3QIOA

Crystal structure of hiv-1 rnase h with engineered e. coli loop and n-hydroxy quinazolinedione inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
148
structure length
136
Chain Sequence
MYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIITQWIHNWKKNVDLVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein,Ribonuclease HI,Gag-Pol polyprotein
publication title Structural and Binding Analysis of Pyrimidinol Carboxylic Acid and N-Hydroxy Quinazolinedione HIV-1 RNase H Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Transferase, hydrolase/inhibitor
total genus 43
structure length 136
sequence length 148
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3qioA00
3AV9A 4DQPA 4JRQA 3OYAA 1RTJA 5K14A 3U6FA 2D0BA 3TANA 3IAYA 4M3YA 1RCHA 1VSLA 1QSSA 4F8RA 3HP9A 2OYQA 3AVMA 2Z1GA 4K8ZA 4F3TA 4F2RA 3M8RA 3G10A 1ITGA 5KGWA 1TV6A 4GW6A 3OYDA 4FM1A 2X6NA 3PX0A 3DMJA 3ZT4A 1TK0A 3KD5E 4DWIA 1T8EA 5DMRA 1RBUA 4RG8A 3KJVA 2G8IA 4E19A 4CHQA 3OYIA 4FLTA 4CE9A 4K8XA 3IS9A 1J9AA 1WSJA 3AO1A 4JLHA 4LY7A 1NK7A 3PO4A 4KRFA 3NDKA 1WAFA 3AVKA 1RDAA 4ID1A 4AHCA 4N47A 3LWMA 4R5PA 3D45A 1T7PA 3L2VA 4RW7A 4N41A 1SUQA 3K59A 2VG6A 4DTNA 4EP5A 1DTTA 4E89A 3VQ6A 4E0DA 1BI4B 3F9KA 3KLFA 1TK5A 3KTQA 4KTQA 1UOCA 2P51A 4OPJA 2XHBA 3EY1A 3AO4A 3OJSA 3V9SA 4DF8A 5KGXA 4B9NA 3PX6A 3AO3A 3AVJA 4HUEA 1TK8A 3LP3A 3K2PA 4FM0A 3T19A 4DU4A 1ASUA 4DFJA 4FZYA 1A5XA 3S3OA 3CG7A 3DLHA 4CESA 1U47A 4HCBA 2ZE2A 1S5JA 1QS4A 1EX4A 1HQEA 3K5LA 2B5JA 2YHAA 2G8HA 3L2RA 5HRPA 4DTXA 3HYFA 1ZBLA 1L3SA 5CYQA 1J53A 3RTVA 1YT3A 2B4JA 2JLEA 1F21A 2YNGA 4H4OA 4CHNA 3TAPA 1LV5A 2G8KA 4B9MA 1NOZA 4W5OA 4BACA 4FJLA 4KHUA 5HBMA 4O4GA 3NGZA 2A1RA 4YFUA 3HPOA 5C42A 2KW4A 1NOYA 3ZCMA 3SI6A 3DLKA 1EETA 1FKOA 2YKNA 3B6PA 4DF4A 3VQ4A 1ZYQA 1N5YA 1KFDA 3ZSOA 2BDPA 4NCAA 1KVAA 3VQ7A 1UA1A 3L3UA 4ZHRA 1KVBA 1S6QA 4FLYA 1KLMA 1Z25A 3L2WA 4EZ6A 1RBVA 3L8BA 3DLRA 3OJUA 3C95A 3MEGA 4HCCA 2A1SA 4BWMA 1BCMA 1GOBA 1QHTA 3DOLA 5CYMA 4C8NA 4Q0BA 1IKVA 4E7KA 2IAJA 3RR8A 3T1AA 3O3HA 3LWLA 3CFRA 4DU1A 3F73A 3TARA 4ZTFA 1GOCA 1K6YA 3LZIA 4CK1A 1RILA 4AH9A 2OZSA 4KB0A 4FLXA 4JS4A 4CGDA 4BE0A 3DLEA 4DTOA 5FRMA 4Q5VA 3VQCA 3AA5X 3C6UA 4CHZA 1CXUA 4CEEA 4ZTJA 3QLHA 1RT1A 4IDKA 1X9WA 4LSNA 1A5VA 1S1TA 2LSNA 3ZT2A 2XY7A 3CYMA 3CFOA 4CHOA 1S1VA 1BISA 3ZSZA 4O55A 4Z4EA 4DSJA 3MECA 4OLBA 2Z1IA 1C0MA 3KIOA 3RMCA 1KVCA 4IG3A 3E01A 4CF8A 1NJXA 4Z4GA 2IC3A 4CIGA 2HHWA 4N56A 1WN7A 1NJWA 1EXQA 1C0UA 3AVFA 1HPZA 3BGRA 3P83D 3QIOA 3TAMA 4CJTA 4BDZA 2E4LA 2F8SA 4B9TA 4KFBA 2NUBA 2ZQBA 2O4IA 2IDOA 4AHRA 4W5TA 4OGEA 3DRRA 3LAMA 5CZ2A 3OYCA 3AVNA 4AHSA 5SZTA 2R7YA 4E7LA 2XY5A 3ZSXA 3K5MA 1R0AA 4O5BA 4Y1CA 1KSPA 4FM2A 2QKKA 4OLAA 3SYZA 5HP1A 3TR8A 1RTHA 1JLGA 4RW8A 1XWLA 1S9GA 1HYVA 5HRNA 1BHLA 2OPQA 4AHUA 1VSEA 3ZT3A 4CHPA 3HM9A 1WSGA 4RW4A 3VQ8A 3HPGA 4BDYA 1W0HA 1IKWA 1O1WA 3NHGA 4FJ7A 4FJ8A 4FYDA 2AJQA 1ZBFA 2KFZA 5E41A 1YTUA 4DQRA 4DLGA 3V9XA 3CM5A 3QIPA 4I2PA 3TAFA 3SQ2A 4CGJA 2YNHA 1ZBUA 4ELUA 4Z4HA 3S3NA 4KTWA 1JXEA 3LPTA 4AHTA 1DLOA 5HLFA 2KZMA 3KKSA 3O4QA 1YTAA 2FC0A 2XY8A 1C0TA 4E1MA 1SKSA 4FJ5A 4J2EA 2HHVA 4H8KA 4M3ZA 1VSFA 4DTRA 3NF9A 4C8MA 4I2QA 4DTUA 1FXXA 1VSIA 4E7IA 1RBTA 5FDLA 5I3UA 4CGIA 4M45A 2OPSA 4B08A 1NK4A 1B92A 1KFSA 4KHQA 4B8AB 4L8RB 4FJXA 1JLCA 3ITHA 3RRGA 3SPZA 4KTZA 4KV8A 4FJKA 4E3SA 3ZSRA 3HK2A 1RDDA 4IG0A 3C6TA 3V1RA 1KTQA 3OYFA 3OYLA 1NKCA 2PZSA 1RT4A 2WONA 1X1PA 5T7BA 3OS0A 3RRHA 1XHZA 2PYLA 3HO1A 1C1AA 4KO0A 3NH2A 4CEBA 2BE2A 4LD0A 3AO5A 2Z1HA 3LDSA 5KRSA 3OYBA 3EYZA 3VQEA 4MQ3A 4B8CA 1HJRA 1HQUA 1RT7A 2IOCA 3MXJA 3NCIA 1D9FA 1BL3A 2XO7A 2GBZA 1WNSA 4IFVA 4KREA 2VWKA 1QQCA 4FW2A 2ITGA 4BDPA 2HHQA 2HNYA 3QESA 2HHTA 2HHUA 4OKKA 3MXIA 4J2BA 1VRUA 1D9DA 3KLIA 2D0AA 2HNZA 2E6MA 1SKRA 1U4BA 4DFMA 3NFAA 4NYNA 3QEIA 4Y1DA 4NCBA 3VQQA 3S3MA 3A2FA 2G8WA 4NYFA 1C1BA 2IGIA 1U48A 3QO9A 1JL2A 3V6DA 5I42A 1Q8IA 4QCLA 3SUNA 1BCOA 1U04A 4DFKA 1X9MA 2ATQA 1IKXA 4FXDA 5HROA 3DLGA 4LSLA 4CHYA 3KD1E 2D5RA 1EP4A 4DS4A 4M3UA 1JLFA 3KK2A 3JYTA 1BQMA 3THVA 3V9UA 4C8LA 3NGIA 1JL1A 2JGUA 3T3FA 4J2AA 3SUPA 1LWCA 4HTUA 1WSEA 2G8UA 3M8QA 2OZMA 1QTMA 1JKHA 4KI6A 2YNFA 2D0CA 1B9DA 1RT2A 3ZSVA 4I7FA 1HYSA 1LW0A 1JLAA 4CERA 4DQSA 4TSXA 4PQUA 3QNNA 2RPIA 4CJLA 3MEEA 3UIQA 4CF9A 4OGCA 3SZ2A 4CFDA 2O4GA 4FVMA 4CJEA 4CJQA 4EZ9A 4CECA 1ASWA 1UWBA 4WE1A 4FJHA 4OJRA 1HNIA 3D0PA 1T03A 3AVLA 3S9HA 1TKDA 2IS3A 2GV9A 3KK1A 1I39A 3RMAA 4DTSA 2X6SA 2ZD1A 2Y1IA 5HRRA 4CIFA 3QEWA 3B6OA 1Q9YA 4F4KA 1U45A 1LAVA 1RNHA 5SWMA 1RT6A 3O4NA 4FK0A 4OKJA 4NCGA 3CQ8A 3PY8A 4KB1A 4KHWA 5HRSA 1TAUA 1J54A 2XRIA 3V1OA 4FK2A 5JS1A 3AVGA 4FLVA 4FLUA 2YHBA 4CEDA 4DTMA 1ZBIA 4DS5A 4DTJA 4CJVA 2HHXA 3NF8A 1JLEA 3DRSA 3KKRA 3VQBA 1SV5A 3OYNA 3TWHA 3VA0A 3TAQA 4I9LA 3WNHA 3ZSQA 2DTUA 3U3GA 4MFBA 3AA2A 1BI4A 3P5JA 4FCYA 4QOZB 1BIZA 1QSLA 5C24A 1NKBA 3SPYA 4KHSA 3ALYA 1YVUA 4CCHA 4Z4FA 2RF2A 1ZBHA 5CZ1A 4CF2A 4QAGA 1CZBA 4DTPA 1UA0A 1FK9A 2BANA 4IKFA 4N76A 1N6QA 1G15A 1XC9A 1CLQA 3KLEA 3ZSWA 4E1NA 3QINA 1XHXA 2OPPA 4PWDA 4C8KA 1WSIA 4GVMA 3DOKA 4CJUA 2G8FA 2KQ2A 1VSKA 1WAJA 3EZ5A 1U49A 4FJGA 3K57A 2Y1JA 1HNVA 4BE1A 3V81A 4UQGA 3AVBA 3ZT0A 4LH5A 4BE2A 4DSIA 1RDBA 1S6PA 4Z4CA 1NK0A 2QK9A 1Z26A 1IO2A 1Y97A 4CJKA 4DFPA 4M3WA 4CIEA 3P1GA 3OYGA 5J2MA 2EHGA 5KTQA 1SL0A 1WSHA 1BGXT 1L5UA 3VQAA 1HRHA 3O3FA 3MAQA 3SV4A 4JS5A 3VA3A 3SQ0A 2OA8A 1TAQA 4CJ3A 4CK3A 4N5SA 3TAEA 3AVCA 3ISNC 3WNEA 3ASMA 1TKZA 4OVLA 5KRTA 1CXQA 3NF6A 4CEFA 3SQ1A 4FZXC 4CJ5A 3JSMA 3LANA 1LAWA 1LWEA 2PYJA 3OYMA 1VRTA 3HJFA 4CEAA 4B3OA 3NF7A 3WNGA 1NK5A 3AA4A 1NK8A 4KI4A 3VQPA 1WLJA 1FKPA 2HNDA 4E7JA 1UAXA 3SQ4A 3IG1A 3QEVA 1VSMA 2X74A 2KZZA 2FBVA 4C8OA 3DM2A 1L3TA 1QE1A 3LP2A 3HT3A 3QEXA 4B9LA 2OPRA 1JXBA 3U3YA 4G1QA 2XY6A 3WNFA 1RBRA 1S1XA 4CGFA 3O3GA 3L2QA 1TL1A 4HUGA 4KHNA 1JLBA 2VWJA 3RMBA 3SUOA 4CF0A 3KK3A 4CEOA 1NKEA 4PA1A 1SKWA 4H4MA 3VN5A 1TVRA 1GOAA 1I3AA 4GMJB 4LH4A 4OKEA 2G8VA 4J2DA 3RMDA 1CZ9A 3I8DA 1MU2A 2FBTA 3HPHA 3I0RA 1TL3A 3SUQA 2P5OA 1KLNA 1B9FA 1DTQA 4DSFA 3SNNA 2RKIA 4W5QA 3K5NA 3LP0A 4O0JA 3L3VA 3G0ZA 3MXMA 1RBSA 4CGHA 1RDCA 3HVRA 4IFYA 1T05A 2P5GA 3NGYA 4IBNA 3DLBA 1C1CA 3M8PA 4KAZA 4KHYA 1RTDA 4M3XA 1VSDA 4O44A 1TKXA 3NE6A 2GUIA 2HVHA 1HYZA 3VQ9A 4CJSA 1S1WA 1IKYA 3ZT1A 4CFBA 5EU7A 2KFNA 4HVJA 4M42A 4PY5A 4CEQA 1BIUA 5DK5A 1Q9XA 5FRNA 3L2UA 2YV0X 1XI1A 1LWFA 3AO2A 3NH1A 3KLGA 4E7HA 1NJYA 3PX4A 3BDPA 1VSHA 4FJIA 1NJZA 4XIUA 4EP4A 2DFEA 2X78A 1BQNA 3KLHA 4ID5A 2FBXA 2FBYA 3DRPA 3LP1A 2E6LA 4M3RA 3V1QA 1QSYA 3OYKA 5FROA 3V4IA 4CJPA 1KRPA 3OVNA 3ULDA 4FLZA 3OS1A 3TAGA 3TI0A 1NK6A 1VSJA 4DU3A 3LPUA 1NK9A 4CFCA 3IRXA 3AVHA 4CJRA 3V9WA 2I5JA 4B9UA 4JRPA 4B9VA 1C6VA 4OPKA 4Z0UA 3MEDA 3QETA 1KCFA 1J5OA 3HL8A 4YNQA 3H08A 3SJJA 2HVIA 3NAEA 3LZJA 4DSEA 4BWJA 4DMNA 3RR7A 4Z4IA 2VG5A 1D8YA 3ZSYA 4FJ9A 2QKBA 4M3TA 2B6AA 2Z1JA 4RW9A 3QNOA 3OYHA 4FLWA 2PY5A 4B9SA 3LAKA 2F8TA 4CEZA 4DSLA 5JS2A 4F2SA 1EKEA 4FW1A 3OS2A 2YKMA 2HHSA 3PO5A 1SL1A 3CM6A 5CY4A 2BGGA 1D5AA 2ETJA 4KKOA 1LW2A 4HHTA 4RW6A 2P1JA 4CJFA 4W5NA 3RWUA 4FZZA 2YNIA 3K58A 1VK0A 1RT5A 2HB5A 4FK4A 4AHVA 3PUFA 3K5OA 3NBPA 4CGGA 3TABA 1S1UA 2W42A 3OYJA 4FJNA 2VG7A 1IH7A 4CF1A 4M41A 1RTIA 2QXFA 4ELTA 3VQDA 5J2PA 1WSFA 2DFHA 2HW3A 3M8SA 1TKTA 3OYEA 4DQIA 5D3GA 2EX3A 3CFPA 2KTQA 4I9QA 3QERA 5KI6A 1ASVA 2RN2A 3OY9A 3HSTB 1JLQA 4O0IA 3AVAA 5J1EA 1RT3A 2F96A 3C94A 5J2NA 3SCXA 3HXMA 4CJ4A 4KPYA 1S9EA 4DLEA 1IG9A 3AVIA 3I0SA 3V9ZA 3PV8A 1REVA 3AA3A 4CJWA 4HUFA 5J2QA 1L3UA 4AILC 2HMIA 4DQQA 3NH0A 1TGOA 3SV3A 4ELVA 4FJJA 3LALA 3HVTA 4DG1A 3DI6A 1A5WA 1HMVA 5C25A 2WOMA 4CK2A 4W5RA 1X9SA 1SL2A 4ICLA 4FJMA 4DSKA 4F3OA 3HP6A 2Q3SA 3DYAA 1W9HA 2DFFA 4CFAA 3QEPA 1L3VA 4PUOA 3VQ5A 3FFIA 2DY4A
chains in the Genus database with same CATH superfamily
