3QITA

Thioesterase domain from curacin biosynthetic pathway
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
284
structure length
281
Chain Sequence
NAMEEKFLEFGGNQICLCSWGSPEHPVVLCIHGILEQGLAWQEVALPLAAQGYRVVAPDLFGHGRSSHLEMVTSYSSLTFLAQIDRVIQELPDQPLLLVGHSMGAMLATAIASVRPKKIKELILVELPLPAEEESAVNQLTTCLDYLSSTPQHPIFPDVATAASRLRQAIPSLSEEFSYILAQRITQPNQGGVRWSWDAIIRTRSILGLNNLPGGRSQYLEMLKSIQVPTTLVYGDSSKLNRPEDLQQQKMTMTQAKRVFLSGGHNLHIDAAAALASLILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Terminal Alkene Formation by the Thioesterase of Curacin A Biosynthesis: STRUCTURE OF A DECARBOXYLATING THIOESTERASE.
pubmed doi rcsb
source organism Lyngbya majuscula 19l
molecule tags Hydrolase
molecule keywords Polyketide synthase
total genus 95
structure length 281
sequence length 284
chains with identical sequence B, C, D
ec nomenclature ec 3.1.2.-:
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qitA00
2BGNA 5HQ3B 2GZSA 1G42A 2QUBA 4M0FA 1ZICA 3I2HA 5AKXA 3TGLA 1ZGBA 5HFNA 3HRHA 3R0VA 4GXNA 4DSZA 3A70A 1MU0A 4JYMA 2GBCA 2JGIA 5LZ5A 4Q34A 4FFWA 3VDXA 4UBNA 3DCNA 2PPLA 3ESCA 5DYTA 4EY6A 5ALUA 1QLWA 1Q84A 2DQZA 2VF2A 1OCEA 4LIPD 4KE7A 1FFBA 4W9RA 4ARAA 3VJMA 3A6ZA 2ZVDA 3QPCA 5KWIA 2YXPX 4J0KA 3W04A 3SC2A 1A88A 5ALRA 2X8BA 4Y2PA 3OG9A 1ZGCA 4UHCA 1ODTC 2CZQA 4X97A 3C6BA 1XLVA 3H17A 4X93A 3V48A 2Y2UA 1QTIA 5KREA 1CUXA 5JAOA 1CUVA 3W2TA 2WIDA 3OTQA 4LYDA 4W63A 3WIBA 5FPQA 5JARA 4UFPA 1XZKA 4BATA 5LKRA 2I3ZA 3FCYA 4FBLA 4X91A 2HHAA 2XLBA 4F60A 3BJMA 2XUFA 1MTZA 2HU5A 1VXRA 1JI3A 3PF9A 4DM7A 5AJHA 3WIOA 3AZPA 2CEKA 5CT4A 1EH5A 4AMYA 5EIEA 3ZV7A 1HQDA 4UBIA 5ALNA 1YB6A 3DL4A 2VQ6A 4DSAA 3JW8A 3O4IA 4WFJA 3WA7A 3WK9A 5HF8A 2QRUA 2WKWA 1W1IA 4A5SA 5AKZA 1CUGA 2JF0A 3M83A 3ZWQA 2OCLA 4P93A 1GGVA 1ACJA 4RPCA 2HU8A 2VJBA 5HK9A 4U2FA 3QYJA 4KAJA 4QNNA 5BOVA 2HDWA 1SOMA 5JADA 2J3DA 5AP9A 4LXHA 1ZOIA 5F4ZA 3WYDA 3QMVA 1R88A 3W06A 1QJ4A 2DR0A 3RKSA 3H0CA 4CIBA 2VA9A 3SK0A 4IH1A 3H2IA 3VKFA 2AJCA 1UKCA 3IUQA 5HF5A 2W6CX 4IO0A 5AI9A 1F8UA 4DGQA 4H77A 3HJUA 4B7ZA 3BF7A 1OILA 5HQ3A 1W75A 3WJ2A 1W6RA 1YSCA 3N0TA 2WIJA 1ZD3A 5LZ8A 2B20A 3QITA 3T4UA 2P8SA 2R8BA 3I1YA 5HFAA 1EB9A 3I2JA 1A8UA 1CUEA 1EB8A 3A2LA 4Y2SA 4W1RA 4BAZA 1XLUA 3EQ7A 2HA3A 2H9YA 2VATA 3CN7A 3B5EA 3R3VA 4H7JA 3O4GA 2BUBA 1O6GA 1DT3A 1Y37A 1C4XA 4Y2YA 3I2IA 5BWCA 4I3FA 4FFVA 5AKHA 4MEAA 2JGEA 4FLMA 2OCKA 2C7BA 3E4DA 3F9CA 3WWPA 5IVKA 3DJYA 3QMMA 4RGYA 2QMQA 3G9TA 1J07A 2D5LA 4QDXA 1H2YA 1QE3A 5CRIA 5I7UA 2XMZA 2BFNA 2O7VA 1TCCA 3AIKA 4IQ4A 1GQRA 1HBJA 1YB7A 3UUFA 4BB0A 2Z5GA 1Q0ZA 4RE6A 3GFFA 5ALDA 1XKTA 4ZV9A 3GZJA 3IUJA 4X6UA 4GI1A 5DNVA 3WQHA 2XQKA 3MUOA 2HA4A 5FV4A 4KAFA 4OSEA 2HRQA 2WQZA 4BAGA 4UFOA 3WYNA 2IX9A 1K6EA 4DLNA 2Y1KA 4U2BA 4TGLA 3WLAA 4G9GA 3DD5A 1WPRA 3DNMA 4C4ZA 5AKIA 1XZJA 3C43A 4G8CA 4OD0A 