA 5FRNA 4RW9A 1C0MA 1HQEA 3T19A 5FROA 1T8EA 1G15A 3VQ7A 2JGUA 5C25A 2BDPA 3L3UA 4B9VA 4HUGA 4J2EA 2KZZA 1DTTA 4B9MA 4IFYA 2VG6A 3OYJA 1ZBIA 1W9HA 3DOKA 3F9KA 4CJKA 2PYLA 4Q0BA 5CYMA 3PUFA 1TV6A 4EP5A 4E7JA 3QLHA 1NOZA 1EETA 3ZSWA 1JXBA 4KB1A 4CJ4A 1I3AA 4E0DA 1IKWA 2VWKA 1NJYA 4DTOA 1TAQA 3DYAA 3OYKA 1B9DA 1XC9A 3LALA 4I2PA 2D0AA 4JRQA 3QINA 3THVA 1KCFA 5I42A 4B9NA 4FJ9A 1WSGA 5CZ2A 2X6NA 1UAXA 3NGIA 4DS4A 4DQPA 3VQBA 1ZBHA 3DLKA 4LH4A 3O3FA 1L3SA 3WNFA 2QXFA 4CEBA 4AH9A 2F96A 3MEGA 4OLBA 4CHNA 1B9FA 5CZ1A 1JXEA 3LAMA 1EKEA 2R7YA 4B3OA 3SQ0A 4HCBA 1VSIA 4LY7A 2BE2A 5HP1A
chains in the Genus database with same CATH superfamily
4FWLA 1KVCA 1JLFA 3EZWA 4CJ7A 1NJIO 2Z1GA 3L2QA 3ZEUB 3MAQA 2P9UA 1NGIA 2FSNA 4JKAA 3GBTA 4DLGA 3Q7CA 3MCPA 1LV5A 3B6OA 3FFIA 5GINA 4ELVA 3BZCA 2QKBA 3P38A 2V52B 4H4OA 4CJRA 3MN6A 3TANA 1T7PA 3NVKA 1EWQA 3V1RA 3EL2A 4CGGA 1NGEA 4QS8A 5LMNK 5AZJB 4JD2A 3THXA 4M7XA 1H1VA 5F0XA 5HOOA 3CF5L 3VPZA 2KW4A 3BZKA 1BISA 1YF5L 2NRWA 3J81O 4B1YB 3EEQA 3SI6A 3U3YA 4H0YB 1F21A 3QEVA 5LL6Z 5A2QO 2BUPA 3WNGA 5C10A 3FZHA 4DSFA 2PY5A 1X3NA 3L2RA 5J2PA 2ZJPL 4DR7K 5AQLA 2CGLA 2QW9A 3VQ8A 1L3TA 2OTJN 3Q7BA 1MWKA 5ADXA 3QEIA 4H4MA 1P90A 2QM1A 4M3UA 1EQYA 1S1WA 3F2KA 2P9NB 1QE1A 3SPZA 4KHQA 3ENHA 1TUUA 3PO4A 4V19S 1GOBA 1XHXA 3DI6A 3FZFA 1VQ7N 4KB0A 1VRUA 2OZSA 4FPBA 3LP2A 4LH5A 4DMNA 2YCHA 3A2FA 4OPJA 1T05A 2YHAA 3O9UA 5M1QA 1JLQA 2B5JA 1GOAA 4OGEA 1C0FA 1JCFA 2FF3B 5AJ3K 4YOTA 5TKWA 5SWMA 4FM0A 2PYJA 1D5AA 5FPDA 4IWVA 4GV6A 1SL1A 2GUPA 1RDWX 3MDQA 1U2VB 3K0SA 2D0CA 1HJOA 2P1JA 4FW1A 4I6MB 1N34K 4FK4A 4FLTA 1R59O 3HI0A 4H8KA 1KTQA 4KTQA 2FSJA 3HSTB 1BG3A 3NF7A 1ZYQA 4IJAA 3RMBA 4GVMA 4A5BA 2E20A 4OKKA 4WF9L 3SPYA 4BQZA 1OH6A 3CC7N 4DWIA 3AO3A 4PUOA 5AQFA 2ASMA 3W3DA 1WN7A 3OJUA 3CCRN 1RTJA 3KHYA 4E7HA 3DLRA 4WE1A 4DV2K 3PX0A 2E1ZA 4PWDA 4LFCK 1OH8A 4OO1J 3CIPA 4CFCA 4BG8A 4LF6K 1LW2A 3RRGA 1I94K 3QIPA 3D7EO 4JD2B 1IBKK 1GLLO 2KFZA 3ID6A 1OH7A 3SQ1A 3OBWA 3PLAA 3AVCA 1RBSA 4CGJA 4JI8K 2CH6A 3OBYA 4AHVA 1LWEA 2OPPA 5BPLA 1VSHA 1Z26A 2VGNA 2HW3A 5ELZA 4LD0A 2CGJA 1V4SA 4RW6A 5C42A 4I9QA 4DSIA 4JI4K 3ZETA 1NGHA 3V9ZA 4TSXA 3LDLA 4BE2A 4IEIA 3TI0A 2OPQA 3R6MA 3CC2N 2BTFA 1VSEA 4BR7A 2ITMA 4DU3A 4IXCA 4Z0UA 1HNVA 1D9DA 2O8BA 4A5AA 3KLHA 3B8AX 3CCEN 3CI5A 4O8UA 3K5OA 3NF6A 1BA0A 3F5TA 3CFPA 3TAQA 3KD5E 3VQ6A 2O4GA 4LF7K 1Y97A 3CD6N 4BRQA 1W0HA 5JVHL 5GIOA 3AA3A 4CGHA 3PY8A 4M41A 3CJCA 1HQUA 4KH5A 4JI6K 3DXMA 4O4GA 1NK7A 4DTSA 1HRHA 3CXCM 4BR5A 1UOCA 1EWRA 4N56A 3VOVA 1OKJA 4CZHA 1U4BA 1HJRA 1P8ZA 4B3MK 3CYMA 4DB3A 4CGFA 2W6LA 2Q0RA 1MWMA 4GMJB 2NZTA 4LC9B 3ZYYX 5FLXO 2W6KA 2WTUA 1NGGA 4JKDA 2DFHA 3CJAA 1RBUA 3GDQA 3L4QA 2HHXA 4RCHA 3LZIA 3RSEA 4FWRA 1VQ5N 1K8KA 2DTUA 1A5WA 1KAYA 2ZWHA 2F9TA 4CJEA 2QWRA 1YT3A 2QWMA 1YJNN 3KVGA 3U8XA 3VEYA 2P9LA 3O3HA 3OYIA 5AQYA 4E1NA 5SZTA 3NH1A 1E4GT 2IC3A 1WNSA 4PY5A 1A5XA 3VF6A 2GEMA 4H0OA 1CZAN 3ZSYA 1HNXK 4DSKA 1LWFA 2EHGA 3KIOA 3HP9A 3V81A 3BDPA 5T7BA 4CJSA 4ELTA 3V9UA 4FWMA 3TTCA 2PAVA 1U04A 3H6EA 3H45C 1BUPA 1X1PA 3F9MA 4WQ5C 4U7BA 3SLCA 3QETA 2RKIA 1YVUA 3VQQA 1WAJA 3KZBA 4Z94A 3C6UA 1UA0A 2LSNA 4DR5K 3C6TA 3MXJA 2G8VA 3A0IX 3I33A 2E2QA 4YOXA 3MECA 2XY8A 2XY6A 3RR7A 4CK3A 4A61A 3ZETB 4B3TK 3OJSA 4KH4A 3SCXA 2XY7A 4B9LA 1VSDA 4KKOA 4K8XA 3TWHA 3SQ2A 1BI4B 3HYFA 1T44A 2GWKA 2NUBA 3ZT1A 3VN5A 2IVNA 5KQDA 5LJWA 4DU1A 1W2BM 5LJVA 1JLGA 1O13A 1N33K 2CH5A 3DLGA 4HWIA 1NG9A 2GX9A 4CGIA 4CF8A 3ZSQA 2HHVA 1C6VA 3EE9A 3SQ4A 3L6QA 3CCJN 1C1CA 2YNGA 4LF9K 4YOYA 2AA4A 1T6CA 3I0RA 1HKBA 4DKWA 4PA1A 2JWKA 1D9FA 2HMPA 1TUYA 1LW0A 1IKYA 3NAEA 1XWLA 2YJEA 5EY4A 3NH0A 5AQUA 1NJZA 2KLAA 4RG8A 3K57A 1QHAA 1ATNA 4YY3K 2FBTA 4OGCA 5CHIA 5J1EA 5JS2A 4JK8A 5HROA 3RSEB 1K8KB 4UQGA 2KZMA 4CE9A 2NRRA 3HVTA 5FRNA 1T8EA 2BDPA 3O5BA 3VQ7A 4B9VA 2KZZA 3L3UA 4KH6A 4HUGA 1NWKA 4NLBA 2GTDA 3OYJA 3HSCA 1ZBIA 1W9HA 5CYMA 3LDPA 4LFAK 3IDHA 3ZSWA 4KB1A 1RGIA 4CJ4A 1IKWA 1NJYA 3OA9A 4DTOA 1VHXA 4CD1A 3DXKA 5KPTA 5DM6L 5AQHA 1RFQA 1XC9A 3LALA 4I2PA 2O8FA 1WSGA 1ZBHA 1Q81O 4LFBK 4X64K 3O3FA 1L3SA 4FO0A 3D2EB 3J7YP 1Y64A 2PBDA 3LAMA 4B3OA 1VQ8N 1VSIA 5M1KA 2UUAK 4OVLA 2BE2A 1LWCA 2JLEA 4O55A 3E9LA 1QZ6A 4C8MA 4DFPA 2W42A 1NU0A 2V7ZA 4BR2A 3VEZA 2DFFA 3TR8A 1YHQN 5AQGA 4DTNA 5M1FA 2I7NA 4DV6K 4GW6A 2G8UA 3EKUA 4JAXA 3R9PA 4ISEA 5DK5A 3HTVA 3LDSA 3OHRA 4CBXA 4B9SA 1Z05A 4FL9A 1QSSA 1N5YA 4E7IA 4JKCA 1ATSA 1SZ2A 4NCGA 4BROA 2QWPA 1G99A 3EO3A 4DFJA 3QNOA 3VQDA 5M1NA 3LWLA 4DQRA 4IFEA 1HPMA 3M5RA 4WCEL 3TSPA 1CZ9A 1YTUA 3H46O 4HHTA 1GLAG 1KAZA 1VQNN 4IBNA 1WSIA 1FXXA 2HSTA 3I56N 4CW7B 4CIFA 4FK0A 4MLHA 3RVCA 3I8DA 5TKYA 4BRKA 1XC3A 2B4JA 4GVEA 3O1WA 4CZJA 4FVUA 5E41A 4IO8A 4OPKA 3UKRA 5FRMA 3T1AA 4YOWA 4J2DA 3A5NC 1L3VA 4EHUA 1NJXA 4G9ZA 5AQNA 4Z4EA 1TKXA 1UWBA 5C2FA 4DSJA 2GUIA 4PQUA 3IAYA 4M3ZA 1JLCA 3SAFA 2D5RA 4FJLA 4WFNL 3O4QA 4MDBA 2Q1NA 4QS7A 1TKZA 4O5FA 1QVGM 4RW4A 2XY5A 3MK6A 3R8EA 3SUPA 3KWIA 5I9EB 5C0YA 5KTQA 5E26A 3QMLA 4CEQA 5BREA 4C8OA 2IVPA 1S1TA 3LP3A 3L3VA 3SZ2A 1VSKA 1FK9A 4ZHRA 2GELA 3QNNA 3C0BA 5DMRA 4YOUA 3LWMA 1K8AO 3VETA 2HHWA 3UKUB 3ZX3A 2QXLA 3M8QA 2B6AA 2X6SA 4CJPA 3LAKA 1VAZA 1BIUA 1ESVA 3PSFA 4F2SA 1Q9YA 1JL2A 1IJJA 3M8PA 1UA1A 1NMNA 1T03A 4CFDA 1DTQA 4EP4A 1NK9A 1VRTA 4MQ3A 1SV5A 3QEXA 3AARA 3KLIA 1LCUA 4M45A 1KAXA 4CECA 3V9SA 4BE1A 3L2WA 4CHZA 1RBTA 3O80A 2O8EB 3K59A 1VQPN 4E3SA 4N41A 3N4PA 1KXPA 1NGBA 2Q97A 4CJFA 3S9HA 3HPOA 2ZD1A 4ILHA 4DCHA 3HT3A 4C8NA 1RDCA 4BWJA 2ZGZA 3CFRA 3RWUA 3FE1A 4HTLA 3FR0A 4H0VB 3AVBA 5AQZA 3LM2A 4Q5VA 3WXIA 4X66K 2FBXA 4CERA 3SUOA 4KPYA 2Q0UA 3TAGA 1QQMA 4FK2A 4M7YA 5JVGL 4Z4HA 2HHUA 2VG7A 1RT4A 1J5EK 3MN9A 3T1HK 3P31A 4FJ5A 4ISGA 2ZM6K 2ZE2A 1BGXT 2UXBK 4X65K 4CF9A 2A1RA 4A59A 3M8RA 3EY1A 1BCMA 1A5VA 1JL1A 3HM8A 2F4VK 2A42A 3LDNA 1FW6A 4H0TB 4G1QA 4IDKA 3KLFA 3SUNA 3HOSA 3P4IA 4CGDA 1WLJA 3LP1A 3OYMA 1ASWA 4BY9C 3VENA 3K9JA 2CGKA 2RF2A 4DTMA 2QK9A 3HJFA 5AQMA 2NLXA 4BRHA 2Q3SA 2P9KA 1NK6A 2IVOA 1YXQA 3AY9A 4CJWA 4DS5A 5CYQA 1YJ9N 4OPAA 4RW7A 4NYFA 5BR8K 3FZKA 2YNFA 3ULEA 5HBMA 4I2QA 2D4WA 1IBLK 4BWMA 4CESA 2NNWA 1D4XA 1NGJA 2IIRA 3ALYA 4OJRA 1U45A 4E7KA 2YHWA 3K9KA 4AM6A 3TPQA 1X9MA 3PO5A 1WSFA 1T3VA 3LPUA 2DPNA 1TK8A 3IMXA 4DF8A 3OVNA 5AQQA 4BRMA 4O0JA 4QAGA 1OH5A 3OW2M 2FXUA 1IO2A 3HZ6A 4BREA 3J8AA 4DTXA 2Z1IA 2V51B 2E8AA 4CEDA 4DTJA 4DFKA 3V9XA 3DLHA 5HRRA 4KHYA 2P9UB 5JLFA 5KRSA 1GLEG 4W5TA 4ID5A 4C23A 4BE0A 4CEEA 2FC0A 1NK4A 1JJ2M 2VQFK 2RPIA 4JI2K 4J8FA 4OKJA 3WXKA 5ADXH 3SV3A 1QSYA 2IDOA 1BCOA 4FWOA 2VCPA 4BRLA 4NXMK 4DR1K 3SYZA 3OTOK 4B1WB 4FJHA 4CK2A 3EKSA 1C0UA 3DLBA 4JKEA 3THXB 4OX9K 4YDUA 4CEZA 3HOTA 2HNDA 3CERA 3MMVA 4M3TA 1GOCA 1DKGD 3P39A 3U9DA 1XMQK 5H1SQ 3BF1A 5M1OA 5K14A 1VSJA 4EIAA 3SAHA 2NRTA 4YORA 5EU7A 3VQ5A 3WT0A 3GG4A 3IKMA 1SKWA 3FGUA 1KLMA 5KGWA 3DWLA 5M1PA 2HOEA 3QFUA 1QQNA 1ZBFA 2HB5A 1LAWA 2QI2A 5EXWA 4AQYK 4FJ7A 3DRPA 2KTQA 3SUQA 4R5PA 1J5OA 5AZIA 4C8KA 2D0BA 2Q2RA 2P51A 2YKMA 1RT5A 2NRZA 4BDYA 3KK3A 2WONA 1RT3A 4DU4A 3U6FA 2VGMA 2ZF5O 3HM9A 4BC4A 2D1KA 1TGOA 3ULEB 3KKSA 1JLAA 4Z4GA 3LZJA 4BGAA 1L5UA 3K58A 2HVIA 4IO9L 1RILA 3NHGA 4DQIA 1KC8O 3NH2A 5JLHA 3C95A 3P83D 4DV0K 2NRVA 4FXDA 1RT1A 5EOYA 1CZBA 2X78A 4F2RA 5IWAK 3M6GA 4CJ3A 4CF1A 4FWQA 4M3YA 3WXLA 1IKVA 4CZFA 3DLLL 1B92A 1ZBUA 3O6WA 4RW9A 5FROA 3T19A 1MA9B 2JGUA 4J2EA 5FPEA 3THWA 1DTTA 4IFYA 2VG6A 3DOKA 3PUFA 4E7JA 1HX1A 1EETA 3THYA 1YIJN 4E0DA 2QEXN 2VWKA 4BR9A 1DEJA 1W7AA 3MWPA 1SS6A 2D0AA 3QINA 4FJ9A 4Y0WA 5CZ2A 2X6NA 4AF1A 4DS4A 3SAGA 3WNFA 5LMUK 4AH9A 1NLVA 1B9FA 4WFBL 1GLDG 2A41A 3SQ0A 4HCBA 4JK7A 2HF3A 4LY7A 3KLGA 2IAJA 4GKKK 2P9PA 4CHPA 4EZ6A 4JKGA 3E9PA 3E1YA 4DSEA 1KRPA 3VTHA 3MCAB 3HVRA 5GAEP 1MU2A 1XUPO 1KSPA 3G0ZA 4BVOA 2OZMA 4FZZA 4AHCA 5AQVA 2GBZA 4M63C 4LF8K 1JLBA 4JNEA 3GOIA 2YNIA 3VQAA 3O4WA 1TYQA 4CF2A 3D45A 3DRSA 4EHTA 3DJCA 4JYAK 4KHWA 4XEIA 1YUWA 3H08A 5KGXA 1S72N 1WSEA 5AQJA 4B8AB 3I55N 1X3MA 4EFHA 2OANA 4FM1A 3QESA 2ZQBA 1WBBA 3CG7A 2O8DA 4ISFA 3OYCA 4FJ8A 3NMUA 4K0KK 2O8BB 2FSKA 4MDAA 4HCCA 