3QIOA

Crystal structure of hiv-1 rnase h with engineered e. coli loop and n-hydroxy quinazolinedione inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
148
structure length
136
Chain Sequence
MYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIITQWIHNWKKNVDLVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Binding Analysis of Pyrimidinol Carboxylic Acid and N-Hydroxy Quinazolinedione HIV-1 RNase H Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Transferase, hydrolase/inhibitor
molecule keywords Gag-Pol polyprotein,Ribonuclease HI,Gag-Pol polyprotein
total genus 43
structure length 136
sequence length 148
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3qioA00
1HNVA 2VWKA 4CF1A 2ZQBA 4Y1DA 2BGGA 1LWCA 1VSKA 2FC0A 4OKJA 3OJUA 1HYVA 4FJKA 3TAQA 3ZSZA 1XHZA 3QEPA 4AHRA 2D0CA 3DOLA 4I2QA 1CLQA 1WSIA 3AVFA 5I42A 2PZSA 3VQCA 3D45A 3G0ZA 3TAMA 1EX4A 2XRIA 4F2SA 4DTMA 1D8YA 1ZBHA 4FM2A 1TAUA 1JXBA 1RDDA 3DLHA 3AA4A 3NF7A 4JRPA 3OYLA 3DLBA 4R5PA 4B9SA 4AHVA 1VRTA 4BE0A 3V81A 5CZ1A 2FBVA 2Q3SA 4HTUA 1FKPA 2HNDA 2YNGA 2KZMA 1I3AA 2OPSA 4KV8A 3ZCMA 3DLRA 3V1RA 3VA3A 3AO3A 4CESA 3RTVA 4B8AB 4CGJA 1T05A 5HRPA 1RT3A 1RBRA 1XHXA 3M8QA 3OYEA 4Z4IA 3KLFA 3EYZA 4JS4A 4M3XA 1N5YA 5DK5A 1VSHA 4BE2A 1TKZA 3SQ4A 2D0BA 3RR8A 3O4QA 3QEVA 1S1TA 1JLEA 3ZSYA 4KRFA 1MU2A 4BDZA 4N47A 4CJQA 1IG9A 4GVMA 1RDCA 3SV3A 1NJWA 4CEAA 1LV5A 1Y97A 4HUGA 5HP1A 5D3GA 5K14A 4DSKA 4KHNA 3HK2A 5CY4A 1NKCA 1O1WA 1TGOA 3AVJA 3VQ6A 2ZE2A 3LZIA 1WLJA 3K58A 2R7YA 1J54A 4M3RA 3V4IA 4OKEA 1KFDA 3LWLA 1IKXA 2OPRA 3ZT2A 1LWEA 3THVA 3OYJA 3VA0A 3U3YA 2G8KA 2A1SA 1NKBA 3NH2A 1ASVA 1VSMA 1CXQA 2HW3A 1X9WA 1XC9A 3CYMA 2BANA 1CZBA 1D9FA 1RTJA 3AO1A 3DMJA 1KCFA 1NK8A 1RT5A 4DU3A 2YV0X 1VSJA 3KLHA 3C6TA 4O5BA 2RPIA 4M3WA 3LPUA 4DLGA 4FJIA 4H8KA 1ITGA 3QEWA 2FBYA 4KI6A 1LAWA 4GMJB 5CYMA 3WNHA 2DTUA 1BQMA 4O0JA 1U49A 4E7KA 3IG1A 3ZSXA 3ZT1A 1WAJA 4AH9A 1TAQA 3AVGA 2FBTA 4AHUA 1SV5A 1YTAA 4FVMA 2P5OA 1JLBA 4DFPA 3LAKA 4OJRA 3OYDA 5KRTA 4CIGA 1D5AA 4CEOA 3LALA 4PA1A 4QOZB 2G8FA 3VQ7A 4B9UA 3DOKA 1TKDA 1QSSA 4DQPA 2F8TA 4CJSA 1XI1A 2IC3A 4FJJA 2DFEA 1WSFA 2HVIA 3L3UA 3SUPA 3HJFA 2VG7A 3IRXA 3DRRA 4G1QA 3SPYA 2F8SA 4M41A 1JKHA 4AILC 3OY9A 2RKIA 4FW1A 3MEEA 4B9MA 1QS4A 1LAVA 3NFAA 4CEZA 3TR8A 4DWIA 1BGXT 5JS2A 4K8XA 4FJ8A 3KK2A 2RN2A 4CF0A 2KW4A 1SUQA 3MECA 3HM9A 2KQ2A 4DTPA 2XY6A 2EX3A 2XY7A 4B9LA 4E1MA 3KTQA 4KREA 4EZ6A 1YVUA 1XWLA 1LW2A 1T8EA 4DTSA 2G8UA 1HYZA 2YKMA 3PO5A 4CCHA 2DY4A 4HCCA 3VQ4A 3F73A 3L2VA 5HROA 1SL0A 4CJ3A 2KTQA 3LWMA 3SPZA 1HQEA 3EY1A 5CZ2A 4J2AA 1RDAA 1KTQA 3DYAA 3ITHA 4FCYA 3EZ5A 4I7FA 4N76A 4JLHA 1DTTA 1RBUA 4DFKA 2O4GA 3RWUA 4DQSA 3B6PA 3HL8A 3LPTA 4OLAA 1GOAA 3WNEA 3K5MA 2YHAA 3OYIA 3K5NA 1DLOA 1TVRA 4M3ZA 4FLUA 1QQCA 1HQUA 3KK1A 3HP6A 1QSLA 5HRSA 5T7BA 2ZD1A 3TARA 1VSLA 4KTWA 4LD0A 1NK5A 2HB5A 4UQGA 4FZZA 1UA0A 3ASMA 1IKWA 4DTOA 3FFIA 4CK3A 4DTJA 1QHTA 3QNOA 3AA3A 4KB1A 2W42A 3OYNA 2YHBA 1RT7A 1J5OA 2WOMA 2RF2A 3LP0A 3DM2A 3VQAA 1NOYA 2KFNA 2IDOA 3OYFA 1QE1A 1Q9YA 1JLQA 1S9EA 4M3UA 3VQPA 4CK2A 3BGRA 4IFVA 3T1AA 4BDYA 4DSEA 3TABA 3HT3A 3RMDA 1IH7A 1X9MA 3ALYA 1WSEA 3KLEA 4J2EA 3MEDA 2G8WA 4KHYA 1S1UA 3KD5E 2BDPA 1B9FA 1J9AA 1RBVA 3O4NA 3AVNA 4NCGA 3AA5X 4M45A 4W5OA 5HRNA 4FM0A 3OVNA 1JXEA 4DSJA 4L8RB 4Z4HA 3M8SA 4OLBA 4FYDA 1HYSA 1QTMA 1X1PA 4LY7A 3MXJA 2VWJA 2OZMA 4ELTA 4CJVA 2G8HA 3L2QA 4FZYA 4C8OA 1SL2A 4KFBA 2X6SA 4E7HA 2B4JA 3S9HA 3NH0A 1JL2A 1BIUA 4QCLA 1SKRA 4F4KA 4TSXA 3VQQA 3KLGA 4JS5A 4J2DA 3QETA 3NAEA 4M3TA 3OYAA 4ZTFA 4YFUA 4B9TA 1NK9A 2P5GA 2B5JA 2HNZA 4NCBA 3P1GA 3CFPA 3VQDA 4Z4CA 2QK9A 2DFHA 3QO9A 3VQ5A 5KGWA 1ASWA 3HYFA 4H4MA 4CF2A 3TWHA 1NJZA 3SQ1A 4RW6A 4EP5A 4CHQA 5FRMA 1S6PA 3H08A 4DFJA 3SNNA 3QNNA 4NYNA 2EHGA 1BQNA 4IKFA 1C0UA 3U3GA 3B6OA 1UOCA 3L8BA 2YNFA 4DS5A 3OS2A 1NK0A 2D5RA 4AHCA 3DLKA 4CFDA 4ELVA 4FJLA 4CHPA 2VG6A 4FXDA 2HHUA 2P51A 4W5QA 4QAGA 4FLVA 3AVLA 2E6MA 4I2PA 1WNSA 2Z1HA 4FW2A 3SUOA 5E41A 1BL3A 4ID5A 3T19A 1ZBFA 4IG0A 4E89A 1TK5A 1DTQA 1KLNA 2XY8A 1C1AA 4PQUA 1S1VA 1S9GA 1HMVA 1VSDA 1GOBA 3PX0A 1F21A 4KKOA 1SKWA 3VQ8A 4ZHRA 1TL1A 5HBMA 4M42A 1ZYQA 3OS0A 1KVBA 4F8RA 1W9HA 4CJFA 4O55A 1FXXA 1I39A 2YNIA 3L2UA 4CF8A 1R0AA 3V9WA 3PX4A 1RT6A 1NJYA 4E7JA 3OYHA 3JYTA 1U48A 1ZBUA 4B3OA 4CHNA 4W5RA 3CM5A 3TAFA 1T03A 4PUOA 4JRQA 4PY5A 1REVA 3LDSA 4E7IA 4N56A 2AJQA 4W5TA 3ZSRA 4CFAA 3OYGA 1TL3A 3BDPA 1CZ9A 2XY5A 4BDPA 3RR7A 1JL1A 1RCHA 1IKVA 1BI4A 3MXIA 4IFYA 1UWBA 2OPQA 4CFBA 5KI6A 3SV4A 3HPGA 5CYQA 3TANA 3NGIA 4DF4A 2QKBA 4N41A 3L3VA 4ICLA 1CXUA 3E01A 3MXMA 3I8DA 5HRRA 4LH4A 5I3UA 1QSYA 4RG8A 5FRNA 4LH5A 1BCOA 1RBSA 4CERA 4CECA 1RT4A 3SYZA 3ISNC 2O4IA 4CK1A 4Z4GA 3PV8A 3RMAA 2E4LA 1RTDA 4Q0BA 1C1CA 4OKKA 3HVRA 3UIQA 1RT1A 4ID1A 3VQBA 3AVKA 1BCMA 1S1XA 4CJ5A 3CM6A 3SUNA 3PUFA 1RDBA 4HUFA 2HVHA 5J1EA 1HNIA 4DU4A 5SZTA 3K59A 1ZBLA 1JLAA 3OYBA 2QKKA 3O3HA 4CJRA 3KD1E 4CJWA 4CJKA 3QIPA 2G8IA 4HUEA 4W5NA 2OYQA 1IKYA 3HO1A 3TAPA 3U6FA 3NH1A 1C0TA 2E6LA 1NK6A 3SI6A 3LP3A 2HHQA 1KVCA 2D0AA 4PWDA 3ZSWA 2DFFA 4YNQA 2YNHA 1SL1A 1EXQA 3O3GA 1FKOA 4EZ9A 1HJRA 2Z1GA 2PYJA 4FLXA 4RW9A 3ZT0A 3AVCA 4E0DA 4B9NA 4LSLA 4B08A 3P83D 3SJJA 1RTHA 3CQ8A 4NYFA 4FJ9A 3NGYA 4E1NA 3CFRA 3SZ2A 2IGIA 4FLZA 4DSFA 3V9ZA 1WSJA 5KGXA 2X78A 4O4GA 2GUIA 3S3MA 1TK8A 3KK3A 1L3SA 3I0SA 1Q9XA 4CJUA 5J2PA 2Z1JA 2HHVA 3QIOA 2I5JA 3WNGA 4I9QA 4GW6A 3KIOA 4IDKA 1WN7A 4F2RA 1VSIA 1EKEA 1K6YA 4CEQA 1G15A 1NK4A 2P1JA 5C24A 1RILA 4RW7A 5HLFA 4WE1A 2HHXA 1U04A 5FDLA 3K5LA 1KSPA 4FJXA 1TK0A 1EP4A 2IS3A 1VRUA 3KKRA 4KTZA 4Y1CA 4CEBA 5J2MA 2A1RA 1RNHA 1JLCA 3V1OA 1BHLA 3NF6A 2JGUA 1YTUA 4Z4EA 4XIUA 4RW4A 4DG1A 3P5JA 4FJNA 3LP1A 1J53A 4CGFA 3DRSA 3AO2A 2XHBA 3ULDA 3AA2A 4CGHA 4CHYA 4OVLA 1UAXA 4CGDA 1BISA 4BACA 4KHUA 2B6AA 2F96A 4FK0A 3OYKA 3DLGA 3HPHA 3PO4A 1C0MA 4KI4A 3G10A 3HP9A 2FBXA 4OPKA 4KHQA 1N6QA 5C25A 3AVMA 3K5OA 4H4OA 5EU7A 4CHZA 2QXFA 3T3FA 3PY8A 3VQEA 4CIEA 4IBNA 2PY5A 1BI4B 4DF8A 1NKEA 1L3TA 4ELUA 4AHTA 4KPYA 1ZBIA 3ZT3A 4DQRA 3NF9A 3D0PA 4J2BA 3SCXA 4FJMA 3SQ0A 3NF8A 3AVHA 5KTQA 2LSNA 4F3OA 1KRPA 3JSMA 1RBTA 1RTIA 4LSNA 5C42A 4DQIA 2BE2A 3M8PA 4IG3A 1B92A 1A5VA 1B9DA 1BIZA 1TKTA 3QEIA 4B8CA 2GBZA 2Y1IA 4CJEA 1S1WA 3ZSOA 3S3OA 1LWFA 1WSGA 3QERA 2ATQA 1UA1A 1KFSA 1C6VA 3TI0A 1U47A 1HRHA 4CFCA 3RRGA 4CJ4A 3AO4A 4FLYA 2HMIA 4DSIA 4NCAA 3A2FA 3OYCA 3VN5A 3AVAA 4CEEA 5J2QA 4F3TA 5JS1A 3OYMA 3AVIA 3QINA 3ZT4A 2IAJA 4DS4A 3HSTB 4C8LA 4DSLA 1VSFA 1S6QA 4DTXA 3S3NA 4RW8A 1Q8IA 4CEDA 2WONA 4CHOA 3DRPA 4OPJA 5FROA 4MQ3A 4CEFA 1W0HA 1A5WA 2JLEA 3HPOA 3NBPA 3SUQA 1NOZA 1LW0A 2OA8A 4FJGA 4FZXC 4FJ5A 4C8MA 1RT2A 1FK9A 2XO7A 4DLEA 4KHSA 1HPZA 3V9UA 2HHWA 1X9SA 4KTQA 4DTNA 3KJVA 4HVJA 3HVTA 3CG7A 3RRHA 4K8ZA 2HHTA 1IO2A 3RMCA 5SWMA 4CJTA 4BWJA 3LP2A 4E3SA 5J2NA 1Z25A 3ZSQA 4AHSA 3NCIA 1U4BA 4DTRA 3MEGA 1C1BA 2GV9A 1VK0A 3V9SA 2Y1JA 1EETA 3K2PA 3ZSVA 1L3UA 3LAMA 3NE6A 2PYLA 4DQQA 4Z0UA 4DMNA 4CIFA 4OGEA 3C6UA 1JLFA 1S5JA 2ITGA 4CGGA 1TV6A 3OJSA 4FK4A 4KAZA 4Z4FA 4C8NA 3LZJA 3QEXA 4B9VA 4HHTA 1WAFA 3AVBA 4O0IA 4N5SA 3TAEA 2X74A 2KFZA 3IAYA 3QLHA 3O3FA 3LANA 3NHGA 3QESA 1NJXA 4KB0A 2OPPA 4ZTJA 3DI6A 4FK2A 1SKSA 3CFOA 3PX6A 4CE9A 2G8VA 4CJPA 2Z1IA 3HXMA 3L2RA 4MFBA 3MAQA 2X6NA 1JLGA 4BWMA 1A5XA 1TKXA 1ASUA 1L3VA 1KLMA 3V1QA 2VG5A 4FM1A 3NDKA 3C94A 1U45A 4KHWA 3NGZA 1WSHA 4OGCA 3VQ9A 2IOCA 1D9DA 4E7LA 4I9LA 4M3YA 1GOCA 2HNYA 4DTUA 3K57A 1NK7A 3V9XA 2ETJA 4E19A 3IS9A 4FLWA 3F9KA 4FLTA 1T7PA 4CF9A 5KRSA 1VSEA 4HCBA 3V6DA 1YT3A 4Q5VA 3C95A 4CJLA 4FJHA 3AO5A 2KZZA 3AV9A 4C8KA 3KKSA 4KO0A 3I0RA 4CGIA 2OZSA 5DMRA 4EP4A 2YKNA 3RMBA 3M8RA 4FJ7A 3OS1A 4DU1A 2HHSA 1L5UA 4O44A 1Z26A 3L2WA 3TAGA 3SQ2A 3WNFA 4BE1A 3KLIA 2NUBA 4DFMA 3DLEA 1KVAA
chains in the Genus database with same CATH superfamily