5CH3A 4Q3LA 1T2NA 2X5XA 1BEEA 1PFQA 4F5ZA 3D2AA 4UBKA 4Q82A 1CV2A 4E14A 3O4JA 3VVLA 2BGRA 3WA6A 3DYIA 4KR0A 5DYWA 3FOBA 4QDUA 5C8ZA 4OUKX 4FDMA 5AI6A 5E4JA 3QM1A 5CH5A 2Z3ZA 2Y2VA 4GLBA 1EHYA 3G0DA 1EX9A 5AK6A 5AM4A 1P0PA 3AFIA 6YASA 3AIMA 3STYA 3F67A 1S8OA 2Z3WA 3H2GA 3M81A 3GA7A 4UFNA 3LCRA 3IURA 3K2IA 4OYYA 4KE8A 1BU8A 1EINA 1USWA 3BDVA 5AOCA 1TQHA 4K6KA 1LPAB 3D7RA 4MJ3A 1FFEA 5EI5A 2UZ0A 1E3QA 1XZBA 2Y6UA 3SWWA 2B9VA 1XRPA 1HL7A 4S0XA 2JIDA 5EHZA 4BE9A 1ODSA 1NX9A 3KWJA 3AZQA 1WHTA 3IDAA 2XDWA 2PVSA 4BRSA 4ZV7A 2VJAA 3C87A 5HKBA 3HLKA 1P0IA 3AUKA 4H35A 4MQLA 1EK2A 5T4BA 4IHAA 3WWOA 4GWLA 1JMYA 5FKJA 5LLSA 3C6XA 4FLFA 4GDMA 4DMHA 2HFKA 4MWSA 2CJPA 2YH2A 3W9BA 3R3ZA 5AOAA 2XUOA 1WB4A 1JJBA 3BWXA 2XB6A 4DNPA 3ESDA 2AJ8A 1LPSA 5LKAA 1YA4A 3S2ZA 5EIHA 4ZGBA 1UOPA 4PO3X 4OB8A 3BF8A 3STVA 2GYUA 2XE4A 1C7IA 1ZIXA 3G9ZA 5ALIA 1YS1X 4E11A 4NMWA 1GZ7A 5BV7A 2Z8XA 1A8SA 1TAHA 1XZEA 2OCIA 4YK7A 3RM3A 1XZLA 5JZBA 2X76A 2OGSA 3DS8A 2WIKA 1UFOA 5AK5A 2H7CA 2QXTA 4A23A 4K6HA 3D59A 4ROTA 3I2GA 1GKLA 4E46A 3W9UA 5SYNA 3PF8A 5ALGA 3AJAA 4BCDA 2CB9A 1H22A 2IITA 2BJHA 1LPNA 2QR5A 2B4KA 4XVCA 1C7JA 3IB3A 4UHBA 1UWCA 4PF1A 5ALTA 3QVMA 1BN7A 4KE6A 2C5GA 4LXGA 4CI9A 5K5EA 2XMSA 4BVKA 1DU4A 3S8YA 1X2BA 3NWOA 3WMRA 1JJFA 2EEPA 4Q05A 1X2EA 1XRMA 4EUSA 2QTBA 3CXUA 1AMNA 4N5HX 3VJKA 4QWMA 5AIAA 3U0VA 1QIGA 3G8YA 5K3FB 4L72A 2G4LA 1N5MA 1LBTA 2ES4A 4DNOA 1R50A 4J3JA 4HXGA 5A62A 1R9NA 2E3JA 1LPBB 5FXMA 2WUEA 1DWQA 3DOHA 5HKAA 2C58A 3LS2A 2ZYSA 1EI9A 1K8QA 3WKDA 5A2GA 2OGZA 3GBSA 4AXBA 2V96A 1IZ8A 3TRDA 2WIFA 1U4NA 1THTA 1SCIA 4C89A 1YCDA 4ZXFA 3ZI7A 1XRNA 2JEYA 4H0CA 2WFLB 2LIPA 3OM8A 1ODCA 3PFCA 4X94A 1L7RA 5DJ5A 4C6HA 5CXXA 2WM2A 4CCWA 4HS9A 3M3DA 3FSGA 1XQXA 5C8VA 2C0QA 2I03A 1MPXA 5AKJA 1BN6A 1QIHA 1GPLA 1W76A 3LIIA 4HTAA 4AX4A 4CG1A 4WDQA 2PSEA 3KWFA 5AK4A 3DKRA 3H2HA 4ZI5A 1VXOA 4G1FA 1I6WA 4HXEB 5EIAA 5IH7A 1DT5A 1XZGA 5D7BA 4WJLA 1DX4A 1WM1A 1JU3A 4QDTA 4YPVA 1MAAA 3ZPXA 1UK6A 4X90A 5ALSA 4FBMA 4KYVA 1MN6A 4MEBA 3IVMA 4J0DA 3PDCA 1HPLA 4L0CA 5ALVA 4BP9A 1U8EA 5JAHA 3PI6A 4C01A 3QH4A 1J06A 1YAJA 3B3QA 1HDEA 5T4EA 2Z8ZA 5IVIA 2HU7A 4LKOA 1H2WA 5A6VA 3CCBA 3VJLA 1ZD2P 1QIEA 4M0MA 5ALOA 2OPHA 4U2CA 1R4ZA 5DLPA 3D4LA 1CQZA 2DSNA 1K4YA 2AJBA 2ONCA 2IIVA 4GBGA 4M0EA 2RGUA 5K3BA 2WG2A 3BIXA 1Z68A 3QPDA 4QEKA 1AQLA 4L3WA 3WK7A 4RNCA 3K6KA 2WJ4A 1XZDA 5FPPA 1XFDA 5JAUA 2JGJA 5CXUA 4G4GA 1UK7A 2C5FA 2RHTA 5JZSA 5A7GA 4H7DA 1QZ3A 2O2GA 4BTLA 2ZSIA 3Q0TA 2AJDA 2PU5A 3HSSA 3EF3A 4DIUA 4W1PA 1GPKA 4H7KA 4DMCA 4MXDA 4HZGA 2WSLA 4V2IA 3R3YA 3H1BA 5ALYA 4WY8A 3FWHA 5LIPA 2WJ6A 5EFZA 4UBMA 1P0MA 1CRLA 1ZJ5A 3TJMA 3WWDA 2OGTA 5A71A 1Y7IA 3DYVA 4Q3KA 4OU5A 3V1MA 4AZ0A 4FTWA 3WKBA 5HCUA 4G8BA 4G9EA 3BE8A 4YASA 1LPPA 1XZCA 1HLGA 4FOLA 2DCMA 3FVTA 3HACA 2C0PA 3PFBA 3HABA 4J03A 3I1IA 4PW0A 