1KXPA 3VTIA 3RVCA 4DQPA 3OYAA 3H1VX 1XNQK 1QSSA 3AVMA 1HNXK 4F3TA 2QWMA 5KGWA 3PX0A 4FM1A 2X6NA 3ZT4A 5DMRA 4CHQA 3OYIA 3A5NC 1J9AA 4JLHA 3THYA 4LY7A 4CZLA 5AR0A 3AVKA 4YOTA 1T7PA 3KWIA 1SUQA 4CZJA 1DTTA 3F9MA 3VQ6A 3P39A 3F9KA 3KLFA 4FWMA 4B9NA 4GNIA 3E1YA 3LP3A 4A2BA 4FZYA 2GUPA 3CG7A 1U47A 1XUPO 3JS6A 3K5LA 3DXMB 4MO4A 1ZBLA 3HYFA 5CYQA 2A40A 1WOQA 1BA1A 4DUZK 3RTVA 2G8KA 4BR4A 4FJLA 4WQ5C 4BACA 1W7AA 2A1RA 2KW4A 2CH5A 3DLKA 2YKNA 5BPNA 3B6PA 3OHRA 1ZYQA 3VQ4A 4A61A 4DR6K 3MX5A 1GLLO 3VQ7A 1UA1A 3UE5A 2FF3B 4LF4K 3L2WA 5HL7L 4IO8A 3OJUA 3D2FA 3QBWA 3M3ZA 3GL1A 1GOBA 1QHTA 4Q0BA 2GWJA 3O9TA 3O3HA 3TARA 4ZTFA 3LZIA 4CK1A 4B3TK 4FLXA 3VESA 3C6UA 4CHZA 4ZTJA 5ADXH 4CHOA 1P90A 1BO5O 4BY9C 4DUYK 3BEXA 3MECA 4ILGB 4OLBA 2Z1IA 1C0MA 4CBXA 3KIOA 4JI3K 3E01A 4N56A 1WN7A 1U6ZA 1HPZA 4BDZA 1LCUA 2O4IA 4W5TA 4OGEA 2R7YA 2XY5A 2QKKA 3ZSXA 3NMUA 4O5BA 2NRTA 4BGAA 1VQNN 4OLAA 2V7ZA 5AQJA 4NLCA 3VGLA 5ADXA 5HRNA 1BU6O 4CHPA 1VSEA 1WSGA 4BDYA 1W0HA 4FJ7A 4FYDA 2KFZA 4DQRA 3BUZB 4I2PA 3MN5A 5MLCQ 3SQ2A 3THXA 4Z4HA 2ZGZA 1DLOA 4K43A 1M1KO 1YJWN 2W40A 1W2BM 4QS8A 4DTRA 3K9JA 4DTUA 4FWNA 2OPSA 4B08A 3H6EA 4IFEA 4B8AB 1JLCA 3ITHA 4KTZA 3CCSN 3R6MA 3HK2A 1RDDA 3V1RA 1VHXA 3OYFA 2PZSA 3O1BA 5C0YA 2PYLA 1C1AA 3DAWA 4CEBA 2BE2A 4JKCA 2W41A 1VQ5N 4CD1A 4JHDA 3VQEA 3D2EB 1S72N 1HJRA 2IOCA 2P9NA 3MXJA 4DV5K 1BL3A 2YHXA 4BVPA 4YHHK 3S41A 1X3MA 4BDPA 4H03B 3FZFA 2KHOA 2HNZA 3VPZA 2IGIA 4B1ZA 1JL2A 2V52B 3V6DA 5AQPA 1Q8IA 3SUNA 2P9SA 4FXDA 4XH5A 5LY3A 1Y64A 5HROA 5KPTA 3AARA 3O9UA 1T3VA 4M3UA 4WQ4A 5BN9A 1YITN 4JI5K 3CQYA 4A5BA 1QTMA 4JI8K 5AQWA 4M63C 4OPAA 5DM6L 1OH6A 1RT2A 4I7FA 3WQTA 4CERA 4DQSA 3O9RA 3TTFA 4CJLA 3FFKB 3MEEA 4YOVA 4CZFA 3WXKA 2O4GA 4FVMA 1ASWA 1UWBA 3SAFA 1HNIA 3VERA 5FPMA 2P9PB 4Z94A 2GV9A 2X6SA 2Y1IA 4CIFA 4PKIA 1U45A 1RNHA 4OKJA 3W0LA 5JS1A 1TAUA 1O13A 3F2KA 2XRIA 3V1OA 4FK2A 3LM9A 4CEDA 1ZBIA 4DTJA 4LF8K 4CJVA 3VQBA 3TWHA 3VA0A 1Q82O 4ISGA 2QWPA 1NGCA 3EO3A 4DB3A 2QWLA 1P8ZA 1UA0A 3MCAB 1N6QA 4BRQA 1CLQA 3SBGA 3ZSWA 3ENBA 4O8KA 4C8KA 1VQMN 1VSKA 3EZ5A 4FJGA 2OTJN 3I33A 2UUBK 3K57A 2V51B 5LJWA 1S6PA 1EWRA 2HBLA 3O8MA 4Z4CA 4K0KK 1GLDG 1NK0A 1Y97A 4CJKA 2O8CA 3OYGA 5J2MA 3VEXA 3VQAA 1HRHA 3O3FA 4JS5A 3SQ0A 3CC7N 1TAQA 1K9MO 4N5SA 3ASMA 5KRTA 3NF6A 3RSEB 1IG8A 3K9KA 3DLLL 2PYJA 1VRTA 3HJFA 1NK8A 4X66K 2HNDA 3MDQA 4JKGA 3IG1A 3QEVA 2VQFK 1QVGM 2KZZA 2FBVA 5AQMA 4NXNK 3LP2A 5FPDA 5EXWA 4MDAA 3SLCA 4G1QA 1SAZA 2XY6A 4CGFA 3QDKA 1TL1A 4KHNA 1S22A 1JLBA 3SUOA 4CF0A 3UKRB 1GOAA 4OKEA 3MWTA 4LH4A 2IVOA 1CZ9A 2FBTA 3HPHA 3I0RA 1KLNA 4BRPA 1WBDA 4W5QA 3ENHA 3LP0A 3K5NA 2ASOA 2UYTA 3G0ZA 3L3VA 4DR3K 2H3GX 4UY8O 1RDCA 1YF5L 4IFYA 4BR5A 4CI6A 1NJIO 3NGYA 5CE3A 1C1CA 1RTDA 1TKXA 2QWOA 4CJSA 3J81O 4HVJA 1Q9XA 3LL3A 1VQ7N 1VSHA 1HNZK 4FJIA 4CBWA 2X78A 1BQNA 3CJ7A 3V1QA 2HBJA 1NGAA 2O8FB 1QSYA 5FROA 3OW2M 1KRPA 3ULDA 3C6AA 4WFAL 3CJCA 3VF2A 4DU3A 1NK9A 4CJRA 3V9WA 4OPKA 4Z0UA 1VQ4N 3HL8A 3A0IX 2IIRA 3ULEB 2HVIA 4DSEA 4DMNA 1ATNA 2A3ZA 3ZSYA 4FJ9A 3KK7A 2NZTA 5IT9O 3CCEN 4JYAK 4C23A 5M1OA 3UKUA 5JS2A 4AF1A 4HWIA 2YKMA 4CZMA 1D5AA 2ETJA 1LW2A 3VEWA 4RW6A 3RWUA 2YNIA 1VK0A 4LF6K 3PUFA 3NBPA 1JJ2M 3OYJA 4BROA 1IH7A 4M41A 3R1XA 5J2PA 3MX2A 1WSFA 2E2NA 4GV3A 3QERA 5KI6A 1ASVA 3JXUA 3OY9A 1JLQA 2YHYA 4O0IA 2F9TA 3AVAA 1E4GT 1S9EA 3EL2A 4DLEA 4I6MA 3I0SA 4K25A 3V9ZA 1REVA 2PY5A 3CCJN 2JWLA 4AILC 4DQQA 3SV3A 3WXMB 4DG1A 3DI6A 1A5WA 5GINA 4W5RA 1XMOK 1GLFO 3TSUA 4ICLA 1ATRA 4FJMA 4BRLA 1L3VA 1W9HA 1K8KB 2ASPA 3AV9A 1V4TA 5K14A 1RCHA 4K8ZA 2GWKA 2UXDK 3G10A 1XQSC 3OYDA 4OX9K 2NRVA 3P4IA 3CI5A 4RG8A 3CJ9A 4JEPA 4B3MK 4FLTA 4H5WA 3IS9A 1WSJA 3THWA 4FOIA 1NK7A 2FLOA 3LWMA 1RDAA 3O5BA 4N47A 5FRNA 4RW7A 2VG6A 1NWKA 1BI4B 3HSCA 1ZC6A 5LMNK 4KTQA 4OPJA 2RHKA 3U6FA 3OJSA 3V9SA 5KGXA 2P9KA 2YX6A 4DKWA 1TK8A 4FM0A 3R9PA 3DLHA 2ZE2A 1S5JA 1HQEA 3MWPA 3SMSA 4FVUA 4CHNA 2YNGA 4H4OA 4KHUA 1C0GA 2CH6A 1RFQA 5AQFA 3NGZA 2UUCK 2HBMA 4M7XA 3ZCMA 1EETA 1FKOA 2P9UA 3VETA 4FPAA 2BDPA 4ZHRA 1KVBA 4EZ6A 1RBVA 5IWAK 5GAGP 4AM7A 4HCCA 3VEVA 2A1SA 5EX5A 3DOLA 2VYPA 4H0OA 3RR8A 2QW9A 4EIAA 2OZSA 3BF3A 1RILA 4BG8A 4DTOA 1HUXA 3SAHA 4X65K 4LSNA 4WF9L 3CYMA 1S1VA 1BISA 4O55A 3NVKA 4CZHA 1U2VB 5M1PA 5BN8A 2NRXA 3LDPA 2ZGYA 3IKMA 4CJTA 3P31A 2F8SA 2E4LA 1KC8O 2NUBA 4BR2A 5CZ2A 3OYCA 3N4QA 4AHSA 5LJVA 4Y1CA 4DR1K 3SYZA 3CETA 1BA0A 3G25A 4X64K 3HRGA 4RW8A 1JLGA 1S9GA 1HYVA 3ZT3A 4RW4A 3DXMA 1QQOA 4FWSA 1O1WA 3PSFA 1MA9B 2P9IA 4PL7A 3ZX2A 4X62K 4DLGA 3V9XA 4CBUA 3KVGA 3TAFA 1E3MA 4CGJA 3CCRN 3NVMA 3S3NA 4KTWA 3LPTA 4AHTA 3G6EN 3KKSA 2XY8A 1SKSA 4E1MA 4FJ5A 1ILYA 3DWLA 4XEIA 5JICA 3J80O 3HOSA 4JD2A 4C8MA 5I3UA 5AZJA 4M45A 1NK4A 5AQZA 1KFSA 3FZHA 3ZSRA 1S3XA 2IVNA 3H1QA 5JLHA 3OYLA 2QWQA 1X1PA 5T7BA 3OS0A 3HO1A 4JI4K 3OYBA 5M1KA 4MQ3A 3EE9A 1RT7A 3KWGA 3VF6A 2VWBA 2GBZA 4IFVA 2VWKA 2ITGA 2ZJQL 1BOTO 2HNYA 3QESA 2HHUA 2CGKA 3MXIA 1D9DA 4Y1DA 3J7YP 3VQQA 2KLAA 4CZEA 3A2FA 1YXQA 4NYFA 4LF9K 1BCOA 1U04A 4DFKA 3KD1E 4DS4A 3V9UA 4C8LA 3AY9A 3NGIA 2JGUA 3T3FA 2DPNA 2E2OA 2Q36A 1LWCA 2G8UA 3M8QA 1NMDA 2OZMA 2D0CA 3OBYA 3ZSVA 5M1FA 1HYSA 1LW0A 1JLAA 2ZF5O 5AQOA 4TSXA 4MO5A 4PQUA 1K8AO 3R8EA 4LF7K 4EAHD 3SZ2A 1TUYA 4CECA 4OJRA 3BZCA 3A5OC 3S9HA 4O5FA 2IS3A 3RMAA 2ZD1A 4NB4A 2ITMA 3QEWA 3CQ8A 3PY8A 4KB1A 4IOXA 4BVOA 5HRSA 2A6AA 4IOCL 3AVGA 5H1SQ 4JI2K 4DTMA 2F4VK 1NGHA 3MN9A 3GOIA 4H5VA 3THYB 4A59A 3KKRA 3TAQA 4I9LA 3WNHA 4MFBA 4LFCK 4FCYA 3D2EA 4U67L 4QOZB 1BIZA 3E9OA 3GE1A 1QSLA 4BRKA 5GAEP 2GTDA 1OH8A 1E4FT 1YVUA 4JKDA 4CCHA 4Z4FA 3CF5L 4M7YA 1YUWA 3ATUA 3A8YA 2ASMA 3OA9A 2BANA 2HF4A 3FR0A 2P9LB 1G15A 3KLEA 5BR8K 2OPPA 4PWDA 4IJAA 1WSIA 1U49A 4WFBL 1HNVA 3V81A 4UQGA 1N8RO 3ZT0A 2D0OA 3BP8A 3KHYA 2O8EA 5AFUH 3G4SN 1X9JA 2QEXN 1Z05A 5AQGA 3MAQA 3VA3A 3TAEA 3AVCA 3ISNC 3U9DA 3D2FB 1TKZA 4CJ5A 1T44A 1LWEA 3OYMA 4JN4A 3WNGA 1NK5A 3P38A 2P9PA 3C65A 4EHUA 4C8OA 1L3TA 5AFUA 1QE1A 1GLEG 3QEXA 4B9LA 4FWQA 3WNFA 4GVEA 1RBRA 1S1XA 4H0VB 4XH4A 3O3GA 2VWJA 3KK3A 2V7YA 1NKEA 3VGKA 4PA1A 3IFRA 3JAMO 1SKWA 4H4MA 5AQKA 3H3NO 4DCHA 1IBMK 4J2DA 3PSIA 3I8DA 4CZKA 3SUQA 2P5OA 4A57A 3CJBA 2RKIA 4CGHA 1RGIA 4BRDA 3C7NA 3HVRA 4E1JA 4IBNA 3DLBA 1N32K 4ISFA 3T69A 1FW6A 1VSDA 3VF4A 5AZIB 3ZT1A 3A5MC 5EU7A 4BC3A 4DR4K 4CEQA 1BIUA 2HHTA 2YV0X 3NH1A 4E7HA 3PX4A 4XIUA 2DFEA 4C1NK 3O4WA 1BUPA 2BTFA 3DRPA 3QMLA 2E6LA 3CCMN 3CIPA 2Q31A 3TI0A 1XC3A 3DXKA 3H46O 1H1VA 3IRXA 3AVHA 3CERA 3AAQA 4B9VA 3QETA 4IEIA 1I94K 1QZ6A 2QKBA 4FOEA 2F8TA 4CEZA 4DSLA 4WQ4C 1EKEA 3IUCA 1EWQA 3OS2A 2P9NB 1SL1A 1Q18A 5AQYA 2WFBA 4HHTA 3PLAA 2P1JA 1D4XA 3W3DA 3UKRA 3K58A 1EO1A 4JKAA 2HB5A 4AHVA 4B9QA 1S1UA 4B1VA 2QXFA 2CGLA 4ELTA 4RWTA 2DFHA 4DR2K 4DQIA 5D3GA 3J7ZO 3CFPA 4YOXA 4I9QA 2HF3A 3AGKA 3HSTB 5GAHP 1RT3A 5J2NA 5TKYA 4CJ4A 1IG9A 3PV8A 4JV5K 2QWRA 4CJWA 4NCBA 5J2QA 2HMIA 1TGOA 3Q7CA 2F7TA 4F3OA 2DFFA 4CFAA 3QEPA 3VQ5A 4JRQA 5EVZA 1RTJA 2D0BA 4M3YA 1VSLA 3HP9A 2OYQA 3HOTA 2Z1GA 2ZJRL 3M8RA 1ITGA 3DMJA 1GLBG 4FWOA 3KJVA 4JK7A 2G8IA 4E19A 3ULEA 5AQTA 3AO1A 5C12A 2RE2A 4KRFA 3NDKA 1WAFA 4AHCA 4R5PA 2JWKA 3D45A 3HBTA 4N41A 4E89A 3O1WA 4E0DA 1HKGA 2P51A 1MWMA 2FF6A 3EY1A 1HKCA 3AO4A 1VQLN 5CR4A 2Q0UA 3AVJA 4DR7K 4AM6A 3BF1A 3K2PA 3T19A 1ASUA 3S3OA 2E2QA 4IXCA 4CESA 2YHAA 2G8HA 3L2RA 1LOTB 5I9EB 2B4JA 2JLEA 1F21A 1LV5A 1KAYA 1NOZA 5F2RA 4BG9A 1Z6RA 2O8BB 4O4GA 3I8BA 4GV6A 5JMVA 3SI6A 3QICA 1HKBA 1KFDA 2O8CB 4NCAA 2HHHK 1S6QA 4FLYA 1KLMA 4KHPK 3L8BA 5AQXA 3WXJA 3C95A 5AQHA 4BWMA 4KH6A 4IWVA 2IAJA 3SAGA 3T1AA 4DU1A 4KPYA 3F73A 1K8KA 4KB0A 3WT0A 2NNWA 5FRMA 2W6KA 4JKGB 3VQCA 1WUAA 1CXUA 4CEEA 3QLHA 1A5VA 1S1TA 2E20A 2LSNA 2FSNA 1KAZA 2XY7A 3ZSZA 4Z4EA 4DSJA 1TUUA 2YJFA 2VGMA 1KVCA 4CF8A 3VGMA 4RCHA 5BRDA 2IC3A 4CIGA 5KPZA 1EXQA 1C0UA 3AVFA 3BGRA 3P83D 4KI6A 3TAMA 4B9TA 1RDUA 2ZQBA 4JKFA 2AA4A 2IDOA 4DR5K 4E7LA 3EEQA 3K5MA 1KSPA 4FM2A 1OKJA 1BWFO 1HX1A 3TR8A 3CC2N 1BHLA 4AHUA 3HM9A 3VQ8A 4IDHA 1VQPN 4FJ8A 3NHGA 1YTUA 3QIPA 1KAXA 4OPHA 4ELUA 2YNHA 1ZBUA 1FJGK 1J6ZA 1YJNN 3O4QA 2HSTA 2FC0A 4J2EA 1C0TA 4MLHA 1ESVA 1VSIA 1G99A 4E7IA 1RBTA 5FDLA 3C6HA 3MN7A 2D1KA 1B92A 4KHQA 4L8RB 4KV8A 1TYQA 3C6TA 4CW7B 1KTQA 1WB9A 1RT4A 5E26A 4KO0A 3NH2A 3VOVA 3UKUB 4LD0A 1T6CA 3AO5A 3WXLA 5FPEA 5KRSA 3EYZA 4B8CA 3LDSA 2ZJPL 1HQUA 3ZEUA 1QHAA 2XO7A 1WNSA 1QQCA 2QWNA 1HR0K 4CZIA 4J2BA 1VRUA 4IO9L 2A42A 2D0AA 4AQYK 2E6MA 2A5XA 1SKRA 4DFMA 3NFAA 3QEIA 3WEEA 4K42A 2HBKA 5AQNA 4WFNL 3ID8A 2G8WA 1C1BA 5M1NA 1U48A 3T1HK 1X9MA 2ATQA 3CCQN 3CJAA 2UU9K 2O8DB 3ZETA 4FWLA 1NGBA 1OVYA 3F5TA 3M1FA 1NBWA 4GKKK 3KK2A 3JYTA 1BQMA 3THVA 4J2AA 4BRNA 4JAXA 1JKHA 1YAGA 5BRHA 1NG9A 1B9DA 4FWKA 3R3LA 3QNNA 2RPIA 2OCEA 4JKEA 4KH4A 3I55N 4CFDA 2PFUA 4CJEA 4CJQA 4EZ9A 3MN6A 4WE1A 5BREA 1T03A 3M6GA 1X3NA 3AVLA 3KK1A 4JK8A 4RTFD 1I39A 2WUSA 1GLCG 3B6OA 4F4KA 1ZBSA 4OO1J 2HOEA 1RT6A 4FK0A 1SS6A 4NCGA 1NGJA 5AQVA 4O8UA 2D0PA 3L4QA 2YI1A 3THWB 1XNRK 3NF8A 4DV3K 1SV5A 4HTLA 4DV4K 3P5JA 4DQ8A 5C24A 1NKBA 3SPYA 4KHSA 2UXBK 1QQMA 2P9KB 4NO7A 3KZBA 3O6WA 4CF2A 1ZBHA 1VQKN 1CZAN 2CGJA 4N76A 4E1NA 3QINA 1XHXA 5KPRA 4WYBA 1IBLK 3DOKA 4L3QA 5LL6Z 4CJUA 4FWPA 3VMFB 2Y1JA 4MDBA 4BE1A 1IJJA 3AVBA 4BE2A 5AQIA 3FZLA 3L0QA 3SBTA 5FLXO 2I7NA 4LC9B 1Z26A 1IO2A 1Q86O 1VQ9N 4M3WA 2E1YA 2P9UB 5GIOA 5KTQA 1SL0A 3VEOA 4CK3A 4DV0K 3WNEA 4OVLA 3FE1A 3TPQA 4H0YB 3JSMA 3LANA 1LAWA 2YJEA 4YOYA 4CZGA 5DM7L 4XH1A 3NF7A 4BREA 4KI4A 3AA4A 3EKSA 4H5TA 3VQPA 1FKPA 4E7JA 5AQUA 1UAXA 3U9ZA 2X74A 4WQ5A 3HZ6A 2I7PA 1DGKN 5C10A 1NGFA 3HT3A 3U3YA 3CJ1A 5JVHL 4DV1K 3RMBA 4DHYA 5GADP 3VN5A 4IOAL 1TVRA 1I3AA 4GMJB 3RMDA 1MU2A 3BY5A 1TL3A 4JI7K 4DSFA 3CXCM 3SNNA 2ZWHA 4O0JA 3MXMA 1RBSA 4GV9A 2Q0RA 5AQSA 2UXCK 3TSQA 3M8PA 4M3XA 1BG3A 3NE6A 2GUIA 2P9LA 1S1WA 1IKYA 2P9IB 5HOOA 2KFNA 1DKGD 3EN9A 3L6QA 1XI1A 1SQKA 3KLGA 3LM2A 5AQRA 4YDUA 1N33K 4EP4A 4MLEA 4QS9A 3KLHA 4PL8A 4M3RA 3OYKA 3V4IA 4CJPA 3LDOA 4JD2B 3OVNA 4FLZA 2E5LK 1VSJA 3LPUA 3ZYYX 5BR9A 5AZJB 4B9UA 4YOUA 1C6VA 3MEDA 2WC9A 1KCFA 3B8AX 1J5OA 4B3RK 3QB0A 3ATVA 3TTCA 3NAEA 3RR7A 4LF5K 4M3TA 2Z1JA 4JKHA 