1HNVA 2QM1A 3UB5A 1LWCA 1VSKA 4ISEA 3OJUA 4FJKA 4GV3A 4AHRA 4LF5K 3W0LA 4I2QA 1CLQA 2A5XA 3CCJN 2NRHA 1BDGA 2XRIA 4A2BA 4YOWA 2P9NB 1VRTA 3SAHA 2FBVA 2Q3SA 4X65K 4B1UB 1I3AA 2OPSA 3ZCMA 4KHPK 3THWB 3ZETB 4CESA 4B8AB 1RT3A 3FZFA 4DV2K 4FWKA 1C0FA 1N5YA 5DK5A 4BE2A 4MO4A 5FPEA 1KD1O 4BDZA 5AQWA 1RDCA 4JV5K 4C23A 1NJWA 1LV5A 1Y97A 5D3GA 4DSKA 3VEVA 1O1WA 3AVJA 5FLXO 4WFNL 3LZIA 4GV9A 1WLJA 2Q97A 3K58A 4BQZA 1IKXA 2OTLN 3OYJA 3VA0A 3P4IA 3KHYA 1VQ6N 1RTJA 4JHDB 1RT5A 1Q82O 2YV0X 2D0OA 3LDNA 3M1FA 1SZ2A 1NGBA 4O5BA 3LPUA 4H8KA 5BR9A 1LAWA 4GKJK 4GMJB 2HBJA 5CYMA 2WFBA 1BQMA 4FOIA 1WAJA 3C65A 1V4SA 3AVGA 4QS9A 1JLBA 2YX6A 3ENOA 4X66K 4QOZB 1QHAA 3NVKA 4B9UA 5AQYA 3CJ1A 4IO9L 2F8TA 4FJJA 2O8EA 2IC3A 1WSFA 4BR9A 3IRXA 2F8SA 4M41A 4AILC 2RKIA 1LAVA 4CEZA 4DWIA 1BGXT 4FJ8A 2KW4A 2KQ2A 3EEQA 4YY3K 4B9LA 4BGBA 4E1MA 4KREA 4AF1A 3WEEA 4M7YA 1T8EA 4CCHA 5B8HA 3PO5A 4M63C 3VQ4A 3F73A 5CZ2A 4LF4K 2FSKA 2P9KB 1YUWA 3R3LA 1RBUA 4DFKA 3ULEB 4DQSA 3SBGA 3B6PA 3LPTA 1E3MA 1GOAA 3K5MA 3K5NA 1TVRA 2QWRA 1GLDG 3TARA 4KTWA 5KQDA 1IKWA 4CZGA 3H1QA 5BRDA 3QNOA 4CZKA 4KB1A 3OYNA 1J5OA 2WOMA 5BN8A 3LP0A 3DM2A 3VQAA 3O80A 3R9PA 3OYFA 4Z94A 1S9EA 4M3UA 5C12A 4DSEA 3TABA 1D4XA 3ALYA 4J2EA 3MEDA 4DQ8A 4WQ4C 4NCGA 3VGKA 4DSJA 1QVGM 4OLBA 4Z4HA 4CZLA 4LY7A 3MXJA 1GLEG 3VEOA 4ELTA 2G8HA 3WQUA 4OPHA 1NGJA 1VQ5N 1JL2A 1BIUA 3CPEA 4JKAA 4F4KA 4JS5A 4J2DA 4CD1A 3OYAA 2P5GA 2QK9A 3P1GA 1S72N 2DFHA 1ASWA 3HYFA 3A8YA 2HHHK 3H08A 3ID8A 3LM9A 4NYNA 4IKFA 3U3GA 4A57A 5IWAK 2PAVA 1ATNA 4FWMA 4WQ5A 4FJLA 2HHUA 2P51A 2I7PA 4FLVA 1YITN 2E6MA 2QWOA 1ILYA 4FW2A 2Q31A 3SUOA 5E41A 4B1ZA 4ID5A 3T19A 3KWGA 3E9PA 1ZBFA 2XY8A 1HUXA 1HMVA 1MWMA 1VSDA 3TPQA 1F21A 2W6KA 5AQFA 5EXWA 5HBMA 5C10A 2QWMA 4BC4A 3EKSA 1FXXA 1HNXK 4BRLA 3L2UA 1R0AA 1YI2N 3V9WA 3PX4A 1RT6A 4CZHA 4X62K 1U48A 1ZBUA 2NRRA 3BUZB 4W5RA 4U7BA 4LF7K 3VEYA 4PUOA 3TAFA 3SAGA 4JKHA 4JRQA 1NGDA 4PY5A 4G9ZA 1TL3A 2BH1A 1DEJA 4BDPA 1JL1A 4IOXA 4CVNE 1IKVA 3MXIA 5AQOA 1TYQA 1UWBA 5BRHA 3HPGA 1X3MA 4Y0WA 4BRIA 5BR8K 2NZTA 3I8DA 4LH4A 1QSYA 1TUUA 4CERA 1XNRK 4CK1A 1RTDA 1BG3A 2HBMA 2V51B 4Q0BA 3CC2N 3AVKA 4MLHA 3VTIA 3SUNA 5AQIA 2E8AA 4JI1K 3A5LC 2QA4N 3K59A 3NVMA 2QWNA 4CJKA 3QIPA 4HUEA 1Q81O 3HO1A 4BRDA 3SI6A 3LP3A 4NB4A 2D0AA 4PWDA 2DFFA 4YNQA 2YNHA 3MWPA 1SL1A 1NLVA 3G71N 2PYJA 4FLXA 1SS6A 3ZT0A 4E0DA 3D6RA 4B9NA 3FZMA 3O6WA 3MMVA 4WFAL 3CFRA 3AGKA 2UXBK 4B1XB 1XMOK 3VERA 1DKGD 2Z1JA 2HHVA 1MA9B 4I9QA 1VSIA 3JXUA 1K6YA 3HTVA 4FWNA 4BRCA 3CCSN 2P1JA 4XEIA 4BRKA 5EY4A 4YHHK 5ADXA 2QWLA 1U04A 2HHXA 3K5LA 4FJXA 1TK0A 3PLAA 3KKRA 3K9KA 5J2MA 2A1RA 5BRFA 1YTUA 4XIUA 4RW4A 1P90A 4FJNA 1J53A 3AO2A 2XHBA 4CGHA 5M1FA 4JK7A 4KHUA 4PKIA 2ZJQL 3HPHA 1C0MA 4B1YB 1R59O 4KHQA 3AVMA 5EU7A 3CCLN 2E88A 1TYQB 1NKEA 1KAYA 4BROA 4CZEA 3GDQA 5E84A 3NF9A 4J2BA 5KTQA 3FGUA 4CI6A 1RDUA 1A5VA 3SJHA 4DKWA 1TKTA 1S1WA 4FWPA 1LWFA 1WSGA 1BOTO 4BC5A 1VAZA 2ZGZA 3VN5A 3AVIA 4BRFA 1S6QA 3EKUA 4CEDA 4FPBA 3NBPA 4IZ9A 4FK4A 3B8AX 4FJGA 4FJ5A 3TSPA 1FK9A 2BTFA 4DLEA 2HHWA 5AQKA 3HVTA 1IO2A 3D7EO 5SWMA 4B3MK 4E3SA 1Z25A 4DV0K 1M90O 4LC9B 3MEGA 1VK0A 4JYAK 4O8UA 1Q86O 4BR5A 2QWPA 1FW6A 3JS6A 4OGEA 1S5JA 3OJSA 1TV6A 4B9VA 4DR7K 2I7NA 4LFAK 2QWQA 1WAFA 2A42A 3AVBA 4O0IA 4I6MA 3CMAN 2X74A 3IAYA 3QLHA 3O3FA 3NHGA 3VENA 2KLAA 4E1JA 2OPPA 3TTCA 1NJXA 2UUBK 3PX6A 1IV0A 4CJPA 3FZKA 4IO8A 3LM2A 3T1HK 4MFBA 1KLMA 4JI7K 2ASPA 3VQ9A 3FZLA 1D9DA 4H5TA 4I9LA 1GLAG 1J6ZA 2HNYA 1VQ9N 2ETJA 1VSEA 4HCBA 3K9JA 4Q5VA 1X3NA 4FJHA 3AO5A 2KZZA 1IBMK 4CGIA 2OZSA 4FJ7A 3OS1A 1L5UA 3L2WA 4BE1A 4ELUA 1XHZA 3DLEA 2D4WA 1KVAA 2VWKA 2BGGA 2P9KA 4XH1A 3DWLA 3TAQA 4RWTA 4GNIA 3QEPA 5AQLA 4JI6K 3DOLA 2ITMA 4FOEA 4BC3A 1WSIA 5I42A 2PZSA 4GVEA 3WEEB 3D45A 1EX4A 3OBYA 1D8YA 1TAUA 4HWIA 1RDDA 5CR4A 3MN7A 1TUYA 5BN9A 4JRPA 1N34K 3DLBA 2YHYA 4AHVA 4DUZK 3CCRN 4BRQA 4WFBL 1FKPA 2HNDA 2YNGA 4KV8A 3ID6A 3DLRA 3O9UA 1Y64A 3RTVA 3R1XA 3UE5A 2D0PA 3U8XA 4JS4A 4NXMK 3RR8A 2D0BA 1S1TA 1JLEA 4KRFA 1EQYA 4CJQA 2OANA 4GVMA 4K43A 3SV3A 4LF9K 4HUGA 5HP1A 2E2OA 3T7ZA 1VQLN 5I9EB 1N36K 4KHNA 4OX9K 3VQ6A 5BPLA 1ATSA 1J54A 4M3RA 3AGRA 3V4IA 1BA1A 2FF3B 2OPRA 3I55N 1HKBA 4YOTA 3I33A 4H0OA 2G8KA 1Q18A 3NH2A 1ASVA 1N32K 3LDLA 3HOTA 2IVOA 4BR7A 1W2BM 4FWQA 4IWVA 1NG9A 1KCFA 5AQZA 2A40A 2NRZA 3KLHA 3C6TA 1HKCA 2RPIA 4JK8A 4DV5K 1ITGA 3QEWA 2FBYA 1EWQA 4O0JA 3ZSXA 3VOVA 3SMPA 2P5OA 4DFPA 2NRXA 2Q2RA 4WF9L 5KRTA 2WBNA 5AQXA 4CIGA 4CZJA 3O08A 5AQGA 2G8FA 3THWA 2DFEA 3L3UA 3SUPA 2FXUA 2VG7A 3CJ9A 3DRRA 4FW1A 4B9MA 1QS4A 2P9NA 3TR8A 2IIRA 5JS2A 2RN2A 4CF0A 5M1NA 1SUQA 3HM9A 2XY6A 3CMEN 4JKCA 3KTQA 2VYPA 2G8UA 2YKMA 2DY4A 4CJ3A 1Q7YO 4IOCL 3EY1A 3G4SN 4J2AA 1RDAA 5A2QO 3ITHA 2O8BA 4KBOA 1DTTA 1ZBSA 4H0TB 1XMQK 2JWKA 2CH5A 1DLOA 2UXDK 4M3ZA 1OH8A 2P9UA 3HP6A 5T7BA 2ZD1A 1U2VA 2Q0RA 2HB5A 4NXNK 3ASMA 2P9LB 1M1KO 3J7ZO 2YHBA 2NRWA 5JICA 2IDOA 3N4PA 1QE1A 3CPWM 3VQPA 3BGRA 1SL2A 4BDYA 3D2EA 1IH7A 3IKMA 3RMDA 3IUCA 1QZ6A 3KLEA 2G8WA 1S1UA 1B9FA 3WXJA 3O9TA 3AA5X 5HRNA 4FM0A 3OVNA 1JXEA 3GG4A 2E2NA 4FYDA 4DCHA 5AR0A 5AZIA 1BO5O 4CBWA 5F0XA 4FZYA 1QQMA 4E7HA 4EHUA 4TSXA 3KLGA 1V4TA 3GOIA 3NAEA 4NCBA 4YFUA 4B9TA 1NK9A 1OVQA 1HNZK 3VQDA 1BUPA 4H4MA 5CHIA 1NJZA 3SQ1A 3O1WA 4EP5A 1S6PA 3ENHA 1QZ5A 1BQNA 1C0UA 3B6OA 1RFQA 1UOCA 2P9IB 3PIPL 5AQPA 2D5RA 4IOAL 3CC4N 3OBWA 4W5QA 4QAGA 4YOVA 1LOTB 3UKRA 1BL3A 4IG0A 4E89A 3A5OC 1KLNA 1JCGA 3K0SA 1GOBA 5LJWA 1ZYQA 4F8RA 1W9HA 4CJFA 4O55A 3ZX2A 5LMUK 4DV4K 4CF8A 1T44A 4B3OA 4BRNA 1T03A 4E7IA 4N56A 2AJQA 2A3ZA 3BDPA 2XY5A 2P9PB 2WUSA 3HOSA 3OW2M 1BI4A 5KI6A 5JVGL 3DJCA 3EZWA 5CYQA 3NGIA 1DGKN 4DF4A 2QKBA 3MXMA 5HRRA 3MCPA 5FRNA 1BCOA 1RT4A 4DR4K 3ISNC 4ILHA 2ZJRL 1I94K 1RT1A 3VESA 1BCMA 1S1XA 4LF8K 3Q7BA 4HUFA 4DR3K 2O8FB 2GTDA 4DU4A 5SZTA 4CJ7A 5GAHP 4CJRA 3QMLA 4FWRA 3ENBA 2OYQA 3CCMN 5GAGP 3EE8A 3U6FA 1QQNA 2E6LA 3NMUA 4A5BA 3M3ZA 1KVCA 3ZSWA 3O3GA 1HJRA 2Z1GA 1Z6RA 2F9TA 1HR0K 3OA9A 4B08A 1WUAA 2O8CA 3O9RA 1RTHA 4JKDA 4FJ9A 3NGYA 4E1NA 2YHWA 5FPNA 5BREA 2IGIA 3BF1A 4FLZA 3V9ZA 4DSFA 3S3MA 2W6LA 1TK8A 3I0SA 1Q9XA 4JI4K 3KIOA 3TU5A 5FPDA 3RSEB 5C24A 4RW7A 1T6CA 5FDLA 3VEZA 1EP4A 1ATRA 5AQTA 2JGUA 2CH6A 2FSJA 3ULDA 3AA2A 4CHYA 1UAXA 2F96A 3OYKA 3PO4A 2RE2A 4FVUA 4OPKA 5BPNA 3FZHA 4H4OA 3PY8A 4CIEA 5AZJB 4JI5K 2PY5A 1LCUA 3ATUA 4AHTA 4KPYA 1YAGA 4H0YB 1T3VA 4F3OA 1KRPA 1RBTA 3ZYYX 4LSNA 4BG9A 1JJ2M 1VHXA 4FL9A 4CZIA 4IG3A 1B92A 1BIZA 3I8BA 2VCPA 3CI5A 2GBZA 4IDHA 4DR2K 4QS7A 5C2FA 2ATQA 1NGEA 2O8DA 1P8ZA 1KFSA 3TI0A 3THYB 4FO0A 3AO4A 3WXMB 4FLYA 3CJBA 2HMIA 5JLFA 3AVAA 4CEEA 4F3TA 3QINA 4C8LA 3ZT4A 4DSLA 1K8KA 5C15A 4RW8A 1Q8IA 3AAPA 3JAMO 4OPJA 4NLCA 5FROA 4H0PA 1NGHA 1W0HA 1IBKK 1NOZA 1LW0A 1BU6O 1HPZA 3E9LA 4BVPA 5E26A 4BWJA 1ZC6A 3ZSQA 5GADP 4DTRA 4V19S 1C1BA 2GV9A 3V9SA 4JD2A 3ZSVA 1DT9A 4F9OA 1L3UA 2PYLA 3O9QA 4DQQA 4Z0UA 4CIFA 4ILJA 4KAZA 3VETA 5C2DA 3TAEA 4IJAA 3LDQA 3DI6A 3HI0A 1N8RO 2X6NA 1JLGA 3H3NO 4BVOA 3VF4A 1ASUA 1L3VA 5C0YA 3C94A 4KHWA 3OTOK 3DXKB 3NGZA 4OGCA 4KH5A 2IOCA 4E7LA 4CZMA 4QS8A 1GOCA 4RCHA 1NK7A 4FLTA 1YT3A 4FWSA 2GUPA 2QTDA 3CERA 5DMRA 4EP4A 4O44A 2EWSA 2NUBA 4EAHD 2YJFA 4OPAA 2ZQBA 1NGGA 2FC0A 4OKJA 3PSFA 3ZSZA 5KQ8A 2FF6A 5GIOA 3UKUA 2D0CA 3AY9A 3AVFA 3VQCA 3TAMA 3MN9A 3UKUB 4DTMA 1ZBHA 1JXBA 3DLHA 3AA4A 3T69A 1W97L 3QDKA 3OYLA 4R5PA 1NWKA 1U6ZA 4BE0A 3V81A 5GIPA 5CZ1A 1NBWA 3MN5A 3J7AP 4HTUA 4BG8A 2ASMA 3VA3A 3AO3A 4CGJA 1RBRA 1XHXA 3M8QA 1GLFO 3KLFA 2GELA 4MLEA 4Z4IA 4M3XA 4BRHA 2HBLA 3SQ4A 1TKZA 3O4QA 5JLHA 3QEVA 1JCEA 4N47A 2Q0UA 1BA0A 3DXKA 2KHOA 3H1VX 4MO5A 5K14A 3O8MA 3H45C 4FSVA 5CY4A 3M5RA 1NKCA 2ZE2A 3F5TA 3SMSA 1KFDA 3AARA 4NO7A 3THVA 5M1OA 5MLCQ 3J81O 2DPNA 1VSMA 2HW3A 4BRGA 1X9WA 3CYMA 3SK3A 3AO1A 3DMJA 4DU3A 3HSCA 1VSJA 4JD2B 4DLGA 4KI6A 1HX1A 3WNHA 1U49A 3IG1A 3ZT1A 4AH9A 1VQMN 3QBWA 1YXQA 2UUCK 1JCFA 1SV5A 1YTAA 4AHUA 4OO1J 1VQKN 3LAKA 3OYDA 5AQSA 3CF5L 2E2PA 3VQ7A 3DOKA 1QSSA 4DQPA 3QB0A 4CJSA 3VF6A 1K8KB 3D2FB 3SPYA 3OY9A 3QFUA 1H1VA 1HJOA 4K8XA 3T1YK 3KK2A 4BQLA 1X9JA 3MECA 4DTPA 5H1SQ 2XY7A 5TKYA 3THYA 3KK7A 1YVUA 1XWLA 3QFPA 4L3QA 2O8DB 4BC2A 3L2VA 1SL0A 3LWMA 5AQQA 3A5NC 4FCYA 3EZ5A 4JLHA 3RWUA 3GBTA 3HL8A 5DM7L 4OLAA 2YHAA 4A2AA 3OYIA 1VQ7N 1QSLA 3KK1A 3CQXA 5GAEP 1NGCA 1UA0A 1MWKA 3L0QA 4DTJA 1QHTA 4JKGA 4C1NK 1OH6A 3KZBA 2P9SB 2W42A 2W40A 1RT7A 2W41A 3U9DA 1NOYA 2KFNA 3MN6A 3CCEN 3MWTA 2VQEK 4CK2A 4IFVA 3T1AA 2ZM6K 5CE3A 1WSEA 3E66A 3SBTA 3KD5E 1NGFA 2BDPA 1RBVA 4M45A 3AVNA 4L8RB 3DLLL 1X1PA 4PHTX 3TSUA 3RSEA 4B1WB 4C8OA 4GY2B 2X6SA 3S9HA 3NH0A 3H3OB 3VQQA 3QETA 4DHYA 4JEPA 2E1YA 4WCEL 4Z4CA 5AQVA 1IG8A 3QO9A 3CCUN 4RW6A 4CHQA 2IVPA 3QNNA 2EHGA 2QXLA 4LFCK 4GKKK 3L8BA 3BF3A 4DS5A 3OS2A 5LMNK 4EHTA 4FXDA 3WT0A 4DR1K 1Z05A 3O5BA 4I2PA 2Z1HA 3P31A 1DTQA 2F9WA 3L4QA 3PX0A 1SKWA 3CC7N 4M42A 3OS0A 1KVBA 2O8FA 5M1PA 5AQNA 3C7NA 2YNIA 4HTLA 1W7AA 4BR0A 4U67L 3SLCA 3JYTA 4JKEA 3RVCA 3E1YA 3VGLA 3VEXA 3CM5A 4CW7B 4PKHA 4JKBA 1REVA 4WYBA 4CFAA 3IMXA 3RR7A 4EFHA 1RCHA 3U9ZA 4YOXA 3MX2A 4CFBA 3SV4A 2E5LK 3ZEUA 4N41A 1XNQK 4RG8A 3SYZA 3BY5A 2O4IA 3LL3A 1WBDA 1C1CA 3HVRA 4K25A 3VQBA 2WC9A 4ID1A 3CM6A 2HVHA 1ESVA 4JAXA 1ZBLA 4DV6K 2E20A 2QKKA 4CJWA 2G8IA 4W5NA 3DXMA 5F1XA 5BPMA 2CGJA 3TAPA 1YJNN 1C0TA 1KAZA 4DUYK 5JMVA 1K9MO 1IBLK 4EZ9A 3THXB 1FKOA 4BRMA 1YF5L 2P9IA 4RW9A 4LSLA 5IT9O 3SZ2A 4H03B 5HL7L 3GE1A 3THXA 4AM6A 2X78A 4O4GA 3KK3A 1K73O 1L3SA 4FWOA 2I5JA 4IDKA 1WN7A 5F2RA 3DXMB 1G15A 1NK4A 2CGLA 4M7XA 5KPRA 2ZF5O 5AZIB 2VQFK 5HLFA 4ISGA 1KSPA 1YIJN 1VRUA 4KTZA 4Y1CA 4C1NI 4O5FA 1BHLA 3NF6A 4CD3A 3P5JA 3LP1A 4OVLA 2B6AA 3C0BA 3G10A 4UY8O 2FBXA 3O4WA 3ZEUB 5C25A 3S41A 3K5OA 4CHZA 3T3FA 2QXFA 5FPMA 4H0XB 3VQEA 4DF8A 1L3TA 2P9UB 4CBXA 2IVNA 3TTDA 1ZBIA 3P38A 3SCXA 4FJMA 3AVHA 2LSNA 2JWLA 1RTIA 5C42A 2O8BB 2BE2A 3VMFB 1B9DA 2A6AA 4LF6K 3BP8A 4B8CA 3H6EA 3MDQA 4CJEA 3QEIA 3S3OA 4K0KK 1UA1A 3C7NB 1HRHA 4CFCA 3RRGA 3PSIA 3A2FA 3OYMA 3WUHA 2Q1NA 3GL1A 3S3NA 1ZXOA 4CHOA 4CEFA 4MQ3A 1A5WA 2JLEA 2OA8A 4A5AA 1S22A 3SUQA 2HF4A 4KHSA 4C8MA 2XO7A 3V9UA 1GLCG 