2JBWA 5FDFA 3FNBA 2J4CA 4I4CA 2BAGA 4ITVA 5ALXA 2HIHA 1XZMA 3DL7A 1GPNA 3IA2A 4UHEA 4P92A 1QFSA 3DKKA 3JYHA 2OQIA 3STTA 2WIGA 3O0DA 5I8PA 4AMZA 3G0BA 2HA6A 4UHHA 1EXWA 3H18A 1KU6A 1EK1A 2WHRA 1JFRA 4BDTA 5ALMA 2VT6A 3KOOA 1CR6A 1AZWA 5CT5A 4ARBA 5FRDA 2DHDA 1QIDA 5K3CA 3STWA 1AC5A 3I6MA 2ZJ7A 2ACEA 3O4HA 5D3KA 4Y7DA 2XUQA 1U65A 4BDSA 4GW3A 5CW2A 5JANA 3KXPA 4WCVA 1DQZA 4Q3OA 2V98A 3V1LA 4C4XA 3BDIA 4B6GA 1RP1A 2WJ3A 1YS2X 4KE9A 3G02A 4F21A 2DHCA 2G63A 4B83A 1XQVA 4TVKA 1R3DA 5EHXA 1EVQA 1G66A 2YASA 4BTVA 4LYEA 2WFMA 3C45A 4DMFA 2Q0XA 1UT6A 3FYUC 5ALLA 1CQWA 4DMKA 1DWPA 3I2FA 5ALWA 1F0PA 1MX1A 2H1IA 2VJDA 2QJRA 3I28A 1G5FA 1E8NA 4UHDA 3VXKA 2PUHA 1N1MA 4IH9A 4AZ3A 4QDOA 4P08A 1KEZA 2OAEA 2ZSHA 4LHEA 4X6XA 5AM3A 3H19A 5LZ2A 4QWWA 2VAXA 3HYSA 4BC0A 5JAPA 1J2EA 2CKMA 4YX9A 5AOBA 4Z49A 1SFRA 3KD2A 2XUIA 1XLWA 3PUIA 4JNCA 4N8SA 4PSCA 3I6YA 4B80A 3H04A 2PSJA 2Y6VA 4C87A 1RWQA 2HFJA 3O9MA 5AIBA 3GELA 2ORYA 2ROQA 1JU4A 2VT7A 2QKYA 2GYWA 3TEJA 2DHEA 1VKHA 1X70A 4BRZA 4MWTA 1G4HA 1ACLA 1E5TA 2PKYX 2G5PA 2FUKA 2VAVA 2O7RA 1IVYA 1WHSA 4AO6A 1U2EA 3C70A 1E8MA 2FJPA 2ZYHA 4B0PA 1CVLA 1L7QA 4NVRA 4UHFA 1CUYA 3ANSA 4EZIA 5FUMA 3B12A 1XRQA 3AIOA 4INZA 1MNAA 2WHQA 3LLCA 1LZKA 2HA0A 4UBOA 1XKLA 1XZIA 4X6YA 4MYDA 1MAHA 4MQMA 4B81A 3FVRA 1CUZA 1FFDA 1BCRA 1TRHA 4BAUA 1QIJA 2XMGA 3R3XA 2H7YA 2PSDA 3ANTA 2WUDA 4Y2UA 3PUHA 4W1QA 4AO8A 4OYLA 1YA8A 2EDAA 2K2QB 3FCXA 3HC7A 5ALPA 1PJAA 3AINA 1TIBA 1ORWA 4H18A 4CFSA 3IULA 1EA5A 4ZREA 3C8DA 2XMBA 4UBJA 1R9MA 5CBKA 5AI5A 5HZGA 5AKEA 2D0DA 5IKXA 5YASA 5LZ4A 2XQFA 1LGYA 1M33A 4QZVA 3RK4A 2GBFA 3G0GA 5T4HA 1F6WA 4XX1A 1DTEA 2XMCA 3QZUA 1ZD4A 1QONA 4Y9SA 1VE6A 5J3JA 5JALA 5ALZA 1T4MA 2HADA 3YASA 2JGFA 5K3AA 3WL5A 2WHPA 3G9XA 5BWBA 4X95A 1UOQA 3WK5A 3K9BA 4X3CA 3DOIA 1QIFA 4AB1A 3FBWA 4CG3A 1FJ2A 3NUZA 4BBZA 2XMRA 1EDBA 2OCGA 3GROA 3M82A 4U2GA 1CPYA 3WKAA 1W52X 1GQSA 4KRYA 5D6OA 5LYYA 3PE6A 3STXA 3EQ8A 4CCYA 3MVEA 5JD4A 3WWEA 1CUHA 5JYCA 4OPMA 4X85A 2HM7A 2R11A 4EY8A 2CBGA 3ESAA 3EBLA 4PQEA 1A8QA 1QOZA 3O9VA 1EDDA 4WFIA 4UBLA 2ZYRA 4X7BA 2WU3A 1VZ2A 2AXEA 5E4YA 2RHWA 4BE4A 2V9ZA 5AKLA 1Y7HA 2QT9A 3NOXA 4QLOA 1ZI8A 1UK9A 3DQZA 3JWEA 3RLIA 4E15A 1UK8A 4Y2JA 1EDEA 3WZLA 3D2CA 4ZWNA 5IVDA 1CUAA 1SCKA 4CG2A 1VZ3A 2GBIA 2XUDA 4FKBA 3T52A 3WL8A 5AM5A 3R40A 5K3FA 2JGMA 3H2JA 1JKMA 1MNQA 3AZOA 2RAUA 3D2BA 2WTNA 5ISMA 4J0GA 4EA6A 2C4HA 4WY5A 3DLTA 5CMLA 3R3WA 1WPXA 1DQYA 1ZD5A 1UXOA 5CT8A 4KAAA 5DNWA 3WWCA 2GBGA 1VA5A 4AN0A 2WTMA 1UKBA 3IUNA 2O2HA 4ZRDA 2PBLA 4Y2QA 2OQVA 3BL8A 4PNZA 2XMDA 4J7AA 5CURA 4P9NA 4HXFB 5FLKA 1XZFA 3WK6A 2AJLI 1L7AA 1Q83A 4H7HA 3EIOA 4JYPA 1XQWA 1MX5A 2BUCA 2WG0A 3QPAA 5FP0A 5HF9A 5EGNA 3QBJA 1BE0A 2PL5A 3F98A 1J1IA 4N8DA 4HRXA 5AK3A 4B82A 4TPKA 2W22A 3AILA 2XLCA 3STUA 5CT9A 4K6GA 1ETHA 2JGKA 3FAKA 1CUIA 5HK8A 3O95A 