3QNOA 3OYHA 4B9SA 3LAKA 1YVNA 2E1ZA 2UUAK 4YY3K 5CY4A 2BGGA 2YHWA 4KKOA 4CJFA 5AQQA 4FZZA 5KQDA 1RT5A 2FSJA 4H0PA 1MWKA 3K5OA 4CGGA 4YDUC 3TABA 3O9SA 2E88A 4JKBA 3VQDA 2NRHA 2HW3A 3M8SA 4KBOA 1TKTA 3OYEA 2EX3A 1SZ2A 1T6DA 2KTQA 5E84A 2RN2A 4B1XB 2HMPA 5J1EA 5AZIA 3AVIA 4HUFA 1L3UA 4ELVA 4FJJA 4BR9A 4FPBA 1K73O 3VEYA 4B3SK 2GX9A 4KH5A 5C25A 5M1QA 1X9SA 4CK2A 4DSKA 3HP6A 1J5EK 3H3OB 4GY2B 2DY4A 2F9WA 3MK6A 3TANA 3IAYA 4F8RA 5BRFA 4F2RA 1TV6A 4GW6A 1TK0A 4BRFA 3KD5E 3CD6N 4DWIA 1T8EA 2KKZA 1RBUA 2QA4N 3LDLA 5EY4A 4CE9A 4K8XA 2FSKA 4FL9A 3PO4A 3DJCA 3O08A 2WTUA 2HHWA 4ID1A 1C0FA 3L2VA 3K59A 4DTNA 4EP5A 3GG4A 3N4PA 4GKJK 5B8HA 1TK5A 3KTQA 1UOCA 2XHBA 4DF8A 3ENOA 3PX6A 3AO3A 4HUEA 3K0SA 4DFJA 4DU4A 1A5XA 4CJ7A 1NMNA 3O9QA 4HCBA 1QS4A 1EX4A 2B5JA 4DTXA 2QI2A 4B1UB 5HRPA 1L3SA 1J53A 1YT3A 2PAVA 4B9MA 4FJNA 3THXB 4C1NI 3TAPA 4W5OA 5HBMA 5BPMA 3ZX3A 4YFUA 3HPOA 1VQ6N 5C42A 1NOYA 3GDQA 2O8EB 4BRMA 1NNEA 4DF4A 1N5YA 2BUPA 3ZSOA 1KVAA 3CMAN 3L3UA 1Z25A 4BGBA 1YJ9N 3DLRA 3FGUA 3MEGA 4PKGA 3RSEA 1BCMA 4C8NA 4J8FA 5CYMA 1IKVA 4E7KA 3LWLA 3CFRA 1GOCA 1K6YA 4AH9A 3CHWA 4H0XB 4CGDA 4JS4A 3DLEA 4BE0A 4DV6K 3LDQA 4Q5VA 3AA5X 1RT1A 4IDKA 4EHTA 4JHDB 1X9WA 3ZT2A 3CFOA 3GBTA 3TSPA 1JCEA 2Q97A 4U7BA 3HTVA 3RMCA 2Q2RA 4IG3A 1NJXA 4Z4GA 1NJWA 3U4LA 3QIOA 2IVPA 4KFBA 1YIJN 4AHRA 3DRRA 3LAMA 3AVNA 5SZTA 2QM1A 2P9SB 2W6LA 1R0AA 5HP1A 4CD3A 4ISEA 3C7NB 1RTHA 5C2DA 1XWLA 2OPQA 1NGEA 3HPGA 2VQEK 1IKWA 2AJQA 1ZBFA 5E41A 3CM5A 4DV2K 3CCVN 1JXEA 2O8BA 2KZMA 5HLFA 1YTAA 2HHVA 4H5NA 1KD1O 4LFBK 2O8FA 4H8KA 4M3ZA 1VSFA 2WBNA 3NF9A 3UB5A 4IEEA 1HLUA 1GLJO 4I2QA 3ZLJA 1FXXA 5C2FA 4BC2A 3DXKB 4CGIA 3WXIA 1YHQN 4ILJA 4FJXA 3L4IA 3RRGA 4FJKA 3SPZA 4E3SA 2AP1A 4IG0A 3E9LA 4B1WB 1QVFM 1NKCA 4BRGA 4YORA 5BPLA 2WONA 1XHZA 3RRHA 3AGRA 3O80A 3OBWA 1OH7A 2Z1HA 2PBDA 4V19S 3NCIA 2E2PA 1D9FA 4KREA 4FW2A 5F0XA 2HHQA 4F9OA 4OKKA 3KLIA 2FXUA 1U4BA 4NYNA 3S3MA 3PIPL 3QO9A 5I42A 3CCLN 3WQUA 4QCLA 1HNWK 4JI6K 1IKXA 3H45C 1NLVA 3DLGA 4LSLA 4R79A 4CHYA 3G71N 3J7AP 1NGGA 5ELZA 2D5RA 1EP4A 1JLFA 1Q7YO 1JL1A 3SUPA 2NRRA 4HTUA 1WSEA 4K41A 3LDNA 2YNFA 4QS7A 5AJ3K 1N36K 3E66A 1VAZA 3UIQA 4CF9A 4OGCA 2OANA 2YCHA 4FJHA 2NRWA 2D4WA 3D0PA 1VQON 1QZ5A 1TKDA 3MMVA 1N34K 4DTSA 4H0TB 5HRRA 1Q9YA 1LAVA 5SWMA 3O4NA 4KHWA 2A41A 1J54A 3EZWA 3TTDA 3SK3A 4FLVA 4FLUA 2YHBA 4DS5A 1EQYA 5EOYA 3PIOL 2HHXA 4NXMK 1JLEA 3DRSA 3OYNA 2DTUA 3ZSQA 3Q7BA 3SJHA 3U3GA 2GEMA 3AA2A 1BI4A 3HI0A 2Q1NA 1MDUB 1Q81O 2VCPA 4JI0K 3ALYA 5FPNA 2RF2A 5CZ1A 1OH5A 4QAGA 3QFUA 1CZBA 4DTPA 3QFPA 1FK9A 3J8AA 5KQ8A 5JLFA 4IKFA 1XC9A 3M5RA 1R59O 1DEJA 4GVMA 2NLXA 2G8FA 2KQ2A 1WAJA 5JVGL 1KQSM 1DT9A 2O8DA 4BQZA 3CMEN 2ZM6K 4LH5A 3I56N 4JNEA 4DSIA 1RDBA 1XMQK 3D6RA 3FZMA 2QK9A 3VENA 3FLCO 5C15A 4LFAK 4DFPA 4CIEA 3P1GA 2EHGA 3T1YK 1WSHA 1BGXT 1L5UA 2QXLA 3SV4A 2OA8A 2GELA 4CJ3A 3IDHA 1CXQA 4ILHA 4CEFA 3SQ1A 3T7ZA 4FZXC 3A5LC 4BRCA 4B3OA 4CEAA 3IMXA 1GLAG 4EFHA 1WLJA 3SQ4A 1VSMA 3DM2A 4PHTX 1IV0A 2OPRA 1JXBA 4Y0WA 3U8XA 5TKWA 3L2QA 4HUGA 1OVQA 1HJOA 2BH1A 4CEOA 1U2VA 3WUHA 4JI1K 2G8VA 1V4SA 1RDWX 2J4RA 4FO0A 3CQXA 5F1XA 1NGIA 3AAPA 1B9FA 4BRAA 1DTQA 4YOWA 3SMPA 1T05A 4NLBA 3C0BA 2P5GA 1VQ8N 4KAZA 4KHYA 5CHIA 2E8AA 4O44A 2HVHA 1HYZA 3VQ9A 4I6MB 4CFBA 3ID6A 4PY5A 4M42A 4JK9A 5DK5A 5LMUK 1QQNA 1HPMA 3L2UA 1LWFA 3AO2A 1NJYA 3BDPA 3BZKA 1NGDA 5AQLA 3E9PA 4WCEL 1NJZA 3FZKA 4ID5A 2FBXA 2FBYA 3LP1A 4DV7K 4BRIA 3OS1A 3TAGA 1NK6A 5A2QO 4H5RA 4A2AA 4CFCA 4FWRA 1YI2N 2I5JA 4JRPA 4FSVA 4YNQA 3H08A 3HM8A 3CPWM 3SJJA 1M90O 3LZJA 1NM1A 4Z4IA 4BWJA 1TYQB 2VG5A 1D8YA 4BRHA 2B6AA 4RW9A 4BR7A 1ATSA 4CVNE 4A62A 1W97L 3CC4N 4FLWA 3EKUA 4F2SA 3ZX0A 3CCUN 4A5AA 4FW1A 2HHSA 2EWSA 3PO5A 3VEZA 3ZEUB 3CM6A 1NU0A 3MCPA 4G9ZA 4PKHA 4IJNA 4W5NA 4BC5A 4FK4A 4BR0A 2W42A 3WEEB 4B1YB 2VG7A 4CF1A 3OTOK 5GIPA 1RTIA 2NRZA 2VGNA 1JCGA 1WBBA 3ZETB 4BC4A 3EE8A 1ZXOA 3QBXA 3D7EO 4BQLA 1JCFA 2QTDA 2F96A 3C94A 3SCXA 3HXMA 3CPEA 3AA3A 3NH0A 3TU5A 3LALA 3HVTA 1IBKK 1HMVA 2WOMA 4IZ9A 1BDGA 1SL2A 4PUOA 2Q3SA 3DYAA 3VTHA 2OTLN 3FFIA
chains in the Genus database with same CATH topology
3AV9A 4DQPA 4JRQA 3OYAA 1RTJA 5K14A 3U6FA 2D0BA 3TANA 3IAYA 4M3YA 1RCHA 1VSLA 1QSSA 4F8RA 3HP9A 2OYQA 3AVMA 2Z1GA 4K8ZA 4F3TA 4F2RA 3M8RA 3G10A 1ITGA 5KGWA 1TV6A 4GW6A 3OYDA 4FM1A 2X6NA 3PX0A 3DMJA 3ZT4A 1TK0A 3KD5E 4DWIA 1T8EA 5DMRA 1RBUA 4RG8A 3KJVA 2G8IA 4E19A 4CHQA 3OYIA 4FLTA 4CE9A 4K8XA 3IS9A 1J9AA 1WSJA 3AO1A 4JLHA 4LY7A 1NK7A 3PO4A 4KRFA 3NDKA 1WAFA 3AVKA 1RDAA 4ID1A 4AHCA 4N47A 3LWMA 4R5PA 3D45A 1T7PA 3L2VA 4RW7A 4N41A 1SUQA 3K59A 2VG6A 4DTNA 4EP5A 1DTTA 4E89A 3VQ6A 4E0DA 1BI4B 3F9KA 3KLFA 1TK5A 3KTQA 4KTQA 1UOCA 2P51A 4OPJA 2XHBA 3EY1A 3AO4A 3OJSA 3V9SA 4DF8A 5KGXA 4B9NA 3PX6A 3AO3A 3AVJA 4HUEA 1TK8A 3LP3A 3K2PA 4FM0A 3T19A 4DU4A 1ASUA 4DFJA 4FZYA 1A5XA 3S3OA 3CG7A 3DLHA 4CESA 1U47A 4HCBA 2ZE2A 1S5JA 1QS4A 1EX4A 1HQEA 3K5LA 2B5JA 2YHAA 2G8HA 3L2RA 5HRPA 4DTXA 3HYFA 1ZBLA 1L3SA 5CYQA 1J53A 3RTVA 1YT3A 2B4JA 2JLEA 1F21A 2YNGA 4H4OA 4CHNA 3TAPA 1LV5A 2G8KA 4B9MA 1NOZA 4W5OA 4BACA 4FJLA 4KHUA 5HBMA 4O4GA 3NGZA 2A1RA 4YFUA 3HPOA 5C42A 2KW4A 1NOYA 3ZCMA 3SI6A 3DLKA 1EETA 1FKOA 2YKNA 3B6PA 4DF4A 3VQ4A 1ZYQA 1N5YA 1KFDA 3ZSOA 2BDPA 4NCAA 1KVAA 3VQ7A 1UA1A 3L3UA 4ZHRA 1KVBA 1S6QA 4FLYA 1KLMA 1Z25A 3L2WA 4EZ6A 1RBVA 3L8BA 3DLRA 3OJUA 3C95A 3MEGA 4HCCA 2A1SA 4BWMA 1BCMA 1GOBA 1QHTA 3DOLA 5CYMA 4C8NA 4Q0BA 1IKVA 4E7KA 2IAJA 3RR8A 3T1AA 3O3HA 3LWLA 3CFRA 4DU1A 3F73A 3TARA 4ZTFA 1GOCA 1K6YA 3LZIA 4CK1A 1RILA 4AH9A 2OZSA 4KB0A 4FLXA 4JS4A 4CGDA 4BE0A 3DLEA 4DTOA 5FRMA 4Q5VA 3VQCA 3AA5X 3C6UA 4CHZA 1CXUA 4CEEA 4ZTJA 3QLHA 1RT1A 4IDKA 1X9WA 4LSNA 1A5VA 1S1TA 2LSNA 3ZT2A 2XY7A 3CYMA 3CFOA 4CHOA 1S1VA 1BISA 3ZSZA 4O55A 4Z4EA 4DSJA 3MECA 4OLBA 2Z1IA 1C0MA 3KIOA 3RMCA 1KVCA 4IG3A 3E01A 4CF8A 1NJXA 4Z4GA 2IC3A 4CIGA 2HHWA 4N56A 1WN7A 1NJWA 1EXQA 1C0UA 3AVFA 1HPZA 3BGRA 3P83D 3QIOA 3TAMA 4CJTA 4BDZA 2E4LA 2F8SA 4B9TA 4KFBA 2NUBA 2ZQBA 2O4IA 2IDOA 4AHRA 4W5TA 4OGEA 3DRRA 3LAMA 5CZ2A 3OYCA 3AVNA 4AHSA 5SZTA 2R7YA 4E7LA 2XY5A 3ZSXA 3K5MA 1R0AA 4O5BA 4Y1CA 1KSPA 4FM2A 2QKKA 4OLAA 3SYZA 5HP1A 3TR8A 1RTHA 1JLGA 4RW8A 1XWLA 1S9GA 1HYVA 5HRNA 1BHLA 2OPQA 4AHUA 1VSEA 3ZT3A 4CHPA 3HM9A 1WSGA 4RW4A 3VQ8A 3HPGA 4BDYA 1W0HA 1IKWA 1O1WA 3NHGA 4FJ7A 4FJ8A 4FYDA 2AJQA 1ZBFA 2KFZA 5E41A 1YTUA 4DQRA 4DLGA 3V9XA 3CM5A 3QIPA 4I2PA 3TAFA 3SQ2A 4CGJA 2YNHA 1ZBUA 4ELUA 4Z4HA 3S3NA 4KTWA 1JXEA 3LPTA 4AHTA 1DLOA 5HLFA 2KZMA 3KKSA 3O4QA 1YTAA 2FC0A 2XY8A 1C0TA 4E1MA 1SKSA 4FJ5A 4J2EA 2HHVA 4H8KA 4M3ZA 1VSFA 4DTRA 3NF9A 4C8MA 4I2QA 4DTUA 1FXXA 1VSIA 4E7IA 1RBTA 5FDLA 5I3UA 4CGIA 4M45A 2OPSA 4B08A 1NK4A 1B92A 1KFSA 4KHQA 4B8AB 4L8RB 4FJXA 1JLCA 3ITHA 3RRGA 3SPZA 4KTZA 4KV8A 4FJKA 4E3SA 3ZSRA 3HK2A 1RDDA 4IG0A 3C6TA 3V1RA 1KTQA 3OYFA 3OYLA 1NKCA 2PZSA 1RT4A 2WONA 1X1PA 5T7BA 3OS0A 3RRHA 1XHZA 2PYLA 3HO1A 1C1AA 4KO0A 3NH2A 4CEBA 2BE2A 4LD0A 3AO5A 2Z1HA 3LDSA 5KRSA 3OYBA 3EYZA 3VQEA 4MQ3A 4B8CA 1HJRA 1HQUA 1RT7A 2IOCA 3MXJA 3NCIA 1D9FA 1BL3A 2XO7A 2GBZA 1WNSA 4IFVA 4KREA 2VWKA 1QQCA 4FW2A 2ITGA 4BDPA 2HHQA 2HNYA 3QESA 2HHTA 2HHUA 4OKKA 3MXIA 4J2BA 1VRUA 1D9DA 3KLIA 2D0AA 2HNZA 2E6MA 1SKRA 1U4BA 4DFMA 3NFAA 4NYNA 3QEIA 4Y1DA 4NCBA 3VQQA 3S3MA 3A2FA 2G8WA 4NYFA 1C1BA 2IGIA 1U48A 3QO9A 1JL2A 3V6DA 5I42A 1Q8IA 4QCLA 3SUNA 1BCOA 1U04A 4DFKA 1X9MA 2ATQA 1IKXA 4FXDA 5HROA 3DLGA 4LSLA 4CHYA 3KD1E 2D5RA 1EP4A 4DS4A 4M3UA 1JLFA 3KK2A 3JYTA 1BQMA 3THVA 3V9UA 4C8LA 3NGIA 1JL1A 2JGUA 3T3FA 4J2AA 3SUPA 1LWCA 4HTUA 1WSEA 2G8UA 3M8QA 2OZMA 1QTMA 1JKHA 4KI6A 2YNFA 2D0CA 1B9DA 1RT2A 3ZSVA 4I7FA 1HYSA 1LW0A 1JLAA 4CERA 4DQSA 4TSXA 4PQUA 3QNNA 2RPIA 4CJLA 3MEEA 3UIQA 4CF9A 4OGCA 3SZ2A 4CFDA 2O4GA 4FVMA 4CJEA 4CJQA 4EZ9A 4CECA 1ASWA 1UWBA 4WE1A 4FJHA 4OJRA 1HNIA 3D0PA 1T03A 3AVLA 3S9HA 1TKDA 2IS3A 2GV9A 3KK1A 1I39A 3RMAA 4DTSA 2X6SA 2ZD1A 2Y1IA 5HRRA 4CIFA 3QEWA 3B6OA 1Q9YA 4F4KA 1U45A 1LAVA 1RNHA 5SWMA 1RT6A 3O4NA 4FK0A 4OKJA 4NCGA 3CQ8A 3PY8A 4KB1A 4KHWA 5HRSA 1TAUA 1J54A 2XRIA 3V1OA 4FK2A 5JS1A 3AVGA 4FLVA 4FLUA 2YHBA 4CEDA 4DTMA 1ZBIA 4DS5A 4DTJA 4CJVA 2HHXA 3NF8A 1JLEA 3DRSA 3KKRA 3VQBA 1SV5A 3OYNA 3TWHA 3VA0A 3TAQA 4I9LA 3WNHA 3ZSQA 2DTUA 3U3GA 4MFBA 3AA2A 1BI4A 3P5JA 4FCYA 4QOZB 1BIZA 1QSLA 5C24A 1NKBA 3SPYA 4KHSA 3ALYA 1YVUA 4CCHA 4Z4FA 2RF2A 1ZBHA 5CZ1A 4CF2A 4QAGA 1CZBA 4DTPA 1UA0A 1FK9A 2BANA 4IKFA 4N76A 1N6QA 1G15A 1XC9A 1CLQA 3KLEA 3ZSWA 4E1NA 3QINA 1XHXA 2OPPA 4PWDA 4C8KA 1WSIA 4GVMA 3DOKA 4CJUA 2G8FA 2KQ2A 1VSKA 1WAJA 3EZ5A 1U49A 4FJGA 3K57A 2Y1JA 1HNVA 4BE1A 3V81A 4UQGA 3AVBA 3ZT0A 4LH5A 4BE2A 4DSIA 1RDBA 1S6PA 4Z4CA 1NK0A 2QK9A 1Z26A 1IO2A 1Y97A 4CJKA 4DFPA 4M3WA 4CIEA 3P1GA 3OYGA 5J2MA 2EHGA 5KTQA 1SL0A 1WSHA 1BGXT 1L5UA 3VQAA 1HRHA 3O3FA 3MAQA 3SV4A 4JS5A 3VA3A 3SQ0A 2OA8A 1TAQA 4CJ3A 4CK3A 4N5SA 3TAEA 3AVCA 3ISNC 3WNEA 3ASMA 1TKZA 4OVLA 5KRTA 1CXQA 3NF6A 4CEFA 3SQ1A 4FZXC 4CJ5A 3JSMA 3LANA 1LAWA 1LWEA 