2P5OA 4K25A 3KWGA 3MN5A 4BRCA 1T6DA 4M3RA 4AM7A 2YV0X 3H1VX 4CD3A 4X62K 3CMEN 3KK7A 4CZEA 3SBTA 4CFBA 1RT2A 2VWBA 3R1XA 1S5JA 3MXIA 3AVJA 2HMIA 5GAHP 2RE2A 1FKPA 1NGAA 1Q9XA 5I3UA 4CFAA 4PKIA 3DXMB 4CI6A 2UYTA 3VESA 4AHRA 4JS4A 4CHYA 3ZT2A 3F73A 3QERA 4BGBA 4KHPK 3S41A 4DR6K 4DUYK 2AJQA 4F3OA 1VQ4N 3AVNA 1TKDA 3QIOA 3L8BA 3V6DA 3K5NA 3HP6A 3EN9A 2QWNA 5AQWA 5AQRA 3OYBA 3V1QA 4CJLA 1KD1O 1RT6A 1RBVA 3VA3A 2E6LA 2P9SA 3MWTA 3VMFB 4DR2K 3CCMN 1QHTA 2QTDA 3C7NA 3OS2A 1YJWN 1BO5O 4O5BA 3RR8A 3TARA 4E89A 2G8WA 5AQXA 1FJGK 4XIUA 3AVMA 2P9LB 3A5MC 3GL1A 1ZBSA 2HHHK 3AV9A 5AQPA 3THYB 2HBMA 3ID8A 4FJGA 2IGIA 1FKOA 3FZMA 2A6AA 3JYTA 3WNEA 1TAUA 1KQSM 4IG0A 4DTUA 2UU9K 3ULDA 4IFVA 3OYFA 5F1XA 4JRPA 4FJXA 5C15A 4Z4CA 1TK5A 3TAMA 1XNQK 2HNYA 1HPZA 1WOQA 5FPMA 3CJ1A 4H5NA 5BRFA 1IH7A 3WQTA 2PFUA 5C2DA 1J54A 4CBWA 4JKHA 4U67L 1BWFO 1S1UA 3V1OA 4K43A 3VGMA 2OYQA 4ID1A 3MX5A 5AFUA 2O8CA 3SK3A 4PL8A 4FWKA 4I9LA 4DV7K 4CZKA 5JMVA 3C6HA 4GKJK 3J80O 4FZXC 1TYQB 2YKNA 3RMCA 2GV9A 3AO5A 1ZBLA 1TK0A 4B08A 4CHQA 3HRGA 3AGKA 3ZEUA 1X9SA 4CJVA 1SKSA 4MO5A 4CBUA 2ITGA 4R79A 3NF9A 2HBJA 5HRPA 3ZSVA 4HTUA 5KQ8A 2HF4A 2WC9A 1D8YA 4BC3A 3DAWA 3ITHA 3SNNA 1RDDA 3LDOA 4AHUA 2F8TA 4CCHA 1EX4A 2D0OA 4IKFA 4K8ZA 2X74A 4N47A 1WAFA 4JI7K 1ILYA 1VQON 5AQTA 3OS1A 1S3XA 4GNIA 4F3TA 3CM6A 1NGCA 3QICA 5CE3A 5FDLA 4H5VA 1QSLA 4OLAA 3K5LA 4KREA 1XNRK 4DG1A 4FW2A 4FVMA 5CY4A 3H1QA 1BQNA 1VQMN 3TTFA 4BRDA 3PIOL 2UUCK 2YNHA 2A1SA 4PKGA 3DRRA 1N6QA 5KI6A 5C24A 4DFMA 4DR4K 4JKBA 3TTDA 4UY8O 3A5LC 4JS5A 3ZSZA 3MEDA 4BRGA 4FJMA 2P9SB 3NCIA 1RTDA 5MLCQ 4NCAA 1KFSA 3VTIA 2WFBA 3TAFA 2P9NA 4KI6A 5JS1A 1M1KO 4M42A 3U9ZA 1K6YA 4QCLA 3P1GA 3LP0A 1HYVA 3C65A 3JAMO 4EZ9A 2Z1JA 4E7LA 5BRDA 1U49A 1JLEA 2XHBA 3VQPA 3DXKB 3NDKA 4CJUA 4PL7A 3O08A 4XH5A 2O8FB 1BDGA 1E3MA 4JK9A 1SKRA 1YVNA 2DY4A 3OYEA 3OY9A 5EX5A 4KHSA 4JI3K 4L3QA 4C1NK 5HRSA 3R3LA 3QBWA 3IS9A 1ASVA 3ZLJA 4DSLA 1U2VA 3T7ZA 3QB0A 2O4IA 4QS9A 4I6MA 4RTFD 2WUSA 3AVAA 1XMOK 2VG5A 3AVKA 1WSHA 1HYSA 3OYHA 3QDKA 3M3ZA 1S9EA 3IG1A 3I8BA 5EVZA 3G4SN 1VSFA 2YHBA 2QWQA 5GAGP 1N36K 4GV3A 2RHKA 3L2UA 1BQMA 3CHWA 4JLHA 4N76A 3TSUA 3FZLA 4KHNA 2AP1A 3O9TA 1JCGA 1DLOA 3CFOA 4NB4A 4E1MA 1NKBA 4B9UA 1CXUA 4ZTJA 4M3WA 1SAZA 4B1VA 1SUQA 3BEXA 3S3OA 1IG9A 3HPGA 4K41A 3CCVN 4H0XB 3QBXA 4ZTFA 3ZX0A 4CJTA 4FM2A 1VK0A 1NJWA 4WQ4A 3CJBA 3P5JA 1TKTA 1LAVA 3ATVA 3G25A 3NF8A 3ZX2A 3OYDA 2IS3A 2HBKA 3UKRB 2FBVA 3ZT0A 3G71N 4FJIA 2ASOA 4AHTA 2OPRA 3VEWA 1K9MO 5BR9A 3KJVA 3ENBA 4N5SA 5JICA 3DOLA 1R0AA 1HR0K 4W5OA 3K2PA 4KRFA 1NK8A 3WNHA 1WB9A 4MFBA 4DV1K 3E66A 4FLZA 4QOZB 3EE8A 4YHHK 3AVGA 1OVYA 2QWOA 4F9OA 5CR4A 1HKCA 2BGGA 3KK1A 1WBDA 2Z1HA 1RNHA 1GLJO 1NM1A 3CMAN 3NGYA 2E2PA 3AVFA 3D0PA 1QZ5A 2YX6A 1IKXA 3OYNA 4CEAA 3VERA 3DMJA 1QQOA 4B8CA 2P5GA 2G8IA 2HHSA 1YITN 3ZT3A 3J7ZO 4BRIA 1X9JA 2KQ2A 4DV3K 1HQEA 3KD1E 1G15A 1J6ZA 5AQSA 4B9MA 2PYLA 4Q0BA 3VEOA 4EP5A 2UUBK 1NOZA 4XH1A 4A62A 1JXBA 5GIPA 1I3AA 3T69A 1N8RO 3CCUN 3D2FA 4BRFA 1B9DA 4IJNA 1GLBG 4JRQA 4B9NA 3O9RA 3NGIA 4DQPA 3VQBA 3DLKA 4CEBA 1HUXA 4CZIA 2F96A 2A40A 2J4RA 4OLBA 3WXJA 2ZGYA 1JXEA 4O8KA 2R7YA 3UB5A 5HP1A 4IOXA 2H3GX 4DQQA 3JS6A 3LANA 3BY5A 5BN9A 3C6AA 4BR4A 2OTLN 3T3FA 4A57A 3BP8A 2P9IA 4YFUA 4IOAL 4C1NI 1JKHA 4LSLA 1HKGA 3MX2A 3O9QA 1RCHA 2GWJA 2KKZA 4BACA 1V4TA 2E4LA 1HNZK 1VSLA 2BH1A 4DTRA 5C12A 1HMVA 3QEPA 1BL3A 2OPSA 4FWPA 3CQXA 3L0QA 1XQSC 1L3UA 3QO9A 1U47A 4RWTA 2NRXA 1SL2A 2E1YA 1N32K 2YHYA 4NO7A 1KFDA 4FLWA 1VQ9N 4KAZA 1E4FT 3K5MA 1TL1A 3ZSXA 1S1XA 5AQKA 4YNQA 5J2NA 4IOCL 3E01A 5IT9O 1BI4A 1YAGA 1NK5A 3T1YK 3WUHA 4B9QA 1CLQA 4BRPA 3ATUA 2DFEA 3VEXA 1ZC6A 2P9KB 4E19A 2G8KA 2JWLA 4L8RB 1LOTB 1BU6O 4DLEA 4CEOA 3FLCO 4KTWA 4B3SK 4W5RA 4FOIA 1SL0A 3SJJA 4NLCA 2OA8A 4KI4A 2XRIA 2QKKA 4Y1CA 2E2OA 2F9WA 4WFAL 4F4KA 1RTIA 4FYDA 4A2BA 3HPHA 3IFRA 4AHSA 4HUEA 4E1JA 2VQEK 4JKFA 4K42A 2ZJQL 3TU5A 4CJQA 4C8LA 4DTPA 3JSMA 3FFKB 1K73O 2W41A 1HYZA 3RRHA 3VQEA 3NFAA 4O44A 4YOVA 5HL7L 3KK2A 3IUCA 4PKHA 2I5JA 2A5XA 1NKCA 2BANA 2E5LK 1J53A 2EWSA 4IG3A 1ATRA 3CQ8A 3TAEA 3TSQA 4CZGA 3J7AP 3AA2A 3HK2A 2HNZA 5D3GA 3D2FB 3HBTA 4FJKA 2RN2A 2YHXA 3U3GA 3CM5A 1KLNA 4W5QA 1VSMA 1TVRA 1RDAA 3VGLA 1YTAA 4FPAA 5J2MA 4PHTX 1QVFM 3E9OA 5E84A 3NGZA 4LF4K 3VEVA 1BA1A 2WOMA 3AVLA 4FLYA 3CCSN 4JV5K 4DQ8A 3WQUA 3VGKA 1EXQA 2E88A 2VWJA 3I0SA 5FPNA 4J2BA 2HVHA 4I7FA 1QS4A 2E2NA 2P9IB 3ZCMA 2HHTA 3D2EA 5F2RA 4BRNA 3CQYA 4GY2B 1VQLN 3A8YA 1NGFA 3AO2A 3ZSOA 3O3GA 1RTHA 3S3MA 2HHQA 3MEEA 4BRAA 4JI0K 4JHDA 1NKEA 5KPRA 4HVJA 3DM2A 3EZ5A 1J9AA 3RMDA 1WUAA 4FJNA 2Y1JA 3PX4A 4CIGA 4JEPA 1JCEA 2ETJA 4B9TA 3UIQA 3WEEA 1QTMA 4KV8A 1U48A 3JXUA 3ZT4A 2PZSA 4H5TA 1U6ZA 2Y1IA 3SJHA 1NBWA 1NGDA 4ELUA 4BG9A 1CXQA 3SBGA 5AZIB 3V9WA 2FBYA 3G10A 3AO1A 3LL3A 3CPEA 4O0IA 4KHUA 4CZLA 3AGRA 4OKEA 1MDUB 1IG8A 1HLUA 3AO4A 3AAPA 1Q82O 2I7PA 1KVBA 5LY3A 4Y1DA 4ICLA 5AQOA 2KFNA 5AQIA 1O1WA 1QQCA 1C0TA 1RDBA 3CJ7A 3PX6A 3CC4N 1IV0A 5J2QA 4FLXA 1ZXOA 5DM7L 3TABA 1XI1A 3G6EN 3QEWA 1EO1A 3LDQA 4BR0A 3GE1A 1S1VA 4H0PA 4FZYA 2E6MA 3UE5A 3LPTA 4BC5A 1Q7YO 5HLFA 3AVIA 3HXMA 4Z4FA 3CCLN 4BVPA 3C94A 3ZSRA 3THWB 1SQKA 3CJ9A 4RW8A 1NK0A 3OS0A 1C0GA 2YI1A 4DV5K 1C1BA 2NRHA 3BUZB 3LM9A 1DT9A 4B1UB 3AVHA 4NXNK 1ITGA 2FLOA 2IOCA 3BGRA 3OYAA 4XH4A 4CEFA 1BIZA 5HRNA 3WXMB 4CF0A 2A3ZA 1Q86O 1NNEA 1ASUA 4DUZK 3ASMA 1S9GA 1RBRA 3VF2A 4JI5K 1RDUA 1Z6RA 4B3RK 3TAPA 3UKUA 3V4IA 1VQ6N 3HL8A 5GADP 2Q31A 3EYZA 2P9PB 3H3NO 4Z4IA 4JKGB 1I39A 3PSIA 4CK1A 3RMAA 4BDPA 1XHZA 1S6PA 2EX3A 3D6RA 4CZMA 3NE6A 1BHLA 4WYBA 3PIPL 4JN4A 1S22A 3KLEA 1GLCG 3L4IA 3VQCA 3MXMA 2UXDK 4KO0A 4KFBA 1M90O 2Q36A 3S3NA 2V7YA 1Q18A 3ENOA 4CVNE 4JHDB 2KHOA 3VQ4A 2O8EA 3MN7A 4BDZA 2OCEA 4F8RA 4DQSA 4W5NA 3AA5X 3H3OB 3N4QA 4FLUA 3NBPA 2WBNA 1NOYA 3AA4A 4LSNA 3WEEB 3VF4A 5BPMA 4J2AA 2O8DB 1Z25A 4WQ4C 3SMPA 2F8SA 4WQ5A 3OYGA 4CHOA 4FOEA 2QA4N 3M1FA 2G8HA 4IDHA 3ISNC 3O8MA 2W40A 5AR0A 4MO4A 4FJJA 3U4LA 4ILGB 5AZJA 1HNIA 5KPZA 1W97L 3O1BA 4NYNA 3CPWM 5BN8A 2XO7A 2G8FA 1HNWK 3AAQA 1GLFO 3O4NA 4FSVA 4B1XB 1NMDA 5B8HA 3RTVA 2YJFA 5BRHA 4FCYA 4DHYA 3OYLA 3O9SA 3KTQA 5KRTA 3W0LA 4OPHA 4DR3K 4CJ5A 4AILC 4ILJA 4BC2A 2ATQA 4FWSA 1YI2N 3SV4A 2D0PA 3DLEA 3CETA 1EP4A 4JI1K 2VYPA 1C1AA 4H5WA 4CIEA 3HO1A 3VQ9A 4GV9A 5AFUH 4H5RA 4BQLA 3C7NB 4FLVA 3KKRA 2F7TA 4A2AA 4KTZA 4M3XA 3B6PA 1KVAA 3IRXA 1X9WA 3PV8A 1TL3A 4NCBA 1Q8IA 1DGKN 3M8SA 1REVA 1OVQA 4FWNA 4HUFA 4IEEA 1S6QA 4KBOA 2FF6A 1WSJA 3L2VA 1RT7A 3VA0A 4B1ZA 4H03B 1C0MA 4MLEA 5C25A 1VQKN 1IBMK 2HBLA 5BPNA 3F9KA 4CJKA 1TV6A 2UXCK 3QLHA 4EAHD 2ZJRL 3QFPA 1TAQA 3DYAA 3OYKA 2ASPA 3THVA 3SMSA 4LF5K 4IZ9A 1KCFA 5I42A 2O8CB 2QWLA 4DV4K 3BF3A 1UAXA 4LH4A 3NVMA 2QXFA 3CCQN 1BOTO 3MEGA 4CHNA 4YDUC 5CZ1A 1EKEA 3A5OC 4DF4A
chains in the Genus database with same CATH topology
1LWCA 2JLEA 2IAJA 4O55A 4C8MA 4DFPA 2W42A 4CHPA 1KVCA 4DQQA 4EZ6A 1JLFA 3LANA 4DSEA 1KRPA 2Z1GA 3L2QA 2DFFA 3MAQA 3TR8A 3HVRA 4DTNA 3T3FA 4DLGA 1LV5A 4GW6A 3B6OA 3FFIA 4YFUA 4ELVA 2G8UA 2QKBA 1MU2A 1JKHA 4LSLA 5DK5A 3LDSA 1KSPA 3G0ZA 4H4OA 4CJRA 1RCHA 2OZMA 4BACA 4AHCA 2E4LA 4FZZA 1VSLA 2GBZA 3TANA 1T7PA 4B9SA 4DTRA 1QSSA 1JLBA 1N5YA 1HMVA 2YNIA 3VQAA 4E7IA 3QEPA 4CF2A 3D45A 3DRSA 4KHWA 1BL3A 2OPSA 4NCGA 5KGXA 3H08A 3V1RA 4CGGA 4DFJA 1WSEA 3QNOA 3VQDA 4B8AB 1L3UA 3LWLA 4FM1A 3QESA 4DQRA 2ZQBA 3QO9A 3CG7A 2KW4A 1U47A 1BISA 1CZ9A 1SL2A 1YTUA 3OYCA 4FJ8A 3SI6A 4HHTA 3U3YA 4HCCA 2P5OA 1KFDA 4FLWA 1F21A 4IBNA 1WSIA 4KAZA 3K5MA 3QEVA 1TL1A 3ZSXA 1S1XA 1FXXA 4YNQA 5J2NA 4M3RA 2YV0X 4CIFA 3E01A 3WNGA 1BI4A 4DSFA 1NK5A 4FK0A 2PY5A 4CFBA 1RT2A 3I8DA 1S5JA 3MXIA 3L2RA 2B4JA 5J2PA 3AVJA 2HMIA 1CLQA 5E41A 4OPKA 2DFEA 5FRMA 3T1AA 4J2DA 3VQ8A 4E19A 2G8KA 1FKPA 4L8RB 1L3TA 1L3VA 1Q9XA 5I3UA 4CFAA 4DLEA 4CEOA 1NJXA 4KTWA 3QEIA 4Z4EA 4H4MA 4AHRA 1TKXA 1UWBA 4JS4A 4CHYA 4W5RA 1SL0A 3SJJA 2OA8A 2GUIA 3ZT2A 3F73A 4DSJA 4KI4A 4PQUA 3QERA 2XRIA 3IAYA 4M3UA 4M3ZA 2QKKA 4Y1CA 1JLCA 1S1WA 2D5RA 4F4KA 4FJLA 2AJQA 4F3OA 3AVNA 1QE1A 3O4QA 3SPZA 1TKDA 3QIOA 3L8BA 4KHQA 