4ISFA 1EO1A 4KTQA 3KJVA 4HVJA 3WXKA 3CG7A 5LL6Z 4K8ZA 2HHTA 1RDWX 3RMCA 2V7ZA 3LP2A 2WTUA 5LY3A 5M1KA 1U4BA 4DR6K 4B3TK 4JI3K 2F7TA 3K2PA 4PL8A 1CZAN 1XQSC 3NE6A 4DMNA 4JI2K 3HM8A 4CGGA 4Z4FA 4C8NA 3LZJA 3QEXA 4HHTA 3FE1A 4N5SA 3C6AA 5AQHA 2KFZA 3LANA 3QESA 4FK2A 2NRVA 4ZTJA 4KB0A 2PBDA 5KPZA 1SKSA 3CFOA 4CE9A 2G8VA 3CJ7A 2Z1IA 3L2RA 3MAQA 2VWBA 1A5XA 3PIOL 4WQ5C 1U45A 3FFKB 2QI2A 1T6DA 3WQTA 3MCAB 4DB3A 3L4IA 1NGIA 1OH5A 1OVYA 2P9SA 1KQSM 3O9SA 4X64K 4M3YA 1K8AO 4JKGB 3V9XA 4H5WA 4CF9A 1KC8O 3ZX0A 1HLUA 1RGIA 5KPTA 4CJLA 4IFEA 4XH4A 4CBUA 3AV9A 4C8KA 2BUPA 3CXCM 1GLLO 2HHSA 3RMBA 3M8RA 3WNFA 4DFMA 2UXCK 4J8FA 3EO3A 3OHRA 4CF1A 4Y1DA 3F2KA 1HKGA 1OKJA 1HYVA 1YJ9N 1NU0A 3BEXA 1WB9A 3VGMA 2V7YA 2YHXA 2HOEA 2ASOA 3G0ZA 4F2SA 4FM2A 2AA4A 3NF7A 4B9SA 1E4GT 2A41A 3D2FA 3F9MA 3ZX3A 3V1RA 3C6HA 1T05A 5HRPA 3OYEA 1YJWN 1XC3A 3E9OA 3EYZA 1VSHA 3FR0A 2E2QA 3ZSYA 1MU2A 3CJCA 2YI1A 3I56N 1IG9A 4GV6A 4CEAA 4BREA 1TGOA 1SAZA 4DR5K 2R7YA 4OKEA 3LWLA 3IFRA 3ZT2A 1LWEA 5EVZA 3HZ6A 3U3YA 2A1SA 2HSTA 4I6MB 1NKBA 1J5EK 1YHQN 4CZFA 1CXQA 1XC9A 2BANA 1KAXA 1CZBA 5ELZA 4A61A 1D9FA 1NK8A 2RHKA 2OCEA 5M1QA 2HBKA 4M3WA 1WBBA 1S3XA 4FJIA 3W3DA 3CD6N 3CCQN 2DTUA 1QVFM 4E7KA 1TAQA 2FBTA 4FVMA 4OJRA 1D5AA 4CEOA 3LALA 4PA1A 3VF2A 1TKDA 3P39A 3SAFA 1NNEA 1XI1A 3N4QA 2HVIA 3HJFA 4G1QA 3J7YP 1JKHA 3MEEA 3NFAA 2GX9A 3H46O 2EX3A 4EZ6A 1LW2A 4DTSA 1HYZA 4HCCA 2NRTA 5HROA 2KTQA 3SPZA 1HQEA 1KTQA 3DYAA 1BWFO 4I7FA 2UU9K 3DAWA 4N76A 2O4GA 4XH5A 3WNEA 1XUPO 3R6MA 4FLUA 1QQCA 1HQUA 5HRSA 1NK5A 2PFUA 1VSLA 4LD0A 4UQGA 2HMPA 2ZGYA 4FZZA 5AJ3K 3FLCO 4AM7A 4DTOA 3FFIA 4CK3A 4A62A 1NGAA 3AA3A 2RF2A 3KVGA 3MK6A 2QW9A 4YDUA 2KKZA 1Q9YA 3VTHA 1JLQA 4KH6A 2KZMA 1X9MA 2VGMA 3HT3A 3CHWA 3HBTA 4KHYA 1J9AA 3O4NA 4W5OA 5AQRA 3M8SA 1HYSA 1QTMA 2VWJA 5EX5A 4CJVA 1KXPA 3L2QA 4KFBA 2B4JA 4QCLA 1SKRA 4R79A 3ATVA 1FJGK 3EL2A 2HF3A 4M3TA 4ZTFA 3U4LA 2B5JA 2HNZA 1C0GA 3CFPA 5ADXH 3VQ5A 5KGWA 4CF2A 3TWHA 3EN9A 5FRMA 4RTFD 4DFJA 5EOYA 3SNNA 1NJIO 3VPZA 2YNFA 4NLBA 1NK0A 4AHCA 3DLKA 4CFDA 4ELVA 4CHPA 2VG6A 2CGKA 3AVLA 3AAQA 1WNSA 4B9QA 1TK5A 5LJVA 1C1AA 1VQNN 1S9GA 1S1VA 2UYTA 4PQUA 4KKOA 3VQ8A 4ZHRA 1TL1A 5AQUA 3TTFA 4WQ4A 1I39A 1NJYA 4E7JA 3OYHA 4CHNA 4AQYK 5HOOA 4KH4A 3J8AA 3LDSA 3KWIA 4W5TA 3ZSRA 3LDPA 3OYGA 1EWRA 4BGAA 1CZ9A 3G25A 2ZWHA 4BRAA 4IFYA 2OPQA 5AZJA 3BZKA 3A5MC 3TANA 3L3VA 4ICLA 1CXUA 3E01A 4YOYA 4JKFA 4MDBA 5I3UA 4LH5A 4CECA 1RBSA 3EE9A 2YJEA 4Z4GA 3PV8A 3RMAA 2E4LA 2ZJPL 4BR2A 4OKKA 3UIQA 4CJ5A 4FWLA 4YORA 3PUFA 1RDBA 5DM6L 1NM1A 5J1EA 4B1VA 1OH7A 1HNIA 1JLAA 3OYBA 3O3HA 3KD1E 3J80O 3R8EA 4JI0K 2YCHA 5JVHL 1IKYA 1QQOA 2GWJA 2E1ZA 3NH1A 1NK6A 2HHQA 4H5NA 4A59A 1VQPN 1EXQA 3CQYA 2GWKA 2GEMA 3L6QA 3AVCA 2D1KA 3QBXA 3P83D 3SJJA 3CQ8A 1GLBG 4NYFA 3ZLJA 2O8CB 2FSNA 3TSQA 3VEWA 1WSJA 5KGXA 2GUIA 4BY9C 4IEEA 4DV7K 4JI8K 4CJUA 2FLOA 5J2PA 3QIOA 4K41A 4JNEA 3WNGA 1G99A 4GW6A 4F2RA 2QEXN 1EKEA 4H0VB 1HNWK 4CEQA 1RILA 2NNWA 4WE1A 1O13A 3O1BA 4JN4A 1NMNA 2IS3A 4CEBA 1MDUB 1RNHA 1JLCA 3V1OA 3BZCA 3CETA 4Z4EA 4EIAA 4DG1A 4CGFA 3DRSA 4CGDA 1BISA 4BACA 2F4VK 4FK0A 2J4RA 3DLGA 4IEIA 4YOUA 4KI4A 1NMDA 3HP9A 1N6QA 3LDOA 5AQMA 1YVNA 3G6EN 4IBNA 1BI4B 2P9PA 3ZT3A 4DQRA 3D0PA 3SQ0A 3NF8A 3ULEA 4JK9A 3JSMA 4DQIA 3M6GA 3M8PA 3CIPA 2AP1A 2Y1IA 3QICA 4MDAA 3ZSOA 3QERA 2VGNA 1C6VA 1U47A 1VQ4N 2UUAK 4CJ4A 4DSIA 4FPAA 4BRPA 3OYCA 4NCAA 5J2QA 5JS1A 5AQJA 5AFUH 2IAJA 4DS4A 3HSTB 1VSFA 2H3GX 3MX5A 5AFUA 4DTXA 2O8EB 3UKRB 2WONA 4YDUC 3A0IX 3DRPA 4DV1K 4O8KA 4IJNA 3WXLA 3HPOA 4FZXC 1E4FT 1RT2A 4B3RK 1WOQA 1GLJO 1X9SA 4H5VA 4DTNA 3RRHA 3Q7CA 1VQ8N 4CJTA 5J2NA 4AHSA 3NCIA 1VQON 5GINA 1HPMA 2NLXA 2Y1JA 1EETA 4K42A 3LAMA 1SQKA 2Q36A 3C6UA 1JLFA 2ITGA 4JHDA 4H5RA 4ILGB 4B3SK 4BR4A 3CJAA 2V52B 4PKGA 3CCVN 3HXMA 3HRGA 4PL7A 5TKWA 3D2EB 4BWMA 3WXIA 1TKXA 3V1QA 3IDHA 2VG5A 4FM1A 3NDKA 1WSHA 4DV3K 1N33K 1IJJA 4DTUA 2P9LA 3K57A 1T7PA 4E19A 3IS9A 4FLWA 3F9KA 2OTJN 5KRSA 3V6DA 4LFBK 3C95A 1U2VB 3KKSA 3ZETA 4KO0A 3I0RA 2YKNA 4DU1A 1Z26A 4IXCA 3TAGA 3SQ2A 3KLIA 3HK2A 2OZMA
chains in the Genus database with same CATH topology
1HNVA 2VWKA 4CF1A 2ZQBA 4Y1DA 2BGGA 1LWCA 1VSKA 2FC0A 4OKJA 3OJUA 1HYVA 4FJKA 3TAQA 3ZSZA 1XHZA 3QEPA 4AHRA 2D0CA 3DOLA 4I2QA 1CLQA 1WSIA 3AVFA 5I42A 2PZSA 3VQCA 3D45A 3G0ZA 3TAMA 1EX4A 2XRIA 4F2SA 4DTMA 1D8YA 1ZBHA 4FM2A 1TAUA 1JXBA 1RDDA 3DLHA 3AA4A 3NF7A 4JRPA 3OYLA 3DLBA 4R5PA 4B9SA 4AHVA 1VRTA 4BE0A 3V81A 5CZ1A 2FBVA 2Q3SA 4HTUA 1FKPA 2HNDA 2YNGA 2KZMA 1I3AA 2OPSA 4KV8A 3ZCMA 3DLRA 3V1RA 3VA3A 3AO3A 4CESA 3RTVA 4B8AB 4CGJA 1T05A 5HRPA 1RT3A 1RBRA 1XHXA 3M8QA 3OYEA 4Z4IA 3KLFA 3EYZA 4JS4A 4M3XA 1N5YA 5DK5A 1VSHA 4BE2A 1TKZA 3SQ4A 2D0BA 3RR8A 3O4QA 3QEVA 1S1TA 1JLEA 3ZSYA 4KRFA 1MU2A 4BDZA 4N47A 4CJQA 1IG9A 4GVMA 1RDCA 3SV3A 1NJWA 4CEAA 1LV5A 1Y97A 4HUGA 5HP1A 5D3GA 5K14A 4DSKA 4KHNA 3HK2A 5CY4A 1NKCA 1O1WA 1TGOA 3AVJA 3VQ6A 2ZE2A 3LZIA 1WLJA 3K58A 2R7YA 1J54A 4M3RA 3V4IA 4OKEA 1KFDA 3LWLA 1IKXA 2OPRA 3ZT2A 1LWEA 3THVA 3OYJA 3VA0A 3U3YA 2G8KA 2A1SA 1NKBA 3NH2A 1ASVA 1VSMA 1CXQA 2HW3A 1X9WA 1XC9A 3CYMA 2BANA 1CZBA 1D9FA 1RTJA 3AO1A 3DMJA 1KCFA 1NK8A 1RT5A 4DU3A 2YV0X 1VSJA 3KLHA 3C6TA 4O5BA 2RPIA 4M3WA 3LPUA 4DLGA 4FJIA 4H8KA 1ITGA 3QEWA 2FBYA 4KI6A 1LAWA 4GMJB 5CYMA 3WNHA 2DTUA 1BQMA 4O0JA 1U49A 4E7KA 3IG1A 3ZSXA 3ZT1A 1WAJA 4AH9A 1TAQA 3AVGA 2FBTA 4AHUA 1SV5A 1YTAA 4FVMA 2P5OA 1JLBA 4DFPA 3LAKA 4OJRA 3OYDA 5KRTA 4CIGA 1D5AA 4CEOA 3LALA 4PA1A 4QOZB 2G8FA 3VQ7A 4B9UA 3DOKA 1TKDA 1QSSA 4DQPA 2F8TA 4CJSA 1XI1A 2IC3A 4FJJA 2DFEA 1WSFA 2HVIA 3L3UA 3SUPA 3HJFA 2VG7A 3IRXA 3DRRA 4G1QA 3SPYA 2F8SA 4M41A 1JKHA 4AILC 3OY9A 2RKIA 4FW1A 3MEEA 4B9MA 1QS4A 1LAVA 3NFAA 4CEZA 3TR8A 4DWIA 1BGXT 5JS2A 4K8XA 4FJ8A 3KK2A 2RN2A 4CF0A 2KW4A 1SUQA 3MECA 3HM9A 2KQ2A 4DTPA 2XY6A 2EX3A 2XY7A 4B9LA 4E1MA 3KTQA 4KREA 4EZ6A 1YVUA 1XWLA 1LW2A 1T8EA 4DTSA 2G8UA 1HYZA 2YKMA 3PO5A 4CCHA 2DY4A 4HCCA 3VQ4A 3F73A 3L2VA 5HROA 1SL0A 4CJ3A 2KTQA 3LWMA 3SPZA 1HQEA 3EY1A 5CZ2A 4J2AA 1RDAA 1KTQA 3DYAA 3ITHA 4FCYA 3EZ5A 4I7FA 4N76A 4JLHA 1DTTA 1RBUA 4DFKA 2O4GA 3RWUA 4DQSA 3B6PA 3HL8A 3LPTA 4OLAA 1GOAA 3WNEA 3K5MA 2YHAA 3OYIA 3K5NA 1DLOA 1TVRA 4M3ZA 4FLUA 1QQCA 1HQUA 3KK1A 3HP6A 1QSLA 5HRSA 5T7BA 2ZD1A 3TARA 1VSLA 4KTWA 4LD0A 1NK5A 2HB5A 4UQGA 4FZZA 1UA0A 3ASMA 1IKWA 4DTOA 3FFIA 4CK3A 4DTJA 1QHTA 3QNOA 3AA3A 4KB1A 2W42A 3OYNA 2YHBA 1RT7A 1J5OA 2WOMA 2RF2A 3LP0A 3DM2A 3VQAA 1NOYA 2KFNA 2IDOA 3OYFA 1QE1A 1Q9YA 1JLQA 1S9EA 4M3UA 3VQPA 4CK2A 3BGRA 4IFVA 3T1AA 4BDYA 4DSEA 3TABA 3HT3A 3RMDA 1IH7A 1X9MA 3ALYA 1WSEA 3KLEA 4J2EA 3MEDA 2G8WA 4KHYA 1S1UA 3KD5E 2BDPA 1B9FA 1J9AA 1RBVA 3O4NA 3AVNA 4NCGA 3AA5X 4M45A 4W5OA 5HRNA 4FM0A 3OVNA 1JXEA 4DSJA 4L8RB 4Z4HA 3M8SA 4OLBA 4FYDA 1HYSA 1QTMA 1X1PA 4LY7A 3MXJA 2VWJA 2OZMA 4ELTA 4CJVA 2G8HA 3L2QA 4FZYA 4C8OA 1SL2A 4KFBA 2X6SA 4E7HA 2B4JA 3S9HA 3NH0A 1JL2A 1BIUA 4QCLA 1SKRA 4F4KA 4TSXA 3VQQA 3KLGA 4JS5A 4J2DA 3QETA 3NAEA 4M3TA 3OYAA 4ZTFA 4YFUA 4B9TA 1NK9A 2P5GA 2B5JA 2HNZA 4NCBA 3P1GA 3CFPA 3VQDA 4Z4CA 2QK9A 2DFHA 3QO9A 3VQ5A 5KGWA 1ASWA 3HYFA 4H4MA 4CF2A 3TWHA 1NJZA 3SQ1A 4RW6A 4EP5A 4CHQA 5FRMA 1S6PA 3H08A 4DFJA 3SNNA 3QNNA 4NYNA 2EHGA 1BQNA 4IKFA 1C0UA 3U3GA 3B6OA 1UOCA 3L8BA 2YNFA 4DS5A 3OS2A 1NK0A 2D5RA 4AHCA 3DLKA 4CFDA 4ELVA 4FJLA 4CHPA 2VG6A 4FXDA 2HHUA 2P51A 4W5QA 4QAGA 4FLVA 3AVLA 2E6MA 4I2PA 1WNSA 2Z1HA 4FW2A 3SUOA 5E41A 1BL3A 4ID5A 3T19A 1ZBFA 4IG0A 4E89A 1TK5A 1DTQA 1KLNA 2XY8A 1C1AA 4PQUA 1S1VA 1S9GA 1HMVA 1VSDA 1GOBA 3PX0A 1F21A 4KKOA 1SKWA 3VQ8A 4ZHRA 1TL1A 5HBMA 4M42A 1ZYQA 3OS0A 1KVBA 4F8RA 1W9HA 4CJFA 4O55A 1FXXA 1I39A 2YNIA 3L2UA 4CF8A 1R0AA 3V9WA 3PX4A 1RT6A 1NJYA 4E7JA 3OYHA 3JYTA 1U48A 1ZBUA 4B3OA 4CHNA 4W5RA 3CM5A 3TAFA 1T03A 4PUOA 4JRQA 4PY5A 1REVA 3LDSA 4E7IA 4N56A 2AJQA 4W5TA 3ZSRA 4CFAA 3OYGA 1TL3A 3BDPA 1CZ9A 2XY5A 4BDPA 3RR7A 1JL1A 1RCHA 1IKVA 1BI4A 3MXIA 4IFYA 1UWBA 2OPQA 4CFBA 5KI6A 3SV4A 3HPGA 5CYQA 3TANA 3NGIA 4DF4A 2QKBA 4N41A 3L3VA 4ICLA 1CXUA 3E01A 3MXMA 3I8DA 5HRRA 4LH4A 5I3UA 1QSYA 4RG8A 5FRNA 4LH5A 1BCOA 1RBSA 4CERA 4CECA 1RT4A 3SYZA 3ISNC 2O4IA 4CK1A 4Z4GA 3PV8A 3RMAA 2E4LA 1RTDA 4Q0BA 1C1CA 4OKKA 3HVRA 3UIQA 1RT1A 4ID1A 3VQBA 3AVKA 1BCMA 1S1XA 4CJ5A 3CM6A 3SUNA 3PUFA 1RDBA 4HUFA 2HVHA 5J1EA 1HNIA 4DU4A 5SZTA 3K59A 1ZBLA 1JLAA 3OYBA 2QKKA 3O3HA 4CJRA 3KD1E 4CJWA 4CJKA 3QIPA 2G8IA 4HUEA 4W5NA 2OYQA 1IKYA 3HO1A 3TAPA 3U6FA 3NH1A 1C0TA 2E6LA 1NK6A 3SI6A 3LP3A 2HHQA 1KVCA 2D0AA 4PWDA 3ZSWA 2DFFA 4YNQA 2YNHA 1SL1A 1EXQA 3O3GA 1FKOA 4EZ9A 1HJRA 2Z1GA 2PYJA 4FLXA 4RW9A 3ZT0A 3AVCA 4E0DA 4B9NA 4LSLA 4B08A 3P83D 3SJJA 1RTHA 3CQ8A 4NYFA 4FJ9A 3NGYA 4E1NA 3CFRA 3SZ2A 2IGIA 4FLZA 4DSFA 3V9ZA 1WSJA 5KGXA 2X78A 4O4GA 2GUIA 3S3MA 1TK8A 3KK3A 1L3SA 3I0SA 1Q9XA 4CJUA 5J2PA 2Z1JA 2HHVA 3QIOA 2I5JA 3WNGA 4I9QA 4GW6A 3KIOA 4IDKA 1WN7A 4F2RA 1VSIA 1EKEA 1K6YA 4CEQA 1G15A 1NK4A 2P1JA 5C24A 1RILA 4RW7A 5HLFA 4WE1A 2HHXA 1U04A 5FDLA 3K5LA 1KSPA 