2PYJA 3OYMA 1VRTA 3HJFA 4CEAA 4B3OA 3NF7A 3WNGA 1NK5A 3AA4A 1NK8A 4KI4A 3VQPA 1WLJA 1FKPA 2HNDA 4E7JA 1UAXA 3SQ4A 3IG1A 3QEVA 1VSMA 2X74A 2KZZA 2FBVA 4C8OA 3DM2A 1L3TA 1QE1A 3LP2A 3HT3A 3QEXA 4B9LA 2OPRA 1JXBA 3U3YA 4G1QA 2XY6A 3WNFA 1RBRA 1S1XA 4CGFA 3O3GA 3L2QA 1TL1A 4HUGA 4KHNA 1JLBA 2VWJA 3RMBA 3SUOA 4CF0A 3KK3A 4CEOA 1NKEA 4PA1A 1SKWA 4H4MA 3VN5A 1TVRA 1GOAA 1I3AA 4GMJB 4LH4A 4OKEA 2G8VA 4J2DA 3RMDA 1CZ9A 3I8DA 1MU2A 2FBTA 3HPHA 3I0RA 1TL3A 3SUQA 2P5OA 1KLNA 1B9FA 1DTQA 4DSFA 3SNNA 2RKIA 4W5QA 3K5NA 3LP0A 4O0JA 3L3VA 3G0ZA 3MXMA 1RBSA 4CGHA 1RDCA 3HVRA 4IFYA 1T05A 2P5GA 3NGYA 4IBNA 3DLBA 1C1CA 3M8PA 4KAZA 4KHYA 1RTDA 4M3XA 1VSDA 4O44A 1TKXA 3NE6A 2GUIA 2HVHA 1HYZA 3VQ9A 4CJSA 1S1WA 1IKYA 3ZT1A 4CFBA 5EU7A 2KFNA 4HVJA 4M42A 4PY5A 4CEQA 1BIUA 5DK5A 1Q9XA 5FRNA 3L2UA 2YV0X 1XI1A 1LWFA 3AO2A 3NH1A 3KLGA 4E7HA 1NJYA 3PX4A 3BDPA 1VSHA 4FJIA 1NJZA 4XIUA 4EP4A 2DFEA 2X78A 1BQNA 3KLHA 4ID5A 2FBXA 2FBYA 3DRPA 3LP1A 2E6LA 4M3RA 3V1QA 1QSYA 3OYKA 5FROA 3V4IA 4CJPA 1KRPA 3OVNA 3ULDA 4FLZA 3OS1A 3TAGA 3TI0A 1NK6A 1VSJA 4DU3A 3LPUA 1NK9A 4CFCA 3IRXA 3AVHA 4CJRA 3V9WA 2I5JA 4B9UA 4JRPA 4B9VA 1C6VA 4OPKA 4Z0UA 3MEDA 3QETA 1KCFA 1J5OA 3HL8A 4YNQA 3H08A 3SJJA 2HVIA 3NAEA 3LZJA 4DSEA 4BWJA 4DMNA 3RR7A 4Z4IA 2VG5A 1D8YA 3ZSYA 4FJ9A 2QKBA 4M3TA 2B6AA 2Z1JA 4RW9A 3QNOA 3OYHA 4FLWA 2PY5A 4B9SA 3LAKA 2F8TA 4CEZA 4DSLA 5JS2A 4F2SA 1EKEA 4FW1A 3OS2A 2YKMA 2HHSA 3PO5A 1SL1A 3CM6A 5CY4A 2BGGA 1D5AA 2ETJA 4KKOA 1LW2A 4HHTA 4RW6A 2P1JA 4CJFA 4W5NA 3RWUA 4FZZA 2YNIA 3K58A 1VK0A 1RT5A 2HB5A 4FK4A 4AHVA 3PUFA 3K5OA 3NBPA 4CGGA 3TABA 1S1UA 2W42A 3OYJA 4FJNA 2VG7A 1IH7A 4CF1A 4M41A 1RTIA 2QXFA 4ELTA 3VQDA 5J2PA 1WSFA 2DFHA 2HW3A 3M8SA 1TKTA 3OYEA 4DQIA 5D3GA 2EX3A 3CFPA 2KTQA 4I9QA 3QERA 5KI6A 1ASVA 2RN2A 3OY9A 3HSTB 1JLQA 4O0IA 3AVAA 5J1EA 1RT3A 2F96A 3C94A 5J2NA 3SCXA 3HXMA 4CJ4A 4KPYA 1S9EA 4DLEA 1IG9A 3AVIA 3I0SA 3V9ZA 3PV8A 1REVA 3AA3A 4CJWA 4HUFA 5J2QA 1L3UA 4AILC 2HMIA 4DQQA 3NH0A 1TGOA 3SV3A 4ELVA 4FJJA 3LALA 3HVTA 4DG1A 3DI6A 1A5WA 1HMVA 5C25A 2WOMA 4CK2A 4W5RA 1X9SA 1SL2A 4ICLA 4FJMA 4DSKA 4F3OA 3HP6A 2Q3SA 3DYAA 1W9HA 2DFFA 4CFAA 3QEPA 1L3VA 4PUOA 3VQ5A 3FFIA 2DY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV9 A;  4DQP A;  4JRQ A;  3OYA A;  1RTJ A;  5K14 A;  3U6F A;  2D0B A;  3TAN A;  3IAY A;  4M3Y A;  1RCH A;  1VSL A;  1QSS A;  4F8R A;  3HP9 A;  2OYQ A;  3AVM A;  2Z1G A;  4K8Z A;  4F3T A;  4F2R A;  3M8R A;  3G10 A;  1ITG A;  5KGW A;  1TV6 A;  4GW6 A;  3OYD A;  4FM1 A;  2X6N A;  3PX0 A;  3DMJ A;  3ZT4 A;  1TK0 A;  3KD5 E;  4DWI A;  1T8E A;  5DMR A;  1RBU A;  4RG8 A;  3KJV A;  2G8I A;  4E19 A;  4CHQ A;  3OYI A;  4FLT A;  4CE9 A;  4K8X A;  3IS9 A;  1J9A A;  1WSJ A;  3AO1 A;  4JLH A;  4LY7 A;  1NK7 A;  3PO4 A;  4KRF A;  3NDK A;  1WAF A;  3AVK A;  1RDA A;  4ID1 A;  4AHC A;  4N47 A;  3LWM A;  4R5P A;  3D45 A;  1T7P A;  3L2V A;  4RW7 A;  4N41 A;  1SUQ A;  3K59 A;  2VG6 A;  4DTN A;  4EP5 A;  1DTT A;  4E89 A;  3VQ6 A;  4E0D A;  1BI4 B;  3F9K A;  3KLF A;  1TK5 A;  3KTQ A;  4KTQ A;  1UOC A;  2P51 A;  4OPJ A;  2XHB A;  3EY1 A;  3AO4 A;  3OJS A;  3V9S A;  4DF8 A;  5KGX A;  4B9N A;  3PX6 A;  3AO3 A;  3AVJ A;  4HUE A;  1TK8 A;  3LP3 A;  3K2P A;  4FM0 A;  3T19 A;  4DU4 A;  1ASU A;  4DFJ A;  4FZY A;  1A5X A;  3S3O A;  3CG7 A;  3DLH A;  4CES A;  1U47 A;  4HCB A;  2ZE2 A;  1S5J A;  1QS4 A;  1EX4 A;  1HQE A;  3K5L A;  2B5J A;  2YHA A;  2G8H A;  3L2R A;  5HRP A;  4DTX A;  3HYF A;  1ZBL A;  1L3S A;  5CYQ A;  1J53 A;  3RTV A;  1YT3 A;  2B4J A;  2JLE A;  1F21 A;  2YNG A;  4H4O A;  4CHN A;  3TAP A;  1LV5 A;  2G8K A;  4B9M A;  1NOZ A;  4W5O A;  4BAC A;  4FJL A;  4KHU A;  5HBM A;  4O4G A;  3NGZ A;  2A1R A;  4YFU A;  3HPO A;  5C42 A;  2KW4 A;  1NOY A;  3ZCM A;  3SI6 A;  3DLK A;  1EET A;  1FKO A;  2YKN A;  3B6P A;  4DF4 A;  3VQ4 A;  1ZYQ A;  1N5Y A;  1KFD A;  3ZSO A;  2BDP A;  4NCA A;  1KVA A;  3VQ7 A;  1UA1 A;  3L3U A;  4ZHR A;  1KVB A;  1S6Q A;  4FLY A;  1KLM A;  1Z25 A;  3L2W A;  4EZ6 A;  1RBV A;  3L8B A;  3DLR A;  3OJU A;  3C95 A;  3MEG A;  4HCC A;  2A1S A;  4BWM A;  1BCM A;  1GOB A;  1QHT A;  3DOL A;  5CYM A;  4C8N A;  4Q0B A;  1IKV A;  4E7K A;  2IAJ A;  3RR8 A;  3T1A A;  3O3H A;  3LWL A;  3CFR A;  4DU1 A;  3F73 A;  3TAR A;  4ZTF A;  1GOC A;  1K6Y A;  3LZI A;  4CK1 A;  1RIL A;  4AH9 A;  2OZS A;  4KB0 A;  4FLX A;  4JS4 A;  4CGD A;  4BE0 A;  3DLE A;  4DTO A;  5FRM A;  4Q5V A;  3VQC A;  3AA5 X;  3C6U A;  4CHZ A;  1CXU A;  4CEE A;  4ZTJ A;  3QLH A;  1RT1 A;  4IDK A;  1X9W A;  4LSN A;  1A5V A;  1S1T A;  2LSN A;  3ZT2 A;  2XY7 A;  3CYM A;  3CFO A;  4CHO A;  1S1V A;  1BIS A;  3ZSZ A;  4O55 A;  4Z4E A;  4DSJ A;  3MEC A;  4OLB A;  2Z1I A;  1C0M A;  3KIO A;  3RMC A;  1KVC A;  4IG3 A;  3E01 A;  4CF8 A;  1NJX A;  4Z4G A;  2IC3 A;  4CIG A;  2HHW A;  4N56 A;  1WN7 A;  1NJW A;  1EXQ A;  1C0U A;  3AVF A;  1HPZ A;  3BGR A;  3P83 D;  3QIO A;  3TAM A;  4CJT A;  4BDZ A;  2E4L A;  2F8S A;  4B9T A;  4KFB A;  2NUB A;  2ZQB A;  2O4I A;  2IDO A;  4AHR A;  4W5T A;  4OGE A;  3DRR A;  3LAM A;  5CZ2 A;  3OYC A;  3AVN A;  4AHS A;  5SZT A;  2R7Y A;  4E7L A;  2XY5 A;  3ZSX A;  3K5M A;  1R0A A;  4O5B A;  4Y1C A;  1KSP A;  4FM2 A;  2QKK A;  4OLA A;  3SYZ A;  5HP1 A;  3TR8 A;  1RTH A;  1JLG A;  4RW8 A;  1XWL A;  1S9G A;  1HYV A;  5HRN A;  1BHL A;  2OPQ A;  4AHU A;  1VSE A;  3ZT3 A;  4CHP A;  3HM9 A;  1WSG A;  4RW4 A;  3VQ8 A;  3HPG A;  4BDY A;  1W0H A;  1IKW A;  1O1W A;  3NHG A;  4FJ7 A;  4FJ8 A;  4FYD A;  2AJQ A;  1ZBF A;  2KFZ A;  5E41 A;  1YTU A;  4DQR A;  4DLG A;  3V9X A;  3CM5 A;  3QIP A;  4I2P A;  3TAF A;  3SQ2 A;  4CGJ A;  2YNH A;  1ZBU A;  4ELU A;  4Z4H A;  3S3N A;  4KTW A;  1JXE A;  3LPT A;  4AHT A;  1DLO A;  5HLF A;  2KZM A;  3KKS A;  3O4Q A;  1YTA A;  2FC0 A;  2XY8 A;  1C0T A;  4E1M A;  1SKS A;  4FJ5 A;  4J2E A;  2HHV A;  4H8K A;  4M3Z A;  1VSF A;  4DTR A;  3NF9 A;  4C8M A;  4I2Q A;  4DTU A;  1FXX A;  1VSI A;  4E7I A;  1RBT A;  5FDL A;  5I3U A;  4CGI A;  4M45 A;  2OPS A;  4B08 A;  1NK4 A;  1B92 A;  1KFS A;  4KHQ A;  4B8A B;  4L8R B;  4FJX A;  1JLC A;  3ITH A;  3RRG A;  3SPZ A;  4KTZ A;  4KV8 A;  4FJK A;  4E3S A;  3ZSR A;  3HK2 A;  1RDD A;  4IG0 A;  3C6T A;  3V1R A;  1KTQ A;  3OYF A;  3OYL A;  1NKC A;  2PZS A;  1RT4 A;  2WON A;  1X1P A;  5T7B A;  3OS0 A;  3RRH A;  1XHZ A;  2PYL A;  3HO1 A;  1C1A A;  4KO0 A;  3NH2 A;  4CEB A;  2BE2 A;  4LD0 A;  3AO5 A;  2Z1H A;  3LDS A;  5KRS A;  3OYB A;  3EYZ A;  3VQE A;  4MQ3 A;  4B8C A;  1HJR A;  1HQU A;  1RT7 A;  2IOC A;  3MXJ A;  3NCI A;  1D9F A;  1BL3 A;  2XO7 A;  2GBZ A;  1WNS A;  4IFV A;  4KRE A;  2VWK A;  1QQC A;  4FW2 A;  2ITG A;  4BDP A;  2HHQ A;  2HNY A;  3QES A;  2HHT A;  2HHU A;  4OKK A;  3MXI A;  4J2B A;  1VRU A;  1D9D A;  3KLI A;  2D0A A;  2HNZ A;  2E6M A;  1SKR A;  1U4B A;  4DFM A;  3NFA A;  4NYN A;  3QEI A;  4Y1D A;  4NCB A;  3VQQ A;  3S3M A;  3A2F A;  2G8W A;  4NYF A;  1C1B A;  2IGI A;  1U48 A;  3QO9 A;  1JL2 A;  3V6D A;  5I42 A;  1Q8I A;  4QCL A;  3SUN A;  1BCO A;  1U04 A;  4DFK A;  1X9M A;  2ATQ A;  1IKX A;  4FXD A;  5HRO A;  3DLG A;  4LSL A;  4CHY A;  3KD1 E;  2D5R A;  1EP4 A;  4DS4 A;  4M3U A;  1JLF A;  3KK2 A;  3JYT A;  1BQM A;  3THV A;  3V9U A;  4C8L A;  3NGI A;  1JL1 A;  2JGU A;  3T3F A;  4J2A A;  3SUP A;  1LWC A;  4HTU A;  1WSE A;  2G8U A;  3M8Q A;  2OZM A;  1QTM A;  1JKH A;  4KI6 A;  2YNF A;  2D0C A;  1B9D A;  1RT2 A;  3ZSV A;  4I7F A;  1HYS A;  1LW0 A;  1JLA A;  4CER A;  4DQS A;  4TSX A;  4PQU A;  3QNN A;  2RPI A;  4CJL A;  3MEE A;  3UIQ A;  4CF9 A;  4OGC A;  3SZ2 A;  4CFD A;  2O4G A;  4FVM A;  4CJE A;  4CJQ A;  4EZ9 A;  4CEC A;  1ASW A;  1UWB A;  4WE1 A;  4FJH A;  4OJR A;  1HNI A;  3D0P A;  1T03 A;  3AVL A;  3S9H A;  1TKD A;  2IS3 A;  2GV9 A;  3KK1 A;  1I39 A;  3RMA A;  4DTS A;  2X6S A;  2ZD1 A;  2Y1I A;  5HRR A;  4CIF A;  3QEW A;  3B6O A;  1Q9Y A;  4F4K A;  1U45 A;  1LAV A;  1RNH A;  5SWM A;  1RT6 A;  3O4N A;  4FK0 A;  4OKJ A;  4NCG A;  3CQ8 A;  3PY8 A;  4KB1 A;  4KHW A;  5HRS A;  1TAU A;  1J54 A;  2XRI A;  3V1O A;  4FK2 A;  5JS1 A;  3AVG A;  4FLV A;  4FLU A;  2YHB A;  4CED A;  4DTM A;  1ZBI A;  4DS5 A;  4DTJ A;  4CJV A;  2HHX A;  3NF8 A;  1JLE A;  3DRS A;  3KKR A;  3VQB A;  1SV5 A;  3OYN A;  3TWH A;  3VA0 A;  3TAQ A;  4I9L A;  3WNH A;  3ZSQ A;  2DTU A;  3U3G A;  4MFB A;  3AA2 A;  1BI4 A;  3P5J A;  4FCY A;  4QOZ B;  1BIZ A;  1QSL A;  5C24 A;  1NKB A;  3SPY A;  4KHS A;  3ALY A;  1YVU A;  4CCH A;  4Z4F A;  2RF2 A;  1ZBH A;  5CZ1 A;  4CF2 A;  4QAG A;  1CZB A;  4DTP A;  1UA0 A;  1FK9 A;  2BAN A;  4IKF A;  4N76 A;  1N6Q A;  1G15 A;  1XC9 A;  1CLQ A;  3KLE A;  3ZSW A;  4E1N A;  3QIN A;  1XHX A;  2OPP A;  4PWD A;  4C8K A;  1WSI A;  4GVM A;  3DOK A;  4CJU A;  2G8F A;  2KQ2 A;  1VSK A;  1WAJ A;  3EZ5 A;  1U49 A;  4FJG A;  3K57 A;  2Y1J A;  1HNV A;  4BE1 A;  3V81 A;  4UQG A;  3AVB