1RTIA 3V6DA 3PO4A 4FYDA 1TKZA 3HPHA 4AHSA 1GOBA 3K5NA 1XHXA 4HUEA 4RW4A 3HP6A 3DI6A 4KB0A 2XY5A 1VRUA 2OZSA 3SUPA 3OYBA 3LP2A 3V1QA 4CJQA 4C8LA 4LH5A 4CJLA 1RT6A 4DTPA 5KTQA 1RBVA 3JSMA 3VA3A 4DMNA 1HYZA 2E6LA 3RRHA 3A2FA 3VQEA 4CEQA 2YHAA 3NFAA 4O44A 4OPJA 1T05A 4C8OA 1QHTA 3OS2A 3KK2A 4O5BA 1JLQA 3RR8A 3TARA 1S1TA 3LP3A 3L3VA 2I5JA 4E89A 1VSKA 3SZ2A 2G8WA 1FK9A 4ZHRA 3QNNA 4XIUA 1NKCA 2B5JA 5DMRA 1GOAA 2BANA 1J53A 4IG3A 3LWMA 3AVMA 3CQ8A 3TAEA 4OGEA 2HHWA 3AV9A 5SWMA 3AA2A 3M8QA 3HK2A 2B6AA 2HNZA 1D5AA 4FM0A 2X6SA 4CJPA 2PYJA 4FJGA 2IGIA 1FKOA 3LAKA 5D3GA 1SL1A 1BIUA 3JYTA 3WNEA 2RN2A 4FJKA 1TAUA 2D0CA 3U3GA 3CM5A 1Q9YA 1KLNA 2P1JA 4FW1A 4W5QA 1JL2A 4IG0A 1VSMA 3M8PA 1TVRA 1RDAA 4DTUA 4FLTA 3ULDA 1UA1A 1YTAA 4IFVA 1T03A 3OYFA 4CFDA 1DTQA 4EP4A 1NK9A 5J2MA 4H8KA 1KTQA 4KTQA 4JRPA 1VRTA 4MQ3A 3HSTB 1SV5A 4FJXA 3QEXA 4Z4CA 3KLGA 3NGZA 3KLIA 1TK5A 3NF7A 3TAMA 1ZYQA 2HNYA 1HPZA 2WOMA 4M45A 3RMBA 4GVMA 3AVLA 4CECA 4FLYA 3V9SA 1IH7A 3L2WA 4BE1A 4CHZA 1RBTA 1J54A 4OKKA 3K59A 3SPYA 1S1UA 3V1OA 2VWJA 1EXQA 4DWIA 3AO3A 4E3SA 4PUOA 2OYQA 4N41A 4ID1A 3I0SA 4J2BA 2HVHA 4I7FA 1QS4A 1WN7A 4CJFA 3S9HA 3HPOA 3OJUA 2ZD1A 1RTJA 3ZCMA 2HHTA 3HT3A 4E7HA 4I9LA 4C8NA 1RDCA 3DLRA 4BWJA 4WE1A 4FZXC 3PX0A 3CFRA 3RWUA 4PWDA 3AO2A 3ZSOA 3O3GA 1RTHA 3S3MA 2HHQA 4CFCA 2YKNA 3RMCA 1LW2A 2GV9A 3MEEA 3AVBA 3AO5A 1NKEA 1ZBLA 1TK0A 4B08A 4HVJA 4CHQA 3DM2A 3EZ5A 3RRGA 1J9AA 3QIPA 3RMDA 4FJNA 2Y1JA 3PX4A 4Q5VA 2KFZA 4CIGA 1X9SA 3SQ1A 3AVCA 1RBSA 2ETJA 2FBXA 4CGJA 4AHVA 4CERA 4CJVA 3SUOA 4B9TA 1LWEA 2OPPA 3UIQA 1SKSA 4KPYA 1VSHA 1Z26A 3TAGA 4KV8A 1QTMA 1U48A 2HW3A 4FK2A 4LD0A 3ZT4A 2ITGA 2PZSA 4RW6A 5C42A 3NF9A 2Y1IA 4I9QA 4Z4HA 5HRPA 4DSIA 3ZSVA 4HTUA 4ELUA 2HHUA 1D8YA 3V9ZA 2VG7A 1CXQA 4TSXA 3ITHA 1RT4A 3SNNA 1RDDA 2F8TA 4AHUA 4FJ5A 3V9WA 1EX4A 4CCHA 4IKFA 4K8ZA 4BE2A 2X74A 4N47A 1WAFA 2FBYA 2ZE2A 1BGXT 3G10A 3AO1A 2OPQA 3TI0A 4O0IA 4KHUA 3OS1A 4CF9A 2A1RA 4F3TA 4OKEA 1VSEA 3M8RA 3CM6A 4DU3A 3EY1A 1BCMA 1A5VA 3AO4A 4Z0UA 1JL1A 1HNVA 5FDLA 1QSLA 4OLAA 3K5LA 4KREA 1D9DA 1KVBA 4G1QA 4IDKA 4DG1A 3KLFA 4FW2A 3KLHA 3SUNA 4FVMA 5CY4A 1BQNA 4Y1DA 4ICLA 3K5OA 4CGDA 2KFNA 1WLJA 3LP1A 3NF6A 1O1WA 1QQCA 1C0TA 3CFPA 3TAQA 1RDBA 3KD5E 3VQ6A 3OYMA 2YNHA 2O4GA 1ASWA 2A1SA 1Y97A 1W0HA 3DRRA 3PX6A 2RF2A 1N6QA 5J2QA 5KI6A 5C24A 4DFMA 4FLXA 4FK4A 3TABA 1XI1A 4DTMA 2QK9A 3HJFA 3QEWA 2Q3SA 3AA3A 4CGHA 3PY8A 1NK6A 4M41A 4JS5A 3ZSZA 4CJWA 4DS5A 1HQUA 3MEDA 1S1VA 5CYQA 4FZYA 2E6MA 4O4GA 1NK7A 3NCIA 4FJMA 4DTSA 1HRHA 3LPTA 5HLFA 1RTDA 4RW7A 4NYFA 3AVIA 3HXMA 1UOCA 4Z4FA 2YNFA 1KFSA 4NCAA 4N56A 5HBMA 3C94A 1U4BA 1HJRA 4I2QA 3ZSRA 3CYMA 4BWMA 4CGFA 3TAFA 4CESA 4KI6A 5JS1A 4GMJB 4RW8A 3ALYA 1NK0A 4M42A 3OS0A 4OJRA 1K6YA 1U45A 4QCLA 2DFHA 3P1GA 4E7KA 3LP0A 1RBUA 1HYVA 1C1BA 4EZ9A 3PO5A 1X9MA 2Z1JA 1WSFA 4E7LA 2HHXA 3LPUA 1U49A 1JLEA 2XHBA 3VQPA 3LZIA 3AVHA 3NDKA 4CJUA 1TK8A 1ITGA 4DF8A 2IOCA 2DTUA 1A5WA 3BGRA 3OYAA 3OVNA 4CEFA 1SKRA 1BIZA 5HRNA 4CF0A 4CJEA 4O0JA 1ASUA 1YT3A 4QAGA 3ASMA 1S9GA 1RBRA 4DF4A 2DY4A 1IO2A 3OYEA 3O3HA 3OYIA 3OY9A 3TAPA 4DTXA 4KHSA 2Z1IA 4E1NA 5SZTA 3V4IA 3HL8A 5HRSA 4CEDA 3NH1A 2IC3A 3IS9A 1ASVA 3EYZA 4DTJA 4DFKA 1WNSA 3V9XA 1A5XA 4Z4IA 1I39A 4DSLA 3RMAA 4CK1A 4PY5A 3DLHA 5HRRA 3ZSYA 1XHZA 1S6PA 4BDPA 2EX3A 4KHYA 2O4IA 5KRSA 4DSKA 3NE6A 1LWFA 1BHLA 3AVAA 4W5TA 4ID5A 2EHGA 3KIOA 3HP9A 4BE0A 3V81A 3BDPA 4CEEA 2VG5A 2FC0A 1NK4A 4F2SA 5T7BA 3KLEA 3KD1E 3AVKA 1WSHA 2RPIA 4CJSA 3OYHA 1HYSA 4ELTA 3V9UA 3VQCA 3MXMA 1S9EA 3IG1A 4KO0A 4OKJA 3SV3A 1QSYA 2IDOA 1BCOA 1VSFA 2YHBA 1U04A 4KFBA 3L2UA 3S3NA 1X1PA 1BQMA 4JLHA 3SYZA 3VQ4A 4N76A 4BDZA 4FJHA 4F8RA 4CK2A 4DQSA 4KHNA 4W5NA 1C0UA 3AA5X 4FLUA 3DLBA 3NBPA 3QETA 2RKIA 1YVUA 1NOYA 3VQQA 1WAJA 3AA4A 1DLOA 3CFOA 4CEZA 4E1MA 3C6UA 2HNDA 4LSNA 1NKBA 1UA0A 4J2AA 4M3TA 4B9UA 1GOCA 1Z25A 2LSNA 1CXUA 4ZTJA 4M3WA 2F8SA 3C6TA 3MXJA 2G8VA 3OYGA 4CHOA 1SUQA 3MECA 2XY8A 5K14A 1VSJA 4CK3A 2XY6A 3S3OA 1IG9A 2G8HA 3VQ5A 3HPGA 5EU7A 3OJSA 1SKWA 4ZTFA 3ISNC 2XY7A 4CJTA 1VSDA 4KKOA 3SCXA 4B9LA 4K8XA 4FM2A 3TWHA 1KLMA 1VK0A 1NJWA 4FJJA 5KGWA 3SQ2A 1BI4B 3P5JA 3HYFA 1HNIA 1TKTA 1LAVA 2NUBA 3ZT1A 3OYDA 3NF8A 4OVLA 3VN5A 2IS3A 4NYNA 1ZBFA 2HB5A 1LAWA 2FBVA 3ZT0A 2XO7A 2G8FA 4FJIA 4DU1A 1JLGA 4FJ7A 4AHTA 2OPRA 3O4NA 3DLGA 3DRPA 4CGIA 2KTQA 3SUQA 4CF8A 4R5PA 3ZSQA 3RTVA 2HHVA 1C6VA 3KJVA 4FCYA 1J5OA 4C8KA 2D0BA 4N5SA 3OYLA 5KRTA 3SQ4A 3KTQA 2P51A 3DOLA 4CJ5A 2YKMA 4AILC 1RT5A 1R0AA 1C1CA 2YNGA 2ATQA 4BDYA 4W5OA 3K2PA 2WONA 3KK3A 3SV4A 1RT3A 3WNHA 4DU4A 1NK8A 3U6FA 4KRFA 3RR7A 4MFBA 4FLZA 3I0RA 3DLEA 3HM9A 4QOZB 1EP4A 3AVGA 1C1AA 4PA1A 4CIEA 1D9FA 3HO1A 3VQ9A 1TGOA 1LW0A 2BGGA 3KK1A 1IKYA 2Z1HA 4FLVA 3KKSA 1RNHA 1JLAA 3KKRA 3NAEA 1XWLA 4Z4GA 3LZJA 3NGYA 1L5UA 3K58A 4KTZA 2HVIA 3NH0A 4M3XA 1RILA 3NHGA 4DQIA 3B6PA 1KVAA 3AVFA 3NH2A 1NJZA 3IRXA 3C95A 3P83D 4RG8A 3D0PA 1X9WA 3PV8A 3K57A 4FXDA 1TL3A 1RT1A 4NCBA 1Q8IA 1IKXA 3OYNA 3M8SA 2FBTA 1CZBA 1REVA 4OGCA 4CEAA 2X78A 4F2RA 3DMJA 5J1EA 5JS2A 4B8CA 4HUFA 2P5GA 4CJ3A 1S6QA 2G8IA 4CF1A 5HROA 2HHSA 1WSJA 3ZT3A 3L2VA 4M3YA 4UQGA 1IKVA 2KZMA 4CE9A 1RT7A 2KQ2A 3VA0A 1B92A 1ZBUA 3HVTA 5FRNA 4RW9A 1C0MA 1HQEA 3T19A 5FROA 1T8EA 1G15A 3VQ7A 2JGUA 5C25A 2BDPA 3L3UA 4B9VA 4HUGA 4J2EA 2KZZA 1DTTA 4B9MA 4IFYA 2VG6A 3OYJA 1ZBIA 1W9HA 3DOKA 3F9KA 4CJKA 2PYLA 4Q0BA 5CYMA 3PUFA 1TV6A 4EP5A 4E7JA 3QLHA 1NOZA 1EETA 3ZSWA 1JXBA 4KB1A 4CJ4A 1I3AA 4E0DA 1IKWA 2VWKA 1NJYA 4DTOA 1TAQA 3DYAA 3OYKA 1B9DA 1XC9A 3LALA 4I2PA 2D0AA 4JRQA 3QINA 3THVA 1KCFA 5I42A 4B9NA 4FJ9A 1WSGA 5CZ2A 2X6NA 1UAXA 3NGIA 4DS4A 4DQPA 3VQBA 1ZBHA 3DLKA 4LH4A 3O3FA 1L3SA 3WNFA 2QXFA 4CEBA 4AH9A 2F96A 3MEGA 4OLBA 4CHNA 1B9FA 5CZ1A 1JXEA 3LAMA 1EKEA 2R7YA 4B3OA 3SQ0A 4HCBA 1VSIA 4LY7A 2BE2A 5HP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LWC A;  2JLE A;  2IAJ A;  4O55 A;  4C8M A;  4DFP A;  2W42 A;  4CHP A;  1KVC A;  4DQQ A;  4EZ6 A;  1JLF A;  3LAN A;  4DSE A;  1KRP A;  2Z1G A;  3L2Q A;  2DFF A;  3MAQ A;  3TR8 A;  3HVR A;  4DTN A;  3T3F A;  4DLG A;  1LV5 A;  4GW6 A;  3B6O A;  3FFI A;  4YFU A;  4ELV A;  2G8U A;  2QKB A;  1MU2 A;  1JKH A;  4LSL A;  5DK5 A;  3LDS A;  1KSP A;  3G0Z A;  4H4O A;  4CJR A;  1RCH A;  2OZM A;  4BAC A;  4AHC A;  2E4L A;  4FZZ A;  1VSL A;  2GBZ A;  3TAN A;  1T7P A;  4B9S A;  4DTR A;  1QSS A;  1JLB A;  1N5Y A;  1HMV A;  2YNI A;  3VQA A;  4E7I A;  3QEP A;  4CF2 A;  3D45 A;  3DRS A;  4KHW A;  1BL3 A;  2OPS A;  4NCG A;  5KGX A;  3H08 A;  3V1R A;  4CGG A;  4DFJ A;  1WSE A;  3QNO A;  3VQD A;  4B8A B;  1L3U A;  3LWL A;  4FM1 A;  3QES A;  4DQR A;  2ZQB A;  3QO9 A;  3CG7 A;  2KW4 A;  1U47 A;  1BIS A;  1CZ9 A;  1SL2 A;  1YTU A;  3OYC A;  4FJ8 A;  3SI6 A;  4HHT A;  3U3Y A;  4HCC A;  2P5O A;  1KFD A;  4FLW A;  1F21 A;  4IBN A;  1WSI A;  4KAZ A;  3K5M A;  3QEV A;  1TL1 A;  3ZSX A;  1S1X A;  1FXX A;  4YNQ A;  5J2N A;  4M3R A;  2YV0 X;  4CIF A;  3E01 A;  3WNG A;  1BI4 A;  4DSF A;  1NK5 A;  4FK0 A;  2PY5 A;  4CFB A;  1RT2 A;  3I8D A;  1S5J A;  3MXI A;  3L2R A;  2B4J A;  5J2P A;  3AVJ A;  2HMI A;  1CLQ A;  5E41 A;  4OPK A;  2DFE A;  5FRM A;  3T1A A;  4J2D A;  3VQ8 A;  4E19 A;  2G8K A;  1FKP A;  4L8R B;  1L3T A;  1L3V A;  1Q9X A;  5I3U A;  4CFA A;  4DLE A;  4CEO A;  1NJX A;  4KTW A;  3QEI A;  4Z4E A;  4H4M A;  4AHR A;  1TKX A;  1UWB A;  4JS4 A;  4CHY A;  4W5R A;  1SL0 A;  3SJJ A;  2OA8 A;  2GUI A;  3ZT2 A;  3F73 A;  4DSJ A;  4KI4 A;  4PQU A;  3QER A;  2XRI A;  3IAY A;  4M3U A;  4M3Z A;  2QKK A;  4Y1C A;  1JLC A;  1S1W A;  2D5R A;  4F4K A;  4FJL A;  2AJQ A;  4F3O A;  3AVN A;  1QE1 A;  3O4Q A;  3SPZ A;  1TKD A;  3QIO A;  3L8B A;  4KHQ A;  1RTI A;  3V6D A;  3PO4 A;  4FYD A;  1TKZ A;  3HPH A;  4AHS A;  1GOB A;  3K5N A;  1XHX A;  4HUE A;  4RW4 A;  3HP6 A;  3DI6 A;  4KB0 A;  2XY5 A;  1VRU A;  2OZS A;  3SUP A;  3OYB A;  3LP2 A;  3V1Q A;  4CJQ A;  4C8L A;  4LH5 A;  4CJL A;  1RT6 A;  4DTP A;  5KTQ A;  1RBV A;  3JSM A;  3VA3 A;  4DMN A;  1HYZ A;  2E6L A;  3RRH A;  3A2F A;  3VQE A;  