4FJXA 1TK0A 1EP4A 2IS3A 1VRUA 3KKRA 4KTZA 4Y1CA 4CEBA 5J2MA 2A1RA 1RNHA 1JLCA 3V1OA 1BHLA 3NF6A 2JGUA 1YTUA 4Z4EA 4XIUA 4RW4A 4DG1A 3P5JA 4FJNA 3LP1A 1J53A 4CGFA 3DRSA 3AO2A 2XHBA 3ULDA 3AA2A 4CGHA 4CHYA 4OVLA 1UAXA 4CGDA 1BISA 4BACA 4KHUA 2B6AA 2F96A 4FK0A 3OYKA 3DLGA 3HPHA 3PO4A 1C0MA 4KI4A 3G10A 3HP9A 2FBXA 4OPKA 4KHQA 1N6QA 5C25A 3AVMA 3K5OA 4H4OA 5EU7A 4CHZA 2QXFA 3T3FA 3PY8A 3VQEA 4CIEA 4IBNA 2PY5A 1BI4B 4DF8A 1NKEA 1L3TA 4ELUA 4AHTA 4KPYA 1ZBIA 3ZT3A 4DQRA 3NF9A 3D0PA 4J2BA 3SCXA 4FJMA 3SQ0A 3NF8A 3AVHA 5KTQA 2LSNA 4F3OA 1KRPA 3JSMA 1RBTA 1RTIA 4LSNA 5C42A 4DQIA 2BE2A 3M8PA 4IG3A 1B92A 1A5VA 1B9DA 1BIZA 1TKTA 3QEIA 4B8CA 2GBZA 2Y1IA 4CJEA 1S1WA 3ZSOA 3S3OA 1LWFA 1WSGA 3QERA 2ATQA 1UA1A 1KFSA 1C6VA 3TI0A 1U47A 1HRHA 4CFCA 3RRGA 4CJ4A 3AO4A 4FLYA 2HMIA 4DSIA 4NCAA 3A2FA 3OYCA 3VN5A 3AVAA 4CEEA 5J2QA 4F3TA 5JS1A 3OYMA 3AVIA 3QINA 3ZT4A 2IAJA 4DS4A 3HSTB 4C8LA 4DSLA 1VSFA 1S6QA 4DTXA 3S3NA 4RW8A 1Q8IA 4CEDA 2WONA 4CHOA 3DRPA 4OPJA 5FROA 4MQ3A 4CEFA 1W0HA 1A5WA 2JLEA 3HPOA 3NBPA 3SUQA 1NOZA 1LW0A 2OA8A 4FJGA 4FZXC 4FJ5A 4C8MA 1RT2A 1FK9A 2XO7A 4DLEA 4KHSA 1HPZA 3V9UA 2HHWA 1X9SA 4KTQA 4DTNA 3KJVA 4HVJA 3HVTA 3CG7A 3RRHA 4K8ZA 2HHTA 1IO2A 3RMCA 5SWMA 4CJTA 4BWJA 3LP2A 4E3SA 5J2NA 1Z25A 3ZSQA 4AHSA 3NCIA 1U4BA 4DTRA 3MEGA 1C1BA 2GV9A 1VK0A 3V9SA 2Y1JA 1EETA 3K2PA 3ZSVA 1L3UA 3LAMA 3NE6A 2PYLA 4DQQA 4Z0UA 4DMNA 4CIFA 4OGEA 3C6UA 1JLFA 1S5JA 2ITGA 4CGGA 1TV6A 3OJSA 4FK4A 4KAZA 4Z4FA 4C8NA 3LZJA 3QEXA 4B9VA 4HHTA 1WAFA 3AVBA 4O0IA 4N5SA 3TAEA 2X74A 2KFZA 3IAYA 3QLHA 3O3FA 3LANA 3NHGA 3QESA 1NJXA 4KB0A 2OPPA 4ZTJA 3DI6A 4FK2A 1SKSA 3CFOA 3PX6A 4CE9A 2G8VA 4CJPA 2Z1IA 3HXMA 3L2RA 4MFBA 3MAQA 2X6NA 1JLGA 4BWMA 1A5XA 1TKXA 1ASUA 1L3VA 1KLMA 3V1QA 2VG5A 4FM1A 3NDKA 3C94A 1U45A 4KHWA 3NGZA 1WSHA 4OGCA 3VQ9A 2IOCA 1D9DA 4E7LA 4I9LA 4M3YA 1GOCA 2HNYA 4DTUA 3K57A 1NK7A 3V9XA 2ETJA 4E19A 3IS9A 4FLWA 3F9KA 4FLTA 1T7PA 4CF9A 5KRSA 1VSEA 4HCBA 3V6DA 1YT3A 4Q5VA 3C95A 4CJLA 4FJHA 3AO5A 2KZZA 3AV9A 4C8KA 3KKSA 4KO0A 3I0RA 4CGIA 2OZSA 5DMRA 4EP4A 2YKNA 3RMBA 3M8RA 4FJ7A 3OS1A 4DU1A 2HHSA 1L5UA 4O44A 1Z26A 3L2WA 3TAGA 3SQ2A 3WNFA 4BE1A 3KLIA 2NUBA 4DFMA 3DLEA 1KVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNV A;  2VWK A;  4CF1 A;  2ZQB A;  4Y1D A;  2BGG A;  1LWC A;  1VSK A;  2FC0 A;  4OKJ A;  3OJU A;  1HYV A;  4FJK A;  3TAQ A;  3ZSZ A;  1XHZ A;  3QEP A;  4AHR A;  2D0C A;  3DOL A;  4I2Q A;  1CLQ A;  1WSI A;  3AVF A;  5I42 A;  2PZS A;  3VQC A;  3D45 A;  3G0Z A;  3TAM A;  1EX4 A;  2XRI A;  4F2S A;  4DTM A;  1D8Y A;  1ZBH A;  4FM2 A;  1TAU A;  1JXB A;  1RDD A;  3DLH A;  3AA4 A;  3NF7 A;  4JRP A;  3OYL A;  3DLB A;  4R5P A;  4B9S A;  4AHV A;  1VRT A;  4BE0 A;  3V81 A;  5CZ1 A;  2FBV A;  2Q3S A;  4HTU A;  1FKP A;  2HND A;  2YNG A;  2KZM A;  1I3A A;  2OPS A;  4KV8 A;  3ZCM A;  3DLR A;  3V1R A;  3VA3 A;  3AO3 A;  4CES A;  3RTV A;  4B8A B;  4CGJ A;  1T05 A;  5HRP A;  1RT3 A;  1RBR A;  1XHX A;  3M8Q A;  3OYE A;  4Z4I A;  3KLF A;  3EYZ A;  4JS4 A;  4M3X A;  1N5Y A;  5DK5 A;  1VSH A;  4BE2 A;  1TKZ A;  3SQ4 A;  2D0B A;  3RR8 A;  3O4Q A;  3QEV A;  1S1T A;  1JLE A;  3ZSY A;  4KRF A;  1MU2 A;  4BDZ A;  4N47 A;  4CJQ A;  1IG9 A;  4GVM A;  1RDC A;  3SV3 A;  1NJW A;  4CEA A;  1LV5 A;  1Y97 A;  4HUG A;  5HP1 A;  5D3G A;  5K14 A;  4DSK A;  4KHN A;  3HK2 A;  5CY4 A;  1NKC A;  1O1W A;  1TGO A;  3AVJ A;  3VQ6 A;  2ZE2 A;  3LZI A;  1WLJ A;  3K58 A;  2R7Y A;  1J54 A;  4M3R A;  3V4I A;  4OKE A;  1KFD A;  3LWL A;  1IKX A;  2OPR A;  3ZT2 A;  1LWE A;  3THV A;  3OYJ A;  3VA0 A;  3U3Y A;  2G8K A;  2A1S A;  1NKB A;  3NH2 A;  1ASV A;  1VSM A;  1CXQ A;  2HW3 A;  1X9W A;  1XC9 A;  3CYM A;  2BAN A;  1CZB A;  1D9F A;  1RTJ A;  3AO1 A;  3DMJ A;  1KCF A;  1NK8 A;  1RT5 A;  4DU3 A;  2YV0 X;  1VSJ A;  3KLH A;  3C6T A;  4O5B A;  2RPI A;  4M3W A;  3LPU A;  4DLG A;  4FJI A;  4H8K A;  1ITG A;  3QEW A;  2FBY A;  4KI6 A;  1LAW A;  4GMJ B;  5CYM A;  3WNH A;  2DTU A;  1BQM A;  4O0J A;  1U49 A;  4E7K A;  3IG1 A;  3ZSX A;  3ZT1 A;  1WAJ A;  4AH9 A;  1TAQ A;  3AVG A;  2FBT A;  4AHU A;  1SV5 A;  1YTA A;  4FVM A;  2P5O A;  1JLB A;  4DFP A;  3LAK A;  4OJR A;  3OYD A;  5KRT A;  4CIG A;  1D5A A;  4CEO A;  3LAL A;  4PA1 A;  4QOZ B;  2G8F A;  3VQ7 A;  4B9U A;  3DOK A;  1TKD A;  1QSS A;  4DQP A;  2F8T A;  4CJS A;  1XI1 A;  2IC3 A;  4FJJ A;  2DFE A;  1WSF A;  2HVI A;  3L3U A;  3SUP A;  3HJF A;  2VG7 A;  3IRX A;  3DRR A;  4G1Q A;  3SPY A;  2F8S A;  4M41 A;  1JKH A;  4AIL C;  3OY9 A;  2RKI A;  4FW1 A;  3MEE A;  4B9M A;  1QS4 A;  1LAV A;  3NFA A;  4CEZ A;  3TR8 A;  4DWI A;  1BGX T;  5JS2 A;  4K8X A;  4FJ8 A;  3KK2 A;  2RN2 A;  4CF0 A;  2KW4 A;  1SUQ A;  3MEC A;  3HM9 A;  2KQ2 A;  4DTP A;  2XY6 A;  2EX3 A;  2XY7 A;  4B9L A;  4E1M A;  3KTQ A;  4KRE A;  4EZ6 A;  1YVU A;  1XWL A;  1LW2 A;  1T8E A;  4DTS A;  2G8U A;  1HYZ A;  2YKM A;  3PO5 A;  4CCH A;  2DY4 A;  4HCC A;  3VQ4 A;  3F73 A;  3L2V A;  5HRO A;  1SL0 A;  4CJ3 A;  2KTQ A;  3LWM A;  3SPZ A;  1HQE A;  3EY1 A;  5CZ2 A;  4J2A A;  1RDA A;  1KTQ A;  3DYA A;  3ITH A;  4FCY A;  3EZ5 A;  4I7F A;  4N76 A;  4JLH A;  1DTT A;  1RBU A;  4DFK A;  2O4G A;  3RWU A;  4DQS A;  3B6P A;  3HL8 A;  3LPT A;  4OLA A;  1GOA A;  3WNE A;  3K5M A;  2YHA A;  3OYI A;  3K5N A;  1DLO A;  1TVR A;  4M3Z A;  4FLU A;  1QQC A;  1HQU A;  3KK1 A;  3HP6 A;  1QSL A;  5HRS A;  5T7B A;  2ZD1 A;  3TAR A;  1VSL A;  4KTW A;  4LD0 A;  1NK5 A;  2HB5 A;  4UQG A;  4FZZ A;  1UA0 A;  3ASM A;  1IKW A;  4DTO A;  3FFI A;  4CK3 A;  4DTJ A;  1QHT A;  3QNO A;  3AA3 A;  4KB1 A;  2W42 A;  3OYN A;  2YHB A;  1RT7 A;  1J5O A;  2WOM A;  2RF2 A;  3LP0 A;  3DM2 A;  3VQA A;  1NOY A;  2KFN A;  2IDO A;  3OYF A;  1QE1 A;  1Q9Y A;  1JLQ A;  1S9E A;  4M3U A;  3VQP A;  4CK2 A;  3BGR A;  4IFV A;  3T1A A;  4BDY A;  4DSE A;  3TAB A;  3HT3 A;  3RMD A;  1IH7 A;  1X9M A;  3ALY A;  1WSE A;  3KLE A;  4J2E A;  3MED A;  2G8W A;  4KHY A;  1S1U A;  3KD5 E;  2BDP A;  1B9F A;  1J9A A;  1RBV A;  3O4N A;  3AVN A;  4NCG A;  3AA5 X;  4M45 A;  4W5O A;  5HRN A;  4FM0 A;  3OVN A;  1JXE A;  4DSJ A;  4L8R B;  4Z4H A;  3M8S A;  4OLB A;  4FYD A;  1HYS A;  1QTM A;  1X1P A;  4LY7 A;  3MXJ A;  2VWJ A;  2OZM A;  4ELT A;  4CJV A;  2G8H A;  3L2Q A;  4FZY A;  4C8O A;  1SL2 A;  4KFB A;  2X6S A;  4E7H A;  2B4J A;  3S9H A;  3NH0 A;  1JL2 A;  1BIU A;  4QCL A;  1SKR A;  4F4K A;  4TSX A;  3VQQ A;  3KLG A;  4JS5 A;  4J2D A;  3QET A;  3NAE A;  4M3T A;  3OYA A;  4ZTF A;  4YFU A;  4B9T A;  1NK9 A;  2P5G A;  2B5J A;  2HNZ A;  4NCB A;  3P1G A;  3CFP A;  3VQD A;  4Z4C A;  2QK9 A;  2DFH A;  3QO9 A;  3VQ5 A;  5KGW A;  1ASW A;  3HYF A;  4H4M A;  4CF2 A;  3TWH A;  1NJZ A;  3SQ1 A;  4RW6 A;  4EP5 A;  4CHQ A;  5FRM A;  1S6P A;  3H08 A;  4DFJ A;  3SNN A;  3QNN A;  4NYN A;  2EHG A;  1BQN A;  4IKF A;  1C0U A;  3U3G A;  3B6O A;  1UOC A;  3L8B A;  2YNF A;  4DS5 A;  3OS2 A;  1NK0 A;  2D5R A;  4AHC A;  3DLK A;  4CFD A;  4ELV A;  4FJL A;  4CHP A;  2VG6 A;  4FXD A;  2HHU A;  2P51 A;  4W5Q A;  4QAG A;  4FLV A;  3AVL A;  2E6M A;  4I2P A;  1WNS A;  2Z1H A;  4FW2 A;  3SUO A;  5E41 A;  1BL3 A;  4ID5 A;  3T19 A;  1ZBF A;  4IG0 A;  4E89 A;  1TK5 A;  1DTQ A;  1KLN A;  2XY8 A;  1C1A A;  4PQU A;  1S1V A;  1S9G A;  1HMV A;  1VSD A;  1GOB A;  3PX0 A;  1F21 A;  4KKO A;  1SKW A;  3VQ8 A;  4ZHR A;  1TL1 A;  5HBM A;  4M42 A;  1ZYQ A;  3OS0 A;  1KVB A;  4F8R A;  1W9H A;  4CJF A;  4O55 A;  1FXX A;  1I39 A;  2YNI A;  3L2U A;  4CF8 A;  1R0A A;  3V9W A;  3PX4 A;  1RT6 A;  1NJY A;  4E7J A;  3OYH A;  3JYT A;  1U48 A;  1ZBU A;  4B3O A;  4CHN A;  4W5R A;  3CM5 A;  3TAF A;  1T03 A;  4PUO A;  4JRQ A;  4PY5 A;  1REV A;  3LDS A;  4E7I A;  4N56 A;  2AJQ A;  4W5T A;  3ZSR A;  4CFA A;  3OYG A;  1TL3 A;  3BDP A;  1CZ9 A;  2XY5 A;  4BDP A;  3RR7 A;  1JL1 A;  1RCH A;  1IKV A;  1BI4 A;  3MXI A;  4IFY A;  1UWB A;  2OPQ A;  4CFB A;  5KI6 A;  3SV4 A;  3HPG A;  5CYQ A;  3TAN A;  3NGI A;  4DF4 A;  2QKB A;  4N41 A;  3L3V A;  4ICL A;  1CXU A;  3E01 A;  3MXM A;  3I8D A;  5HRR A;  4LH4 A;  5I3U A;  1QSY A;  4RG8 A;  5FRN A;  4LH5 A;  1BCO A;  1RBS A;  4CER A;  4CEC A;  1RT4 A;  3SYZ A;  3ISN C;  2O4I A;  4CK1 A;  4Z4G A;  3PV8 A;  3RMA A;  2E4L A;  1RTD A;  4Q0B A;  1C1C A;  4OKK A;  3HVR A;  3UIQ A;  1RT1 A;  4ID1 A;  3VQB A;  3AVK A;  1BCM A;  1S1X A;  4CJ5 A;  3CM6 A;  3SUN A;  3PUF A;  1RDB A;  4HUF A;  2HVH A;  5J1E A;  1HNI A;  4DU4 A;  5SZT A;  3K59 A;  1ZBL A;  1JLA A;  3OYB A;  2QKK A;  3O3H A;  4CJR A;  3KD1 E;  4CJW A;  4CJK A;  3QIP A;  2G8I A;  4HUE A;  4W5N A;  2OYQ A;  1IKY A;  3HO1 A;  3TAP A;  3U6F A;  3NH1 A;  1C0T A;  2E6L A;  1NK6 A;  3SI6 A;  3LP3 A;  2HHQ A;  1KVC A;  2D0A A;  4PWD A;  3ZSW A;  2DFF A;  4YNQ A;  2YNH A;  1SL1 A;  1EXQ A;  3O3G A;  1FKO A;  4EZ9 A;  1HJR A;  2Z1G A;  2PYJ A;  4FLX A;  4RW9 A;  3ZT0 A;  3AVC A;  4E0D A;  4B9N A;  4LSL