A;  3ZT0 A;  4LH5 A;  4BE2 A;  4DSI A;  1RDB A;  1S6P A;  4Z4C A;  1NK0 A;  2QK9 A;  1Z26 A;  1IO2 A;  1Y97 A;  4CJK A;  4DFP A;  4M3W A;  4CIE A;  3P1G A;  3OYG A;  5J2M A;  2EHG A;  5KTQ A;  1SL0 A;  1WSH A;  1BGX T;  1L5U A;  3VQA A;  1HRH A;  3O3F A;  3MAQ A;  3SV4 A;  4JS5 A;  3VA3 A;  3SQ0 A;  2OA8 A;  1TAQ A;  4CJ3 A;  4CK3 A;  4N5S A;  3TAE A;  3AVC A;  3ISN C;  3WNE A;  3ASM A;  1TKZ A;  4OVL A;  5KRT A;  1CXQ A;  3NF6 A;  4CEF A;  3SQ1 A;  4FZX C;  4CJ5 A;  3JSM A;  3LAN A;  1LAW A;  1LWE A;  2PYJ A;  3OYM A;  1VRT A;  3HJF A;  4CEA A;  4B3O A;  3NF7 A;  3WNG A;  1NK5 A;  3AA4 A;  1NK8 A;  4KI4 A;  3VQP A;  1WLJ A;  1FKP A;  2HND A;  4E7J A;  1UAX A;  3SQ4 A;  3IG1 A;  3QEV A;  1VSM A;  2X74 A;  2KZZ A;  2FBV A;  4C8O A;  3DM2 A;  1L3T A;  1QE1 A;  3LP2 A;  3HT3 A;  3QEX A;  4B9L A;  2OPR A;  1JXB A;  3U3Y A;  4G1Q A;  2XY6 A;  3WNF A;  1RBR A;  1S1X A;  4CGF A;  3O3G A;  3L2Q A;  1TL1 A;  4HUG A;  4KHN A;  1JLB A;  2VWJ A;  3RMB A;  3SUO A;  4CF0 A;  3KK3 A;  4CEO A;  1NKE A;  4PA1 A;  1SKW A;  4H4M A;  3VN5 A;  1TVR A;  1GOA A;  1I3A A;  4GMJ B;  4LH4 A;  4OKE A;  2G8V A;  4J2D A;  3RMD A;  1CZ9 A;  3I8D A;  1MU2 A;  2FBT A;  3HPH A;  3I0R A;  1TL3 A;  3SUQ A;  2P5O A;  1KLN A;  1B9F A;  1DTQ A;  4DSF A;  3SNN A;  2RKI A;  4W5Q A;  3K5N A;  3LP0 A;  4O0J A;  3L3V A;  3G0Z A;  3MXM A;  1RBS A;  4CGH A;  1RDC A;  3HVR A;  4IFY A;  1T05 A;  2P5G A;  3NGY A;  4IBN A;  3DLB A;  1C1C A;  3M8P A;  4KAZ A;  4KHY A;  1RTD A;  4M3X A;  1VSD A;  4O44 A;  1TKX A;  3NE6 A;  2GUI A;  2HVH A;  1HYZ A;  3VQ9 A;  4CJS A;  1S1W A;  1IKY A;  3ZT1 A;  4CFB A;  5EU7 A;  2KFN A;  4HVJ A;  4M42 A;  4PY5 A;  4CEQ A;  1BIU A;  5DK5 A;  1Q9X A;  5FRN A;  3L2U A;  2YV0 X;  1XI1 A;  1LWF A;  3AO2 A;  3NH1 A;  3KLG A;  4E7H A;  1NJY A;  3PX4 A;  3BDP A;  1VSH A;  4FJI A;  1NJZ A;  4XIU A;  4EP4 A;  2DFE A;  2X78 A;  1BQN A;  3KLH A;  4ID5 A;  2FBX A;  2FBY A;  3DRP A;  3LP1 A;  2E6L A;  4M3R A;  3V1Q A;  1QSY A;  3OYK A;  5FRO A;  3V4I A;  4CJP A;  1KRP A;  3OVN A;  3ULD A;  4FLZ A;  3OS1 A;  3TAG A;  3TI0 A;  1NK6 A;  1VSJ A;  4DU3 A;  3LPU A;  1NK9 A;  4CFC A;  3IRX A;  3AVH A;  4CJR A;  3V9W A;  2I5J A;  4B9U A;  4JRP A;  4B9V A;  1C6V A;  4OPK A;  4Z0U A;  3MED A;  3QET A;  1KCF A;  1J5O A;  3HL8 A;  4YNQ A;  3H08 A;  3SJJ A;  2HVI A;  3NAE A;  3LZJ A;  4DSE A;  4BWJ A;  4DMN A;  3RR7 A;  4Z4I A;  2VG5 A;  1D8Y A;  3ZSY A;  4FJ9 A;  2QKB A;  4M3T A;  2B6A A;  2Z1J A;  4RW9 A;  3QNO A;  3OYH A;  4FLW A;  2PY5 A;  4B9S A;  3LAK A;  2F8T A;  4CEZ A;  4DSL A;  5JS2 A;  4F2S A;  1EKE A;  4FW1 A;  3OS2 A;  2YKM A;  2HHS A;  3PO5 A;  1SL1 A;  3CM6 A;  5CY4 A;  2BGG A;  1D5A A;  2ETJ A;  4KKO A;  1LW2 A;  4HHT A;  4RW6 A;  2P1J A;  4CJF A;  4W5N A;  3RWU A;  4FZZ A;  2YNI A;  3K58 A;  1VK0 A;  1RT5 A;  2HB5 A;  4FK4 A;  4AHV A;  3PUF A;  3K5O A;  3NBP A;  4CGG A;  3TAB A;  1S1U A;  2W42 A;  3OYJ A;  4FJN A;  2VG7 A;  1IH7 A;  4CF1 A;  4M41 A;  1RTI A;  2QXF A;  4ELT A;  3VQD A;  5J2P A;  1WSF A;  2DFH A;  2HW3 A;  3M8S A;  1TKT A;  3OYE A;  4DQI A;  5D3G A;  2EX3 A;  3CFP A;  2KTQ A;  4I9Q A;  3QER A;  5KI6 A;  1ASV A;  2RN2 A;  3OY9 A;  3HST B;  1JLQ A;  4O0I A;  3AVA A;  5J1E A;  1RT3 A;  2F96 A;  3C94 A;  5J2N A;  3SCX A;  3HXM A;  4CJ4 A;  4KPY A;  1S9E A;  4DLE A;  1IG9 A;  3AVI A;  3I0S A;  3V9Z A;  3PV8 A;  1REV A;  3AA3 A;  4CJW A;  4HUF A;  5J2Q A;  1L3U A;  4AIL C;  2HMI A;  4DQQ A;  3NH0 A;  1TGO A;  3SV3 A;  4ELV A;  4FJJ A;  3LAL A;  3HVT A;  4DG1 A;  3DI6 A;  1A5W A;  1HMV A;  5C25 A;  2WOM A;  4CK2 A;  4W5R A;  1X9S A;  1SL2 A;  4ICL A;  4FJM A;  4DSK A;  4F3O A;  3HP6 A;  2Q3S A;  3DYA A;  1W9H A;  2DFF A;  4CFA A;  3QEP A;  1L3V A;  4PUO A;  3VQ5 A;  3FFI A;  2DY4 A; 
#chains in the Genus database with same CATH topology
 1KXP A;  3VTI A;  3RVC A;  4DQP A;  3OYA A;  3H1V X;  1XNQ K;  1QSS A;  3AVM A;  1HNX K;  4F3T A;  2QWM A;  5KGW A;  3PX0 A;  4FM1 A;  2X6N A;  3ZT4 A;  5DMR A;  4CHQ A;  3OYI A;  3A5N C;  1J9A A;  4JLH A;  3THY A;  4LY7 A;  4CZL A;  5AR0 A;  3AVK A;  4YOT A;  1T7P A;  3KWI A;  1SUQ A;  4CZJ A;  1DTT A;  3F9M A;  3VQ6 A;  3P39 A;  3F9K A;  3KLF A;  4FWM A;  4B9N A;  4GNI A;  3E1Y A;  3LP3 A;  4A2B A;  4FZY A;  2GUP A;  3CG7 A;  1U47 A;  1XUP O;  3JS6 A;  3K5L A;  3DXM B;  4MO4 A;  1ZBL A;  3HYF A;  5CYQ A;  2A40 A;  1WOQ A;  1BA1 A;  4DUZ K;  3RTV A;  2G8K A;  4BR4 A;  4FJL A;  4WQ5 C;  4BAC A;  1W7A A;  2A1R A;  2KW4 A;  2CH5 A;  3DLK A;  2YKN A;  5BPN A;  3B6P A;  3OHR A;  1ZYQ A;  3VQ4 A;  4A61 A;  4DR6 K;  3MX5 A;  1GLL O;  3VQ7 A;  1UA1 A;  3UE5 A;  2FF3 B;  4LF4 K;  3L2W A;  5HL7 L;  4IO8 A;  3OJU A;  3D2F A;  3QBW A;  3M3Z A;  3GL1 A;  1GOB A;  1QHT A;  4Q0B A;  2GWJ A;  3O9T A;  3O3H A;  3TAR A;  4ZTF A;  3LZI A;  4CK1 A;  4B3T K;  4FLX A;  3VES A;  3C6U A;  4CHZ A;  4ZTJ A;  5ADX H;  4CHO A;  1P90 A;  1BO5 O;  4BY9 C;  4DUY K;  3BEX A;  3MEC A;  4ILG B;  4OLB A;  2Z1I A;  1C0M A;  4CBX A;  3KIO A;  4JI3 K;  3E01 A;  4N56 A;  1WN7 A;  1U6Z A;  1HPZ A;  4BDZ A;  1LCU A;  2O4I A;  4W5T A;  4OGE A;  2R7Y A;  2XY5 A;  2QKK A;  3ZSX A;  3NMU A;  4O5B A;  2NRT A;  4BGA A;  1VQN N;  4OLA A;  2V7Z A;  5AQJ A;  4NLC A;  3VGL A;  5ADX A;  5HRN A;  1BU6 O;  4CHP A;  1VSE A;  1WSG A;  4BDY A;  1W0H A;  4FJ7 A;  4FYD A;  2KFZ A;  4DQR A;  3BUZ B;  4I2P A;  3MN5 A;  5MLC Q;  3SQ2 A;  3THX A;  4Z4H A;  2ZGZ A;  1DLO A;  4K43 A;  1M1K O;  1YJW N;  2W40 A;  1W2B M;  4QS8 A;  4DTR A;  3K9J A;  4DTU A;  4FWN A;  2OPS A;  4B08 A;  3H6E A;  4IFE A;  4B8A B;  1JLC A;  3ITH A;  4KTZ A;  3CCS N;  3R6M A;  3HK2 A;  1RDD A;  3V1R A;  1VHX A;  3OYF A;  2PZS A;  3O1B A;  5C0Y A;  2PYL A;  1C1A A;  3DAW A;  4CEB A;  2BE2 A;  4JKC A;  2W41 A;  1VQ5 N;  4CD1 A;  4JHD A;  3VQE A;  3D2E B;  1S72 N;  1HJR A;  2IOC A;  2P9N A;  3MXJ A;  4DV5 K;  1BL3 A;  2YHX A;  4BVP A;  4YHH K;  3S41 A;  1X3M A;  4BDP A;  4H03 B;  3FZF A;  2KHO A;  2HNZ A;  3VPZ A;  2IGI A;  4B1Z A;  1JL2 A;  2V52 B;  3V6D A;  5AQP A;  1Q8I A;  3SUN A;  2P9S A;  4FXD A;  4XH5 A;  5LY3 A;  1Y64 A;  5HRO A;  5KPT A;  3AAR A;  3O9U A;  1T3V A;  4M3U A;  4WQ4 A;  5BN9 A;  1YIT N;  4JI5 K;  3CQY A;  4A5B A;  1QTM A;  4JI8 K;  5AQW A;  4M63 C;  4OPA A;  5DM6 L;  1OH6 A;  1RT2 A;  4I7F A;  3WQT A;  4CER A;  4DQS A;  3O9R A;  3TTF A;  4CJL A;  3FFK B;  3MEE A;  4YOV A;  4CZF A;  3WXK A;  2O4G A;  4FVM A;  1ASW A;  1UWB A;  3SAF A;  1HNI A;  3VER A;  5FPM A;  2P9P B;  4Z94 A;  2GV9 A;  2X6S A;  2Y1I A;  4CIF A;  4PKI A;  1U45 A;  1RNH A;  4OKJ A;  3W0L A;  5JS1 A;  1TAU A;  1O13 A;  3F2K A;  2XRI A;  3V1O A;  4FK2 A;  3LM9 A;  4CED A;  1ZBI A;  4DTJ A;  4LF8 K;  4CJV A;  3VQB A;  3TWH A;  3VA0 A;  1Q82 O;  4ISG A;  2QWP A;  1NGC A;  3EO3 A;  4DB3 A;  2QWL A;  1P8Z A;  1UA0 A;  3MCA B;  1N6Q A;  4BRQ A;  1CLQ A;  3SBG A;  3ZSW A;  3ENB A;  4O8K A;  4C8K A;  1VQM N;  1VSK A;  3EZ5 A;  4FJG A;  2OTJ N;  3I33 A;  2UUB K;  3K57 A;  2V51 B;  5LJW A;  1S6P A;  1EWR A;  2HBL A;  3O8M A;  4Z4C A;  4K0K K;  1GLD G;  1NK0 A;  1Y97 A;  4CJK A;  2O8C A;  3OYG A;  5J2M A;  3VEX A;  3VQA A;  1HRH A;  3O3F A;  4JS5 A;  3SQ0 A;  3CC7 N;  1TAQ A;  1K9M O;  4N5S A;  3ASM A;  5KRT A;  3NF6 A;  3RSE B;  1IG8 A;  3K9K A;  3DLL L;  2PYJ A;  1VRT A;  3HJF A;  1NK8 A;  4X66 K;  2HND A;  3MDQ A;  4JKG A;  3IG1 A;  3QEV A;  2VQF K;  1QVG M;  2KZZ A;  2FBV A;  5AQM A;  4NXN K;  3LP2 A;  5FPD A;  5EXW A;  4MDA A;  3SLC A;  4G1Q A;  1SAZ A;  2XY6 A;  4CGF A;  3QDK A;  1TL1 A;  4KHN A;  1S22 A;  1JLB A;  3SUO A;  4CF0 A;  3UKR B;  1GOA A;  4OKE A;  3MWT A;  4LH4 A;  2IVO A;  1CZ9 A;  2FBT A;  3HPH A;  3I0R A;  1KLN A;  4BRP A;  1WBD A;  4W5Q A;  3ENH A;  3LP0 A;  3K5N A;  2ASO A;  2UYT A;  3G0Z A;  3L3V A;  4DR3 K;  2H3G X;  4UY8 O;  1RDC A;  1YF5 L;  4IFY A;  4BR5 A;  4CI6 A;  1NJI O;  3NGY A;  5CE3 A;  1C1C A;  1RTD A;  1TKX A;  2QWO A;  4CJS A;  3J81 O;  4HVJ A;  1Q9X A;  3LL3 A;  1VQ7 N;  1VSH A;  1HNZ K;  4FJI A;  4CBW A;  2X78 A;  1BQN A;  3CJ7 A;  3V1Q A;  2HBJ A;  1NGA A;  2O8F B;  1QSY A;  5FRO A;  3OW2 M;  1KRP A;  3ULD A;  3C6A A;  4WFA L;  3CJC A;  3VF2 A;  4DU3 A;  1NK9 A;  4CJR A;  3V9W A;  4OPK A;  4Z0U A;  1VQ4 N;  3HL8 A;  3A0I X;  2IIR A;  3ULE B;  2HVI A;  4DSE A;  4DMN A;  1ATN A;  2A3Z A;  3ZSY A;  4FJ9 A;  3KK7 A;  2NZT A;  5IT9 O;  3CCE N;  4JYA K;  4C23 A;  5M1O A;  3UKU A;  5JS2 A;  4AF1 A;  4HWI A;  2YKM A;  4CZM A;  1D5A A;  2ETJ A;  1LW2 A;  3VEW A;  4RW6 A;  3RWU A;  2YNI A;  1VK0 A;  4LF6 K;  3PUF A;  3NBP A;  1JJ2 M;  3OYJ A;  4BRO A;  1IH7 A;  4M41 A;  3R1X A;  5J2P A;  3MX2 A;  1WSF A;  2E2N A;  4GV3 A;  3QER A;  5KI6 A;  1ASV A;  3JXU A;  3OY9 A;  1JLQ A;  2YHY A;  4O0I A;  2F9T A;  3AVA A;  1E4G T;  1S9E A;  3EL2 A;  4DLE