4CEQ A;  2YHA A;  3NFA A;  4O44 A;  4OPJ A;  1T05 A;  4C8O A;  1QHT A;  3OS2 A;  3KK2 A;  4O5B A;  1JLQ A;  3RR8 A;  3TAR A;  1S1T A;  3LP3 A;  3L3V A;  2I5J A;  4E89 A;  1VSK A;  3SZ2 A;  2G8W A;  1FK9 A;  4ZHR A;  3QNN A;  4XIU A;  1NKC A;  2B5J A;  5DMR A;  1GOA A;  2BAN A;  1J53 A;  4IG3 A;  3LWM A;  3AVM A;  3CQ8 A;  3TAE A;  4OGE A;  2HHW A;  3AV9 A;  5SWM A;  3AA2 A;  3M8Q A;  3HK2 A;  2B6A A;  2HNZ A;  1D5A A;  4FM0 A;  2X6S A;  4CJP A;  2PYJ A;  4FJG A;  2IGI A;  1FKO A;  3LAK A;  5D3G A;  1SL1 A;  1BIU A;  3JYT A;  3WNE A;  2RN2 A;  4FJK A;  1TAU A;  2D0C A;  3U3G A;  3CM5 A;  1Q9Y A;  1KLN A;  2P1J A;  4FW1 A;  4W5Q A;  1JL2 A;  4IG0 A;  1VSM A;  3M8P A;  1TVR A;  1RDA A;  4DTU A;  4FLT A;  3ULD A;  1UA1 A;  1YTA A;  4IFV A;  1T03 A;  3OYF A;  4CFD A;  1DTQ A;  4EP4 A;  1NK9 A;  5J2M A;  4H8K A;  1KTQ A;  4KTQ A;  4JRP A;  1VRT A;  4MQ3 A;  3HST B;  1SV5 A;  4FJX A;  3QEX A;  4Z4C A;  3KLG A;  3NGZ A;  3KLI A;  1TK5 A;  3NF7 A;  3TAM A;  1ZYQ A;  2HNY A;  1HPZ A;  2WOM A;  4M45 A;  3RMB A;  4GVM A;  3AVL A;  4CEC A;  4FLY A;  3V9S A;  1IH7 A;  3L2W A;  4BE1 A;  4CHZ A;  1RBT A;  1J54 A;  4OKK A;  3K59 A;  3SPY A;  1S1U A;  3V1O A;  2VWJ A;  1EXQ A;  4DWI A;  3AO3 A;  4E3S A;  4PUO A;  2OYQ A;  4N41 A;  4ID1 A;  3I0S A;  4J2B A;  2HVH A;  4I7F A;  1QS4 A;  1WN7 A;  4CJF A;  3S9H A;  3HPO A;  3OJU A;  2ZD1 A;  1RTJ A;  3ZCM A;  2HHT A;  3HT3 A;  4E7H A;  4I9L A;  4C8N A;  1RDC A;  3DLR A;  4BWJ A;  4WE1 A;  4FZX C;  3PX0 A;  3CFR A;  3RWU A;  4PWD A;  3AO2 A;  3ZSO A;  3O3G A;  1RTH A;  3S3M A;  2HHQ A;  4CFC A;  2YKN A;  3RMC A;  1LW2 A;  2GV9 A;  3MEE A;  3AVB A;  3AO5 A;  1NKE A;  1ZBL A;  1TK0 A;  4B08 A;  4HVJ A;  4CHQ A;  3DM2 A;  3EZ5 A;  3RRG A;  1J9A A;  3QIP A;  3RMD A;  4FJN A;  2Y1J A;  3PX4 A;  4Q5V A;  2KFZ A;  4CIG A;  1X9S A;  3SQ1 A;  3AVC A;  1RBS A;  2ETJ A;  2FBX A;  4CGJ A;  4AHV A;  4CER A;  4CJV A;  3SUO A;  4B9T A;  1LWE A;  2OPP A;  3UIQ A;  1SKS A;  4KPY A;  1VSH A;  1Z26 A;  3TAG A;  4KV8 A;  1QTM A;  1U48 A;  2HW3 A;  4FK2 A;  4LD0 A;  3ZT4 A;  2ITG A;  2PZS A;  4RW6 A;  5C42 A;  3NF9 A;  2Y1I A;  4I9Q A;  4Z4H A;  5HRP A;  4DSI A;  3ZSV A;  4HTU A;  4ELU A;  2HHU A;  1D8Y A;  3V9Z A;  2VG7 A;  1CXQ A;  4TSX A;  3ITH A;  1RT4 A;  3SNN A;  1RDD A;  2F8T A;  4AHU A;  4FJ5 A;  3V9W A;  1EX4 A;  4CCH A;  4IKF A;  4K8Z A;  4BE2 A;  2X74 A;  4N47 A;  1WAF A;  2FBY A;  2ZE2 A;  1BGX T;  3G10 A;  3AO1 A;  2OPQ A;  3TI0 A;  4O0I A;  4KHU A;  3OS1 A;  4CF9 A;  2A1R A;  4F3T A;  4OKE A;  1VSE A;  3M8R A;  3CM6 A;  4DU3 A;  3EY1 A;  1BCM A;  1A5V A;  3AO4 A;  4Z0U A;  1JL1 A;  1HNV A;  5FDL A;  1QSL A;  4OLA A;  3K5L A;  4KRE A;  1D9D A;  1KVB A;  4G1Q A;  4IDK A;  4DG1 A;  3KLF A;  4FW2 A;  3KLH A;  3SUN A;  4FVM A;  5CY4 A;  1BQN A;  4Y1D A;  4ICL A;  3K5O A;  4CGD A;  2KFN A;  1WLJ A;  3LP1 A;  3NF6 A;  1O1W A;  1QQC A;  1C0T A;  3CFP A;  3TAQ A;  1RDB A;  3KD5 E;  3VQ6 A;  3OYM A;  2YNH A;  2O4G A;  1ASW A;  2A1S A;  1Y97 A;  1W0H A;  3DRR A;  3PX6 A;  2RF2 A;  1N6Q A;  5J2Q A;  5KI6 A;  5C24 A;  4DFM A;  4FLX A;  4FK4 A;  3TAB A;  1XI1 A;  4DTM A;  2QK9 A;  3HJF A;  3QEW A;  2Q3S A;  3AA3 A;  4CGH A;  3PY8 A;  1NK6 A;  4M41 A;  4JS5 A;  3ZSZ A;  4CJW A;  4DS5 A;  1HQU A;  3MED A;  1S1V A;  5CYQ A;  4FZY A;  2E6M A;  4O4G A;  1NK7 A;  3NCI A;  4FJM A;  4DTS A;  1HRH A;  3LPT A;  5HLF A;  1RTD A;  4RW7 A;  4NYF A;  3AVI A;  3HXM A;  1UOC A;  4Z4F A;  2YNF A;  1KFS A;  4NCA A;  4N56 A;  5HBM A;  3C94 A;  1U4B A;  1HJR A;  4I2Q A;  3ZSR A;  3CYM A;  4BWM A;  4CGF A;  3TAF A;  4CES A;  4KI6 A;  5JS1 A;  4GMJ B;  4RW8 A;  3ALY A;  1NK0 A;  4M42 A;  3OS0 A;  4OJR A;  1K6Y A;  1U45 A;  4QCL A;  2DFH A;  3P1G A;  4E7K A;  3LP0 A;  1RBU A;  1HYV A;  1C1B A;  4EZ9 A;  3PO5 A;  1X9M A;  2Z1J A;  1WSF A;  4E7L A;  2HHX A;  3LPU A;  1U49 A;  1JLE A;  2XHB A;  3VQP A;  3LZI A;  3AVH A;  3NDK A;  4CJU A;  1TK8 A;  1ITG A;  4DF8 A;  2IOC A;  2DTU A;  1A5W A;  3BGR A;  3OYA A;  3OVN A;  4CEF A;  1SKR A;  1BIZ A;  5HRN A;  4CF0 A;  4CJE A;  4O0J A;  1ASU A;  1YT3 A;  4QAG A;  3ASM A;  1S9G A;  1RBR A;  4DF4 A;  2DY4 A;  1IO2 A;  3OYE A;  3O3H A;  3OYI A;  3OY9 A;  3TAP A;  4DTX A;  4KHS A;  2Z1I A;  4E1N A;  5SZT A;  3V4I A;  3HL8 A;  5HRS A;  4CED A;  3NH1 A;  2IC3 A;  3IS9 A;  1ASV A;  3EYZ A;  4DTJ A;  4DFK A;  1WNS A;  3V9X A;  1A5X A;  4Z4I A;  1I39 A;  4DSL A;  3RMA A;  4CK1 A;  4PY5 A;  3DLH A;  5HRR A;  3ZSY A;  1XHZ A;  1S6P A;  4BDP A;  2EX3 A;  4KHY A;  2O4I A;  5KRS A;  4DSK A;  3NE6 A;  1LWF A;  1BHL A;  3AVA A;  4W5T A;  4ID5 A;  2EHG A;  3KIO A;  3HP9 A;  4BE0 A;  3V81 A;  3BDP A;  4CEE A;  2VG5 A;  2FC0 A;  1NK4 A;  4F2S A;  5T7B A;  3KLE A;  3KD1 E;  3AVK A;  1WSH A;  2RPI A;  4CJS A;  3OYH A;  1HYS A;  4ELT A;  3V9U A;  3VQC A;  3MXM A;  1S9E A;  3IG1 A;  4KO0 A;  4OKJ A;  3SV3 A;  1QSY A;  2IDO A;  1BCO A;  1VSF A;  2YHB A;  1U04 A;  4KFB A;  3L2U A;  3S3N A;  1X1P A;  1BQM A;  4JLH A;  3SYZ A;  3VQ4 A;  4N76 A;  4BDZ A;  4FJH A;  4F8R A;  4CK2 A;  4DQS A;  4KHN A;  4W5N A;  1C0U A;  3AA5 X;  4FLU A;  3DLB A;  3NBP A;  3QET A;  2RKI A;  1YVU A;  1NOY A;  3VQQ A;  1WAJ A;  3AA4 A;  1DLO A;  3CFO A;  4CEZ A;  4E1M A;  3C6U A;  2HND A;  4LSN A;  1NKB A;  1UA0 A;  4J2A A;  4M3T A;  4B9U A;  1GOC A;  1Z25 A;  2LSN A;  1CXU A;  4ZTJ A;  4M3W A;  2F8S A;  3C6T A;  3MXJ A;  2G8V A;  3OYG A;  4CHO A;  1SUQ A;  3MEC A;  2XY8 A;  5K14 A;  1VSJ A;  4CK3 A;  2XY6 A;  3S3O A;  1IG9 A;  2G8H A;  3VQ5 A;  3HPG A;  5EU7 A;  3OJS A;  1SKW A;  4ZTF A;  3ISN C;  2XY7 A;  4CJT A;  1VSD A;  4KKO A;  3SCX A;  4B9L A;  4K8X A;  4FM2 A;  3TWH A;  1KLM A;  1VK0 A;  1NJW A;  4FJJ A;  5KGW A;  3SQ2 A;  1BI4 B;  3P5J A;  3HYF A;  1HNI A;  1TKT A;  1LAV A;  2NUB A;  3ZT1 A;  3OYD A;  3NF8 A;  4OVL A;  3VN5 A;  2IS3 A;  4NYN A;  1ZBF A;  2HB5 A;  1LAW A;  2FBV A;  3ZT0 A;  2XO7 A;  2G8F A;  4FJI A;  4DU1 A;  1JLG A;  4FJ7 A;  4AHT A;  2OPR A;  3O4N A;  3DLG A;  3DRP A;  4CGI A;  2KTQ A;  3SUQ A;  4CF8 A;  4R5P A;  3ZSQ A;  3RTV A;  2HHV A;  1C6V A;  3KJV A;  4FCY A;  1J5O A;  4C8K A;  2D0B A;  4N5S A;  3OYL A;  5KRT A;  3SQ4 A;  3KTQ A;  2P51 A;  3DOL A;  4CJ5 A;  2YKM A;  4AIL C;  1RT5 A;  1R0A A;  1C1C A;  2YNG A;  2ATQ A;  4BDY A;  4W5O A;  3K2P A;  2WON A;  3KK3 A;  3SV4 A;  1RT3 A;  3WNH A;  4DU4 A;  1NK8 A;  3U6F A;  4KRF A;  3RR7 A;  4MFB A;  4FLZ A;  3I0R A;  3DLE A;  3HM9 A;  4QOZ B;  1EP4 A;  3AVG A;  1C1A A;  4PA1 A;  4CIE A;  1D9F A;  3HO1 A;  3VQ9 A;  1TGO A;  1LW0 A;  2BGG A;  3KK1 A;  1IKY A;  2Z1H A;  4FLV A;  3KKS A;  1RNH A;  1JLA A;  3KKR A;  3NAE A;  1XWL A;  4Z4G A;  3LZJ A;  3NGY A;  1L5U A;  3K58 A;  4KTZ A;  2HVI A;  3NH0 A;  4M3X A;  1RIL A;  3NHG A;  4DQI A;  3B6P A;  1KVA A;  3AVF A;  3NH2 A;  1NJZ A;  3IRX A;  3C95 A;  3P83 D;  4RG8 A;  3D0P A;  1X9W A;  3PV8 A;  3K57 A;  4FXD A;  1TL3 A;  1RT1 A;  4NCB A;  1Q8I A;  1IKX A;  3OYN A;  3M8S A;  2FBT A;  1CZB A;  1REV A;  4OGC A;  4CEA A;  2X78 A;  4F2R A;  3DMJ A;  5J1E A;  5JS2 A;  4B8C A;  4HUF A;  2P5G A;  4CJ3 A;  1S6Q A;  2G8I A;  4CF1 A;  5HRO A;  2HHS A;  1WSJ A;  3ZT3 A;  3L2V A;  4M3Y A;  4UQG A;  1IKV A;  2KZM A;  4CE9 A;  1RT7 A;  2KQ2 A;  3VA0 A;  1B92 A;  1ZBU A;  3HVT A;  5FRN A;  4RW9 A;  1C0M A;  1HQE A;  3T19 A;  5FRO A;  1T8E A;  1G15 A;  3VQ7 A;  2JGU A;  5C25 A;  2BDP A;  3L3U A;  4B9V A;  4HUG A;  4J2E A;  2KZZ A;  1DTT A;  4B9M A;  4IFY A;  2VG6 A;  3OYJ A;  1ZBI A;  1W9H A;  3DOK A;  3F9K A;  4CJK A;  2PYL A;  4Q0B A;  5CYM A;  3PUF A;  1TV6 A;  4EP5 A;  4E7J A;  3QLH A;  1NOZ A;  1EET A;  3ZSW A;  1JXB A;  4KB1 A;  4CJ4 A;  1I3A A;  4E0D A;  1IKW A;  2VWK A;  1NJY A;  4DTO A;  1TAQ A;  3DYA A;  3OYK A;  1B9D A;  1XC9 A;  3LAL A;  4I2P A;  2D0A A;  4JRQ A;  3QIN A;  3THV A;  1KCF A;  5I42 A;  4B9N A;  4FJ9 A;  1WSG A;  5CZ2 A;  2X6N A;  1UAX A;  3NGI A;  4DS4 A;  4DQP A;  3VQB A;  1ZBH A;  3DLK A;  4LH4 A;  3O3F A;  1L3S A;  3WNF A;  2QXF A;  4CEB A;  4AH9 A;  2F96 A;  3MEG A;  4OLB A;  4CHN A;  1B9F A;  5CZ1 A;  1JXE A;  3LAM A;  1EKE A;  2R7Y A;  4B3O A;  3SQ0 A;  4HCB A;  1VSI A;  4LY7 A;  2BE2 A;  5HP1 A; 