2CMFA 2EDCA 3FLEA 1NU6A 1QIIA 1WB5A 4K5QA 4N5IX 5FOQA 1UKAA 3ICWA 2DQYA 1CEXA 4CCYB 3IUMA 5ALQA 4XWGA 1O6FA 3UMJA 5E2IA 1XRRA 5CH8A 1CIJA 1JT2A 5AKYA 3WL7A 3MUNA 4DTCA 4U2EA 2XI4A 1AKNA 1LPOA 4DYHA 3G0IA 5ALHA 1E8DA 1CUCA 5I9IA 3L1HA 1P0QA 1AUOA 1LNSA 2G5TA 3H1AA 2RONA 4EY7A 4GHWA 2QUAA 1QO9A 3A2MA 1CUWA 3QMWA 3IIIA 3G0CA 3WJ1A 4NS4A 3V1NA 4BCCA 4GEGA 2WG1A 5SYMA 1VJ5A 2JEZA 4QLAA 1QIKA 1FFAA 2HA5A 4B84A 2RI6A 1DINA 1IUOA 5AI4A 1ORVA 1W4LA 5AH0A 4MYSA 3KSRA 3ILSA 3MGAA 4Y2XA 2BKLA 1B6GA 2WU4A 2XQIA 3BJRA 3F8SA 1XZAA 3WKCA 5JIBA 1N5RA 3SX4A 1CUDA 2DFPA 1XQYA 3OOSA 2PUJA 4AO7A 1R1DA 1N8SA 2XUJA 4H7IA 3F96A 3FSGD 3H2KA 4XIIA 5ALFA 3C6YA 2FJ0A 3C8HA 5JD6A 4OB7A 3Q8WA 3WK4A 4KEAA 4PSUA 1BS9A 4X71A 3FYTA 3KDAA 3R41A 3FLAA 4QE3A 1ZJ4A 1IUNA 4N8EA 4K2AA 2VSQA 4WDRA 1AURA 1TK3A 5H3HA 1H2ZA 2ECFA 1ISPA 3FYUB 2QVBA 1GXSA 1IZ7A 3WKEA 4KRXA 2HRRA 2QS9A 1AGYA 4EBBA 1XROA 3VVMA 1VLQA 4FMPA 1DWOA 1VA4A 2PSHA 2BCEA 4BC1A 1CUJA 4LXIA 3D0KA 3ZLVA 5AM1A 2OLEA 2I3DA 3HI4A 5AKKA 1YASA 1JMKC 2HA7A 4BZZA 2WLSA 4AQDA 4JH0A 3G7NA 5E4TA 5AI8A 2PU7A 1TCBA 2QJWA 5CT6A 1MJ5A 1VOTA 4HRYA 2XT0A 5ALJA 4G4JA 3F97A 3WZMA 3ED1A 1BEZA 4WFKA 1WOMA 5AM2A 4BYMA 4JUIA 1YR2A 2NW6A 2HA2A 1UOOA 5DWDA 2XUKA 1PV1A 2QOEA 1UZAA 1TKRA 1LLFA 5AM0A 1ZI6A 4FNMA 5JASA 3GUUA 4O08A 2XUAA 3CCCA 2I78A 4J0IA 1LPMA 5C81A 1FSSA 4PV7A 2ZJ6A 1MX9A 5ESRA 1ZI9A 5LZ7A 2OXEA 4EB0A 5LP1A 3ESBA 3HXKA 2WILA 5D3ZA 1FFCA 4B85A 5EHNA 1YAHA 1VE7A 2PX6A 1CUSA 1GKKA 1QIMA 1QFMA 2QM0A 1WB6A 4Q1VA 1THGA 4B9EA 2BUAA 5DYYA 4KACA 2OAGA 5C7YA 2XMQA 4DNFA 4I19A 4KJXA 4U2DA 2J3QA 5CTAA 2WUGA 5AICA 4QA9A 3C6ZA 2OG1A 4FNGA 2RIPA 1CUFA 4C4YA 3LP5A 3E0XA 5EHQA 4D9JA 1F0NA 2VEOA 4FHZA 4CIAA 3EQ9A 3FLBA 3BIWA 4J0HA 2XUGA 1GT6A 5KWJA 2ACKA 4HVTA 2XQGA 3E1GA 2GYVA 3DEAA 3X3HA 2XUHA 2B61A 3I2KA 4NZZA 1MO2A 3WK8A 4X00A 2ZJFA 3A2NA 1BRTA 4HAIA 1E66A 3FYUA 4L9AA 4EHBA 1CFJA 3VISA 1SC9A 1EVEA 3NGMA 2VTVA 3ZLUA 1IUPA 3LIPA 4G5XA 3W05A 1HKHA 3OURA 4F0JA 5A7HA 4QDZA 2WFZA 1AX9A 4Y2RA 4BP8A 2V97A 1LBSA 2PM8A 4J0JA 1E89A 4ETWA 1D07A 5AI0A 4BCBA 5IVHA 5AKGA 1OXMA 2WUFA 4DNQA 1ZIYA 2H7XA 4GECA 3C5WP 3OPMA 4BVLA 3E3AA 2J4FA 3N2ZB 1XZHA 3D3NA 4H7FA 4W1SA 5K3EA 4AN1A 2QZPA 4BVJA 3L1JA 2VJCA 2JGLA 4OU4A 4Y2VA 4UPDA 3UUEA 4G4IA 2ZYIA 3RARA 2XQJA 1Q0RA 4G8DA 3P2MA 5A7FA 5LZ9A 4J0CA 3G9UA 1QO7A 1B41A 2CUTA 4PSDA 1BROA 3HEAA 3IBTA 4X92A 4B9AA 1QTRA 4RE5A 2HL6A 3U1TA 1LZLA 1IMJA 5K3DA 4A16A 4BZWA 1QGED 7YASA 5DTIA 3C5VA 3V1KA 3WI7A 3L1IA 4B0OA 3CN9A 2FX5A 5JATA 1H23A 1CLEA 2WHPB 1JJIA 2QXUA 3ICVA 1SCQA 4H7EA 4XJVA 1XRLA 5DTJA 3I6ZA 1DX6A 3BXPA 3PICA 5ALKA 5DNUA 2YYSA 5JD5A 5HF6A 2GZRA 4FWBA 1H2XA 2O2IA 1CUUA 1NU8A 5AHXA 3OC0A 3WL6A 2WFLA 3HZOA 1TCAA 4JEIA 4UUQA 3DDUA 4IH4A 2PSFA 3R3UA 1RYYA 1KU0A 4Y2TA 1K5PA 5KBYA 4EY4A 1A7UA 1CUBA 5ALEA 4OCZA 1BCSA 5AO9A 3V9AA 2XUPA 4OB6A 3ZLTA 1K63A 5C8XA 1MT3A 5T4FA 4EY5A 3D5EA 5JZ9A 1WCYA 4C88A 4FLEA