A;  4B08 A;  3P83 D;  3SJJ A;  1RTH A;  3CQ8 A;  4NYF A;  4FJ9 A;  3NGY A;  4E1N A;  3CFR A;  3SZ2 A;  2IGI A;  4FLZ A;  4DSF A;  3V9Z A;  1WSJ A;  5KGX A;  2X78 A;  4O4G A;  2GUI A;  3S3M A;  1TK8 A;  3KK3 A;  1L3S A;  3I0S A;  1Q9X A;  4CJU A;  5J2P A;  2Z1J A;  2HHV A;  3QIO A;  2I5J A;  3WNG A;  4I9Q A;  4GW6 A;  3KIO A;  4IDK A;  1WN7 A;  4F2R A;  1VSI A;  1EKE A;  1K6Y A;  4CEQ A;  1G15 A;  1NK4 A;  2P1J A;  5C24 A;  1RIL A;  4RW7 A;  5HLF A;  4WE1 A;  2HHX A;  1U04 A;  5FDL A;  3K5L A;  1KSP A;  4FJX A;  1TK0 A;  1EP4 A;  2IS3 A;  1VRU A;  3KKR A;  4KTZ A;  4Y1C A;  4CEB A;  5J2M A;  2A1R A;  1RNH A;  1JLC A;  3V1O A;  1BHL A;  3NF6 A;  2JGU A;  1YTU A;  4Z4E A;  4XIU A;  4RW4 A;  4DG1 A;  3P5J A;  4FJN A;  3LP1 A;  1J53 A;  4CGF A;  3DRS A;  3AO2 A;  2XHB A;  3ULD A;  3AA2 A;  4CGH A;  4CHY A;  4OVL A;  1UAX A;  4CGD A;  1BIS A;  4BAC A;  4KHU A;  2B6A A;  2F96 A;  4FK0 A;  3OYK A;  3DLG A;  3HPH A;  3PO4 A;  1C0M A;  4KI4 A;  3G10 A;  3HP9 A;  2FBX A;  4OPK A;  4KHQ A;  1N6Q A;  5C25 A;  3AVM A;  3K5O A;  4H4O A;  5EU7 A;  4CHZ A;  2QXF A;  3T3F A;  3PY8 A;  3VQE A;  4CIE A;  4IBN A;  2PY5 A;  1BI4 B;  4DF8 A;  1NKE A;  1L3T A;  4ELU A;  4AHT A;  4KPY A;  1ZBI A;  3ZT3 A;  4DQR A;  3NF9 A;  3D0P A;  4J2B A;  3SCX A;  4FJM A;  3SQ0 A;  3NF8 A;  3AVH A;  5KTQ A;  2LSN A;  4F3O A;  1KRP A;  3JSM A;  1RBT A;  1RTI A;  4LSN A;  5C42 A;  4DQI A;  2BE2 A;  3M8P A;  4IG3 A;  1B92 A;  1A5V A;  1B9D A;  1BIZ A;  1TKT A;  3QEI A;  4B8C A;  2GBZ A;  2Y1I A;  4CJE A;  1S1W A;  3ZSO A;  3S3O A;  1LWF A;  1WSG A;  3QER A;  2ATQ A;  1UA1 A;  1KFS A;  1C6V A;  3TI0 A;  1U47 A;  1HRH A;  4CFC A;  3RRG A;  4CJ4 A;  3AO4 A;  4FLY A;  2HMI A;  4DSI A;  4NCA A;  3A2F A;  3OYC A;  3VN5 A;  3AVA A;  4CEE A;  5J2Q A;  4F3T A;  5JS1 A;  3OYM A;  3AVI A;  3QIN A;  3ZT4 A;  2IAJ A;  4DS4 A;  3HST B;  4C8L A;  4DSL A;  1VSF A;  1S6Q A;  4DTX A;  3S3N A;  4RW8 A;  1Q8I A;  4CED A;  2WON A;  4CHO A;  3DRP A;  4OPJ A;  5FRO A;  4MQ3 A;  4CEF A;  1W0H A;  1A5W A;  2JLE A;  3HPO A;  3NBP A;  3SUQ A;  1NOZ A;  1LW0 A;  2OA8 A;  4FJG A;  4FZX C;  4FJ5 A;  4C8M A;  1RT2 A;  1FK9 A;  2XO7 A;  4DLE A;  4KHS A;  1HPZ A;  3V9U A;  2HHW A;  1X9S A;  4KTQ A;  4DTN A;  3KJV A;  4HVJ A;  3HVT A;  3CG7 A;  3RRH A;  4K8Z A;  2HHT A;  1IO2 A;  3RMC A;  5SWM A;  4CJT A;  4BWJ A;  3LP2 A;  4E3S A;  5J2N A;  1Z25 A;  3ZSQ A;  4AHS A;  3NCI A;  1U4B A;  4DTR A;  3MEG A;  1C1B A;  2GV9 A;  1VK0 A;  3V9S A;  2Y1J A;  1EET A;  3K2P A;  3ZSV A;  1L3U A;  3LAM A;  3NE6 A;  2PYL A;  4DQQ A;  4Z0U A;  4DMN A;  4CIF A;  4OGE A;  3C6U A;  1JLF A;  1S5J A;  2ITG A;  4CGG A;  1TV6 A;  3OJS A;  4FK4 A;  4KAZ A;  4Z4F A;  4C8N A;  3LZJ A;  3QEX A;  4B9V A;  4HHT A;  1WAF A;  3AVB A;  4O0I A;  4N5S A;  3TAE A;  2X74 A;  2KFZ A;  3IAY A;  3QLH A;  3O3F A;  3LAN A;  3NHG A;  3QES A;  1NJX A;  4KB0 A;  2OPP A;  4ZTJ A;  3DI6 A;  4FK2 A;  1SKS A;  3CFO A;  3PX6 A;  4CE9 A;  2G8V A;  4CJP A;  2Z1I A;  3HXM A;  3L2R A;  4MFB A;  3MAQ A;  2X6N A;  1JLG A;  4BWM A;  1A5X A;  1TKX A;  1ASU A;  1L3V A;  1KLM A;  3V1Q A;  2VG5 A;  4FM1 A;  3NDK A;  3C94 A;  1U45 A;  4KHW A;  3NGZ A;  1WSH A;  4OGC A;  3VQ9 A;  2IOC A;  1D9D A;  4E7L A;  4I9L A;  4M3Y A;  1GOC A;  2HNY A;  4DTU A;  3K57 A;  1NK7 A;  3V9X A;  2ETJ A;  4E19 A;  3IS9 A;  4FLW A;  3F9K A;  4FLT A;  1T7P A;  4CF9 A;  5KRS A;  1VSE A;  4HCB A;  3V6D A;  1YT3 A;  4Q5V A;  3C95 A;  4CJL A;  4FJH A;  3AO5 A;  2KZZ A;  3AV9 A;  4C8K A;  3KKS A;  4KO0 A;  3I0R A;  4CGI A;  2OZS A;  5DMR A;  4EP4 A;  2YKN A;  3RMB A;  3M8R A;  4FJ7 A;  3OS1 A;  4DU1 A;  2HHS A;  1L5U A;  4O44 A;  1Z26 A;  3L2W A;  3TAG A;  3SQ2 A;  3WNF A;  4BE1 A;  3KLI A;  2NUB A;  4DFM A;  3DLE A;  1KVA A; 
#chains in the Genus database with same CATH topology
 1HNV A;  2QM1 A;  3UB5 A;  1LWC A;  1VSK A;  4ISE A;  3OJU A;  4FJK A;  4GV3 A;  4AHR A;  4LF5 K;  3W0L A;  4I2Q A;  1CLQ A;  2A5X A;  3CCJ N;  2NRH A;  1BDG A;  2XRI A;  4A2B A;  4YOW A;  2P9N B;  1VRT A;  3SAH A;  2FBV A;  2Q3S A;  4X65 K;  4B1U B;  1I3A A;  2OPS A;  3ZCM A;  4KHP K;  3THW B;  3ZET B;  4CES A;  4B8A B;  1RT3 A;  3FZF A;  4DV2 K;  4FWK A;  1C0F A;  1N5Y A;  5DK5 A;  4BE2 A;  4MO4 A;  5FPE A;  1KD1 O;  4BDZ A;  5AQW A;  1RDC A;  4JV5 K;  4C23 A;  1NJW A;  1LV5 A;  1Y97 A;  5D3G A;  4DSK A;  3VEV A;  1O1W A;  3AVJ A;  5FLX O;  4WFN L;  3LZI A;  4GV9 A;  1WLJ A;  2Q97 A;  3K58 A;  4BQZ A;  1IKX A;  2OTL N;  3OYJ A;  3VA0 A;  3P4I A;  3KHY A;  1VQ6 N;  1RTJ A;  4JHD B;  1RT5 A;  1Q82 O;  2YV0 X;  2D0O A;  3LDN A;  3M1F A;  1SZ2 A;  1NGB A;  4O5B A;  3LPU A;  4H8K A;  5BR9 A;  1LAW A;  4GKJ K;  4GMJ B;  2HBJ A;  5CYM A;  2WFB A;  1BQM A;  4FOI A;  1WAJ A;  3C65 A;  1V4S A;  3AVG A;  4QS9 A;  1JLB A;  2YX6 A;  3ENO A;  4X66 K;  4QOZ B;  1QHA A;  3NVK A;  4B9U A;  5AQY A;  3CJ1 A;  4IO9 L;  2F8T A;  4FJJ A;  2O8E A;  2IC3 A;  1WSF A;  4BR9 A;  3IRX A;  2F8S A;  4M41 A;  4AIL C;  2RKI A;  1LAV A;  4CEZ A;  4DWI A;  1BGX T;  4FJ8 A;  2KW4 A;  2KQ2 A;  3EEQ A;  4YY3 K;  4B9L A;  4BGB A;  4E1M A;  4KRE A;  4AF1 A;  3WEE A;  4M7Y A;  1T8E A;  4CCH A;  5B8H A;  3PO5 A;  4M63 C;  3VQ4 A;  3F73 A;  5CZ2 A;  4LF4 K;  2FSK A;  2P9K B;  1YUW A;  3R3L A;  1RBU A;  4DFK A;  3ULE B;  4DQS A;  3SBG A;  3B6P A;  3LPT A;  1E3M A;  1GOA A;  3K5M A;  3K5N A;  1TVR A;  2QWR A;  1GLD G;  3TAR A;  4KTW A;  5KQD A;  1IKW A;  4CZG A;  3H1Q A;  5BRD A;  3QNO A;  4CZK A;  4KB1 A;  3OYN A;  1J5O A;  2WOM A;  5BN8 A;  3LP0 A;  3DM2 A;  3VQA A;  3O80 A;  3R9P A;  3OYF A;  4Z94 A;  1S9E A;  4M3U A;  5C12 A;  4DSE A;  3TAB A;  1D4X A;  3ALY A;  4J2E A;  3MED A;  4DQ8 A;  4WQ4 C;  4NCG A;  3VGK A;  4DSJ A;  1QVG M;  4OLB A;  4Z4H A;  4CZL A;  4LY7 A;  3MXJ A;  1GLE G;  3VEO A;  4ELT A;  2G8H A;  3WQU A;  4OPH A;  1NGJ A;  1VQ5 N;  1JL2 A;  1BIU A;  3CPE A;  4JKA A;  4F4K A;  4JS5 A;  4J2D A;  4CD1 A;  3OYA A;  2P5G A;  2QK9 A;  3P1G A;  1S72 N;  2DFH A;  1ASW A;  3HYF A;  3A8Y A;  2HHH K;  3H08 A;  3ID8 A;  3LM9 A;  4NYN A;  4IKF A;  3U3G A;  4A57 A;  5IWA K;  2PAV A;  1ATN A;  4FWM A;  4WQ5 A;  4FJL A;  2HHU A;  2P51 A;  2I7P A;  4FLV A;  1YIT N;  2E6M A;  2QWO A;  1ILY A;  4FW2 A;  2Q31 A;  3SUO A;  5E41 A;  4B1Z A;  4ID5 A;  3T19 A;  3KWG A;  3E9P A;  1ZBF A;  2XY8 A;  1HUX A;  1HMV A;  1MWM A;  1VSD A;  3TPQ A;  1F21 A;  2W6K A;  5AQF A;  5EXW A;  5HBM A;  5C10 A;  2QWM A;  4BC4 A;  3EKS A;  1FXX A;  1HNX K;  4BRL A;  3L2U A;  1R0A A;  1YI2 N;  3V9W A;  3PX4 A;  1RT6 A;  4CZH A;  4X62 K;  1U48 A;  1ZBU A;  2NRR A;  3BUZ B;  4W5R A;  4U7B A;  4LF7 K;  3VEY A;  4PUO A;  3TAF A;  3SAG A;  4JKH A;  4JRQ A;  1NGD A;  4PY5 A;  4G9Z A;  1TL3 A;  2BH1 A;  1DEJ A;  4BDP A;  1JL1 A;  4IOX A;  4CVN E;  1IKV A;  3MXI A;  5AQO A;  1TYQ A;  1UWB A;  5BRH A;  3HPG A;  1X3M A;  4Y0W A;  4BRI A;  5BR8 K;  2NZT A;  3I8D A;  4LH4 A;  1QSY A;  1TUU A;  4CER A;  1XNR K;  4CK1 A;  1RTD A;  1BG3 A;  2HBM A;  2V51 B;  4Q0B A;  3CC2 N;  3AVK A;  4MLH A;  3VTI A;  3SUN A;  5AQI A;  2E8A A;  4JI1 K;  3A5L C;  2QA4 N;  3K59 A;  3NVM A;  2QWN A;  4CJK A;  3QIP A;  4HUE A;  1Q81 O;  3HO1 A;  4BRD A;  3SI6 A;  3LP3 A;  4NB4 A;  2D0A A;  4PWD A;  2DFF A;  4YNQ A;  2YNH A;  3MWP A;  1SL1 A;  1NLV A;  3G71 N;  2PYJ A;  4FLX A;  1SS6 A;  3ZT0 A;  4E0D A;  3D6R A;  4B9N A;  3FZM A;  3O6W A;  3MMV A;  4WFA L;  3CFR A;  3AGK A;  2UXB K;  4B1X B;  1XMO K;  3VER A;  1DKG D;  2Z1J A;  2HHV A;  1MA9 B;  4I9Q A;  1VSI A;  3JXU A;  1K6Y A;  3HTV A;  4FWN A;  4BRC A;  3CCS N;  2P1J A;  4XEI A;  4BRK A;  5EY4 A;  4YHH K;  5ADX A;  2QWL A;  1U04 A;  2HHX A;  3K5L A;  4FJX A;  1TK0 A;  3PLA A;  3KKR A;  3K9K A;  5J2M A;  2A1R A;  5BRF A;  1YTU A;  4XIU A;  4RW4 A;  1P90 A;  4FJN A;  1J53 A;  3AO2 A;  2XHB A;  4CGH A;  5M1F A;  4JK7 A;  4KHU A;  4PKI A;  2ZJQ L;  3HPH A;  1C0M A;  4B1Y B;  1R59 O;  4KHQ A;  3AVM A;  5EU7 A;  3CCL N;  2E88 A;  1TYQ B;  1NKE A;  1KAY A;  4BRO A;  4CZE A;  3GDQ A;  5E84 A;  3NF9 A;  4J2B A;  5KTQ A;  3FGU A;  4CI6 A;  1RDU A;  1A5V A;  3SJH A;  4DKW A;  1TKT A;  1S1W A;  4FWP A;  1LWF A;  1WSG A;  1BOT O;  4BC5 A;  1VAZ A;  2ZGZ A;  3VN5 A;  3AVI A;  4BRF A;  1S6Q A;  3EKU A;  4CED A;  4FPB A;  3NBP A;  4IZ9 A;  4FK4 A;  3B8A X;  4FJG A;  4FJ5 A;  3TSP A;  1FK9 A;  2BTF A;  4DLE A;  2HHW A;  5AQK A;  3HVT A;  1IO2 A;  3D7E O;  5SWM A;  4B3M K;  4E3S A;  1Z25 A;  4DV0 K;  1M90 O;  4LC9 B;  3MEG A;  1VK0 A;  4JYA K;  4O8U A;  1Q86 O;  4BR5 A;  2QWP A;  1FW6 A;  3JS6 A;  4OGE A;  1S5J A;  3OJS A;  1TV6 A;  4B9V A;  4DR7 K;  2I7N A;  4LFA K;  2QWQ A;  1WAF A;  2A42 A;  3AVB A;  4O0I A;  4I6M A;  3CMA N;  2X74 A;  3IAY A;  3QLH A;  3O3F A;  3NHG A;  3VEN A;  2KLA A;  4E1J A;  2OPP A;  3TTC A;  1NJX