#chains in the Genus database with same CATH topology
 4FWL A;  1KVC A;  1JLF A;  3EZW A;  4CJ7 A;  1NJI O;  2Z1G A;  3L2Q A;  3ZEU B;  3MAQ A;  2P9U A;  1NGI A;  2FSN A;  4JKA A;  3GBT A;  4DLG A;  3Q7C A;  3MCP A;  1LV5 A;  3B6O A;  3FFI A;  5GIN A;  4ELV A;  3BZC A;  2QKB A;  3P38 A;  2V52 B;  4H4O A;  4CJR A;  3MN6 A;  3TAN A;  1T7P A;  3NVK A;  1EWQ A;  3V1R A;  3EL2 A;  4CGG A;  1NGE A;  4QS8 A;  5LMN K;  5AZJ B;  4JD2 A;  3THX A;  4M7X A;  1H1V A;  5F0X A;  5HOO A;  3CF5 L;  3VPZ A;  2KW4 A;  3BZK A;  1BIS A;  1YF5 L;  2NRW A;  3J81 O;  4B1Y B;  3EEQ A;  3SI6 A;  3U3Y A;  4H0Y B;  1F21 A;  3QEV A;  5LL6 Z;  5A2Q O;  2BUP A;  3WNG A;  5C10 A;  3FZH A;  4DSF A;  2PY5 A;  1X3N A;  3L2R A;  5J2P A;  2ZJP L;  4DR7 K;  5AQL A;  2CGL A;  2QW9 A;  3VQ8 A;  1L3T A;  2OTJ N;  3Q7B A;  1MWK A;  5ADX A;  3QEI A;  4H4M A;  1P90 A;  2QM1 A;  4M3U A;  1EQY A;  1S1W A;  3F2K A;  2P9N B;  1QE1 A;  3SPZ A;  4KHQ A;  3ENH A;  1TUU A;  3PO4 A;  4V19 S;  1GOB A;  1XHX A;  3DI6 A;  3FZF A;  1VQ7 N;  4KB0 A;  1VRU A;  2OZS A;  4FPB A;  3LP2 A;  4LH5 A;  4DMN A;  2YCH A;  3A2F A;  4OPJ A;  1T05 A;  2YHA A;  3O9U A;  5M1Q A;  1JLQ A;  2B5J A;  1GOA A;  4OGE A;  1C0F A;  1JCF A;  2FF3 B;  5AJ3 K;  4YOT A;  5TKW A;  5SWM A;  4FM0 A;  2PYJ A;  1D5A A;  5FPD A;  4IWV A;  4GV6 A;  1SL1 A;  2GUP A;  1RDW X;  3MDQ A;  1U2V B;  3K0S A;  2D0C A;  1HJO A;  2P1J A;  4FW1 A;  4I6M B;  1N34 K;  4FK4 A;  4FLT A;  1R59 O;  3HI0 A;  4H8K A;  1KTQ A;  4KTQ A;  2FSJ A;  3HST B;  1BG3 A;  3NF7 A;  1ZYQ A;  4IJA A;  3RMB A;  4GVM A;  4A5B A;  2E20 A;  4OKK A;  4WF9 L;  3SPY A;  4BQZ A;  1OH6 A;  3CC7 N;  4DWI A;  3AO3 A;  4PUO A;  5AQF A;  2ASM A;  3W3D A;  1WN7 A;  3OJU A;  3CCR N;  1RTJ A;  3KHY A;  4E7H A;  3DLR A;  4WE1 A;  4DV2 K;  3PX0 A;  2E1Z A;  4PWD A;  4LFC K;  1OH8 A;  4OO1 J;  3CIP A;  4CFC A;  4BG8 A;  4LF6 K;  1LW2 A;  3RRG A;  1I94 K;  3QIP A;  3D7E O;  4JD2 B;  1IBK K;  1GLL O;  2KFZ A;  3ID6 A;  1OH7 A;  3SQ1 A;  3OBW A;  3PLA A;  3AVC A;  1RBS A;  4CGJ A;  4JI8 K;  2CH6 A;  3OBY A;  4AHV A;  1LWE A;  2OPP A;  5BPL A;  1VSH A;  1Z26 A;  2VGN A;  2HW3 A;  5ELZ A;  4LD0 A;  2CGJ A;  1V4S A;  4RW6 A;  5C42 A;  4I9Q A;  4DSI A;  4JI4 K;  3ZET A;  1NGH A;  3V9Z A;  4TSX A;  3LDL A;  4BE2 A;  4IEI A;  3TI0 A;  2OPQ A;  3R6M A;  3CC2 N;  2BTF A;  1VSE A;  4BR7 A;  2ITM A;  4DU3 A;  4IXC A;  4Z0U A;  1HNV A;  1D9D A;  2O8B A;  4A5A A;  3KLH A;  3B8A X;  3CCE N;  3CI5 A;  4O8U A;  3K5O A;  3NF6 A;  1BA0 A;  3F5T A;  3CFP A;  3TAQ A;  3KD5 E;  3VQ6 A;  2O4G A;  4LF7 K;  1Y97 A;  3CD6 N;  4BRQ A;  1W0H A;  5JVH L;  5GIO A;  3AA3 A;  4CGH A;  3PY8 A;  4M41 A;  3CJC A;  1HQU A;  4KH5 A;  4JI6 K;  3DXM A;  4O4G A;  1NK7 A;  4DTS A;  1HRH A;  3CXC M;  4BR5 A;  1UOC A;  1EWR A;  4N56 A;  3VOV A;  1OKJ A;  4CZH A;  1U4B A;  1HJR A;  1P8Z A;  4B3M K;  3CYM A;  4DB3 A;  4CGF A;  2W6L A;  2Q0R A;  1MWM A;  4GMJ B;  2NZT A;  4LC9 B;  3ZYY X;  5FLX O;  2W6K A;  2WTU A;  1NGG A;  4JKD A;  2DFH A;  3CJA A;  1RBU A;  3GDQ A;  3L4Q A;  2HHX A;  4RCH A;  3LZI A;  3RSE A;  4FWR A;  1VQ5 N;  1K8K A;  2DTU A;  1A5W A;  1KAY A;  2ZWH A;  2F9T A;  4CJE A;  2QWR A;  1YT3 A;  2QWM A;  1YJN N;  3KVG A;  3U8X A;  3VEY A;  2P9L A;  3O3H A;  3OYI A;  5AQY A;  4E1N A;  5SZT A;  3NH1 A;  1E4G T;  2IC3 A;  1WNS A;  4PY5 A;  1A5X A;  3VF6 A;  2GEM A;  4H0O A;  1CZA N;  3ZSY A;  1HNX K;  4DSK A;  1LWF A;  2EHG A;  3KIO A;  3HP9 A;  3V81 A;  3BDP A;  5T7B A;  4CJS A;  4ELT A;  3V9U A;  4FWM A;  3TTC A;  2PAV A;  1U04 A;  3H6E A;  3H45 C;  1BUP A;  1X1P A;  3F9M A;  4WQ5 C;  4U7B A;  3SLC A;  3QET A;  2RKI A;  1YVU A;  3VQQ A;  1WAJ A;  3KZB A;  4Z94 A;  3C6U A;  1UA0 A;  2LSN A;  4DR5 K;  3C6T A;  3MXJ A;  2G8V A;  3A0I X;  3I33 A;  2E2Q A;  4YOX A;  3MEC A;  2XY8 A;  2XY6 A;  3RR7 A;  4CK3 A;  4A61 A;  3ZET B;  4B3T K;  3OJS A;  4KH4 A;  3SCX A;  2XY7 A;  4B9L A;  1VSD A;  4KKO A;  4K8X A;  3TWH A;  3SQ2 A;  1BI4 B;  3HYF A;  1T44 A;  2GWK A;  2NUB A;  3ZT1 A;  3VN5 A;  2IVN A;  5KQD A;  5LJW A;  4DU1 A;  1W2B M;  5LJV A;  1JLG A;  1O13 A;  1N33 K;  2CH5 A;  3DLG A;  4HWI A;  1NG9 A;  2GX9 A;  4CGI A;  4CF8 A;  3ZSQ A;  2HHV A;  1C6V A;  3EE9 A;  3SQ4 A;  3L6Q A;  3CCJ N;  1C1C A;  2YNG A;  4LF9 K;  4YOY A;  2AA4 A;  1T6C A;  3I0R A;  1HKB A;  4DKW A;  4PA1 A;  2JWK A;  1D9F A;  2HMP A;  1TUY A;  1LW0 A;  1IKY A;  3NAE A;  1XWL A;  2YJE A;  5EY4 A;  3NH0 A;  5AQU A;  1NJZ A;  2KLA A;  4RG8 A;  3K57 A;  1QHA A;  1ATN A;  4YY3 K;  2FBT A;  4OGC A;  5CHI A;  5J1E A;  5JS2 A;  4JK8 A;  5HRO A;  3RSE B;  1K8K B;  4UQG A;  2KZM A;  4CE9 A;  2NRR A;  3HVT A;  5FRN A;  1T8E A;  2BDP A;  3O5B A;  3VQ7 A;  4B9V A;  2KZZ A;  3L3U A;  4KH6 A;  4HUG A;  1NWK A;  4NLB A;  2GTD A;  3OYJ A;  3HSC A;  1ZBI A;  1W9H A;  5CYM A;  3LDP A;  4LFA K;  3IDH A;  3ZSW A;  4KB1 A;  1RGI A;  4CJ4 A;  1IKW A;  1NJY A;  3OA9 A;  4DTO A;  1VHX A;  4CD1 A;  3DXK A;  5KPT A;  5DM6 L;  5AQH A;  1RFQ A;  1XC9 A;  3LAL A;  4I2P A;  2O8F A;  1WSG A;  1ZBH A;  1Q81 O;  4LFB K;  4X64 K;  3O3F A;  1L3S A;  4FO0 A;  3D2E B;  3J7Y P;  1Y64 A;  2PBD A;  3LAM A;  4B3O A;  1VQ8 N;  1VSI A;  5M1K A;  2UUA K;  4OVL A;  2BE2 A;  1LWC A;  2JLE A;  4O55 A;  3E9L A;  1QZ6 A;  4C8M A;  4DFP A;  2W42 A;  1NU0 A;  2V7Z A;  4BR2 A;  3VEZ A;  2DFF A;  3TR8 A;  1YHQ N;  5AQG A;  4DTN A;  5M1F A;  2I7N A;  4DV6 K;  4GW6 A;  2G8U A;  3EKU A;  4JAX A;  3R9P A;  4ISE A;  5DK5 A;  3HTV A;  3LDS A;  3OHR A;  4CBX A;  4B9S A;  1Z05 A;  4FL9 A;  1QSS A;  1N5Y A;  4E7I A;  4JKC A;  1ATS A;  1SZ2 A;  4NCG A;  4BRO A;  2QWP A;  1G99 A;  3EO3 A;  4DFJ A;  3QNO A;  3VQD A;  5M1N A;  3LWL A;  4DQR A;  4IFE A;  1HPM A;  3M5R A;  4WCE L;  3TSP A;  1CZ9 A;  1YTU A;  3H46 O;  4HHT A;  1GLA G;  1KAZ A;  1VQN N;  4IBN A;  1WSI A;  1FXX A;  2HST A;  3I56 N;  4CW7 B;  4CIF A;  4FK0 A;  4MLH A;  3RVC A;  3I8D A;  5TKY A;  4BRK A;  1XC3 A;  2B4J A;  4GVE A;  3O1W A;  4CZJ A;  4FVU A;  5E41 A;  4IO8 A;  4OPK A;  3UKR A;  5FRM A;  3T1A A;  4YOW A;  4J2D A;  3A5N C;  1L3V A;  4EHU A;  1NJX A;  4G9Z A;  5AQN A;  4Z4E A;  1TKX A;  1UWB A;  5C2F A;  4DSJ A;  2GUI A;  4PQU A;  3IAY A;  4M3Z A;  1JLC A;  3SAF A;  2D5R A;  4FJL A;  4WFN L;  3O4Q A;  4MDB A;  2Q1N A;  4QS7 A;  1TKZ A;  4O5F A;  1QVG M;  4RW4 A;  2XY5 A;  3MK6 A;  3R8E A;  3SUP A;  3KWI A;  5I9E B;  5C0Y A;  5KTQ A;  5E26 A;  3QML A;  4CEQ A;  5BRE A;  4C8O A;  2IVP A;  1S1T A;  3LP3 A;  3L3V A;  3SZ2 A;  1VSK A;  1FK9 A;  4ZHR A;  2GEL A;  3QNN A;  3C0B A;  5DMR A;  4YOU A;  3LWM A;  1K8A O;  3VET A;  2HHW A;  3UKU B;  3ZX3 A;  2QXL A;  3M8Q A;  2B6A A;  2X6S A;  4CJP A;  3LAK A;  1VAZ A;  1BIU A;  1ESV A;  3PSF A;  4F2S A;  1Q9Y A;  1JL2 A;  1IJJ A;  3M8P A;  1UA1 A;  1NMN A;  1T03 A;  4CFD A;  1DTQ A;  4EP4 A;  1NK9 A;  1VRT A;  4MQ3 A;  1SV5 A;  3QEX A;  3AAR A;  3KLI A;  1LCU A;  4M45 A;  1KAX A;  4CEC A;  3V9S A;  4BE1 A;  3L2W A;  4CHZ A;  1RBT A;  3O80 A;  2O8E B;  3K59 A;  1VQP N;  4E3S A;  4N41 A;  3N4P A;  1KXP A;  1NGB A;  2Q97 A;  4CJF A;  3S9H A;  3HPO A;  2ZD1 A;  4ILH A;  4DCH A;  3HT3 A;  4C8N A;  1RDC A;  4BWJ A;  2ZGZ A;  3CFR A;  3RWU A;  3FE1 A;  4HTL A;  3FR0 A;  4H0V B;  3AVB A;  5AQZ A;  3LM2 A;  4Q5V A;  3WXI A;  4X66 K;  2FBX A;  4CER A;  3SUO A;  4KPY A;  2Q0U A;  3TAG A;  1QQM A;  4FK2 A;  4M7Y A;  5JVG L;  4Z4H A;  2HHU A;  2VG7 A;  1RT4 A;  1J5E K;  3MN9 A;  3T1H K;  3P31 A;  4FJ5 A;  4ISG A;  2ZM6 K;  2ZE2 A;  1BGX T;  2UXB K;  4X65 K;  4CF9 A;  2A1R A;  4A59 A;  3M8R A;  3EY1 A;  1BCM A;  1A5V A;  1JL1 A;  3HM8 A;  2F4V K;  2A42 A;  3LDN A;  1FW6 