chains in the Genus database with same CATH superfamily
2GZ1A 5HQ3B 5CNKA 2A86A 2GZSA 3GJSA 4KSBA 2O8CA 2Q2VA 2ZE7A 1NATA 4DXHA 2DWQA 2RAFA 3MJHA 4QELA 3CGGA 5LQUA 1JVNA 4MMZB 4RF5A 4ILKA 4K9LA 2CK3A 3I2HA 2UZAA 2BZ0A 3NDIA 4O4JB 3RKUA 3ZEAA 1UFRA 5B58C 5K8UA 2RAPA 5HFNA 2YXBA 4QXMA 5FV7A 2VDUE 4PYKA 4DSZA 1IAQA 4N0MA 3UAXA 4JYMA 4D44A 2X1HA 5I51A 3UG7A 2PX8A 3NZEA 4JJFA 3SJUA 4R71A 5A5EA 1X9GA 5ADVA 5BVHA 4FFWA 2H4WA 3A9WA 1I5RA 1JXMA 2B7BA 4KO1S 3GDOA 1RWBA 2E4YA 1GL9B 1ZEMA 4XE5A 3HO6A 2O0MA 2WWVD 4EY6A 4CTOA 1W4RA 1C7EA 5B7PA 4DDHA 1E9RA 1MH9A 1YRAA 4X1YA 1FVXA 1TU0A 1AHPA 3RVMA 1CY4A 2WSMA 3LJKA 3M7IA 4KE7A 3UKOA 1D2AA 5IT4A 2HMTA 2EFEB 2D5CA 4PC6A 4YLYA 1KI8A 3AR5A 1VJTA 2FFAA 3WYGA 3GMDA 2BFEA 2IUSA 3QPCA 3RRMA 1ZUD1 4Q7JB 3TB4A 4JLNA 3SC2A 2HMVA 5BMVA 3NUQA 5ALRA 3C7CB 3EMBA 2X8BA 4HQ6A 4NKRA 5E6UB 4YRSA 2R6JA 1AGNA 1SUCA 3IH5A 4LOAA 4MQ6A 1TNDA 1ZGCA 4LRXA 1OZFA 4OBXA 4OQZA 3TH5A 1ZU5A 3ETCA 2CZQA 4X97A 2GF0A 4LFBB 2ZTLA 1Q16A 2PD6A 3H17A 4X93A 2VHWA 2IUEA 1RI3A 1U7TA 1X7WA 3GL9A 3KQTA 4UDYX 7MHTA 1E0DA 2IH2A 3CQ9A 1X38A 4HNRA 3E05A 3T9FA 4LYHA 5E9JA 2BBWA 4HH4A 1TVCA 5FFFA 4JLMA 2JHGA 2M6LA 1EWRA 3LPAA 3W2TA 2P68A 1GV1A 1II9A 2PQ0A 2WIDA 1XTUA 3OY2A 2ATIA 3OTQA 2C5HA 3PHJA 2H1RA 1GCIA 2LRHA 4LYDA 5C5CA 3HZRA 4KGZA 3EFEA 3CLTD 1VKNA 4UFPA 1U8AA 1PGPA 4I5EA 4DLTA 1Y3HA 4IDNA 4F1KA 4E2YA 2C2MA 1M66A 5LKRA 4C2TA 2Z04A 3DJFA 5LJIA 1ZX1A 2G4CA 5B2EA 4URUR 3AGPA 2K87A 3FCYA 4RYLA 1UJMA 1N5OX 4IIYA 1U2SA 1YJCA 3MJFA 4X91A 3WNDA 1LBIA 1IJFA 3HYCA 1DXHA 3PC3A 3BDAA 1SUFA 1BZYA 1US8B 4MB6A 4MI9A 5AVYA 4L9SA 5DEOA 4HZUA 5ERYA 4K6CA 4M9CA 5FHQA 1L4KA 1XJWA 2C5AA 4KQIA 1FUYB 3K9CA 4U7WA 1VXRA 1JI3A 5CFNA 4C05A 4DPLA 3O5AA 3AZPA 4QHTA 5T67A 5CT4A 4J7CA 3HJTA 5KYYA 4CMJA 6REQB 1EH5A 2FFRA 3BGVA 1CNEA 4ZQBA 3K2BA 3KETA 1HQDA 1KO8A 1J2RA 2ZSUA 3TM4A 1O0BA 4G89A 5ALNA 2FNAA 1ZM4A 2XOXA 4BNDB 1J8MF 3SBOA 1P3DA 1Q95A 1SVOA 2VQ6A 3FKSD 3MMPA 4OREX 4DSAA 1OLUB 2ONJA 5HUQA 2CNNA 1QYRA 1OZHA 3WK9A 3TEFA 1AVTA 3U3XA 1H1LA 2QRUA 4DJEC 5KNDD 3UAYA 4HEJA 1R64A 4RIFA 2XA2A 4Y9TA 2HWXA 1UJ4A 1YJ5A 4MITA 3TF5A 2JF0A 4UVGA 3A9VA 3BRWA 2CC2A 2AHRA 1I8TA 2IPAB 3GHYA 2PCLA 3AOGA 5DE3A 4X7PA 5IC6A 2DECA 2GTHA 2O2EA 4HGPA 1GGVA 4GLJA 4L95C 4X61A 4XYBA 1H66A 3OOYA 4N39A 1J25A 2AB0A 4H4DA 5KNCA 4QREA 3W7VA 5HK9A 1Q22A 1QU2A 4U2FA 1L7EA 1ZW6A 2W11A 1M8GA 2QNRA 3JWIA 2PGOA 1RBQA 3QYJA 4GVPA 2OXRA 1KYVA 2ZI7A 1NUHA 2WOJA 3KLMX 4KAJA 4YHHB 1XMJA 3QWBA 4RZXA 3S99A 5BOVA 2HDWA 2UZ1B 1GFWA 1EDZA 1FU7A 2HCJB 1FRNA 4LXHA 3HKDA 4O3FA 1KO5A 3HJBA 3ZWDA 2I54A 2H29A 3W06A 4Q15A 1QJ4A 1E4VA 2DR0A 5CVCA 1GOTA 4YMIA 2GPBA 4CCSA 4J6EA 5F9MA 3WBFA 3VDNB 3CJQA 4CIBA 2QY6A 4RDIA 2VA9A 4RFSB 3W4KA 2V7QD 1UWKA 4N48A 