A;  4I6M A;  3I0S A;  4K25 A;  3V9Z A;  1REV A;  2PY5 A;  3CCJ N;  2JWL A;  4AIL C;  4DQQ A;  3SV3 A;  3WXM B;  4DG1 A;  3DI6 A;  1A5W A;  5GIN A;  4W5R A;  1XMO K;  1GLF O;  3TSU A;  4ICL A;  1ATR A;  4FJM A;  4BRL A;  1L3V A;  1W9H A;  1K8K B;  2ASP A;  3AV9 A;  1V4T A;  5K14 A;  1RCH A;  4K8Z A;  2GWK A;  2UXD K;  3G10 A;  1XQS C;  3OYD A;  4OX9 K;  2NRV A;  3P4I A;  3CI5 A;  4RG8 A;  3CJ9 A;  4JEP A;  4B3M K;  4FLT A;  4H5W A;  3IS9 A;  1WSJ A;  3THW A;  4FOI A;  1NK7 A;  2FLO A;  3LWM A;  1RDA A;  3O5B A;  4N47 A;  5FRN A;  4RW7 A;  2VG6 A;  1NWK A;  1BI4 B;  3HSC A;  1ZC6 A;  5LMN K;  4KTQ A;  4OPJ A;  2RHK A;  3U6F A;  3OJS A;  3V9S A;  5KGX A;  2P9K A;  2YX6 A;  4DKW A;  1TK8 A;  4FM0 A;  3R9P A;  3DLH A;  2ZE2 A;  1S5J A;  1HQE A;  3MWP A;  3SMS A;  4FVU A;  4CHN A;  2YNG A;  4H4O A;  4KHU A;  1C0G A;  2CH6 A;  1RFQ A;  5AQF A;  3NGZ A;  2UUC K;  2HBM A;  4M7X A;  3ZCM A;  1EET A;  1FKO A;  2P9U A;  3VET A;  4FPA A;  2BDP A;  4ZHR A;  1KVB A;  4EZ6 A;  1RBV A;  5IWA K;  5GAG P;  4AM7 A;  4HCC A;  3VEV A;  2A1S A;  5EX5 A;  3DOL A;  2VYP A;  4H0O A;  3RR8 A;  2QW9 A;  4EIA A;  2OZS A;  3BF3 A;  1RIL A;  4BG8 A;  4DTO A;  1HUX A;  3SAH A;  4X65 K;  4LSN A;  4WF9 L;  3CYM A;  1S1V A;  1BIS A;  4O55 A;  3NVK A;  4CZH A;  1U2V B;  5M1P A;  5BN8 A;  2NRX A;  3LDP A;  2ZGY A;  3IKM A;  4CJT A;  3P31 A;  2F8S A;  2E4L A;  1KC8 O;  2NUB A;  4BR2 A;  5CZ2 A;  3OYC A;  3N4Q A;  4AHS A;  5LJV A;  4Y1C A;  4DR1 K;  3SYZ A;  3CET A;  1BA0 A;  3G25 A;  4X64 K;  3HRG A;  4RW8 A;  1JLG A;  1S9G A;  1HYV A;  3ZT3 A;  4RW4 A;  3DXM A;  1QQO A;  4FWS A;  1O1W A;  3PSF A;  1MA9 B;  2P9I A;  4PL7 A;  3ZX2 A;  4X62 K;  4DLG A;  3V9X A;  4CBU A;  3KVG A;  3TAF A;  1E3M A;  4CGJ A;  3CCR N;  3NVM A;  3S3N A;  4KTW A;  3LPT A;  4AHT A;  3G6E N;  3KKS A;  2XY8 A;  1SKS A;  4E1M A;  4FJ5 A;  1ILY A;  3DWL A;  4XEI A;  5JIC A;  3J80 O;  3HOS A;  4JD2 A;  4C8M A;  5I3U A;  5AZJ A;  4M45 A;  1NK4 A;  5AQZ A;  1KFS A;  3FZH A;  3ZSR A;  1S3X A;  2IVN A;  3H1Q A;  5JLH A;  3OYL A;  2QWQ A;  1X1P A;  5T7B A;  3OS0 A;  3HO1 A;  4JI4 K;  3OYB A;  5M1K A;  4MQ3 A;  3EE9 A;  1RT7 A;  3KWG A;  3VF6 A;  2VWB A;  2GBZ A;  4IFV A;  2VWK A;  2ITG A;  2ZJQ L;  1BOT O;  2HNY A;  3QES A;  2HHU A;  2CGK A;  3MXI A;  1D9D A;  4Y1D A;  3J7Y P;  3VQQ A;  2KLA A;  4CZE A;  3A2F A;  1YXQ A;  4NYF A;  4LF9 K;  1BCO A;  1U04 A;  4DFK A;  3KD1 E;  4DS4 A;  3V9U A;  4C8L A;  3AY9 A;  3NGI A;  2JGU A;  3T3F A;  2DPN A;  2E2O A;  2Q36 A;  1LWC A;  2G8U A;  3M8Q A;  1NMD A;  2OZM A;  2D0C A;  3OBY A;  3ZSV A;  5M1F A;  1HYS A;  1LW0 A;  1JLA A;  2ZF5 O;  5AQO A;  4TSX A;  4MO5 A;  4PQU A;  1K8A O;  3R8E A;  4LF7 K;  4EAH D;  3SZ2 A;  1TUY A;  4CEC A;  4OJR A;  3BZC A;  3A5O C;  3S9H A;  4O5F A;  2IS3 A;  3RMA A;  2ZD1 A;  4NB4 A;  2ITM A;  3QEW A;  3CQ8 A;  3PY8 A;  4KB1 A;  4IOX A;  4BVO A;  5HRS A;  2A6A A;  4IOC L;  3AVG A;  5H1S Q;  4JI2 K;  4DTM A;  2F4V K;  1NGH A;  3MN9 A;  3GOI A;  4H5V A;  3THY B;  4A59 A;  3KKR A;  3TAQ A;  4I9L A;  3WNH A;  4MFB A;  4LFC K;  4FCY A;  3D2E A;  4U67 L;  4QOZ B;  1BIZ A;  3E9O A;  3GE1 A;  1QSL A;  4BRK A;  5GAE P;  2GTD A;  1OH8 A;  1E4F T;  1YVU A;  4JKD A;  4CCH A;  4Z4F A;  3CF5 L;  4M7Y A;  1YUW A;  3ATU A;  3A8Y A;  2ASM A;  3OA9 A;  2BAN A;  2HF4 A;  3FR0 A;  2P9L B;  1G15 A;  3KLE A;  5BR8 K;  2OPP A;  4PWD A;  4IJA A;  1WSI A;  1U49 A;  4WFB L;  1HNV A;  3V81 A;  4UQG A;  1N8R O;  3ZT0 A;  2D0O A;  3BP8 A;  3KHY A;  2O8E A;  5AFU H;  3G4S N;  1X9J A;  2QEX N;  1Z05 A;  5AQG A;  3MAQ A;  3VA3 A;  3TAE A;  3AVC A;  3ISN C;  3U9D A;  3D2F B;  1TKZ A;  4CJ5 A;  1T44 A;  1LWE A;  3OYM A;  4JN4 A;  3WNG A;  1NK5 A;  3P38 A;  2P9P A;  3C65 A;  4EHU A;  4C8O A;  1L3T A;  5AFU A;  1QE1 A;  1GLE G;  3QEX A;  4B9L A;  4FWQ A;  3WNF A;  4GVE A;  1RBR A;  1S1X A;  4H0V B;  4XH4 A;  3O3G A;  2VWJ A;  3KK3 A;  2V7Y A;  1NKE A;  3VGK A;  4PA1 A;  3IFR A;  3JAM O;  1SKW A;  4H4M A;  5AQK A;  3H3N O;  4DCH A;  1IBM K;  4J2D A;  3PSI A;  3I8D A;  4CZK A;  3SUQ A;  2P5O A;  4A57 A;  3CJB A;  2RKI A;  4CGH A;  1RGI A;  4BRD A;  3C7N A;  3HVR A;  4E1J A;  4IBN A;  3DLB A;  1N32 K;  4ISF A;  3T69 A;  1FW6 A;  1VSD A;  3VF4 A;  5AZI B;  3ZT1 A;  3A5M C;  5EU7 A;  4BC3 A;  4DR4 K;  4CEQ A;  1BIU A;  2HHT A;  2YV0 X;  3NH1 A;  4E7H A;  3PX4 A;  4XIU A;  2DFE A;  4C1N K;  3O4W A;  1BUP A;  2BTF A;  3DRP A;  3QML A;  2E6L A;  3CCM N;  3CIP A;  2Q31 A;  3TI0 A;  1XC3 A;  3DXK A;  3H46 O;  1H1V A;  3IRX A;  3AVH A;  3CER A;  3AAQ A;  4B9V A;  3QET A;  4IEI A;  1I94 K;  1QZ6 A;  2QKB A;  4FOE A;  2F8T A;  4CEZ A;  4DSL A;  4WQ4 C;  1EKE A;  3IUC A;  1EWQ A;  3OS2 A;  2P9N B;  1SL1 A;  1Q18 A;  5AQY A;  2WFB A;  4HHT A;  3PLA A;  2P1J A;  1D4X A;  3W3D A;  3UKR A;  3K58 A;  1EO1 A;  4JKA A;  2HB5 A;  4AHV A;  4B9Q A;  1S1U A;  4B1V A;  2QXF A;  2CGL A;  4ELT A;  4RWT A;  2DFH A;  4DR2 K;  4DQI A;  5D3G A;  3J7Z O;  3CFP A;  4YOX A;  4I9Q A;  2HF3 A;  3AGK A;  3HST B;  5GAH P;  1RT3 A;  5J2N A;  5TKY A;  4CJ4 A;  1IG9 A;  3PV8 A;  4JV5 K;  2QWR A;  4CJW A;  4NCB A;  5J2Q A;  2HMI A;  1TGO A;  3Q7C A;  2F7T A;  4F3O A;  2DFF A;  4CFA A;  3QEP A;  3VQ5 A;  4JRQ A;  5EVZ A;  1RTJ A;  2D0B A;  4M3Y A;  1VSL A;  3HP9 A;  2OYQ A;  3HOT A;  2Z1G A;  2ZJR L;  3M8R A;  1ITG A;  3DMJ A;  1GLB G;  4FWO A;  3KJV A;  4JK7 A;  2G8I A;  4E19 A;  3ULE A;  5AQT A;  3AO1 A;  5C12 A;  2RE2 A;  4KRF A;  3NDK A;  1WAF A;  4AHC A;  4R5P A;  2JWK A;  3D45 A;  3HBT A;  4N41 A;  4E89 A;  3O1W A;  4E0D A;  1HKG A;  2P51 A;  1MWM A;  2FF6 A;  3EY1 A;  1HKC A;  3AO4 A;  1VQL N;  5CR4 A;  2Q0U A;  3AVJ A;  4DR7 K;  4AM6 A;  3BF1 A;  3K2P A;  3T19 A;  1ASU A;  3S3O A;  2E2Q A;  4IXC A;  4CES A;  2YHA A;  2G8H A;  3L2R A;  1LOT B;  5I9E B;  2B4J A;  2JLE A;  1F21 A;  1LV5 A;  1KAY A;  1NOZ A;  5F2R A;  4BG9 A;  1Z6R A;  2O8B B;  4O4G A;  3I8B A;  4GV6 A;  5JMV A;  3SI6 A;  3QIC A;  1HKB A;  1KFD A;  2O8C B;  4NCA A;  2HHH K;  1S6Q A;  4FLY A;  1KLM A;  4KHP K;  3L8B A;  5AQX A;  3WXJ A;  3C95 A;  5AQH A;  4BWM A;  4KH6 A;  4IWV A;  2IAJ A;  3SAG A;  3T1A A;  4DU1 A;  4KPY A;  3F73 A;  1K8K A;  4KB0 A;  3WT0 A;  2NNW A;  5FRM A;  2W6K A;  4JKG B;  3VQC A;  1WUA A;  1CXU A;  4CEE A;  3QLH A;  1A5V A;  1S1T A;  2E20 A;  2LSN A;  2FSN A;  1KAZ A;  2XY7 A;  3ZSZ A;  4Z4E A;  4DSJ A;  1TUU A;  2YJF A;  2VGM A;  1KVC A;  4CF8 A;  3VGM A;  4RCH A;  5BRD A;  2IC3 A;  4CIG A;  5KPZ A;  1EXQ A;  1C0U A;  3AVF A;  3BGR A;  3P83 D;  4KI6 A;  3TAM A;  4B9T A;  1RDU A;  2ZQB A;  4JKF A;  2AA4 A;  2IDO A;  4DR5 K;  4E7L A;  3EEQ A;  3K5M A;  1KSP A;  4FM2 A;  1OKJ A;  1BWF O;  1HX1 A;  3TR8 A;  3CC2 N;  1BHL A;  4AHU A;  3HM9 A;  3VQ8 A;  4IDH A;  1VQP N;  4FJ8 A;  3NHG A;  1YTU A;  3QIP A;  1KAX A;  4OPH A;  4ELU A;  2YNH A;  1ZBU A;  1FJG K;  1J6Z A;  1YJN N;  3O4Q A;  2HST A;  2FC0 A;  4J2E A;  1C0T A;  4MLH A;  1ESV A;  1VSI A;  1G99 A;  4E7I A;  1RBT A;  5FDL A;  3C6H A;  3MN7 A;  2D1K A;  1B92 A;  4KHQ A;  4L8R B;  4KV8 A;  1TYQ A;  3C6T A;  4CW7 B;  1KTQ A;  1WB9 A;  1RT4 A;  5E26 A;  4KO0 A;  3NH2 A;  3VOV A;  3UKU B;  4LD0 A;  1T6C A;  3AO5 A;  3WXL A;  5FPE A;  5KRS A;  3EYZ A;  4B8C A;  3LDS A;  2ZJP L;  1HQU A;  3ZEU A;  1QHA A;  2XO7 A;  1WNS A;  1QQC A;  2QWN A;  1HR0 K;  4CZI A;  4J2B A;  1VRU A;  4IO9 L;  2A42 A;  2D0A A;  4AQY K;  2E6M A;  2A5X A;  1SKR A;  4DFM A;  3NFA A;  3QEI A;  3WEE A;  4K42 A;  2HBK A;  5AQN A;  4WFN L;  3ID8 A;  2G8W A;  1C1B A;  5M1N A;  1U48 A;  3T1H K;  1X9M A;  2ATQ A;  3CCQ N;  3CJA A;  2UU9 K;  2O8D B;  3ZET A;  4FWL A;  1NGB A;  1OVY A;  3F5T A;  3M1F A;  1NBW A;  4GKK K;  3KK2 A;  3JYT A;  1BQM A;  3THV A;  4J2A A;  4BRN A;  4JAX A;  1JKH A;  1YAG A;  5BRH A;  1NG9 A;  1B9D A;  4FWK A;  3R3L A;  3QNN A;  2RPI A;  2OCE A;  4JKE A;  4KH4 A;  3I55 N;  4CFD A;  2PFU A;  4CJE A;  4CJQ A;  4EZ9 A;  3MN6 A;  4WE1 A;  5BRE A;  1T03 A;  3M6G A;  1X3N A;  3AVL A;  3KK1 A;  4JK8 A;  4RTF D;  1I39 A;  2WUS A;  1GLC G;  3B6O A;  4F4K A;  1ZBS A;  4OO1 J;  2HOE A;  1RT6 A;  4FK0 A;  1SS6 A;  4NCG A;  1NGJ A;  5AQV A;  4O8U A;  2D0P A;  3L4Q A;  2YI1 A;  3THW B;  1XNR K;  3NF8 A;  4DV3 K;  1SV5 A;  4HTL A;  4DV4 K;  3P5J A;  4DQ8 A;  5C24 A;  1NKB A;  3SPY A;  4KHS A;  2UXB K;  1QQM A;  2P9K B;  4NO7 A;  3KZB A;  3O6W A;  4CF2 A;  1ZBH A;  1VQK N;  1CZA N;  2CGJ A;  4N76 A;  4E1N A;  3QIN A;  1XHX A;  5KPR A;  4WYB A;  1IBL K;  3DOK A;  4L3Q A;  5LL6 Z;  4CJU A;  4FWP A;  3VMF B;  2Y1J A;  4MDB A;  4BE1 A;  1IJJ A;  3AVB A;  4BE2 A;  5AQI A;  3FZL A;  3L0Q A;  3SBT A;  5FLX O;  2I7N A;  4LC9 B;  1Z26 A;  1IO2 A;  1Q86 O;  1VQ9 N;  4M3W A;  2E1Y A;  2P9U B;  5GIO A;  5KTQ A;  1SL0 A;  3VEO A;  4CK3 A;  4DV0 K;  3WNE A;  