A;  4H0T B;  4G1Q A;  4IDK A;  3KLF A;  3SUN A;  3HOS A;  3P4I A;  4CGD A;  1WLJ A;  3LP1 A;  3OYM A;  1ASW A;  4BY9 C;  3VEN A;  3K9J A;  2CGK A;  2RF2 A;  4DTM A;  2QK9 A;  3HJF A;  5AQM A;  2NLX A;  4BRH A;  2Q3S A;  2P9K A;  1NK6 A;  2IVO A;  1YXQ A;  3AY9 A;  4CJW A;  4DS5 A;  5CYQ A;  1YJ9 N;  4OPA A;  4RW7 A;  4NYF A;  5BR8 K;  3FZK A;  2YNF A;  3ULE A;  5HBM A;  4I2Q A;  2D4W A;  1IBL K;  4BWM A;  4CES A;  2NNW A;  1D4X A;  1NGJ A;  2IIR A;  3ALY A;  4OJR A;  1U45 A;  4E7K A;  2YHW A;  3K9K A;  4AM6 A;  3TPQ A;  1X9M A;  3PO5 A;  1WSF A;  1T3V A;  3LPU A;  2DPN A;  1TK8 A;  3IMX A;  4DF8 A;  3OVN A;  5AQQ A;  4BRM A;  4O0J A;  4QAG A;  1OH5 A;  3OW2 M;  2FXU A;  1IO2 A;  3HZ6 A;  4BRE A;  3J8A A;  4DTX A;  2Z1I A;  2V51 B;  2E8A A;  4CED A;  4DTJ A;  4DFK A;  3V9X A;  3DLH A;  5HRR A;  4KHY A;  2P9U B;  5JLF A;  5KRS A;  1GLE G;  4W5T A;  4ID5 A;  4C23 A;  4BE0 A;  4CEE A;  2FC0 A;  1NK4 A;  1JJ2 M;  2VQF K;  2RPI A;  4JI2 K;  4J8F A;  4OKJ A;  3WXK A;  5ADX H;  3SV3 A;  1QSY A;  2IDO A;  1BCO A;  4FWO A;  2VCP A;  4BRL A;  4NXM K;  4DR1 K;  3SYZ A;  3OTO K;  4B1W B;  4FJH A;  4CK2 A;  3EKS A;  1C0U A;  3DLB A;  4JKE A;  3THX B;  4OX9 K;  4YDU A;  4CEZ A;  3HOT A;  2HND A;  3CER A;  3MMV A;  4M3T A;  1GOC A;  1DKG D;  3P39 A;  3U9D A;  1XMQ K;  5H1S Q;  3BF1 A;  5M1O A;  5K14 A;  1VSJ A;  4EIA A;  3SAH A;  2NRT A;  4YOR A;  5EU7 A;  3VQ5 A;  3WT0 A;  3GG4 A;  3IKM A;  1SKW A;  3FGU A;  1KLM A;  5KGW A;  3DWL A;  5M1P A;  2HOE A;  3QFU A;  1QQN A;  1ZBF A;  2HB5 A;  1LAW A;  2QI2 A;  5EXW A;  4AQY K;  4FJ7 A;  3DRP A;  2KTQ A;  3SUQ A;  4R5P A;  1J5O A;  5AZI A;  4C8K A;  2D0B A;  2Q2R A;  2P51 A;  2YKM A;  1RT5 A;  2NRZ A;  4BDY A;  3KK3 A;  2WON A;  1RT3 A;  4DU4 A;  3U6F A;  2VGM A;  2ZF5 O;  3HM9 A;  4BC4 A;  2D1K A;  1TGO A;  3ULE B;  3KKS A;  1JLA A;  4Z4G A;  3LZJ A;  4BGA A;  1L5U A;  3K58 A;  2HVI A;  4IO9 L;  1RIL A;  3NHG A;  4DQI A;  1KC8 O;  3NH2 A;  5JLH A;  3C95 A;  3P83 D;  4DV0 K;  2NRV A;  4FXD A;  1RT1 A;  5EOY A;  1CZB A;  2X78 A;  4F2R A;  5IWA K;  3M6G A;  4CJ3 A;  4CF1 A;  4FWQ A;  4M3Y A;  3WXL A;  1IKV A;  4CZF A;  3DLL L;  1B92 A;  1ZBU A;  3O6W A;  4RW9 A;  5FRO A;  3T19 A;  1MA9 B;  2JGU A;  4J2E A;  5FPE A;  3THW A;  1DTT A;  4IFY A;  2VG6 A;  3DOK A;  3PUF A;  4E7J A;  1HX1 A;  1EET A;  3THY A;  1YIJ N;  4E0D A;  2QEX N;  2VWK A;  4BR9 A;  1DEJ A;  1W7A A;  3MWP A;  1SS6 A;  2D0A A;  3QIN A;  4FJ9 A;  4Y0W A;  5CZ2 A;  2X6N A;  4AF1 A;  4DS4 A;  3SAG A;  3WNF A;  5LMU K;  4AH9 A;  1NLV A;  1B9F A;  4WFB L;  1GLD G;  2A41 A;  3SQ0 A;  4HCB A;  4JK7 A;  2HF3 A;  4LY7 A;  3KLG A;  2IAJ A;  4GKK K;  2P9P A;  4CHP A;  4EZ6 A;  4JKG A;  3E9P A;  3E1Y A;  4DSE A;  1KRP A;  3VTH A;  3MCA B;  3HVR A;  5GAE P;  1MU2 A;  1XUP O;  1KSP A;  3G0Z A;  4BVO A;  2OZM A;  4FZZ A;  4AHC A;  5AQV A;  2GBZ A;  4M63 C;  4LF8 K;  1JLB A;  4JNE A;  3GOI A;  2YNI A;  3VQA A;  3O4W A;  1TYQ A;  4CF2 A;  3D45 A;  3DRS A;  4EHT A;  3DJC A;  4JYA K;  4KHW A;  4XEI A;  1YUW A;  3H08 A;  5KGX A;  1S72 N;  1WSE A;  5AQJ A;  4B8A B;  3I55 N;  1X3M A;  4EFH A;  2OAN A;  4FM1 A;  3QES A;  2ZQB A;  1WBB A;  3CG7 A;  2O8D A;  4ISF A;  3OYC A;  4FJ8 A;  3NMU A;  4K0K K;  2O8B B;  2FSK A;  4MDA A;  4HCC A;  2P5O A;  4K25 A;  3KWG A;  3MN5 A;  4BRC A;  1T6D A;  4M3R A;  4AM7 A;  2YV0 X;  3H1V X;  4CD3 A;  4X62 K;  3CME N;  3KK7 A;  4CZE A;  3SBT A;  4CFB A;  1RT2 A;  2VWB A;  3R1X A;  1S5J A;  3MXI A;  3AVJ A;  2HMI A;  5GAH P;  2RE2 A;  1FKP A;  1NGA A;  1Q9X A;  5I3U A;  4CFA A;  4PKI A;  3DXM B;  4CI6 A;  2UYT A;  3VES A;  4AHR A;  4JS4 A;  4CHY A;  3ZT2 A;  3F73 A;  3QER A;  4BGB A;  4KHP K;  3S41 A;  4DR6 K;  4DUY K;  2AJQ A;  4F3O A;  1VQ4 N;  3AVN A;  1TKD A;  3QIO A;  3L8B A;  3V6D A;  3K5N A;  3HP6 A;  3EN9 A;  2QWN A;  5AQW A;  5AQR A;  3OYB A;  3V1Q A;  4CJL A;  1KD1 O;  1RT6 A;  1RBV A;  3VA3 A;  2E6L A;  2P9S A;  3MWT A;  3VMF B;  4DR2 K;  3CCM N;  1QHT A;  2QTD A;  3C7N A;  3OS2 A;  1YJW N;  1BO5 O;  4O5B A;  3RR8 A;  3TAR A;  4E89 A;  2G8W A;  5AQX A;  1FJG K;  4XIU A;  3AVM A;  2P9L B;  3A5M C;  3GL1 A;  1ZBS A;  2HHH K;  3AV9 A;  5AQP A;  3THY B;  2HBM A;  3ID8 A;  4FJG A;  2IGI A;  1FKO A;  3FZM A;  2A6A A;  3JYT A;  3WNE A;  1TAU A;  1KQS M;  4IG0 A;  4DTU A;  2UU9 K;  3ULD A;  4IFV A;  3OYF A;  5F1X A;  4JRP A;  4FJX A;  5C15 A;  4Z4C A;  1TK5 A;  3TAM A;  1XNQ K;  2HNY A;  1HPZ A;  1WOQ A;  5FPM A;  3CJ1 A;  4H5N A;  5BRF A;  1IH7 A;  3WQT A;  2PFU A;  5C2D A;  1J54 A;  4CBW A;  4JKH A;  4U67 L;  1BWF O;  1S1U A;  3V1O A;  4K43 A;  3VGM A;  2OYQ A;  4ID1 A;  3MX5 A;  5AFU A;  2O8C A;  3SK3 A;  4PL8 A;  4FWK A;  4I9L A;  4DV7 K;  4CZK A;  5JMV A;  3C6H A;  4GKJ K;  3J80 O;  4FZX C;  1TYQ B;  2YKN A;  3RMC A;  2GV9 A;  3AO5 A;  1ZBL A;  1TK0 A;  4B08 A;  4CHQ A;  3HRG A;  3AGK A;  3ZEU A;  1X9S A;  4CJV A;  1SKS A;  4MO5 A;  4CBU A;  2ITG A;  4R79 A;  3NF9 A;  2HBJ A;  5HRP A;  3ZSV A;  4HTU A;  5KQ8 A;  2HF4 A;  2WC9 A;  1D8Y A;  4BC3 A;  3DAW A;  3ITH A;  3SNN A;  1RDD A;  3LDO A;  4AHU A;  2F8T A;  4CCH A;  1EX4 A;  2D0O A;  4IKF A;  4K8Z A;  2X74 A;  4N47 A;  1WAF A;  4JI7 K;  1ILY A;  1VQO N;  5AQT A;  3OS1 A;  1S3X A;  4GNI A;  4F3T A;  3CM6 A;  1NGC A;  3QIC A;  5CE3 A;  5FDL A;  4H5V A;  1QSL A;  4OLA A;  3K5L A;  4KRE A;  1XNR K;  4DG1 A;  4FW2 A;  4FVM A;  5CY4 A;  3H1Q A;  1BQN A;  1VQM N;  3TTF A;  4BRD A;  3PIO L;  2UUC K;  2YNH A;  2A1S A;  4PKG A;  3DRR A;  1N6Q A;  5KI6 A;  5C24 A;  4DFM A;  4DR4 K;  4JKB A;  3TTD A;  4UY8 O;  3A5L C;  4JS5 A;  3ZSZ A;  3MED A;  4BRG A;  4FJM A;  2P9S B;  3NCI A;  1RTD A;  5MLC Q;  4NCA A;  1KFS A;  3VTI A;  2WFB A;  3TAF A;  2P9N A;  4KI6 A;  5JS1 A;  1M1K O;  4M42 A;  3U9Z A;  1K6Y A;  4QCL A;  3P1G A;  3LP0 A;  1HYV A;  3C65 A;  3JAM O;  4EZ9 A;  2Z1J A;  4E7L A;  5BRD A;  1U49 A;  1JLE A;  2XHB A;  3VQP A;  3DXK B;  3NDK A;  4CJU A;  4PL7 A;  3O08 A;  4XH5 A;  2O8F B;  1BDG A;  1E3M A;  4JK9 A;  1SKR A;  1YVN A;  2DY4 A;  3OYE A;  3OY9 A;  5EX5 A;  4KHS A;  4JI3 K;  4L3Q A;  4C1N K;  5HRS A;  3R3L A;  3QBW A;  3IS9 A;  1ASV A;  3ZLJ A;  4DSL A;  1U2V A;  3T7Z A;  3QB0 A;  2O4I A;  4QS9 A;  4I6M A;  4RTF D;  2WUS A;  3AVA A;  1XMO K;  2VG5 A;  3AVK A;  1WSH A;  1HYS A;  3OYH A;  3QDK A;  3M3Z A;  1S9E A;  3IG1 A;  3I8B A;  5EVZ A;  3G4S N;  1VSF A;  2YHB A;  2QWQ A;  5GAG P;  1N36 K;  4GV3 A;  2RHK A;  3L2U A;  1BQM A;  3CHW A;  4JLH A;  4N76 A;  3TSU A;  3FZL A;  4KHN A;  2AP1 A;  3O9T A;  1JCG A;  1DLO A;  3CFO A;  4NB4 A;  4E1M A;  1NKB A;  4B9U A;  1CXU A;  4ZTJ A;  4M3W A;  1SAZ A;  4B1V A;  1SUQ A;  3BEX A;  3S3O A;  1IG9 A;  3HPG A;  4K41 A;  3CCV N;  4H0X B;  3QBX A;  4ZTF A;  3ZX0 A;  4CJT A;  4FM2 A;  1VK0 A;  1NJW A;  4WQ4 A;  3CJB A;  3P5J A;  1TKT A;  1LAV A;  3ATV A;  3G25 A;  3NF8 A;  3ZX2 A;  3OYD A;  2IS3 A;  2HBK A;  3UKR B;  2FBV A;  3ZT0 A;  3G71 N;  4FJI A;  2ASO A;  4AHT A;  2OPR A;  3VEW A;  1K9M O;  5BR9 A;  3KJV A;  3ENB A;  4N5S A;  5JIC A;  3DOL A;  1R0A A;  1HR0 K;  4W5O A;  3K2P A;  4KRF A;  1NK8 A;  3WNH A;  1WB9 A;  4MFB A;  4DV1 K;  3E66 A;  4FLZ A;  4QOZ B;  3EE8 A;  4YHH K;  3AVG A;  1OVY A;  2QWO A;  4F9O A;  5CR4 A;  1HKC A;  2BGG A;  3KK1 A;  1WBD A;  2Z1H A;  1RNH A;  1GLJ O;  1NM1 A;  3CMA N;  3NGY A;  2E2P A;  3AVF A;  3D0P A;  1QZ5 A;  2YX6 A;  1IKX A;  3OYN A;  4CEA A;  3VER A;  3DMJ A;  1QQO A;  4B8C A;  2P5G A;  2G8I A;  2HHS A;  1YIT N;  3ZT3 A;  3J7Z O;  4BRI A;  1X9J A;  2KQ2 A;  4DV3 K;  1HQE A;  3KD1 E;  1G15 A;  1J6Z A;  5AQS A;  4B9M A;  2PYL A;  4Q0B A;  3VEO A;  4EP5 A;  2UUB K;  1NOZ A;  4XH1 A;  4A62 A;  1JXB A;  5GIP A;  1I3A A;  3T69 A;  1N8R O;  3CCU N;  3D2F A;  4BRF A;  1B9D A;  4IJN A;  1GLB G;  4JRQ A;  4B9N A;  3O9R A;  3NGI A;  4DQP A;  3VQB A;  3DLK A;  4CEB A;  1HUX A;  4CZI A;  2F96 A;  2A40 A;  2J4R A;  4OLB A;  