1J23A 4IH1A 2AFVA 2ENWA 3EUEA 1KC3A 2AJCA 3H2IA 3K8ZA 3VKFA 4UOZA 2H2AA 4CNBA 1H42A 2FR1A 1ZQ9A 2ZCUA 2QVZX 4D8VA 2P0EA 2VJKA 4EG4A 4UXJA 4EYOA 2W6CX 1G0NA 3RC8A 3N8GA 5KWVA 5AI9A 3EZ6A 3W3AH 4D4LA 3R7FA 5CCEA 4RZSA 2AN5A 5D5PA 4BNXA 2GF9A 3FWZA 4WNYA 3FNIA 2O19A 1HL3A 4DMRA 4P38A 4ZP1A 2DFLA 2A7XA 2KBFA 4C0LA 3JALA 5HQ3A 1Q50A 1GQOA 1JA1A 1YFLA 2Y1GA 3WJ2A 4B43A 2X6TA 1YSCA 4OEHA 4YCBA 4ENTA 1J39A 4ATNA 5IUNC 1I3CA 1JIVA 1ZD3A 4LF4B 1D03A 1U6IA 1DX9A 4P3YA 4TMTA 1Y1SA 1T8YA 2R25B 4OHMA 5CYFA 5GAJA 2QF7A 3UJAA 5BNZA 3QELB 2E85A 2VQDA 3TXYA 1NJ8A 2D5AA 2Q8PA 2FPGB 3OHPA 4LDPA 3DT9A 4OHVA 1TIPA 4MEJA 4P4NA 3T7JA 3EUAA 2GOYA 2IP2A 3PDJA 5CNMA 4YRCA 5KYGA 3ZHTA 3LC1O 2AMJA 3WO0A 4I55B 5ELXA 1T9KA 4ZGWA 5EHGA 3X44A 4D9NA 2ZYAA 2PEYA 1NBHA 2O0HA 5IU6A 1XJ0A 1NQTA 1V47A 1MHTA 3R3VA 4S35A 4JXXA 1YQGA 4NZ9A 2IHUA 4AMGA 5KUTA 2GQ0A 3O4GA 1XU7A 5JXWA 1Z38A 3QWAA 5KC9A 2QG9A 3PR1A 5B36A 3O2JA 3WQQA 3NT5A 1DT3A 3DDSA 1R8QA 2PIDA 3COYA 3D2LA 3C5EA 3RC2A 3GJ8A 2FLKA 3K5IA 1M0SA 2FR8C 2I5PO 1NY5A 4PHHA 4W5HA 5HDQA 5B1SA 3RUEA 3HYRA 3RSHA 2WICA 1YF3A 4IF4A 1K5HA 1JH9A 3B36A 3D6NB 3LHDA 3AKZA 3ICCA 1AKYA 2PYZA 1GRNA 4FLMA 2ZIAA 4WZBE 1WP9A 4LZZA 1UXIA 3B85A 5C3UA 1TRKA 2JD1A 2PZKA 2RGAA 3K1JA 4X41A 4YDSA 4ZO7A 3AM1A 1ZONA 2E55A 2ORWA 4R2LA 1JAIA 1RLMA 1YE8A 2Z4TA 4MVJF 5GOTA 1Y7LA 2P0AA 4LWPA 3WWPA 5IF3A 2XCIA 4RCVA 3EY4A 4UCWA 5EMLA 2QMQA 1T6XA 1Z7YA 4IRUB 5FA5A 3U3MA 4RY9A 4CKEA 1ZZGA 4KLCA 3O90A 5JMPA 3GLIE 1ZMXA 3EASA 5JCPA 1DADA 1H2YA 5EZYF 4WV3A 1QE3A 2BFNA 5E95A 1AT1A 2FFHA 4QULA 4UUBA 5E0KB 3SZGA 3AIKA 4IQ4A 1HBJA 1I4TD 3HBLA 5FF9A 3DBIA 3OLZA 4RAQA 3EJ6A 4QFCA 5AK0A 3U3JA 2PKXA 2BGWA 1SCUB 2O23A 3F5QA 4BB0A 2NTVA 3PU6A 2Z5GA 3DHNA 2ZKLA 2J9FA 3KZVA 4RE6A 4MTCA 3UH1A 4JJZA 3GFFA 4O4IF 2NZ8A 2ZJ5A 3WWZA 1VDZA 3A10A 3G5MA 2CDNA 2ASVA 4HVLA 3GZJA 3PIIA 1N6IA 4LS3A 3IUJA 4IWYA 4GI1A 1R0XA 2FRXA 2WJGA 2BM0A 2O8VA 1BNCA 4Z9YA 4ZYXA 5DN9A 1H0SA 3C24A 4ZZ3A 5FV4A 1CCWA 1L5MA 2N0SA 2GJ8A 4YV7A 3GJ6A 2EJCA 4E32A 2D6FA 1FNCA 3ROKA 3BD9A 2XDYA 2HRQA 3OESA 2P9EA 4OMFG 5IAJA 4GMHA 4FILA 3PEUA 3U9LA 2F59A 2OCXA 2Z43A 2ZRLA 3ZIDA 1GLNA 1S2MA 1J8FA 1TAQA 3EEYA 4R8KA 1ZSNA 3WLIA 3AHDA 2QL6A 5HUJA 2YQZA 4R05A 3WYNA 1KVQA 2IX9A 1JDJA 1TL7C 4U7JA 1P3JA 1DOHA 3TTUA 2C31A 3JYQA 5J2TA 1TQ8A 2GR9A 3AB8A 3OZRA 1PNRA 2H5JA 3FHCB 4TV9B 1PQ4A 3IERA 4KO2S 2NU6B 2P3QA 3GCDA 2WVJA 4KQ9A 4DQUA 2EJBA 4NU8X 5I7HA 3OPYA 3CO5A 4F5WA 2NXCA 4YRNA 4OOFA 2RGCA 3K09C 2E5WA 2GT1A 3H4IA 1FU4A 1OZAA 3B1JA 5CH3A 4YI5A 3IXMA 3T0IA 4TYWA 3MGCA 2Q6KA 4IWNA 4N5NA 5EUMA 4JLUA 3M89A 3SFZA 3U37A 4KLNA 2A33A 2VPPA 4NYMQ 1KI4A 1E1CA 3AKEA 4QBKA 2V54A 2C8KA 2P2ZA 2H48A 2VHQA 1N2CE 2REBA 3O4JA 2VHTA 4AC9A 4AKIA 2XF2A 1AD2A 2ZRFA 3SHTA 3VVLA 4CIVA 1GAXA 2ZIXB 3BC1A 4NJEB 3MOIA 1GGFA 4D41A 1WIWA 3HBAA 3OFVA 1DHRA 