A;  2UUB K;  3PX6 A;  1IV0 A;  4CJP A;  3FZK A;  4IO8 A;  3LM2 A;  3T1H K;  4MFB A;  1KLM A;  4JI7 K;  2ASP A;  3VQ9 A;  3FZL A;  1D9D A;  4H5T A;  4I9L A;  1GLA G;  1J6Z A;  2HNY A;  1VQ9 N;  2ETJ A;  1VSE A;  4HCB A;  3K9J A;  4Q5V A;  1X3N A;  4FJH A;  3AO5 A;  2KZZ A;  1IBM K;  4CGI A;  2OZS A;  4FJ7 A;  3OS1 A;  1L5U A;  3L2W A;  4BE1 A;  4ELU A;  1XHZ A;  3DLE A;  2D4W A;  1KVA A;  2VWK A;  2BGG A;  2P9K A;  4XH1 A;  3DWL A;  3TAQ A;  4RWT A;  4GNI A;  3QEP A;  5AQL A;  4JI6 K;  3DOL A;  2ITM A;  4FOE A;  4BC3 A;  1WSI A;  5I42 A;  2PZS A;  4GVE A;  3WEE B;  3D45 A;  1EX4 A;  3OBY A;  1D8Y A;  1TAU A;  4HWI A;  1RDD A;  5CR4 A;  3MN7 A;  1TUY A;  5BN9 A;  4JRP A;  1N34 K;  3DLB A;  2YHY A;  4AHV A;  4DUZ K;  3CCR N;  4BRQ A;  4WFB L;  1FKP A;  2HND A;  2YNG A;  4KV8 A;  3ID6 A;  3DLR A;  3O9U A;  1Y64 A;  3RTV A;  3R1X A;  3UE5 A;  2D0P A;  3U8X A;  4JS4 A;  4NXM K;  3RR8 A;  2D0B A;  1S1T A;  1JLE A;  4KRF A;  1EQY A;  4CJQ A;  2OAN A;  4GVM A;  4K43 A;  3SV3 A;  4LF9 K;  4HUG A;  5HP1 A;  2E2O A;  3T7Z A;  1VQL N;  5I9E B;  1N36 K;  4KHN A;  4OX9 K;  3VQ6 A;  5BPL A;  1ATS A;  1J54 A;  4M3R A;  3AGR A;  3V4I A;  1BA1 A;  2FF3 B;  2OPR A;  3I55 N;  1HKB A;  4YOT A;  3I33 A;  4H0O A;  2G8K A;  1Q18 A;  3NH2 A;  1ASV A;  1N32 K;  3LDL A;  3HOT A;  2IVO A;  4BR7 A;  1W2B M;  4FWQ A;  4IWV A;  1NG9 A;  1KCF A;  5AQZ A;  2A40 A;  2NRZ A;  3KLH A;  3C6T A;  1HKC A;  2RPI A;  4JK8 A;  4DV5 K;  1ITG A;  3QEW A;  2FBY A;  1EWQ A;  4O0J A;  3ZSX A;  3VOV A;  3SMP A;  2P5O A;  4DFP A;  2NRX A;  2Q2R A;  4WF9 L;  5KRT A;  2WBN A;  5AQX A;  4CIG A;  4CZJ A;  3O08 A;  5AQG A;  2G8F A;  3THW A;  2DFE A;  3L3U A;  3SUP A;  2FXU A;  2VG7 A;  3CJ9 A;  3DRR A;  4FW1 A;  4B9M A;  1QS4 A;  2P9N A;  3TR8 A;  2IIR A;  5JS2 A;  2RN2 A;  4CF0 A;  5M1N A;  1SUQ A;  3HM9 A;  2XY6 A;  3CME N;  4JKC A;  3KTQ A;  2VYP A;  2G8U A;  2YKM A;  2DY4 A;  4CJ3 A;  1Q7Y O;  4IOC L;  3EY1 A;  3G4S N;  4J2A A;  1RDA A;  5A2Q O;  3ITH A;  2O8B A;  4KBO A;  1DTT A;  1ZBS A;  4H0T B;  1XMQ K;  2JWK A;  2CH5 A;  1DLO A;  2UXD K;  4M3Z A;  1OH8 A;  2P9U A;  3HP6 A;  5T7B A;  2ZD1 A;  1U2V A;  2Q0R A;  2HB5 A;  4NXN K;  3ASM A;  2P9L B;  1M1K O;  3J7Z O;  2YHB A;  2NRW A;  5JIC A;  2IDO A;  3N4P A;  1QE1 A;  3CPW M;  3VQP A;  3BGR A;  1SL2 A;  4BDY A;  3D2E A;  1IH7 A;  3IKM A;  3RMD A;  3IUC A;  1QZ6 A;  3KLE A;  2G8W A;  1S1U A;  1B9F A;  3WXJ A;  3O9T A;  3AA5 X;  5HRN A;  4FM0 A;  3OVN A;  1JXE A;  3GG4 A;  2E2N A;  4FYD A;  4DCH A;  5AR0 A;  5AZI A;  1BO5 O;  4CBW A;  5F0X A;  4FZY A;  1QQM A;  4E7H A;  4EHU A;  4TSX A;  3KLG A;  1V4T A;  3GOI A;  3NAE A;  4NCB A;  4YFU A;  4B9T A;  1NK9 A;  1OVQ A;  1HNZ K;  3VQD A;  1BUP A;  4H4M A;  5CHI A;  1NJZ A;  3SQ1 A;  3O1W A;  4EP5 A;  1S6P A;  3ENH A;  1QZ5 A;  1BQN A;  1C0U A;  3B6O A;  1RFQ A;  1UOC A;  2P9I B;  3PIP L;  5AQP A;  2D5R A;  4IOA L;  3CC4 N;  3OBW A;  4W5Q A;  4QAG A;  4YOV A;  1LOT B;  3UKR A;  1BL3 A;  4IG0 A;  4E89 A;  3A5O C;  1KLN A;  1JCG A;  3K0S A;  1GOB A;  5LJW A;  1ZYQ A;  4F8R A;  1W9H A;  4CJF A;  4O55 A;  3ZX2 A;  5LMU K;  4DV4 K;  4CF8 A;  1T44 A;  4B3O A;  4BRN A;  1T03 A;  4E7I A;  4N56 A;  2AJQ A;  2A3Z A;  3BDP A;  2XY5 A;  2P9P B;  2WUS A;  3HOS A;  3OW2 M;  1BI4 A;  5KI6 A;  5JVG L;  3DJC A;  3EZW A;  5CYQ A;  3NGI A;  1DGK N;  4DF4 A;  2QKB A;  3MXM A;  5HRR A;  3MCP A;  5FRN A;  1BCO A;  1RT4 A;  4DR4 K;  3ISN C;  4ILH A;  2ZJR L;  1I94 K;  1RT1 A;  3VES A;  1BCM A;  1S1X A;  4LF8 K;  3Q7B A;  4HUF A;  4DR3 K;  2O8F B;  2GTD A;  4DU4 A;  5SZT A;  4CJ7 A;  5GAH P;  4CJR A;  3QML A;  4FWR A;  3ENB A;  2OYQ A;  3CCM N;  5GAG P;  3EE8 A;  3U6F A;  1QQN A;  2E6L A;  3NMU A;  4A5B A;  3M3Z A;  1KVC A;  3ZSW A;  3O3G A;  1HJR A;  2Z1G A;  1Z6R A;  2F9T A;  1HR0 K;  3OA9 A;  4B08 A;  1WUA A;  2O8C A;  3O9R A;  1RTH A;  4JKD A;  4FJ9 A;  3NGY A;  4E1N A;  2YHW A;  5FPN A;  5BRE A;  2IGI A;  3BF1 A;  4FLZ A;  3V9Z A;  4DSF A;  3S3M A;  2W6L A;  1TK8 A;  3I0S A;  1Q9X A;  4JI4 K;  3KIO A;  3TU5 A;  5FPD A;  3RSE B;  5C24 A;  4RW7 A;  1T6C A;  5FDL A;  3VEZ A;  1EP4 A;  1ATR A;  5AQT A;  2JGU A;  2CH6 A;  2FSJ A;  3ULD A;  3AA2 A;  4CHY A;  1UAX A;  2F96 A;  3OYK A;  3PO4 A;  2RE2 A;  4FVU A;  4OPK A;  5BPN A;  3FZH A;  4H4O A;  3PY8 A;  4CIE A;  5AZJ B;  4JI5 K;  2PY5 A;  1LCU A;  3ATU A;  4AHT A;  4KPY A;  1YAG A;  4H0Y B;  1T3V A;  4F3O A;  1KRP A;  1RBT A;  3ZYY X;  4LSN A;  4BG9 A;  1JJ2 M;  1VHX A;  4FL9 A;  4CZI A;  4IG3 A;  1B92 A;  1BIZ A;  3I8B A;  2VCP A;  3CI5 A;  2GBZ A;  4IDH A;  4DR2 K;  4QS7 A;  5C2F A;  2ATQ A;  1NGE A;  2O8D A;  1P8Z A;  1KFS A;  3TI0 A;  3THY B;  4FO0 A;  3AO4 A;  3WXM B;  4FLY A;  3CJB A;  2HMI A;  5JLF A;  3AVA A;  4CEE A;  4F3T A;  3QIN A;  4C8L A;  3ZT4 A;  4DSL A;  1K8K A;  5C15 A;  4RW8 A;  1Q8I A;  3AAP A;  3JAM O;  4OPJ A;  4NLC A;  5FRO A;  4H0P A;  1NGH A;  1W0H A;  1IBK K;  1NOZ A;  1LW0 A;  1BU6 O;  1HPZ A;  3E9L A;  4BVP A;  5E26 A;  4BWJ A;  1ZC6 A;  3ZSQ A;  5GAD P;  4DTR A;  4V19 S;  1C1B A;  2GV9 A;  3V9S A;  4JD2 A;  3ZSV A;  1DT9 A;  4F9O A;  1L3U A;  2PYL A;  3O9Q A;  4DQQ A;  4Z0U A;  4CIF A;  4ILJ A;  4KAZ A;  3VET A;  5C2D A;  3TAE A;  4IJA A;  3LDQ A;  3DI6 A;  3HI0 A;  1N8R O;  2X6N A;  1JLG A;  3H3N O;  4BVO A;  3VF4 A;  1ASU A;  1L3V A;  5C0Y A;  3C94 A;  4KHW A;  3OTO K;  3DXK B;  3NGZ A;  4OGC A;  4KH5 A;  2IOC A;  4E7L A;  4CZM A;  4QS8 A;  1GOC A;  4RCH A;  1NK7 A;  4FLT A;  1YT3 A;  4FWS A;  2GUP A;  2QTD A;  3CER A;  5DMR A;  4EP4 A;  4O44 A;  2EWS A;  2NUB A;  4EAH D;  2YJF A;  4OPA A;  2ZQB A;  1NGG A;  2FC0 A;  4OKJ A;  3PSF A;  3ZSZ A;  5KQ8 A;  2FF6 A;  5GIO A;  3UKU A;  2D0C A;  3AY9 A;  3AVF A;  3VQC A;  3TAM A;  3MN9 A;  3UKU B;  4DTM A;  1ZBH A;  1JXB A;  3DLH A;  3AA4 A;  3T69 A;  1W97 L;  3QDK A;  3OYL A;  4R5P A;  1NWK A;  1U6Z A;  4BE0 A;  3V81 A;  5GIP A;  5CZ1 A;  1NBW A;  3MN5 A;  3J7A P;  4HTU A;  4BG8 A;  2ASM A;  3VA3 A;  3AO3 A;  4CGJ A;  1RBR A;  1XHX A;  3M8Q A;  1GLF O;  3KLF A;  2GEL A;  4MLE A;  4Z4I A;  4M3X A;  4BRH A;  2HBL A;  3SQ4 A;  1TKZ A;  3O4Q A;  5JLH A;  3QEV A;  1JCE A;  4N47 A;  2Q0U A;  1BA0 A;  3DXK A;  2KHO A;  3H1V X;  4MO5 A;  5K14 A;  3O8M A;  3H45 C;  4FSV A;  5CY4 A;  3M5R A;  1NKC A;  2ZE2 A;  3F5T A;  3SMS A;  1KFD A;  3AAR A;  4NO7 A;  3THV A;  5M1O A;  5MLC Q;  3J81 O;  2DPN A;  1VSM A;  2HW3 A;  4BRG A;  1X9W A;  3CYM A;  3SK3 A;  3AO1 A;  3DMJ A;  4DU3 A;  3HSC A;  1VSJ A;  4JD2 B;  4DLG A;  4KI6 A;  1HX1 A;  3WNH A;  1U49 A;  3IG1 A;  3ZT1 A;  4AH9 A;  1VQM N;  3QBW A;  1YXQ A;  2UUC K;  1JCF A;  1SV5 A;  1YTA A;  4AHU A;  4OO1 J;  1VQK N;  3LAK A;  3OYD A;  5AQS A;  3CF5 L;  2E2P A;  3VQ7 A;  3DOK A;  1QSS A;  4DQP A;  3QB0 A;  4CJS A;  3VF6 A;  1K8K B;  3D2F B;  3SPY A;  3OY9 A;  3QFU A;  1H1V A;  1HJO A;  4K8X A;  3T1Y K;  3KK2 A;  4BQL A;  1X9J A;  3MEC A;  4DTP A;  5H1S Q;  2XY7 A;  5TKY A;  3THY A;  3KK7 A;  1YVU A;  1XWL A;  3QFP A;  4L3Q A;  2O8D B;  4BC2 A;  3L2V A;  1SL0 A;  3LWM A;  5AQQ A;  3A5N C;  4FCY A;  3EZ5 A;  4JLH A;  3RWU A;  3GBT A;  3HL8 A;  5DM7 L;  4OLA A;  2YHA A;  4A2A A;  3OYI A;  1VQ7 N;  1QSL A;  3KK1 A;  3CQX A;  5GAE P;  1NGC A;  1UA0 A;  1MWK A;  3L0Q A;  4DTJ A;  1QHT A;  4JKG A;  4C1N K;  1OH6 A;  3KZB A;  2P9S B;  2W42 A;  2W40 A;  1RT7 A;  2W41 A;  3U9D A;  1NOY A;  2KFN A;  3MN6 A;  3CCE N;  3MWT A;  2VQE K;  4CK2 A;  4IFV A;  3T1A A;  2ZM6 K;  5CE3 A;  1WSE A;  3E66 A;  3SBT A;  3KD5 E;  1NGF A;  2BDP A;  1RBV A;  4M45 A;  3AVN A;  4L8R B;  3DLL L;  1X1P A;  4PHT X;  3TSU A;  3RSE A;  4B1W B;  4C8O A;  4GY2 B;  2X6S A;  3S9H A;  3NH0 A;  3H3O B;  3VQQ A;  3QET A;  4DHY A;  4JEP A;  2E1Y A;  4WCE L;  4Z4C A;  5AQV A;  1IG8 A;  3QO9 A;  3CCU N;  4RW6 A;  4CHQ A;  2IVP A;  3QNN A;  2EHG A;  2QXL A;  4LFC K;  4GKK K;  3L8B A;  3BF3 A;  4DS5 A;  3OS2 A;  5LMN K;  4EHT A;  4FXD A;  3WT0 A;  4DR1 K;  1Z05 A;  3O5B A;  4I2P A;  2Z1H A;  3P31 A;  1DTQ A;  2F9W A;  3L4Q A;  3PX0 A;  1SKW A;  3CC7 N;  4M42 A;  3OS0 A;  1KVB A;  2O8F A;  5M1P A;  5AQN A;  3C7N A;  2YNI A;  4HTL A;  1W7A A;  4BR0 A;  4U67 L;  3SLC A;  3JYT A;  4JKE A;  3RVC A;  3E1Y A;  3VGL A;  3VEX A;  3CM5 A;  4CW7 B;  4PKH A;  4JKB A;  1REV A;  4WYB A;  4CFA A;  3IMX A;  3RR7 A;  4EFH A;  1RCH A;  3U9Z A;  4YOX A;  3MX2 A;  4CFB A;  3SV4 A;  2E5L K;  3ZEU A;  4N41 A;  1XNQ K;  4RG8 A;  3SYZ A;  3BY5 A;  2O4I A;  3LL3 A;  1WBD A;  1C1C A;  3HVR A;  4K25 A;  3VQB A;  2WC9 A;  4ID1 A;  3CM6 A;  2HVH A;  1ESV A;  4JAX A;  1ZBL A;  4DV6 K;  2E20 A;  2QKK A;  4CJW A;  2G8I A;  4W5N A;  3DXM A;  5F1X A;  5BPM A;  2CGJ A;  3TAP A;  1YJN N;  1C0T A;  1KAZ A;  4DUY K;  5JMV A;  1K9M O;  1IBL K;  4EZ9 A;  3THX B;  1FKO A;  4BRM A;  