4OVL A;  3FE1 A;  3TPQ A;  4H0Y B;  3JSM A;  3LAN A;  1LAW A;  2YJE A;  4YOY A;  4CZG A;  5DM7 L;  4XH1 A;  3NF7 A;  4BRE A;  4KI4 A;  3AA4 A;  3EKS A;  4H5T A;  3VQP A;  1FKP A;  4E7J A;  5AQU A;  1UAX A;  3U9Z A;  2X74 A;  4WQ5 A;  3HZ6 A;  2I7P A;  1DGK N;  5C10 A;  1NGF A;  3HT3 A;  3U3Y A;  3CJ1 A;  5JVH L;  4DV1 K;  3RMB A;  4DHY A;  5GAD P;  3VN5 A;  4IOA L;  1TVR A;  1I3A A;  4GMJ B;  3RMD A;  1MU2 A;  3BY5 A;  1TL3 A;  4JI7 K;  4DSF A;  3CXC M;  3SNN A;  2ZWH A;  4O0J A;  3MXM A;  1RBS A;  4GV9 A;  2Q0R A;  5AQS A;  2UXC K;  3TSQ A;  3M8P A;  4M3X A;  1BG3 A;  3NE6 A;  2GUI A;  2P9L A;  1S1W A;  1IKY A;  2P9I B;  5HOO A;  2KFN A;  1DKG D;  3EN9 A;  3L6Q A;  1XI1 A;  1SQK A;  3KLG A;  3LM2 A;  5AQR A;  4YDU A;  1N33 K;  4EP4 A;  4MLE A;  4QS9 A;  3KLH A;  4PL8 A;  4M3R A;  3OYK A;  3V4I A;  4CJP A;  3LDO A;  4JD2 B;  3OVN A;  4FLZ A;  2E5L K;  1VSJ A;  3LPU A;  3ZYY X;  5BR9 A;  5AZJ B;  4B9U A;  4YOU A;  1C6V A;  3MED A;  2WC9 A;  1KCF A;  3B8A X;  1J5O A;  4B3R K;  3QB0 A;  3ATV A;  3TTC A;  3NAE A;  3RR7 A;  4LF5 K;  4M3T A;  2Z1J A;  4JKH A;  3QNO A;  3OYH A;  4B9S A;  3LAK A;  1YVN A;  2E1Z A;  2UUA K;  4YY3 K;  5CY4 A;  2BGG A;  2YHW A;  4KKO A;  4CJF A;  5AQQ A;  4FZZ A;  5KQD A;  1RT5 A;  2FSJ A;  4H0P A;  1MWK A;  3K5O A;  4CGG A;  4YDU C;  3TAB A;  3O9S A;  2E88 A;  4JKB A;  3VQD A;  2NRH A;  2HW3 A;  3M8S A;  4KBO A;  1TKT A;  3OYE A;  2EX3 A;  1SZ2 A;  1T6D A;  2KTQ A;  5E84 A;  2RN2 A;  4B1X B;  2HMP A;  5J1E A;  5AZI A;  3AVI A;  4HUF A;  1L3U A;  4ELV A;  4FJJ A;  4BR9 A;  4FPB A;  1K73 O;  3VEY A;  4B3S K;  2GX9 A;  4KH5 A;  5C25 A;  5M1Q A;  1X9S A;  4CK2 A;  4DSK A;  3HP6 A;  1J5E K;  3H3O B;  4GY2 B;  2DY4 A;  2F9W A;  3MK6 A;  3TAN A;  3IAY A;  4F8R A;  5BRF A;  4F2R A;  1TV6 A;  4GW6 A;  1TK0 A;  4BRF A;  3KD5 E;  3CD6 N;  4DWI A;  1T8E A;  2KKZ A;  1RBU A;  2QA4 N;  3LDL A;  5EY4 A;  4CE9 A;  4K8X A;  2FSK A;  4FL9 A;  3PO4 A;  3DJC A;  3O08 A;  2WTU A;  2HHW A;  4ID1 A;  1C0F A;  3L2V A;  3K59 A;  4DTN A;  4EP5 A;  3GG4 A;  3N4P A;  4GKJ K;  5B8H A;  1TK5 A;  3KTQ A;  1UOC A;  2XHB A;  4DF8 A;  3ENO A;  3PX6 A;  3AO3 A;  4HUE A;  3K0S A;  4DFJ A;  4DU4 A;  1A5X A;  4CJ7 A;  1NMN A;  3O9Q A;  4HCB A;  1QS4 A;  1EX4 A;  2B5J A;  4DTX A;  2QI2 A;  4B1U B;  5HRP A;  1L3S A;  1J53 A;  1YT3 A;  2PAV A;  4B9M A;  4FJN A;  3THX B;  4C1N I;  3TAP A;  4W5O A;  5HBM A;  5BPM A;  3ZX3 A;  4YFU A;  3HPO A;  1VQ6 N;  5C42 A;  1NOY A;  3GDQ A;  2O8E B;  4BRM A;  1NNE A;  4DF4 A;  1N5Y A;  2BUP A;  3ZSO A;  1KVA A;  3CMA N;  3L3U A;  1Z25 A;  4BGB A;  1YJ9 N;  3DLR A;  3FGU A;  3MEG A;  4PKG A;  3RSE A;  1BCM A;  4C8N A;  4J8F A;  5CYM A;  1IKV A;  4E7K A;  3LWL A;  3CFR A;  1GOC A;  1K6Y A;  4AH9 A;  3CHW A;  4H0X B;  4CGD A;  4JS4 A;  3DLE A;  4BE0 A;  4DV6 K;  3LDQ A;  4Q5V A;  3AA5 X;  1RT1 A;  4IDK A;  4EHT A;  4JHD B;  1X9W A;  3ZT2 A;  3CFO A;  3GBT A;  3TSP A;  1JCE A;  2Q97 A;  4U7B A;  3HTV A;  3RMC A;  2Q2R A;  4IG3 A;  1NJX A;  4Z4G A;  1NJW A;  3U4L A;  3QIO A;  2IVP A;  4KFB A;  1YIJ N;  4AHR A;  3DRR A;  3LAM A;  3AVN A;  5SZT A;  2QM1 A;  2P9S B;  2W6L A;  1R0A A;  5HP1 A;  4CD3 A;  4ISE A;  3C7N B;  1RTH A;  5C2D A;  1XWL A;  2OPQ A;  1NGE A;  3HPG A;  2VQE K;  1IKW A;  2AJQ A;  1ZBF A;  5E41 A;  3CM5 A;  4DV2 K;  3CCV N;  1JXE A;  2O8B A;  2KZM A;  5HLF A;  1YTA A;  2HHV A;  4H5N A;  1KD1 O;  4LFB K;  2O8F A;  4H8K A;  4M3Z A;  1VSF A;  2WBN A;  3NF9 A;  3UB5 A;  4IEE A;  1HLU A;  1GLJ O;  4I2Q A;  3ZLJ A;  1FXX A;  5C2F A;  4BC2 A;  3DXK B;  4CGI A;  3WXI A;  1YHQ N;  4ILJ A;  4FJX A;  3L4I A;  3RRG A;  4FJK A;  3SPZ A;  4E3S A;  2AP1 A;  4IG0 A;  3E9L A;  4B1W B;  1QVF M;  1NKC A;  4BRG A;  4YOR A;  5BPL A;  2WON A;  1XHZ A;  3RRH A;  3AGR A;  3O80 A;  3OBW A;  1OH7 A;  2Z1H A;  2PBD A;  4V19 S;  3NCI A;  2E2P A;  1D9F A;  4KRE A;  4FW2 A;  5F0X A;  2HHQ A;  4F9O A;  4OKK A;  3KLI A;  2FXU A;  1U4B A;  4NYN A;  3S3M A;  3PIP L;  3QO9 A;  5I42 A;  3CCL N;  3WQU A;  4QCL A;  1HNW K;  4JI6 K;  1IKX A;  3H45 C;  1NLV A;  3DLG A;  4LSL A;  4R79 A;  4CHY A;  3G71 N;  3J7A P;  1NGG A;  5ELZ A;  2D5R A;  1EP4 A;  1JLF A;  1Q7Y O;  1JL1 A;  3SUP A;  2NRR A;  4HTU A;  1WSE A;  4K41 A;  3LDN A;  2YNF A;  4QS7 A;  5AJ3 K;  1N36 K;  3E66 A;  1VAZ A;  3UIQ A;  4CF9 A;  4OGC A;  2OAN A;  2YCH A;  4FJH A;  2NRW A;  2D4W A;  3D0P A;  1VQO N;  1QZ5 A;  1TKD A;  3MMV A;  1N34 K;  4DTS A;  4H0T B;  5HRR A;  1Q9Y A;  1LAV A;  5SWM A;  3O4N A;  4KHW A;  2A41 A;  1J54 A;  3EZW A;  3TTD A;  3SK3 A;  4FLV A;  4FLU A;  2YHB A;  4DS5 A;  1EQY A;  5EOY A;  3PIO L;  2HHX A;  4NXM K;  1JLE A;  3DRS A;  3OYN A;  2DTU A;  3ZSQ A;  3Q7B A;  3SJH A;  3U3G A;  2GEM A;  3AA2 A;  1BI4 A;  3HI0 A;  2Q1N A;  1MDU B;  1Q81 O;  2VCP A;  4JI0 K;  3ALY A;  5FPN A;  2RF2 A;  5CZ1 A;  1OH5 A;  4QAG A;  3QFU A;  1CZB A;  4DTP A;  3QFP A;  1FK9 A;  3J8A A;  5KQ8 A;  5JLF A;  4IKF A;  1XC9 A;  3M5R A;  1R59 O;  1DEJ A;  4GVM A;  2NLX A;  2G8F A;  2KQ2 A;  1WAJ A;  5JVG L;  1KQS M;  1DT9 A;  2O8D A;  4BQZ A;  3CME N;  2ZM6 K;  4LH5 A;  3I56 N;  4JNE A;  4DSI A;  1RDB A;  1XMQ K;  3D6R A;  3FZM A;  2QK9 A;  3VEN A;  3FLC O;  5C15 A;  4LFA K;  4DFP A;  4CIE A;  3P1G A;  2EHG A;  3T1Y K;  1WSH A;  1BGX T;  1L5U A;  2QXL A;  3SV4 A;  2OA8 A;  2GEL A;  4CJ3 A;  3IDH A;  1CXQ A;  4ILH A;  4CEF A;  3SQ1 A;  3T7Z A;  4FZX C;  3A5L C;  4BRC A;  4B3O A;  4CEA A;  3IMX A;  1GLA G;  4EFH A;  1WLJ A;  3SQ4 A;  1VSM A;  3DM2 A;  4PHT X;  1IV0 A;  2OPR A;  1JXB A;  4Y0W A;  3U8X A;  5TKW A;  3L2Q A;  4HUG A;  1OVQ A;  1HJO A;  2BH1 A;  4CEO A;  1U2V A;  3WUH A;  4JI1 K;  2G8V A;  1V4S A;  1RDW X;  2J4R A;  4FO0 A;  3CQX A;  5F1X A;  1NGI A;  3AAP A;  1B9F A;  4BRA A;  1DTQ A;  4YOW A;  3SMP A;  1T05 A;  4NLB A;  3C0B A;  2P5G A;  1VQ8 N;  4KAZ A;  4KHY A;  5CHI A;  2E8A A;  4O44 A;  2HVH A;  1HYZ A;  3VQ9 A;  4I6M B;  4CFB A;  3ID6 A;  4PY5 A;  4M42 A;  4JK9 A;  5DK5 A;  5LMU K;  1QQN A;  1HPM A;  3L2U A;  1LWF A;  3AO2 A;  1NJY A;  3BDP A;  3BZK A;  1NGD A;  5AQL A;  3E9P A;  4WCE L;  1NJZ A;  3FZK A;  4ID5 A;  2FBX A;  2FBY A;  3LP1 A;  4DV7 K;  4BRI A;  3OS1 A;  3TAG A;  1NK6 A;  5A2Q O;  4H5R A;  4A2A A;  4CFC A;  4FWR A;  1YI2 N;  2I5J A;  4JRP A;  4FSV A;  4YNQ A;  3H08 A;  3HM8 A;  3CPW M;  3SJJ A;  1M90 O;  3LZJ A;  1NM1 A;  4Z4I A;  4BWJ A;  1TYQ B;  2VG5 A;  1D8Y A;  4BRH A;  2B6A A;  4RW9 A;  4BR7 A;  1ATS A;  4CVN E;  4A62 A;  1W97 L;  3CC4 N;  4FLW A;  3EKU A;  4F2S A;  3ZX0 A;  3CCU N;  4A5A A;  4FW1 A;  2HHS A;  2EWS A;  3PO5 A;  3VEZ A;  3ZEU B;  3CM6 A;  1NU0 A;  3MCP A;  4G9Z A;  4PKH A;  4IJN A;  4W5N A;  4BC5 A;  4FK4 A;  4BR0 A;  2W42 A;  3WEE B;  4B1Y B;  2VG7 A;  4CF1 A;  3OTO K;  5GIP A;  1RTI A;  2NRZ A;  2VGN A;  1JCG A;  1WBB A;  3ZET B;  4BC4 A;  3EE8 A;  1ZXO A;  3QBX A;  3D7E O;  4BQL A;  1JCF A;  2QTD A;  2F96 A;  3C94 A;  3SCX A;  3HXM A;  3CPE A;  3AA3 A;  3NH0 A;  3TU5 A;  3LAL A;  3HVT A;  1IBK K;  1HMV A;  2WOM A;  4IZ9 A;  1BDG A;  1SL2 A;  4PUO A;  2Q3S A;  3DYA A;  3VTH A;  2OTL N;  3FFI A; 
#chains in the Genus database with same CATH homology
 3AV9 A;  4DQP A;  4JRQ A;  3OYA A;  1RTJ A;  5K14 A;  3U6F A;  2D0B A;  3TAN A;  3IAY A;  4M3Y A;  1RCH A;  1VSL A;  1QSS A;  4F8R A;  3HP9 A;  2OYQ A;  3AVM A;  2Z1G A;  4K8Z A;  4F3T A;  4F2R A;  3M8R A;  3G10 A;  1ITG A;  5KGW A;  1TV6 A;  4GW6 A;  3OYD A;  4FM1 A;  2X6N A;  3PX0 A;  3DMJ A;  3ZT4 A;  1TK0 A;  3KD5 E;  4DWI A;  1T8E A;  5DMR A;  1RBU A;  4RG8 A;  3KJV A;  2G8I A;  4E19 A;  4CHQ A;  3OYI A;  4FLT A;  4CE9 A;  4K8X A;  3IS9 A;  1J9A A;  1WSJ A;  3AO1 A;  4JLH A;  4LY7 A;  1NK7 A;  3PO4 A;  4KRF A;  3NDK A;  1WAF A;  3AVK A;  1RDA A;  4ID1 A;  4AHC A;  4N47 A;  3LWM A;  4R5P A;  3D45 A;  1T7P A;  3L2V A;  4RW7 A;  4N41 A;  1SUQ A;  3K59 A;  2VG6 A;  4DTN A;  4EP5 A;  1DTT A;  4E89 A;  3VQ6 A;  4E0D A;  1BI4 B;  3F9K A;  3KLF A;  1TK5 A;  3KTQ A;  4KTQ A;  1UOC A;  2P51 A;  4OPJ A;  2XHB A;  3EY1 A;  3AO4 A;  3OJS A;  3V9S A;  4DF8 A;  5KGX A;  4B9N A;  3PX6 A;  3AO3 A;  3AVJ A;  4HUE A;  1TK8 A;  3LP3 A;  3K2P A;  4FM0 A;  3T19 A;  4DU4 A;  1ASU A;  4DFJ A;  4FZY A;  1A5X A;  3S3O A;  3CG7 A;  3DLH A;  4CES A;  1U47 A;  4HCB A;  2ZE2 A;  1S5J A;  1QS4 A;  1EX4 A;  1HQE A;  3K5L A;  2B5J A;  2YHA A;  2G8H A;  3L2R A;  5HRP A;  4DTX A;  3HYF A;  1ZBL A;  1L3S A;  5CYQ A;  1J53 A;  3RTV A;  1YT3 A;  2B4J A;  2JLE A;  1F21 A;  2YNG A;  4H4O A;  4CHN A;  3TAP A;  1LV5 A;  2G8K A;  4B9M A;  1NOZ A;  4W5O A;  4BAC A;  4FJL A;  4KHU A;  5HBM A;  4O4G A;  3NGZ A;  2A1R A;  4YFU A;  3HPO A;  5C42 A;  2KW4 A;  1NOY A;  3ZCM A;  3SI6 A;  3DLK A;  1EET A;  1FKO A;  2YKN A;  3B6P A;  4DF4 A;  3VQ4 A;  1ZYQ A;  1N5Y A;  