1J70A 3L6RA 4OUKX 4QUIA 1T0UA 1KAOA 1HTTA 1OXBB 4FDMA 1XD2B 5JJBA 3QM1A 3TR6A 5CH5A 3VPAA 3ZOKA 1I5OA 3MWLA 3V7FA 1FP4B 4LDZA 1EHYA 3G0DA 1QQAA 4JJ4A 4YLGA 3SZMA 4B40A 1U2ZA 3PL5A 1NUQA 3ROEA 1Z6PA 3QFHA 3E1SA 1QYWA 3HKEB 9ABPA 2YXEA 3JD0A 1N8TA 1KNXA 2PL9A 2BEWB 2VP5A 3A3NA 2VG8A 4PAMA 6YASA 1UBCA 2CSUA 4XLLA 5JNUA 5EJ5A 2Z3WA 2O3SA 1C0LA 1RAEA 1A9TA 3H2GA 3KSMA 4BWYA 4UFNA 1L3BA 4M1SA 1J20A 3K94A 3MPUA 4HTFA 4KE8A 2OGUA 3GGDA 4KMRA 4Q1AA 3BXGA 4KR3A 1EINA 1DAMA 4YCDA 4IG4A 4IEEA 4CODB 4XDYA 2AQHA 3BDVA 4CMEA 3ZGZA 1GN9A 3L6OO 4MV0A 4F92B 4ALJA 1U3DA 1UWVA 4F71A 3FTPA 1A77A 2RC6A 2ZRCA 3G2NA 4WI1A 4JL5A 5CCBA 1V4BA 3VR4H 1JWBB 1LPAB 3RSCA 3I5MA 4CMBA 3O8LA 1MVLA 3MINA 2LP4Y 2ZAIA 2IYEA 1FFEA 2OBNA 2VN8A 2Y99A 1FUUA 3PK0A 5G0TA 3SKYA 4WBNA 3GEDA 4F96A 3GJYA 2YWHA 4GOKA 3ZS8A 5DSTA 4C3VA 5AUOB 1DIAA 1XZBA 2WIAA 3ZNPA 5KYWA 1BXKA 3H4VA 1HL7A 3FOAA 3H97A 4YP0A 4TZTA 3LP8A 4OJMX 4HC4A 3RS4A 5EHZA 3QWIA 4BE9A 4HWTA 2FN3A 2DPGA 1Q2UA 3G2PA 1YV9A 3QOFA 4YP1A 1ZOOA 4R1OA 4BRSA 1OHHA 1HE8B 3B52X 2VJAA 1UQRA 5JSQA 5JTTA 4KUGA 3K9QO 4XCVA 3BTVA 5AXBA 4OBEA 4BKPA 5HKBA 4KHZA 5IWAB 4D3XA 4WD3A 1P0IA 3CSUA 5L3QB 3GRKA 2E82A 4MQLA 3DE7X 1P9NA 3RDPA 4H0FA 4K46A 4P53A 4DUGD 3OMWA 5K3OA 2GXQA 4QYWA 1SKUA 2BFBA 1WMAA 1N4DA 3W9YA 1PW5A 3WWOA 3TPFA 1Z88A 5IBPA 1TYDE 1JMYA 3AWIA 2FW7A 3EVFA 4R7ZA 2Z8YA 5FKJA 3RYIA 3PJRA 2NZ2A 4A6PA 4F3TA 4GDMA 4D99A 2YMLA 1OFTA 3ZI0A 2BIFA 3W9BA 3WIVA 2QUJA 2VZLA 1YDWA 1TCVA 4MOWA 3FSRA 4NH0A 3TBHA 4YT5A 5BSEA 1JBQA 4LNUB 3UK0A 2PLRA 3ZUPA 2BFDA 2P9QA 2TMYA 1JDVA 1ZCZA 2H54A 2XB6A 3GG2A 3MRTA 1OHHD 1BD4A 5KDOA 1L1EA 2WB2A 1J2YA 2ODPA 1VE3A 2JVIA 3GEEA 4LCEA 4XKJA 3FPLA 5EIHA 3UA4A 1UFQA 3NRCA 1E2HA 1J97A 2GDZA 3W2GA 3WYBA 2PVPA 3E7PA 3DEIA 2YIVX 3UMCA 1QHNA 1LW7A 1VFNA 3M9XA 2C2YA 4IGEA 4KR2A 3SYNA 4B6OA 3K8YA 1GKYA 2C42A 4M3NA 1GQYA 4IDQA 4PXAA 4DPKA 1DUSA 1T5HX 4O4JF 1DS6A 3L01A 4FUQA 1UBUS 3DH0A 3KYBA 3HDTA 3IPLA 5HIIA 1SQ6A 1FE8A 5DCWA 3NBQA 2XKJE 3G2QA 3G9ZA 1CHNA 1TU4A 1DCTA 3V8BA 2QPLA 1WMEA 4I55F 3SZOA 721PA 4E11A 1RXIA 1KPGA 4NMWA 1Q1QA 2QY9A 1UMDA 3RVQA 3BKXA 3DPSA 1E4OA 2CNKA 3A1CA 4L73A 1LJLA 1GZ7A 3O8RA 3WLJA 4DEYA 2Z8XA 3MA0A 2PGDA 2R1TB 4I5FA 3IX7A 5ENDA 1FPQA 3I72A 4GYKA 3BSSA 1XZEA 1CJVC 3D3EA 3CR7A 4YK7A 2AQKA 5T8KC 3RM3A 2L2QA 2ZRBA 4MI1A 4DFDA 5KYVA 2X76A 4GRIA 4Q6BA 4FK8A 1Z3CA 1Q0SA 3IJRA 1RBMA 5MF6A 1T10A 1TD9A 2QRGA 2XNKA 3DS8A 1DAIA 2ZUFA 4G8JA 4D0GA 1T1GA 1JDTA 4KNVA 1CEEA 1DKLA 1NN0A 1OYYA 2WIKA 3GGSA 3SEQA 5CA0B 5HYVA 1F2TA 2BISA 4NECA 1KY5A 3SAJA 4CM3A 2QW1A 3BGSA 5CDFA 3OE1A 4IKPA 3TCNA 1KAHA 3T7DA 3M4ZA 4A23A 1G8HA 2FRDC 3TSZA 1NDUA 3HPQA 1T3SA 1Y42X 4PZZA 2X1VA 3H11A 1CY7A 3D8NA 3D59A 3DL2A 1H69A 1Y3CE 4R0VA 4E46A 4C4PA 1ID8A 1OT3A 1ZXLA 4XTCS 3TNFA 3UMSA 1H3NA 1SHLA 1VLLA 2G9NA 1C1DB 5ALGA 5DLDA 4I1YA 