1YF5 L;  2P9I A;  4RW9 A;  4LSL A;  5IT9 O;  3SZ2 A;  4H03 B;  5HL7 L;  3GE1 A;  3THX A;  4AM6 A;  2X78 A;  4O4G A;  3KK3 A;  1K73 O;  1L3S A;  4FWO A;  2I5J A;  4IDK A;  1WN7 A;  5F2R A;  3DXM B;  1G15 A;  1NK4 A;  2CGL A;  4M7X A;  5KPR A;  2ZF5 O;  5AZI B;  2VQF K;  5HLF A;  4ISG A;  1KSP A;  1YIJ N;  1VRU A;  4KTZ A;  4Y1C A;  4C1N I;  4O5F A;  1BHL A;  3NF6 A;  4CD3 A;  3P5J A;  3LP1 A;  4OVL A;  2B6A A;  3C0B A;  3G10 A;  4UY8 O;  2FBX A;  3O4W A;  3ZEU B;  5C25 A;  3S41 A;  3K5O A;  4CHZ A;  3T3F A;  2QXF A;  5FPM A;  4H0X B;  3VQE A;  4DF8 A;  1L3T A;  2P9U B;  4CBX A;  2IVN A;  3TTD A;  1ZBI A;  3P38 A;  3SCX A;  4FJM A;  3AVH A;  2LSN A;  2JWL A;  1RTI A;  5C42 A;  2O8B B;  2BE2 A;  3VMF B;  1B9D A;  2A6A A;  4LF6 K;  3BP8 A;  4B8C A;  3H6E A;  3MDQ A;  4CJE A;  3QEI A;  3S3O A;  4K0K K;  1UA1 A;  3C7N B;  1HRH A;  4CFC A;  3RRG A;  3PSI A;  3A2F A;  3OYM A;  3WUH A;  2Q1N A;  3GL1 A;  3S3N A;  1ZXO A;  4CHO A;  4CEF A;  4MQ3 A;  1A5W A;  2JLE A;  2OA8 A;  4A5A A;  1S22 A;  3SUQ A;  2HF4 A;  4KHS A;  4C8M A;  2XO7 A;  3V9U A;  1GLC G;  4ISF A;  1EO1 A;  4KTQ A;  3KJV A;  4HVJ A;  3WXK A;  3CG7 A;  5LL6 Z;  4K8Z A;  2HHT A;  1RDW X;  3RMC A;  2V7Z A;  3LP2 A;  2WTU A;  5LY3 A;  5M1K A;  1U4B A;  4DR6 K;  4B3T K;  4JI3 K;  2F7T A;  3K2P A;  4PL8 A;  1CZA N;  1XQS C;  3NE6 A;  4DMN A;  4JI2 K;  3HM8 A;  4CGG A;  4Z4F A;  4C8N A;  3LZJ A;  3QEX A;  4HHT A;  3FE1 A;  4N5S A;  3C6A A;  5AQH A;  2KFZ A;  3LAN A;  3QES A;  4FK2 A;  2NRV A;  4ZTJ A;  4KB0 A;  2PBD A;  5KPZ A;  1SKS A;  3CFO A;  4CE9 A;  2G8V A;  3CJ7 A;  2Z1I A;  3L2R A;  3MAQ A;  2VWB A;  1A5X A;  3PIO L;  4WQ5 C;  1U45 A;  3FFK B;  2QI2 A;  1T6D A;  3WQT A;  3MCA B;  4DB3 A;  3L4I A;  1NGI A;  1OH5 A;  1OVY A;  2P9S A;  1KQS M;  3O9S A;  4X64 K;  4M3Y A;  1K8A O;  4JKG B;  3V9X A;  4H5W A;  4CF9 A;  1KC8 O;  3ZX0 A;  1HLU A;  1RGI A;  5KPT A;  4CJL A;  4IFE A;  4XH4 A;  4CBU A;  3AV9 A;  4C8K A;  2BUP A;  3CXC M;  1GLL O;  2HHS A;  3RMB A;  3M8R A;  3WNF A;  4DFM A;  2UXC K;  4J8F A;  3EO3 A;  3OHR A;  4CF1 A;  4Y1D A;  3F2K A;  1HKG A;  1OKJ A;  1HYV A;  1YJ9 N;  1NU0 A;  3BEX A;  1WB9 A;  3VGM A;  2V7Y A;  2YHX A;  2HOE A;  2ASO A;  3G0Z A;  4F2S A;  4FM2 A;  2AA4 A;  3NF7 A;  4B9S A;  1E4G T;  2A41 A;  3D2F A;  3F9M A;  3ZX3 A;  3V1R A;  3C6H A;  1T05 A;  5HRP A;  3OYE A;  1YJW N;  1XC3 A;  3E9O A;  3EYZ A;  1VSH A;  3FR0 A;  2E2Q A;  3ZSY A;  1MU2 A;  3CJC A;  2YI1 A;  3I56 N;  1IG9 A;  4GV6 A;  4CEA A;  4BRE A;  1TGO A;  1SAZ A;  4DR5 K;  2R7Y A;  4OKE A;  3LWL A;  3IFR A;  3ZT2 A;  1LWE A;  5EVZ A;  3HZ6 A;  3U3Y A;  2A1S A;  2HST A;  4I6M B;  1NKB A;  1J5E K;  1YHQ N;  4CZF A;  1CXQ A;  1XC9 A;  2BAN A;  1KAX A;  1CZB A;  5ELZ A;  4A61 A;  1D9F A;  1NK8 A;  2RHK A;  2OCE A;  5M1Q A;  2HBK A;  4M3W A;  1WBB A;  1S3X A;  4FJI A;  3W3D A;  3CD6 N;  3CCQ N;  2DTU A;  1QVF M;  4E7K A;  1TAQ A;  2FBT A;  4FVM A;  4OJR A;  1D5A A;  4CEO A;  3LAL A;  4PA1 A;  3VF2 A;  1TKD A;  3P39 A;  3SAF A;  1NNE A;  1XI1 A;  3N4Q A;  2HVI A;  3HJF A;  4G1Q A;  3J7Y P;  1JKH A;  3MEE A;  3NFA A;  2GX9 A;  3H46 O;  2EX3 A;  4EZ6 A;  1LW2 A;  4DTS A;  1HYZ A;  4HCC A;  2NRT A;  5HRO A;  2KTQ A;  3SPZ A;  1HQE A;  1KTQ A;  3DYA A;  1BWF O;  4I7F A;  2UU9 K;  3DAW A;  4N76 A;  2O4G A;  4XH5 A;  3WNE A;  1XUP O;  3R6M A;  4FLU A;  1QQC A;  1HQU A;  5HRS A;  1NK5 A;  2PFU A;  1VSL A;  4LD0 A;  4UQG A;  2HMP A;  2ZGY A;  4FZZ A;  5AJ3 K;  3FLC O;  4AM7 A;  4DTO A;  3FFI A;  4CK3 A;  4A62 A;  1NGA A;  3AA3 A;  2RF2 A;  3KVG A;  3MK6 A;  2QW9 A;  4YDU A;  2KKZ A;  1Q9Y A;  3VTH A;  1JLQ A;  4KH6 A;  2KZM A;  1X9M A;  2VGM A;  3HT3 A;  3CHW A;  3HBT A;  4KHY A;  1J9A A;  3O4N A;  4W5O A;  5AQR A;  3M8S A;  1HYS A;  1QTM A;  2VWJ A;  5EX5 A;  4CJV A;  1KXP A;  3L2Q A;  4KFB A;  2B4J A;  4QCL A;  1SKR A;  4R79 A;  3ATV A;  1FJG K;  3EL2 A;  2HF3 A;  4M3T A;  4ZTF A;  3U4L A;  2B5J A;  2HNZ A;  1C0G A;  3CFP A;  5ADX H;  3VQ5 A;  5KGW A;  4CF2 A;  3TWH A;  3EN9 A;  5FRM A;  4RTF D;  4DFJ A;  5EOY A;  3SNN A;  1NJI O;  3VPZ A;  2YNF A;  4NLB A;  1NK0 A;  4AHC A;  3DLK A;  4CFD A;  4ELV A;  4CHP A;  2VG6 A;  2CGK A;  3AVL A;  3AAQ A;  1WNS A;  4B9Q A;  1TK5 A;  5LJV A;  1C1A A;  1VQN N;  1S9G A;  1S1V A;  2UYT A;  4PQU A;  4KKO A;  3VQ8 A;  4ZHR A;  1TL1 A;  5AQU A;  3TTF A;  4WQ4 A;  1I39 A;  1NJY A;  4E7J A;  3OYH A;  4CHN A;  4AQY K;  5HOO A;  4KH4 A;  3J8A A;  3LDS A;  3KWI A;  4W5T A;  3ZSR A;  3LDP A;  3OYG A;  1EWR A;  4BGA A;  1CZ9 A;  3G25 A;  2ZWH A;  4BRA A;  4IFY A;  2OPQ A;  5AZJ A;  3BZK A;  3A5M C;  3TAN A;  3L3V A;  4ICL A;  1CXU A;  3E01 A;  4YOY A;  4JKF A;  4MDB A;  5I3U A;  4LH5 A;  4CEC A;  1RBS A;  3EE9 A;  2YJE A;  4Z4G A;  3PV8 A;  3RMA A;  2E4L A;  2ZJP L;  4BR2 A;  4OKK A;  3UIQ A;  4CJ5 A;  4FWL A;  4YOR A;  3PUF A;  1RDB A;  5DM6 L;  1NM1 A;  5J1E A;  4B1V A;  1OH7 A;  1HNI A;  1JLA A;  3OYB A;  3O3H A;  3KD1 E;  3J80 O;  3R8E A;  4JI0 K;  2YCH A;  5JVH L;  1IKY A;  1QQO A;  2GWJ A;  2E1Z A;  3NH1 A;  1NK6 A;  2HHQ A;  4H5N A;  4A59 A;  1VQP N;  1EXQ A;  3CQY A;  2GWK A;  2GEM A;  3L6Q A;  3AVC A;  2D1K A;  3QBX A;  3P83 D;  3SJJ A;  3CQ8 A;  1GLB G;  4NYF A;  3ZLJ A;  2O8C B;  2FSN A;  3TSQ A;  3VEW A;  1WSJ A;  5KGX A;  2GUI A;  4BY9 C;  4IEE A;  4DV7 K;  4JI8 K;  4CJU A;  2FLO A;  5J2P A;  3QIO A;  4K41 A;  4JNE A;  3WNG A;  1G99 A;  4GW6 A;  4F2R A;  2QEX N;  1EKE A;  4H0V B;  1HNW K;  4CEQ A;  1RIL A;  2NNW A;  4WE1 A;  1O13 A;  3O1B A;  4JN4 A;  1NMN A;  2IS3 A;  4CEB A;  1MDU B;  1RNH A;  1JLC A;  3V1O A;  3BZC A;  3CET A;  4Z4E A;  4EIA A;  4DG1 A;  4CGF A;  3DRS A;  4CGD A;  1BIS A;  4BAC A;  2F4V K;  4FK0 A;  2J4R A;  3DLG A;  4IEI A;  4YOU A;  4KI4 A;  1NMD A;  3HP9 A;  1N6Q A;  3LDO A;  5AQM A;  1YVN A;  3G6E N;  4IBN A;  1BI4 B;  2P9P A;  3ZT3 A;  4DQR A;  3D0P A;  3SQ0 A;  3NF8 A;  3ULE A;  4JK9 A;  3JSM A;  4DQI A;  3M6G A;  3M8P A;  3CIP A;  2AP1 A;  2Y1I A;  3QIC A;  4MDA A;  3ZSO A;  3QER A;  2VGN A;  1C6V A;  1U47 A;  1VQ4 N;  2UUA K;  4CJ4 A;  4DSI A;  4FPA A;  4BRP A;  3OYC A;  4NCA A;  5J2Q A;  5JS1 A;  5AQJ A;  5AFU H;  2IAJ A;  4DS4 A;  3HST B;  1VSF A;  2H3G X;  3MX5 A;  5AFU A;  4DTX A;  2O8E B;  3UKR B;  2WON A;  4YDU C;  3A0I X;  3DRP A;  4DV1 K;  4O8K A;  4IJN A;  3WXL A;  3HPO A;  4FZX C;  1E4F T;  1RT2 A;  4B3R K;  1WOQ A;  1GLJ O;  1X9S A;  4H5V A;  4DTN A;  3RRH A;  3Q7C A;  1VQ8 N;  4CJT A;  5J2N A;  4AHS A;  3NCI A;  1VQO N;  5GIN A;  1HPM A;  2NLX A;  2Y1J A;  1EET A;  4K42 A;  3LAM A;  1SQK A;  2Q36 A;  3C6U A;  1JLF A;  2ITG A;  4JHD A;  4H5R A;  4ILG B;  4B3S K;  4BR4 A;  3CJA A;  2V52 B;  4PKG A;  3CCV N;  3HXM A;  3HRG A;  4PL7 A;  5TKW A;  3D2E B;  4BWM A;  3WXI A;  1TKX A;  3V1Q A;  3IDH A;  2VG5 A;  4FM1 A;  3NDK A;  1WSH A;  4DV3 K;  1N33 K;  1IJJ A;  4DTU A;  2P9L A;  3K57 A;  1T7P A;  4E19 A;  3IS9 A;  4FLW A;  3F9K A;  2OTJ N;  5KRS A;  3V6D A;  4LFB K;  3C95 A;  1U2V B;  3KKS A;  3ZET A;  4KO0 A;  3I0R A;  2YKN A;  4DU1 A;  1Z26 A;  4IXC A;  3TAG A;  3SQ2 A;  3KLI A;  3HK2 A;  2OZM A; 
#chains in the Genus database with same CATH homology
 1HNV A;  2VWK A;  4CF1 A;  2ZQB A;  4Y1D A;  2BGG A;  1LWC A;  1VSK A;  2FC0 A;  4OKJ A;  3OJU A;  1HYV A;  4FJK A;  3TAQ A;  3ZSZ A;  1XHZ A;  3QEP A;  4AHR A;  2D0C A;  3DOL A;  4I2Q A;  1CLQ A;  1WSI A;  3AVF A;  5I42 A;  2PZS A;  3VQC A;  3D45 A;  3G0Z A;  3TAM A;  1EX4 A;  2XRI A;  4F2S A;  4DTM A;  1D8Y A;  1ZBH A;  4FM2 A;  1TAU A;  1JXB A;  1RDD A;  3DLH A;  3AA4 A;  3NF7 A;  4JRP A;  3OYL A;  3DLB A;  4R5P A;  4B9S A;  4AHV A;  1VRT A;  4BE0 A;  3V81 A;  5CZ1 A;  2FBV A;  2Q3S A;  4HTU A;  1FKP A;  2HND A;  2YNG A;  2KZM A;  1I3A A;  2OPS A;  4KV8 A;  3ZCM A;  3DLR A;  3V1R A;  3VA3 A;  3AO3 A;  4CES A;  3RTV A;  4B8A B;  4CGJ A;  1T05 A;  5HRP A;  1RT3 A;  1RBR A;  1XHX A;  3M8Q A;  3OYE A;  4Z4I A;  3KLF A;  3EYZ A;  4JS4 A;  4M3X A;  1N5Y A;  5DK5 A;  1VSH A;  4BE2 A;  1TKZ A;  3SQ4 A;  2D0B A;  3RR8 A;  3O4Q A;  3QEV A;  1S1T A;  1JLE A;  3ZSY A;  4KRF A;  1MU2 A;  4BDZ A;  4N47 A;  4CJQ A;  1IG9 A;  4GVM A;  1RDC A;  3SV3 A;  1NJW A;  4CEA A;  1LV5 A;  1Y97 A;  4HUG A;  5HP1 A;  5D3G A;  5K14 A;  4DSK A;  4KHN A;  3HK2 A;  5CY4 A;  1NKC A;  1O1W A;  1TGO A;  3AVJ A;  3VQ6 A;  2ZE2 A;  3LZI A;  1WLJ A;  3K58 A;  2R7Y A;  1J54 A;  4M3R A;  3V4I A;  4OKE A;  1KFD A;  3LWL A;  1IKX A;  2OPR A;  3ZT2 A;  1LWE A;  3THV A;  3OYJ A;  3VA0 A;  3U3Y A;  2G8K A;  2A1S A;  1NKB A;  3NH2 A;  1ASV A;  1VSM A;  1CXQ A;  2HW3 A;  1X9W A;  1XC9 A;  3CYM A;  2BAN A;  1CZB A;  1D9F A;  1RTJ A;  3AO1 A;  3DMJ A;  1KCF A;  1NK8 A;  1RT5 A;  4DU3 A;  2YV0 X;  1VSJ A;  3KLH A;  3C6T A;  4O5B A;  2RPI A;  4M3W A;  3LPU A;  4DLG A;  