3WXJ A;  2ZGY A;  1JXE A;  4O8K A;  2R7Y A;  3UB5 A;  5HP1 A;  4IOX A;  2H3G X;  4DQQ A;  3JS6 A;  3LAN A;  3BY5 A;  5BN9 A;  3C6A A;  4BR4 A;  2OTL N;  3T3F A;  4A57 A;  3BP8 A;  2P9I A;  4YFU A;  4IOA L;  4C1N I;  1JKH A;  4LSL A;  1HKG A;  3MX2 A;  3O9Q A;  1RCH A;  2GWJ A;  2KKZ A;  4BAC A;  1V4T A;  2E4L A;  1HNZ K;  1VSL A;  2BH1 A;  4DTR A;  5C12 A;  1HMV A;  3QEP A;  1BL3 A;  2OPS A;  4FWP A;  3CQX A;  3L0Q A;  1XQS C;  1L3U A;  3QO9 A;  1U47 A;  4RWT A;  2NRX A;  1SL2 A;  2E1Y A;  1N32 K;  2YHY A;  4NO7 A;  1KFD A;  4FLW A;  1VQ9 N;  4KAZ A;  1E4F T;  3K5M A;  1TL1 A;  3ZSX A;  1S1X A;  5AQK A;  4YNQ A;  5J2N A;  4IOC L;  3E01 A;  5IT9 O;  1BI4 A;  1YAG A;  1NK5 A;  3T1Y K;  3WUH A;  4B9Q A;  1CLQ A;  4BRP A;  3ATU A;  2DFE A;  3VEX A;  1ZC6 A;  2P9K B;  4E19 A;  2G8K A;  2JWL A;  4L8R B;  1LOT B;  1BU6 O;  4DLE A;  4CEO A;  3FLC O;  4KTW A;  4B3S K;  4W5R A;  4FOI A;  1SL0 A;  3SJJ A;  4NLC A;  2OA8 A;  4KI4 A;  2XRI A;  2QKK A;  4Y1C A;  2E2O A;  2F9W A;  4WFA L;  4F4K A;  1RTI A;  4FYD A;  4A2B A;  3HPH A;  3IFR A;  4AHS A;  4HUE A;  4E1J A;  2VQE K;  4JKF A;  4K42 A;  2ZJQ L;  3TU5 A;  4CJQ A;  4C8L A;  4DTP A;  3JSM A;  3FFK B;  1K73 O;  2W41 A;  1HYZ A;  3RRH A;  3VQE A;  3NFA A;  4O44 A;  4YOV A;  5HL7 L;  3KK2 A;  3IUC A;  4PKH A;  2I5J A;  2A5X A;  1NKC A;  2BAN A;  2E5L K;  1J53 A;  2EWS A;  4IG3 A;  1ATR A;  3CQ8 A;  3TAE A;  3TSQ A;  4CZG A;  3J7A P;  3AA2 A;  3HK2 A;  2HNZ A;  5D3G A;  3D2F B;  3HBT A;  4FJK A;  2RN2 A;  2YHX A;  3U3G A;  3CM5 A;  1KLN A;  4W5Q A;  1VSM A;  1TVR A;  1RDA A;  3VGL A;  1YTA A;  4FPA A;  5J2M A;  4PHT X;  1QVF M;  3E9O A;  5E84 A;  3NGZ A;  4LF4 K;  3VEV A;  1BA1 A;  2WOM A;  3AVL A;  4FLY A;  3CCS N;  4JV5 K;  4DQ8 A;  3WQU A;  3VGK A;  1EXQ A;  2E88 A;  2VWJ A;  3I0S A;  5FPN A;  4J2B A;  2HVH A;  4I7F A;  1QS4 A;  2E2N A;  2P9I B;  3ZCM A;  2HHT A;  3D2E A;  5F2R A;  4BRN A;  3CQY A;  4GY2 B;  1VQL N;  3A8Y A;  1NGF A;  3AO2 A;  3ZSO A;  3O3G A;  1RTH A;  3S3M A;  2HHQ A;  3MEE A;  4BRA A;  4JI0 K;  4JHD A;  1NKE A;  5KPR A;  4HVJ A;  3DM2 A;  3EZ5 A;  1J9A A;  3RMD A;  1WUA A;  4FJN A;  2Y1J A;  3PX4 A;  4CIG A;  4JEP A;  1JCE A;  2ETJ A;  4B9T A;  3UIQ A;  3WEE A;  1QTM A;  4KV8 A;  1U48 A;  3JXU A;  3ZT4 A;  2PZS A;  4H5T A;  1U6Z A;  2Y1I A;  3SJH A;  1NBW A;  1NGD A;  4ELU A;  4BG9 A;  1CXQ A;  3SBG A;  5AZI B;  3V9W A;  2FBY A;  3G10 A;  3AO1 A;  3LL3 A;  3CPE A;  4O0I A;  4KHU A;  4CZL A;  3AGR A;  4OKE A;  1MDU B;  1IG8 A;  1HLU A;  3AO4 A;  3AAP A;  1Q82 O;  2I7P A;  1KVB A;  5LY3 A;  4Y1D A;  4ICL A;  5AQO A;  2KFN A;  5AQI A;  1O1W A;  1QQC A;  1C0T A;  1RDB A;  3CJ7 A;  3PX6 A;  3CC4 N;  1IV0 A;  5J2Q A;  4FLX A;  1ZXO A;  5DM7 L;  3TAB A;  1XI1 A;  3G6E N;  3QEW A;  1EO1 A;  3LDQ A;  4BR0 A;  3GE1 A;  1S1V A;  4H0P A;  4FZY A;  2E6M A;  3UE5 A;  3LPT A;  4BC5 A;  1Q7Y O;  5HLF A;  3AVI A;  3HXM A;  4Z4F A;  3CCL N;  4BVP A;  3C94 A;  3ZSR A;  3THW B;  1SQK A;  3CJ9 A;  4RW8 A;  1NK0 A;  3OS0 A;  1C0G A;  2YI1 A;  4DV5 K;  1C1B A;  2NRH A;  3BUZ B;  3LM9 A;  1DT9 A;  4B1U B;  3AVH A;  4NXN K;  1ITG A;  2FLO A;  2IOC A;  3BGR A;  3OYA A;  4XH4 A;  4CEF A;  1BIZ A;  5HRN A;  3WXM B;  4CF0 A;  2A3Z A;  1Q86 O;  1NNE A;  1ASU A;  4DUZ K;  3ASM A;  1S9G A;  1RBR A;  3VF2 A;  4JI5 K;  1RDU A;  1Z6R A;  4B3R K;  3TAP A;  3UKU A;  3V4I A;  1VQ6 N;  3HL8 A;  5GAD P;  2Q31 A;  3EYZ A;  2P9P B;  3H3N O;  4Z4I A;  4JKG B;  1I39 A;  3PSI A;  4CK1 A;  3RMA A;  4BDP A;  1XHZ A;  1S6P A;  2EX3 A;  3D6R A;  4CZM A;  3NE6 A;  1BHL A;  4WYB A;  3PIP L;  4JN4 A;  1S22 A;  3KLE A;  1GLC G;  3L4I A;  3VQC A;  3MXM A;  2UXD K;  4KO0 A;  4KFB A;  1M90 O;  2Q36 A;  3S3N A;  2V7Y A;  1Q18 A;  3ENO A;  4CVN E;  4JHD B;  2KHO A;  3VQ4 A;  2O8E A;  3MN7 A;  4BDZ A;  2OCE A;  4F8R A;  4DQS A;  4W5N A;  3AA5 X;  3H3O B;  3N4Q A;  4FLU A;  3NBP A;  2WBN A;  1NOY A;  3AA4 A;  4LSN A;  3WEE B;  3VF4 A;  5BPM A;  4J2A A;  2O8D B;  1Z25 A;  4WQ4 C;  3SMP A;  2F8S A;  4WQ5 A;  3OYG A;  4CHO A;  4FOE A;  2QA4 N;  3M1F A;  2G8H A;  4IDH A;  3ISN C;  3O8M A;  2W40 A;  5AR0 A;  4MO4 A;  4FJJ A;  3U4L A;  4ILG B;  5AZJ A;  1HNI A;  5KPZ A;  1W97 L;  3O1B A;  4NYN A;  3CPW M;  5BN8 A;  2XO7 A;  2G8F A;  1HNW K;  3AAQ A;  1GLF O;  3O4N A;  4FSV A;  4B1X B;  1NMD A;  5B8H A;  3RTV A;  2YJF A;  5BRH A;  4FCY A;  4DHY A;  3OYL A;  3O9S A;  3KTQ A;  5KRT A;  3W0L A;  4OPH A;  4DR3 K;  4CJ5 A;  4AIL C;  4ILJ A;  4BC2 A;  2ATQ A;  4FWS A;  1YI2 N;  3SV4 A;  2D0P A;  3DLE A;  3CET A;  1EP4 A;  4JI1 K;  2VYP A;  1C1A A;  4H5W A;  4CIE A;  3HO1 A;  3VQ9 A;  4GV9 A;  5AFU H;  4H5R A;  4BQL A;  3C7N B;  4FLV A;  3KKR A;  2F7T A;  4A2A A;  4KTZ A;  4M3X A;  3B6P A;  1KVA A;  3IRX A;  1X9W A;  3PV8 A;  1TL3 A;  4NCB A;  1Q8I A;  1DGK N;  3M8S A;  1REV A;  1OVQ A;  4FWN A;  4HUF A;  4IEE A;  1S6Q A;  4KBO A;  2FF6 A;  1WSJ A;  3L2V A;  1RT7 A;  3VA0 A;  4B1Z A;  4H03 B;  1C0M A;  4MLE A;  5C25 A;  1VQK N;  1IBM K;  2HBL A;  5BPN A;  3F9K A;  4CJK A;  1TV6 A;  2UXC K;  3QLH A;  4EAH D;  2ZJR L;  3QFP A;  1TAQ A;  3DYA A;  3OYK A;  2ASP A;  3THV A;  3SMS A;  4LF5 K;  4IZ9 A;  1KCF A;  5I42 A;  2O8C B;  2QWL A;  4DV4 K;  3BF3 A;  1UAX A;  4LH4 A;  3NVM A;  2QXF A;  3CCQ N;  1BOT O;  3MEG A;  4CHN A;  4YDU C;  5CZ1 A;  1EKE A;  3A5O C;  4DF4 A; 
#chains in the Genus database with same CATH homology
 1LWC A;  2JLE A;  2IAJ A;  4O55 A;  4C8M A;  4DFP A;  2W42 A;  4CHP A;  1KVC A;  4DQQ A;  4EZ6 A;  1JLF A;  3LAN A;  4DSE A;  1KRP A;  2Z1G A;  3L2Q A;  2DFF A;  3MAQ A;  3TR8 A;  3HVR A;  4DTN A;  3T3F A;  4DLG A;  1LV5 A;  4GW6 A;  3B6O A;  3FFI A;  4YFU A;  4ELV A;  2G8U A;  2QKB A;  1MU2 A;  1JKH A;  4LSL A;  5DK5 A;  3LDS A;  1KSP A;  3G0Z A;  4H4O A;  4CJR A;  1RCH A;  2OZM A;  4BAC A;  4AHC A;  2E4L A;  4FZZ A;  1VSL A;  2GBZ A;  3TAN A;  1T7P A;  4B9S A;  4DTR A;  1QSS A;  1JLB A;  1N5Y A;  1HMV A;  2YNI A;  3VQA A;  4E7I A;  3QEP A;  4CF2 A;  3D45 A;  3DRS A;  4KHW A;  1BL3 A;  2OPS A;  4NCG A;  5KGX A;  3H08 A;  3V1R A;  4CGG A;  4DFJ A;  1WSE A;  3QNO A;  3VQD A;  4B8A B;  1L3U A;  3LWL A;  4FM1 A;  3QES A;  4DQR A;  2ZQB A;  3QO9 A;  3CG7 A;  2KW4 A;  1U47 A;  1BIS A;  1CZ9 A;  1SL2 A;  1YTU A;  3OYC A;  4FJ8 A;  3SI6 A;  4HHT A;  3U3Y A;  4HCC A;  2P5O A;  1KFD A;  4FLW A;  1F21 A;  4IBN A;  1WSI A;  4KAZ A;  3K5M A;  3QEV A;  1TL1 A;  3ZSX A;  1S1X A;  1FXX A;  4YNQ A;  5J2N A;  4M3R A;  2YV0 X;  4CIF A;  3E01 A;  3WNG A;  1BI4 A;  4DSF A;  1NK5 A;  4FK0 A;  2PY5 A;  4CFB A;  1RT2 A;  3I8D A;  1S5J A;  3MXI A;  3L2R A;  2B4J A;  5J2P A;  3AVJ A;  2HMI A;  1CLQ A;  5E41 A;  4OPK A;  2DFE A;  5FRM A;  3T1A A;  4J2D A;  3VQ8 A;  4E19 A;  2G8K A;  1FKP A;  4L8R B;  1L3T A;  1L3V A;  1Q9X A;  5I3U A;  4CFA A;  4DLE A;  4CEO A;  1NJX A;  4KTW A;  3QEI A;  4Z4E A;  4H4M A;  4AHR A;  1TKX A;  1UWB A;  4JS4 A;  4CHY A;  4W5R A;  1SL0 A;  3SJJ A;  2OA8 A;  2GUI A;  3ZT2 A;  3F73 A;  4DSJ A;  4KI4 A;  4PQU A;  3QER A;  2XRI A;  3IAY A;  4M3U A;  4M3Z A;  2QKK A;  4Y1C A;  1JLC A;  1S1W A;  2D5R A;  4F4K A;  4FJL A;  2AJQ A;  4F3O A;  3AVN A;  1QE1 A;  3O4Q A;  3SPZ A;  1TKD A;  3QIO A;  3L8B A;  4KHQ A;  1RTI A;  3V6D A;  3PO4 A;  4FYD A;  1TKZ A;  3HPH A;  4AHS A;  1GOB A;  3K5N A;  1XHX A;  4HUE A;  4RW4 A;  3HP6 A;  3DI6 A;  4KB0 A;  2XY5 A;  1VRU A;  2OZS A;  3SUP A;  3OYB A;  3LP2 A;  3V1Q A;  4CJQ A;  4C8L A;  4LH5 A;  4CJL A;  1RT6 A;  4DTP A;  5KTQ A;  1RBV A;  3JSM A;  3VA3 A;  4DMN A;  1HYZ A;  2E6L A;  3RRH A;  3A2F A;  3VQE A;  4CEQ A;  2YHA A;  3NFA A;  4O44 A;  4OPJ A;  1T05 A;  4C8O A;  1QHT A;  3OS2 A;  3KK2 A;  4O5B A;  1JLQ A;  3RR8 A;  3TAR A;  1S1T A;  3LP3 A;  3L3V A;  2I5J A;  4E89 A;  1VSK A;  3SZ2 A;  2G8W A;  1FK9 A;  4ZHR A;  3QNN A;  4XIU A;  1NKC A;  2B5J A;  5DMR A;  1GOA A;  2BAN A;  1J53 A;  4IG3 A;  3LWM A;  3AVM