1KFD A;  3ZSO A;  2BDP A;  4NCA A;  1KVA A;  3VQ7 A;  1UA1 A;  3L3U A;  4ZHR A;  1KVB A;  1S6Q A;  4FLY A;  1KLM A;  1Z25 A;  3L2W A;  4EZ6 A;  1RBV A;  3L8B A;  3DLR A;  3OJU A;  3C95 A;  3MEG A;  4HCC A;  2A1S A;  4BWM A;  1BCM A;  1GOB A;  1QHT A;  3DOL A;  5CYM A;  4C8N A;  4Q0B A;  1IKV A;  4E7K A;  2IAJ A;  3RR8 A;  3T1A A;  3O3H A;  3LWL A;  3CFR A;  4DU1 A;  3F73 A;  3TAR A;  4ZTF A;  1GOC A;  1K6Y A;  3LZI A;  4CK1 A;  1RIL A;  4AH9 A;  2OZS A;  4KB0 A;  4FLX A;  4JS4 A;  4CGD A;  4BE0 A;  3DLE A;  4DTO A;  5FRM A;  4Q5V A;  3VQC A;  3AA5 X;  3C6U A;  4CHZ A;  1CXU A;  4CEE A;  4ZTJ A;  3QLH A;  1RT1 A;  4IDK A;  1X9W A;  4LSN A;  1A5V A;  1S1T A;  2LSN A;  3ZT2 A;  2XY7 A;  3CYM A;  3CFO A;  4CHO A;  1S1V A;  1BIS A;  3ZSZ A;  4O55 A;  4Z4E A;  4DSJ A;  3MEC A;  4OLB A;  2Z1I A;  1C0M A;  3KIO A;  3RMC A;  1KVC A;  4IG3 A;  3E01 A;  4CF8 A;  1NJX A;  4Z4G A;  2IC3 A;  4CIG A;  2HHW A;  4N56 A;  1WN7 A;  1NJW A;  1EXQ A;  1C0U A;  3AVF A;  1HPZ A;  3BGR A;  3P83 D;  3QIO A;  3TAM A;  4CJT A;  4BDZ A;  2E4L A;  2F8S A;  4B9T A;  4KFB A;  2NUB A;  2ZQB A;  2O4I A;  2IDO A;  4AHR A;  4W5T A;  4OGE A;  3DRR A;  3LAM A;  5CZ2 A;  3OYC A;  3AVN A;  4AHS A;  5SZT A;  2R7Y A;  4E7L A;  2XY5 A;  3ZSX A;  3K5M A;  1R0A A;  4O5B A;  4Y1C A;  1KSP A;  4FM2 A;  2QKK A;  4OLA A;  3SYZ A;  5HP1 A;  3TR8 A;  1RTH A;  1JLG A;  4RW8 A;  1XWL A;  1S9G A;  1HYV A;  5HRN A;  1BHL A;  2OPQ A;  4AHU A;  1VSE A;  3ZT3 A;  4CHP A;  3HM9 A;  1WSG A;  4RW4 A;  3VQ8 A;  3HPG A;  4BDY A;  1W0H A;  1IKW A;  1O1W A;  3NHG A;  4FJ7 A;  4FJ8 A;  4FYD A;  2AJQ A;  1ZBF A;  2KFZ A;  5E41 A;  1YTU A;  4DQR A;  4DLG A;  3V9X A;  3CM5 A;  3QIP A;  4I2P A;  3TAF A;  3SQ2 A;  4CGJ A;  2YNH A;  1ZBU A;  4ELU A;  4Z4H A;  3S3N A;  4KTW A;  1JXE A;  3LPT A;  4AHT A;  1DLO A;  5HLF A;  2KZM A;  3KKS A;  3O4Q A;  1YTA A;  2FC0 A;  2XY8 A;  1C0T A;  4E1M A;  1SKS A;  4FJ5 A;  4J2E A;  2HHV A;  4H8K A;  4M3Z A;  1VSF A;  4DTR A;  3NF9 A;  4C8M A;  4I2Q A;  4DTU A;  1FXX A;  1VSI A;  4E7I A;  1RBT A;  5FDL A;  5I3U A;  4CGI A;  4M45 A;  2OPS A;  4B08 A;  1NK4 A;  1B92 A;  1KFS A;  4KHQ A;  4B8A B;  4L8R B;  4FJX A;  1JLC A;  3ITH A;  3RRG A;  3SPZ A;  4KTZ A;  4KV8 A;  4FJK A;  4E3S A;  3ZSR A;  3HK2 A;  1RDD A;  4IG0 A;  3C6T A;  3V1R A;  1KTQ A;  3OYF A;  3OYL A;  1NKC A;  2PZS A;  1RT4 A;  2WON A;  1X1P A;  5T7B A;  3OS0 A;  3RRH A;  1XHZ A;  2PYL A;  3HO1 A;  1C1A A;  4KO0 A;  3NH2 A;  4CEB A;  2BE2 A;  4LD0 A;  3AO5 A;  2Z1H A;  3LDS A;  5KRS A;  3OYB A;  3EYZ A;  3VQE A;  4MQ3 A;  4B8C A;  1HJR A;  1HQU A;  1RT7 A;  2IOC A;  3MXJ A;  3NCI A;  1D9F A;  1BL3 A;  2XO7 A;  2GBZ A;  1WNS A;  4IFV A;  4KRE A;  2VWK A;  1QQC A;  4FW2 A;  2ITG A;  4BDP A;  2HHQ A;  2HNY A;  3QES A;  2HHT A;  2HHU A;  4OKK A;  3MXI A;  4J2B A;  1VRU A;  1D9D A;  3KLI A;  2D0A A;  2HNZ A;  2E6M A;  1SKR A;  1U4B A;  4DFM A;  3NFA A;  4NYN A;  3QEI A;  4Y1D A;  4NCB A;  3VQQ A;  3S3M A;  3A2F A;  2G8W A;  4NYF A;  1C1B A;  2IGI A;  1U48 A;  3QO9 A;  1JL2 A;  3V6D A;  5I42 A;  1Q8I A;  4QCL A;  3SUN A;  1BCO A;  1U04 A;  4DFK A;  1X9M A;  2ATQ A;  1IKX A;  4FXD A;  5HRO A;  3DLG A;  4LSL A;  4CHY A;  3KD1 E;  2D5R A;  1EP4 A;  4DS4 A;  4M3U A;  1JLF A;  3KK2 A;  3JYT A;  1BQM A;  3THV A;  3V9U A;  4C8L A;  3NGI A;  1JL1 A;  2JGU A;  3T3F A;  4J2A A;  3SUP A;  1LWC A;  4HTU A;  1WSE A;  2G8U A;  3M8Q A;  2OZM A;  1QTM A;  1JKH A;  4KI6 A;  2YNF A;  2D0C A;  1B9D A;  1RT2 A;  3ZSV A;  4I7F A;  1HYS A;  1LW0 A;  1JLA A;  4CER A;  4DQS A;  4TSX A;  4PQU A;  3QNN A;  2RPI A;  4CJL A;  3MEE A;  3UIQ A;  4CF9 A;  4OGC A;  3SZ2 A;  4CFD A;  2O4G A;  4FVM A;  4CJE A;  4CJQ A;  4EZ9 A;  4CEC A;  1ASW A;  1UWB A;  4WE1 A;  4FJH A;  4OJR A;  1HNI A;  3D0P A;  1T03 A;  3AVL A;  3S9H A;  1TKD A;  2IS3 A;  2GV9 A;  3KK1 A;  1I39 A;  3RMA A;  4DTS A;  2X6S A;  2ZD1 A;  2Y1I A;  5HRR A;  4CIF A;  3QEW A;  3B6O A;  1Q9Y A;  4F4K A;  1U45 A;  1LAV A;  1RNH A;  5SWM A;  1RT6 A;  3O4N A;  4FK0 A;  4OKJ A;  4NCG A;  3CQ8 A;  3PY8 A;  4KB1 A;  4KHW A;  5HRS A;  1TAU A;  1J54 A;  2XRI A;  3V1O A;  4FK2 A;  5JS1 A;  3AVG A;  4FLV A;  4FLU A;  2YHB A;  4CED A;  4DTM A;  1ZBI A;  4DS5 A;  4DTJ A;  4CJV A;  2HHX A;  3NF8 A;  1JLE A;  3DRS A;  3KKR A;  3VQB A;  1SV5 A;  3OYN A;  3TWH A;  3VA0 A;  3TAQ A;  4I9L A;  3WNH A;  3ZSQ A;  2DTU A;  3U3G A;  4MFB A;  3AA2 A;  1BI4 A;  3P5J A;  4FCY A;  4QOZ B;  1BIZ A;  1QSL A;  5C24 A;  1NKB A;  3SPY A;  4KHS A;  3ALY A;  1YVU A;  4CCH A;  4Z4F A;  2RF2 A;  1ZBH A;  5CZ1 A;  4CF2 A;  4QAG A;  1CZB A;  4DTP A;  1UA0 A;  1FK9 A;  2BAN A;  4IKF A;  4N76 A;  1N6Q A;  1G15 A;  1XC9 A;  1CLQ A;  3KLE A;  3ZSW A;  4E1N A;  3QIN A;  1XHX A;  2OPP A;  4PWD A;  4C8K A;  1WSI A;  4GVM A;  3DOK A;  4CJU A;  2G8F A;  2KQ2 A;  1VSK A;  1WAJ A;  3EZ5 A;  1U49 A;  4FJG A;  3K57 A;  2Y1J A;  1HNV A;  4BE1 A;  3V81 A;  4UQG A;  3AVB A;  3ZT0 A;  4LH5 A;  4BE2 A;  4DSI A;  1RDB A;  1S6P A;  4Z4C A;  1NK0 A;  2QK9 A;  1Z26 A;  1IO2 A;  1Y97 A;  4CJK A;  4DFP A;  4M3W A;  4CIE A;  3P1G A;  3OYG A;  5J2M A;  2EHG A;  5KTQ A;  1SL0 A;  1WSH A;  1BGX T;  1L5U A;  3VQA A;  1HRH A;  3O3F A;  3MAQ A;  3SV4 A;  4JS5 A;  3VA3 A;  3SQ0 A;  2OA8 A;  1TAQ A;  4CJ3 A;  4CK3 A;  4N5S A;  3TAE A;  3AVC A;  3ISN C;  3WNE A;  3ASM A;  1TKZ A;  4OVL A;  5KRT A;  1CXQ A;  3NF6 A;  4CEF A;  3SQ1 A;  4FZX C;  4CJ5 A;  3JSM A;  3LAN A;  1LAW A;  1LWE A;  2PYJ A;  3OYM A;  1VRT A;  3HJF A;  4CEA A;  4B3O A;  3NF7 A;  3WNG A;  1NK5 A;  3AA4 A;  1NK8 A;  4KI4 A;  3VQP A;  1WLJ A;  1FKP A;  2HND A;  4E7J A;  1UAX A;  3SQ4 A;  3IG1 A;  3QEV A;  1VSM A;  2X74 A;  2KZZ A;  2FBV A;  4C8O A;  3DM2 A;  1L3T A;  1QE1 A;  3LP2 A;  3HT3 A;  3QEX A;  4B9L A;  2OPR A;  1JXB A;  3U3Y A;  4G1Q A;  2XY6 A;  3WNF A;  1RBR A;  1S1X A;  4CGF A;  3O3G A;  3L2Q A;  1TL1 A;  4HUG A;  4KHN A;  1JLB A;  2VWJ A;  3RMB A;  3SUO A;  4CF0 A;  3KK3 A;  4CEO A;  1NKE A;  4PA1 A;  1SKW A;  4H4M A;  3VN5 A;  1TVR A;  1GOA A;  1I3A A;  4GMJ B;  4LH4 A;  4OKE A;  2G8V A;  4J2D A;  3RMD A;  1CZ9 A;  3I8D A;  1MU2 A;  2FBT A;  3HPH A;  3I0R A;  1TL3 A;  3SUQ A;  2P5O A;  1KLN A;  1B9F A;  1DTQ A;  4DSF A;  3SNN A;  2RKI A;  4W5Q A;  3K5N A;  3LP0 A;  4O0J A;  3L3V A;  3G0Z A;  3MXM A;  1RBS A;  4CGH A;  1RDC A;  3HVR A;  4IFY A;  1T05 A;  2P5G A;  3NGY A;  4IBN A;  3DLB A;  1C1C A;  3M8P A;  4KAZ A;  4KHY A;  1RTD A;  4M3X A;  1VSD A;  4O44 A;  1TKX A;  3NE6 A;  2GUI A;  2HVH A;  1HYZ A;  3VQ9 A;  4CJS A;  1S1W A;  1IKY A;  3ZT1 A;  4CFB A;  5EU7 A;  2KFN A;  4HVJ A;  4M42 A;  4PY5 A;  4CEQ A;  1BIU A;  5DK5 A;  1Q9X A;  5FRN A;  3L2U A;  2YV0 X;  1XI1 A;  1LWF A;  3AO2 A;  3NH1 A;  3KLG A;  4E7H A;  1NJY A;  3PX4 A;  3BDP A;  1VSH A;  4FJI A;  1NJZ A;  4XIU A;  4EP4 A;  2DFE A;  2X78 A;  1BQN A;  3KLH A;  4ID5 A;  2FBX A;  2FBY A;  3DRP A;  3LP1 A;  2E6L A;  4M3R A;  3V1Q A;  1QSY A;  3OYK A;  5FRO A;  3V4I A;  4CJP A;  1KRP A;  3OVN A;  3ULD A;  4FLZ A;  3OS1 A;  3TAG A;  3TI0 A;  1NK6 A;  1VSJ A;  4DU3 A;  3LPU A;  1NK9 A;  4CFC A;  3IRX A;  3AVH A;  4CJR A;  3V9W A;  2I5J A;  4B9U A;  4JRP A;  4B9V A;  1C6V A;  4OPK A;  4Z0U A;  3MED A;  3QET A;  1KCF A;  1J5O A;  3HL8 A;  4YNQ A;  3H08 A;  3SJJ A;  2HVI A;  3NAE A;  3LZJ A;  4DSE A;  4BWJ A;  4DMN A;  3RR7 A;  4Z4I A;  2VG5 A;  1D8Y A;  3ZSY A;  4FJ9 A;  2QKB A;  4M3T A;  2B6A A;  2Z1J A;  4RW9 A;  3QNO A;  3OYH A;  4FLW A;  2PY5 A;  4B9S A;  3LAK A;  2F8T A;  4CEZ A;  4DSL A;  5JS2 A;  4F2S A;  1EKE A;  4FW1 A;  3OS2 A;  2YKM A;  2HHS A;  3PO5 A;  1SL1 A;  3CM6 A;  5CY4 A;  2BGG A;  1D5A A;  2ETJ A;  4KKO A;  1LW2 A;  4HHT A;  4RW6 A;  2P1J A;  4CJF A;  4W5N A;  3RWU A;  4FZZ A;  2YNI A;  3K58 A;  1VK0 A;  1RT5 A;  2HB5 A;  4FK4 A;  4AHV A;  3PUF A;  3K5O A;  3NBP A;  4CGG A;  3TAB A;  1S1U A;  2W42 A;  3OYJ A;  4FJN A;  2VG7 A;  1IH7 A;  4CF1 A;  4M41 A;  1RTI A;  2QXF A;  4ELT A;  3VQD A;  5J2P A;  1WSF A;  2DFH A;  2HW3 A;  3M8S A;  1TKT A;  3OYE A;  4DQI A;  5D3G A;  2EX3 A;  3CFP A;  2KTQ A;  4I9Q A;  3QER A;  5KI6 A;  1ASV A;  2RN2 A;  3OY9 A;  3HST B;  1JLQ A;  4O0I A;  3AVA A;  5J1E A;  1RT3 A;  2F96 A;  3C94 A;  5J2N A;  3SCX A;  3HXM A;  4CJ4 A;  4KPY A;  1S9E A;  4DLE A;  1IG9 A;  3AVI A;  3I0S A;  3V9Z A;  3PV8 A;  1REV A;  3AA3 A;  4CJW A;  4HUF A;  5J2Q A;  1L3U A;  4AIL C;  2HMI A;  4DQQ A;  3NH0 A;  1TGO A;  3SV3 A;  4ELV A;  4FJJ A;  3LAL A;  3HVT A;  4DG1 A;  3DI6 A;  1A5W A;  1HMV A;  5C25 A;  2WOM A;  4CK2 A;  4W5R A;  1X9S A;  1SL2 A;  4ICL A;  4FJM A;  4DSK A;  4F3O A;  3HP6 A;  2Q3S A;  3DYA A;  1W9H A;  2DFF A;  4CFA A;  3QEP A;  1L3V A;  4PUO A;  3VQ5 A;  3FFI A;  2DY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...