4FJI A;  4H8K A;  1ITG A;  3QEW A;  2FBY A;  4KI6 A;  1LAW A;  4GMJ B;  5CYM A;  3WNH A;  2DTU A;  1BQM A;  4O0J A;  1U49 A;  4E7K A;  3IG1 A;  3ZSX A;  3ZT1 A;  1WAJ A;  4AH9 A;  1TAQ A;  3AVG A;  2FBT A;  4AHU A;  1SV5 A;  1YTA A;  4FVM A;  2P5O A;  1JLB A;  4DFP A;  3LAK A;  4OJR A;  3OYD A;  5KRT A;  4CIG A;  1D5A A;  4CEO A;  3LAL A;  4PA1 A;  4QOZ B;  2G8F A;  3VQ7 A;  4B9U A;  3DOK A;  1TKD A;  1QSS A;  4DQP A;  2F8T A;  4CJS A;  1XI1 A;  2IC3 A;  4FJJ A;  2DFE A;  1WSF A;  2HVI A;  3L3U A;  3SUP A;  3HJF A;  2VG7 A;  3IRX A;  3DRR A;  4G1Q A;  3SPY A;  2F8S A;  4M41 A;  1JKH A;  4AIL C;  3OY9 A;  2RKI A;  4FW1 A;  3MEE A;  4B9M A;  1QS4 A;  1LAV A;  3NFA A;  4CEZ A;  3TR8 A;  4DWI A;  1BGX T;  5JS2 A;  4K8X A;  4FJ8 A;  3KK2 A;  2RN2 A;  4CF0 A;  2KW4 A;  1SUQ A;  3MEC A;  3HM9 A;  2KQ2 A;  4DTP A;  2XY6 A;  2EX3 A;  2XY7 A;  4B9L A;  4E1M A;  3KTQ A;  4KRE A;  4EZ6 A;  1YVU A;  1XWL A;  1LW2 A;  1T8E A;  4DTS A;  2G8U A;  1HYZ A;  2YKM A;  3PO5 A;  4CCH A;  2DY4 A;  4HCC A;  3VQ4 A;  3F73 A;  3L2V A;  5HRO A;  1SL0 A;  4CJ3 A;  2KTQ A;  3LWM A;  3SPZ A;  1HQE A;  3EY1 A;  5CZ2 A;  4J2A A;  1RDA A;  1KTQ A;  3DYA A;  3ITH A;  4FCY A;  3EZ5 A;  4I7F A;  4N76 A;  4JLH A;  1DTT A;  1RBU A;  4DFK A;  2O4G A;  3RWU A;  4DQS A;  3B6P A;  3HL8 A;  3LPT A;  4OLA A;  1GOA A;  3WNE A;  3K5M A;  2YHA A;  3OYI A;  3K5N A;  1DLO A;  1TVR A;  4M3Z A;  4FLU A;  1QQC A;  1HQU A;  3KK1 A;  3HP6 A;  1QSL A;  5HRS A;  5T7B A;  2ZD1 A;  3TAR A;  1VSL A;  4KTW A;  4LD0 A;  1NK5 A;  2HB5 A;  4UQG A;  4FZZ A;  1UA0 A;  3ASM A;  1IKW A;  4DTO A;  3FFI A;  4CK3 A;  4DTJ A;  1QHT A;  3QNO A;  3AA3 A;  4KB1 A;  2W42 A;  3OYN A;  2YHB A;  1RT7 A;  1J5O A;  2WOM A;  2RF2 A;  3LP0 A;  3DM2 A;  3VQA A;  1NOY A;  2KFN A;  2IDO A;  3OYF A;  1QE1 A;  1Q9Y A;  1JLQ A;  1S9E A;  4M3U A;  3VQP A;  4CK2 A;  3BGR A;  4IFV A;  3T1A A;  4BDY A;  4DSE A;  3TAB A;  3HT3 A;  3RMD A;  1IH7 A;  1X9M A;  3ALY A;  1WSE A;  3KLE A;  4J2E A;  3MED A;  2G8W A;  4KHY A;  1S1U A;  3KD5 E;  2BDP A;  1B9F A;  1J9A A;  1RBV A;  3O4N A;  3AVN A;  4NCG A;  3AA5 X;  4M45 A;  4W5O A;  5HRN A;  4FM0 A;  3OVN A;  1JXE A;  4DSJ A;  4L8R B;  4Z4H A;  3M8S A;  4OLB A;  4FYD A;  1HYS A;  1QTM A;  1X1P A;  4LY7 A;  3MXJ A;  2VWJ A;  2OZM A;  4ELT A;  4CJV A;  2G8H A;  3L2Q A;  4FZY A;  4C8O A;  1SL2 A;  4KFB A;  2X6S A;  4E7H A;  2B4J A;  3S9H A;  3NH0 A;  1JL2 A;  1BIU A;  4QCL A;  1SKR A;  4F4K A;  4TSX A;  3VQQ A;  3KLG A;  4JS5 A;  4J2D A;  3QET A;  3NAE A;  4M3T A;  3OYA A;  4ZTF A;  4YFU A;  4B9T A;  1NK9 A;  2P5G A;  2B5J A;  2HNZ A;  4NCB A;  3P1G A;  3CFP A;  3VQD A;  4Z4C A;  2QK9 A;  2DFH A;  3QO9 A;  3VQ5 A;  5KGW A;  1ASW A;  3HYF A;  4H4M A;  4CF2 A;  3TWH A;  1NJZ A;  3SQ1 A;  4RW6 A;  4EP5 A;  4CHQ A;  5FRM A;  1S6P A;  3H08 A;  4DFJ A;  3SNN A;  3QNN A;  4NYN A;  2EHG A;  1BQN A;  4IKF A;  1C0U A;  3U3G A;  3B6O A;  1UOC A;  3L8B A;  2YNF A;  4DS5 A;  3OS2 A;  1NK0 A;  2D5R A;  4AHC A;  3DLK A;  4CFD A;  4ELV A;  4FJL A;  4CHP A;  2VG6 A;  4FXD A;  2HHU A;  2P51 A;  4W5Q A;  4QAG A;  4FLV A;  3AVL A;  2E6M A;  4I2P A;  1WNS A;  2Z1H A;  4FW2 A;  3SUO A;  5E41 A;  1BL3 A;  4ID5 A;  3T19 A;  1ZBF A;  4IG0 A;  4E89 A;  1TK5 A;  1DTQ A;  1KLN A;  2XY8 A;  1C1A A;  4PQU A;  1S1V A;  1S9G A;  1HMV A;  1VSD A;  1GOB A;  3PX0 A;  1F21 A;  4KKO A;  1SKW A;  3VQ8 A;  4ZHR A;  1TL1 A;  5HBM A;  4M42 A;  1ZYQ A;  3OS0 A;  1KVB A;  4F8R A;  1W9H A;  4CJF A;  4O55 A;  1FXX A;  1I39 A;  2YNI A;  3L2U A;  4CF8 A;  1R0A A;  3V9W A;  3PX4 A;  1RT6 A;  1NJY A;  4E7J A;  3OYH A;  3JYT A;  1U48 A;  1ZBU A;  4B3O A;  4CHN A;  4W5R A;  3CM5 A;  3TAF A;  1T03 A;  4PUO A;  4JRQ A;  4PY5 A;  1REV A;  3LDS A;  4E7I A;  4N56 A;  2AJQ A;  4W5T A;  3ZSR A;  4CFA A;  3OYG A;  1TL3 A;  3BDP A;  1CZ9 A;  2XY5 A;  4BDP A;  3RR7 A;  1JL1 A;  1RCH A;  1IKV A;  1BI4 A;  3MXI A;  4IFY A;  1UWB A;  2OPQ A;  4CFB A;  5KI6 A;  3SV4 A;  3HPG A;  5CYQ A;  3TAN A;  3NGI A;  4DF4 A;  2QKB A;  4N41 A;  3L3V A;  4ICL A;  1CXU A;  3E01 A;  3MXM A;  3I8D A;  5HRR A;  4LH4 A;  5I3U A;  1QSY A;  4RG8 A;  5FRN A;  4LH5 A;  1BCO A;  1RBS A;  4CER A;  4CEC A;  1RT4 A;  3SYZ A;  3ISN C;  2O4I A;  4CK1 A;  4Z4G A;  3PV8 A;  3RMA A;  2E4L A;  1RTD A;  4Q0B A;  1C1C A;  4OKK A;  3HVR A;  3UIQ A;  1RT1 A;  4ID1 A;  3VQB A;  3AVK A;  1BCM A;  1S1X A;  4CJ5 A;  3CM6 A;  3SUN A;  3PUF A;  1RDB A;  4HUF A;  2HVH A;  5J1E A;  1HNI A;  4DU4 A;  5SZT A;  3K59 A;  1ZBL A;  1JLA A;  3OYB A;  2QKK A;  3O3H A;  4CJR A;  3KD1 E;  4CJW A;  4CJK A;  3QIP A;  2G8I A;  4HUE A;  4W5N A;  2OYQ A;  1IKY A;  3HO1 A;  3TAP A;  3U6F A;  3NH1 A;  1C0T A;  2E6L A;  1NK6 A;  3SI6 A;  3LP3 A;  2HHQ A;  1KVC A;  2D0A A;  4PWD A;  3ZSW A;  2DFF A;  4YNQ A;  2YNH A;  1SL1 A;  1EXQ A;  3O3G A;  1FKO A;  4EZ9 A;  1HJR A;  2Z1G A;  2PYJ A;  4FLX A;  4RW9 A;  3ZT0 A;  3AVC A;  4E0D A;  4B9N A;  4LSL A;  4B08 A;  3P83 D;  3SJJ A;  1RTH A;  3CQ8 A;  4NYF A;  4FJ9 A;  3NGY A;  4E1N A;  3CFR A;  3SZ2 A;  2IGI A;  4FLZ A;  4DSF A;  3V9Z A;  1WSJ A;  5KGX A;  2X78 A;  4O4G A;  2GUI A;  3S3M A;  1TK8 A;  3KK3 A;  1L3S A;  3I0S A;  1Q9X A;  4CJU A;  5J2P A;  2Z1J A;  2HHV A;  3QIO A;  2I5J A;  3WNG A;  4I9Q A;  4GW6 A;  3KIO A;  4IDK A;  1WN7 A;  4F2R A;  1VSI A;  1EKE A;  1K6Y A;  4CEQ A;  1G15 A;  1NK4 A;  2P1J A;  5C24 A;  1RIL A;  4RW7 A;  5HLF A;  4WE1 A;  2HHX A;  1U04 A;  5FDL A;  3K5L A;  1KSP A;  4FJX A;  1TK0 A;  1EP4 A;  2IS3 A;  1VRU A;  3KKR A;  4KTZ A;  4Y1C A;  4CEB A;  5J2M A;  2A1R A;  1RNH A;  1JLC A;  3V1O A;  1BHL A;  3NF6 A;  2JGU A;  1YTU A;  4Z4E A;  4XIU A;  4RW4 A;  4DG1 A;  3P5J A;  4FJN A;  3LP1 A;  1J53 A;  4CGF A;  3DRS A;  3AO2 A;  2XHB A;  3ULD A;  3AA2 A;  4CGH A;  4CHY A;  4OVL A;  1UAX A;  4CGD A;  1BIS A;  4BAC A;  4KHU A;  2B6A A;  2F96 A;  4FK0 A;  3OYK A;  3DLG A;  3HPH A;  3PO4 A;  1C0M A;  4KI4 A;  3G10 A;  3HP9 A;  2FBX A;  4OPK A;  4KHQ A;  1N6Q A;  5C25 A;  3AVM A;  3K5O A;  4H4O A;  5EU7 A;  4CHZ A;  2QXF A;  3T3F A;  3PY8 A;  3VQE A;  4CIE A;  4IBN A;  2PY5 A;  1BI4 B;  4DF8 A;  1NKE A;  1L3T A;  4ELU A;  4AHT A;  4KPY A;  1ZBI A;  3ZT3 A;  4DQR A;  3NF9 A;  3D0P A;  4J2B A;  3SCX A;  4FJM A;  3SQ0 A;  3NF8 A;  3AVH A;  5KTQ A;  2LSN A;  4F3O A;  1KRP A;  3JSM A;  1RBT A;  1RTI A;  4LSN A;  5C42 A;  4DQI A;  2BE2 A;  3M8P A;  4IG3 A;  1B92 A;  1A5V A;  1B9D A;  1BIZ A;  1TKT A;  3QEI A;  4B8C A;  2GBZ A;  2Y1I A;  4CJE A;  1S1W A;  3ZSO A;  3S3O A;  1LWF A;  1WSG A;  3QER A;  2ATQ A;  1UA1 A;  1KFS A;  1C6V A;  3TI0 A;  1U47 A;  1HRH A;  4CFC A;  3RRG A;  4CJ4 A;  3AO4 A;  4FLY A;  2HMI A;  4DSI A;  4NCA A;  3A2F A;  3OYC A;  3VN5 A;  3AVA A;  4CEE A;  5J2Q A;  4F3T A;  5JS1 A;  3OYM A;  3AVI A;  3QIN A;  3ZT4 A;  2IAJ A;  4DS4 A;  3HST B;  4C8L A;  4DSL A;  1VSF A;  1S6Q A;  4DTX A;  3S3N A;  4RW8 A;  1Q8I A;  4CED A;  2WON A;  4CHO A;  3DRP A;  4OPJ A;  5FRO A;  4MQ3 A;  4CEF A;  1W0H A;  1A5W A;  2JLE A;  3HPO A;  3NBP A;  3SUQ A;  1NOZ A;  1LW0 A;  2OA8 A;  4FJG A;  4FZX C;  4FJ5 A;  4C8M A;  1RT2 A;  1FK9 A;  2XO7 A;  4DLE A;  4KHS A;  1HPZ A;  3V9U A;  2HHW A;  1X9S A;  4KTQ A;  4DTN A;  3KJV A;  4HVJ A;  3HVT A;  3CG7 A;  3RRH A;  4K8Z A;  2HHT A;  1IO2 A;  3RMC A;  5SWM A;  4CJT A;  4BWJ A;  3LP2 A;  4E3S A;  5J2N A;  1Z25 A;  3ZSQ A;  4AHS A;  3NCI A;  1U4B A;  4DTR A;  3MEG A;  1C1B A;  2GV9 A;  1VK0 A;  3V9S A;  2Y1J A;  1EET A;  3K2P A;  3ZSV A;  1L3U A;  3LAM A;  3NE6 A;  2PYL A;  4DQQ A;  4Z0U A;  4DMN A;  4CIF A;  4OGE A;  3C6U A;  1JLF A;  1S5J A;  2ITG A;  4CGG A;  1TV6 A;  3OJS A;  4FK4 A;  4KAZ A;  4Z4F A;  4C8N A;  3LZJ A;  3QEX A;  4B9V A;  4HHT A;  1WAF A;  3AVB A;  4O0I A;  4N5S A;  3TAE A;  2X74 A;  2KFZ A;  3IAY A;  3QLH A;  3O3F A;  3LAN A;  3NHG A;  3QES A;  1NJX A;  4KB0 A;  2OPP A;  4ZTJ A;  3DI6 A;  4FK2 A;  1SKS A;  3CFO A;  3PX6 A;  4CE9 A;  2G8V A;  4CJP A;  2Z1I A;  3HXM A;  3L2R A;  4MFB A;  3MAQ A;  2X6N A;  1JLG A;  4BWM A;  1A5X A;  1TKX A;  1ASU A;  1L3V A;  1KLM A;  3V1Q A;  2VG5 A;  4FM1 A;  3NDK A;  3C94 A;  1U45 A;  4KHW A;  3NGZ A;  1WSH A;  4OGC A;  3VQ9 A;  2IOC A;  1D9D A;  4E7L A;  4I9L A;  4M3Y A;  1GOC A;  2HNY A;  4DTU A;  3K57 A;  1NK7 A;  3V9X A;  2ETJ A;  4E19 A;  3IS9 A;  4FLW A;  3F9K A;  4FLT A;  1T7P A;  4CF9 A;  5KRS A;  1VSE A;  4HCB A;  3V6D A;  1YT3 A;  4Q5V A;  3C95 A;  4CJL A;  4FJH A;  3AO5 A;  2KZZ A;  3AV9 A;  4C8K A;  3KKS A;  4KO0 A;  3I0R A;  4CGI A;  2OZS A;  5DMR A;  4EP4 A;  2YKN A;  3RMB A;  3M8R A;  4FJ7 A;  3OS1 A;  4DU1 A;  2HHS A;  1L5U A;  4O44 A;  1Z26 A;  3L2W A;  3TAG A;  3SQ2 A;  3WNF A;  4BE1 A;  3KLI A;  2NUB A;  4DFM A;  3DLE A;  1KVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...