A;  3CQ8 A;  3TAE A;  4OGE A;  2HHW A;  3AV9 A;  5SWM A;  3AA2 A;  3M8Q A;  3HK2 A;  2B6A A;  2HNZ A;  1D5A A;  4FM0 A;  2X6S A;  4CJP A;  2PYJ A;  4FJG A;  2IGI A;  1FKO A;  3LAK A;  5D3G A;  1SL1 A;  1BIU A;  3JYT A;  3WNE A;  2RN2 A;  4FJK A;  1TAU A;  2D0C A;  3U3G A;  3CM5 A;  1Q9Y A;  1KLN A;  2P1J A;  4FW1 A;  4W5Q A;  1JL2 A;  4IG0 A;  1VSM A;  3M8P A;  1TVR A;  1RDA A;  4DTU A;  4FLT A;  3ULD A;  1UA1 A;  1YTA A;  4IFV A;  1T03 A;  3OYF A;  4CFD A;  1DTQ A;  4EP4 A;  1NK9 A;  5J2M A;  4H8K A;  1KTQ A;  4KTQ A;  4JRP A;  1VRT A;  4MQ3 A;  3HST B;  1SV5 A;  4FJX A;  3QEX A;  4Z4C A;  3KLG A;  3NGZ A;  3KLI A;  1TK5 A;  3NF7 A;  3TAM A;  1ZYQ A;  2HNY A;  1HPZ A;  2WOM A;  4M45 A;  3RMB A;  4GVM A;  3AVL A;  4CEC A;  4FLY A;  3V9S A;  1IH7 A;  3L2W A;  4BE1 A;  4CHZ A;  1RBT A;  1J54 A;  4OKK A;  3K59 A;  3SPY A;  1S1U A;  3V1O A;  2VWJ A;  1EXQ A;  4DWI A;  3AO3 A;  4E3S A;  4PUO A;  2OYQ A;  4N41 A;  4ID1 A;  3I0S A;  4J2B A;  2HVH A;  4I7F A;  1QS4 A;  1WN7 A;  4CJF A;  3S9H A;  3HPO A;  3OJU A;  2ZD1 A;  1RTJ A;  3ZCM A;  2HHT A;  3HT3 A;  4E7H A;  4I9L A;  4C8N A;  1RDC A;  3DLR A;  4BWJ A;  4WE1 A;  4FZX C;  3PX0 A;  3CFR A;  3RWU A;  4PWD A;  3AO2 A;  3ZSO A;  3O3G A;  1RTH A;  3S3M A;  2HHQ A;  4CFC A;  2YKN A;  3RMC A;  1LW2 A;  2GV9 A;  3MEE A;  3AVB A;  3AO5 A;  1NKE A;  1ZBL A;  1TK0 A;  4B08 A;  4HVJ A;  4CHQ A;  3DM2 A;  3EZ5 A;  3RRG A;  1J9A A;  3QIP A;  3RMD A;  4FJN A;  2Y1J A;  3PX4 A;  4Q5V A;  2KFZ A;  4CIG A;  1X9S A;  3SQ1 A;  3AVC A;  1RBS A;  2ETJ A;  2FBX A;  4CGJ A;  4AHV A;  4CER A;  4CJV A;  3SUO A;  4B9T A;  1LWE A;  2OPP A;  3UIQ A;  1SKS A;  4KPY A;  1VSH A;  1Z26 A;  3TAG A;  4KV8 A;  1QTM A;  1U48 A;  2HW3 A;  4FK2 A;  4LD0 A;  3ZT4 A;  2ITG A;  2PZS A;  4RW6 A;  5C42 A;  3NF9 A;  2Y1I A;  4I9Q A;  4Z4H A;  5HRP A;  4DSI A;  3ZSV A;  4HTU A;  4ELU A;  2HHU A;  1D8Y A;  3V9Z A;  2VG7 A;  1CXQ A;  4TSX A;  3ITH A;  1RT4 A;  3SNN A;  1RDD A;  2F8T A;  4AHU A;  4FJ5 A;  3V9W A;  1EX4 A;  4CCH A;  4IKF A;  4K8Z A;  4BE2 A;  2X74 A;  4N47 A;  1WAF A;  2FBY A;  2ZE2 A;  1BGX T;  3G10 A;  3AO1 A;  2OPQ A;  3TI0 A;  4O0I A;  4KHU A;  3OS1 A;  4CF9 A;  2A1R A;  4F3T A;  4OKE A;  1VSE A;  3M8R A;  3CM6 A;  4DU3 A;  3EY1 A;  1BCM A;  1A5V A;  3AO4 A;  4Z0U A;  1JL1 A;  1HNV A;  5FDL A;  1QSL A;  4OLA A;  3K5L A;  4KRE A;  1D9D A;  1KVB A;  4G1Q A;  4IDK A;  4DG1 A;  3KLF A;  4FW2 A;  3KLH A;  3SUN A;  4FVM A;  5CY4 A;  1BQN A;  4Y1D A;  4ICL A;  3K5O A;  4CGD A;  2KFN A;  1WLJ A;  3LP1 A;  3NF6 A;  1O1W A;  1QQC A;  1C0T A;  3CFP A;  3TAQ A;  1RDB A;  3KD5 E;  3VQ6 A;  3OYM A;  2YNH A;  2O4G A;  1ASW A;  2A1S A;  1Y97 A;  1W0H A;  3DRR A;  3PX6 A;  2RF2 A;  1N6Q A;  5J2Q A;  5KI6 A;  5C24 A;  4DFM A;  4FLX A;  4FK4 A;  3TAB A;  1XI1 A;  4DTM A;  2QK9 A;  3HJF A;  3QEW A;  2Q3S A;  3AA3 A;  4CGH A;  3PY8 A;  1NK6 A;  4M41 A;  4JS5 A;  3ZSZ A;  4CJW A;  4DS5 A;  1HQU A;  3MED A;  1S1V A;  5CYQ A;  4FZY A;  2E6M A;  4O4G A;  1NK7 A;  3NCI A;  4FJM A;  4DTS A;  1HRH A;  3LPT A;  5HLF A;  1RTD A;  4RW7 A;  4NYF A;  3AVI A;  3HXM A;  1UOC A;  4Z4F A;  2YNF A;  1KFS A;  4NCA A;  4N56 A;  5HBM A;  3C94 A;  1U4B A;  1HJR A;  4I2Q A;  3ZSR A;  3CYM A;  4BWM A;  4CGF A;  3TAF A;  4CES A;  4KI6 A;  5JS1 A;  4GMJ B;  4RW8 A;  3ALY A;  1NK0 A;  4M42 A;  3OS0 A;  4OJR A;  1K6Y A;  1U45 A;  4QCL A;  2DFH A;  3P1G A;  4E7K A;  3LP0 A;  1RBU A;  1HYV A;  1C1B A;  4EZ9 A;  3PO5 A;  1X9M A;  2Z1J A;  1WSF A;  4E7L A;  2HHX A;  3LPU A;  1U49 A;  1JLE A;  2XHB A;  3VQP A;  3LZI A;  3AVH A;  3NDK A;  4CJU A;  1TK8 A;  1ITG A;  4DF8 A;  2IOC A;  2DTU A;  1A5W A;  3BGR A;  3OYA A;  3OVN A;  4CEF A;  1SKR A;  1BIZ A;  5HRN A;  4CF0 A;  4CJE A;  4O0J A;  1ASU A;  1YT3 A;  4QAG A;  3ASM A;  1S9G A;  1RBR A;  4DF4 A;  2DY4 A;  1IO2 A;  3OYE A;  3O3H A;  3OYI A;  3OY9 A;  3TAP A;  4DTX A;  4KHS A;  2Z1I A;  4E1N A;  5SZT A;  3V4I A;  3HL8 A;  5HRS A;  4CED A;  3NH1 A;  2IC3 A;  3IS9 A;  1ASV A;  3EYZ A;  4DTJ A;  4DFK A;  1WNS A;  3V9X A;  1A5X A;  4Z4I A;  1I39 A;  4DSL A;  3RMA A;  4CK1 A;  4PY5 A;  3DLH A;  5HRR A;  3ZSY A;  1XHZ A;  1S6P A;  4BDP A;  2EX3 A;  4KHY A;  2O4I A;  5KRS A;  4DSK A;  3NE6 A;  1LWF A;  1BHL A;  3AVA A;  4W5T A;  4ID5 A;  2EHG A;  3KIO A;  3HP9 A;  4BE0 A;  3V81 A;  3BDP A;  4CEE A;  2VG5 A;  2FC0 A;  1NK4 A;  4F2S A;  5T7B A;  3KLE A;  3KD1 E;  3AVK A;  1WSH A;  2RPI A;  4CJS A;  3OYH A;  1HYS A;  4ELT A;  3V9U A;  3VQC A;  3MXM A;  1S9E A;  3IG1 A;  4KO0 A;  4OKJ A;  3SV3 A;  1QSY A;  2IDO A;  1BCO A;  1VSF A;  2YHB A;  1U04 A;  4KFB A;  3L2U A;  3S3N A;  1X1P A;  1BQM A;  4JLH A;  3SYZ A;  3VQ4 A;  4N76 A;  4BDZ A;  4FJH A;  4F8R A;  4CK2 A;  4DQS A;  4KHN A;  4W5N A;  1C0U A;  3AA5 X;  4FLU A;  3DLB A;  3NBP A;  3QET A;  2RKI A;  1YVU A;  1NOY A;  3VQQ A;  1WAJ A;  3AA4 A;  1DLO A;  3CFO A;  4CEZ A;  4E1M A;  3C6U A;  2HND A;  4LSN A;  1NKB A;  1UA0 A;  4J2A A;  4M3T A;  4B9U A;  1GOC A;  1Z25 A;  2LSN A;  1CXU A;  4ZTJ A;  4M3W A;  2F8S A;  3C6T A;  3MXJ A;  2G8V A;  3OYG A;  4CHO A;  1SUQ A;  3MEC A;  2XY8 A;  5K14 A;  1VSJ A;  4CK3 A;  2XY6 A;  3S3O A;  1IG9 A;  2G8H A;  3VQ5 A;  3HPG A;  5EU7 A;  3OJS A;  1SKW A;  4ZTF A;  3ISN C;  2XY7 A;  4CJT A;  1VSD A;  4KKO A;  3SCX A;  4B9L A;  4K8X A;  4FM2 A;  3TWH A;  1KLM A;  1VK0 A;  1NJW A;  4FJJ A;  5KGW A;  3SQ2 A;  1BI4 B;  3P5J A;  3HYF A;  1HNI A;  1TKT A;  1LAV A;  2NUB A;  3ZT1 A;  3OYD A;  3NF8 A;  4OVL A;  3VN5 A;  2IS3 A;  4NYN A;  1ZBF A;  2HB5 A;  1LAW A;  2FBV A;  3ZT0 A;  2XO7 A;  2G8F A;  4FJI A;  4DU1 A;  1JLG A;  4FJ7 A;  4AHT A;  2OPR A;  3O4N A;  3DLG A;  3DRP A;  4CGI A;  2KTQ A;  3SUQ A;  4CF8 A;  4R5P A;  3ZSQ A;  3RTV A;  2HHV A;  1C6V A;  3KJV A;  4FCY A;  1J5O A;  4C8K A;  2D0B A;  4N5S A;  3OYL A;  5KRT A;  3SQ4 A;  3KTQ A;  2P51 A;  3DOL A;  4CJ5 A;  2YKM A;  4AIL C;  1RT5 A;  1R0A A;  1C1C A;  2YNG A;  2ATQ A;  4BDY A;  4W5O A;  3K2P A;  2WON A;  3KK3 A;  3SV4 A;  1RT3 A;  3WNH A;  4DU4 A;  1NK8 A;  3U6F A;  4KRF A;  3RR7 A;  4MFB A;  4FLZ A;  3I0R A;  3DLE A;  3HM9 A;  4QOZ B;  1EP4 A;  3AVG A;  1C1A A;  4PA1 A;  4CIE A;  1D9F A;  3HO1 A;  3VQ9 A;  1TGO A;  1LW0 A;  2BGG A;  3KK1 A;  1IKY A;  2Z1H A;  4FLV A;  3KKS A;  1RNH A;  1JLA A;  3KKR A;  3NAE A;  1XWL A;  4Z4G A;  3LZJ A;  3NGY A;  1L5U A;  3K58 A;  4KTZ A;  2HVI A;  3NH0 A;  4M3X A;  1RIL A;  3NHG A;  4DQI A;  3B6P A;  1KVA A;  3AVF A;  3NH2 A;  1NJZ A;  3IRX A;  3C95 A;  3P83 D;  4RG8 A;  3D0P A;  1X9W A;  3PV8 A;  3K57 A;  4FXD A;  1TL3 A;  1RT1 A;  4NCB A;  1Q8I A;  1IKX A;  3OYN A;  3M8S A;  2FBT A;  1CZB A;  1REV A;  4OGC A;  4CEA A;  2X78 A;  4F2R A;  3DMJ A;  5J1E A;  5JS2 A;  4B8C A;  4HUF A;  2P5G A;  4CJ3 A;  1S6Q A;  2G8I A;  4CF1 A;  5HRO A;  2HHS A;  1WSJ A;  3ZT3 A;  3L2V A;  4M3Y A;  4UQG A;  1IKV A;  2KZM A;  4CE9 A;  1RT7 A;  2KQ2 A;  3VA0 A;  1B92 A;  1ZBU A;  3HVT A;  5FRN A;  4RW9 A;  1C0M A;  1HQE A;  3T19 A;  5FRO A;  1T8E A;  1G15 A;  3VQ7 A;  2JGU A;  5C25 A;  2BDP A;  3L3U A;  4B9V A;  4HUG A;  4J2E A;  2KZZ A;  1DTT A;  4B9M A;  4IFY A;  2VG6 A;  3OYJ A;  1ZBI A;  1W9H A;  3DOK A;  3F9K A;  4CJK A;  2PYL A;  4Q0B A;  5CYM A;  3PUF A;  1TV6 A;  4EP5 A;  4E7J A;  3QLH A;  1NOZ A;  1EET A;  3ZSW A;  1JXB A;  4KB1 A;  4CJ4 A;  1I3A A;  4E0D A;  1IKW A;  2VWK A;  1NJY A;  4DTO A;  1TAQ A;  3DYA A;  3OYK A;  1B9D A;  1XC9 A;  3LAL A;  4I2P A;  2D0A A;  4JRQ A;  3QIN A;  3THV A;  1KCF A;  5I42 A;  4B9N A;  4FJ9 A;  1WSG A;  5CZ2 A;  2X6N A;  1UAX A;  3NGI A;  4DS4 A;  4DQP A;  3VQB A;  1ZBH A;  3DLK A;  4LH4 A;  3O3F A;  1L3S A;  3WNF A;  2QXF A;  4CEB A;  4AH9 A;  2F96 A;  3MEG A;  4OLB A;  4CHN A;  1B9F A;  5CZ1 A;  1JXE A;  3LAM A;  1EKE A;  2R7Y A;  4B3O A;  3SQ0 A;  4HCB A;  1VSI A;  4LY7 A;  2BE2 A;  5HP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...