4DR7B 5JH7F 3A9TA 4TROA 4IQ0A 2AQIA 4NMHA 1W9HA 2CB9A 1K8YB 3EG5A 3OLVA 2IITA 3IQHX 2BJHA 3FB4A 4IJVA 2HMYB 5CG2A 1CC1S 5EPUA 3EZ7A 2WWYA 4E13A 5KI6A 4DQDA 1VRWA 2V7WA 2A35A 2YXNA 3EEBA 2VCYA 1JIIA 1NVKA 1S1MA 2I6TA 2VJMA 1X1AA 1NE7A 2W6ID 4GH5A 2QUIA 2CXOA 4PF1A 1GSOA 4YAGA 4YXWD 1SXJA 4KE6A 3WLMA 1LLDA 4B3JA 1UJBA 3EXHB 4ASUD 5LXTA 4BX0A 2BR3A 4LXGA 1FL9A 2HAEA 1ZWLA 4CI9A 1DU4A 4X1KA 4DWVA 2ZCJA 1OKKA 4XLZA 4IDPA 2D0OB 2I33A 2ZYVX 3TTSA 5JSUA 2F67A 3SBXA 2FX2A 4NK5A 5GONB 2IH4A 4EUSA 1VCNA 3ZWXA 2HK6A 3E9EA 4PSKA 4PLGA 4F6RB 1B0AA 3CXUA 4MS1A 1AMNA 4N5HX 3CXRA 3B82A 4E14A 1NAIA 2CZCA 1XALA 1XJ5A 3PD0A 3E48A 1WW2A 4IVNA 4N18A 4KLAA 4HTFB 4ED9A 4UEWA 3B8EA 1R4AA 2ES4A 3PWKA 4K1LA 4LJSA 4R0MA 5KWSA 2Q5LA 3INNA 3Q3JB 1VMKA 1XA0A 4JBHA 1M34A 2UYOA 3SX2A 3ZOZA 2ILTA 3P9KA 4P7GA 1PN3A 2W6JD 4CKBA 2PRIA 1BHQ1 1WVGA 4N3AA 2VP9A 3VQTA 5A62A 5I4KA 1N0WA 1XT6A 2JJMA 4CLOB 1PG5A 3MWDB 1T13A 4ODIA 1IBSA 1LPBB 4RL4A 1JBEA 1PUXA 1CKEA 3MINB 3EH1A 2JA1A 2QRMA 3FKJA 3BBPA 2P9YA 1LU9A 3KU4A 4B8YA 4QGSA 3G0OA 4GI5A 1KQGA 2PXAA 1MQ9A 3OKAA 5HKAA 1Z2CA 5LDHA 2FU5C 2A2ZA 1FW8A 3BEOA 3EF1A 3T7IA 4PGMA 2VRWA 1CIPA 1E9DA 1C3OB 1K7FB 2OGZA 5JVDB 4CT5A 2GJAA 2VPQA 1GG8A 2W9XA 4D3SA 5C0OE 1EVKA 1VTKA 3N3AC 2C9BA 2R751 5G41A 4EHKA 2EWWA 3IP6A 2HJSA 2VJYA 4ZJPA 1SCIA 2WZQA 2IKQA 3LRTA 5AVZA 3ZKWA 5EEGA 4UNRA 4ZXFA 2ZJ0A 1ENZA 4YS6A 3VR3A 4HLCA 4ZCRA 1O1YA 2WFLB 4UE2A 1I6MA 3CPEA 3TLJA 4BKRA 1ODCA 1W2GA 5F12A 3ELYA 1L7RA 4Y6OA 2QL7A 1AQJA 1K06A 2NT3A 3VNQA 1Q0HA 1PG0A 1ZBQA 3QU2A 1F8GA 3KU1A 4RTLA 5HP4A 4GOXA 4XUCA 4LHXA 1EGAA 4MS4A 1R9JA 4K9DA 1JR3A 1MXFA 4FYIA 2W5UA 3CZAA 5EXXA 5TJ9A 3TW4A 1NVUQ 2GN2A 3AL3A 4V3BA 1ZMOA 1W36C 4MI6A 1YQUA 3BFPA 4GMKA 4YRTA 3T3DA 1HY3A 4QJ4A 2UAGA 5EZSA 1S2DA 3M6MD 1JQ3A 3HY6A 1GD1O 2C92A 3E9RA 4HTAA 1U3TA 4TN5A 4AX4A 2J0QA 2WYUA 2N46A 1D8AA 1MAUA 1ZK1A 3FDZB 3SQNA 3W79A 1Z26A 1L5OA 1OXXK 1UBHS 5GONF 1UM8A 5A05A 3V6MA 4TS1A 2J3JA 2BHLA 2DQ4A 5FQNA 2DJ5A 3UZUA 4ER5A 1NW3A 4IXMA 3I58A 4FWTA 4CN9A 4E09A 1K0FA 5HZMA 2Y1XA 2QG4A 3M3HA 4HXEB 3ZGYA 2V7EA 1KZYC 4D8YA 2PUCA 3ZS9A 2IHBA 2N47A 3GLFA 3VDMA 4EI9A 1TEZA 3E84A 1D2GA 1WM1A 3UJPA 1JU3A 1X42A 3EYAA 3OFKA 5FL7A 1KQ3A 1MAAA 3QWFA 4D9HA 5CLIA 1DV2A 3G49A 1UK6A 2EJWA 5B2ZA 3HLTA 1CDEA 5JT1A 4YJ3F 2QV7A 1L7PA 2V6JA 4WSOA 1V9SA 2NV0A 1I10A 1RYBA 2C96A 2BFFA 3IVMA 1PWEA 2IBTA 1PZHA 2C00A 1RFGE 1GSHA 4J2HA 2E89A 4OYHA 4QQKA 4E03A 5KHLB 2G9VA 3NTRA 1VMAA 4MYCA 1V7CA 4MVJI 2YFQA 1IBRA 3IGFA 1U3VA 1OZGA 4TLMB 4C01A 2Q4RA 2D0PB 3QH4A 3K73O 4JEHA 2HX1A 1CQPA 3K20A 3VR2A 4UUNA 2R0QC 1TYZA 3B3QA 2Z8ZA 1T3GA 2VNIA 2H2DA 2GA9A 3F2IA 3HP7A 4NMMA 2DH6A 5IJZA 2VYVD 4X66B 2QXYA 1V8OA 3CCBA 4MH0R 4E3WA 4K6MA 2P4EA 2VYQA 1CDZA 2O8NA 5FBQB 2NO7A 4YJDA 1QQBA 2JAHA 3OQHA 2ZXUA 3VOAA 5ALOA 3UEOA 1E3SA 2IQ5A 3ZE6A 1AMOA 3MTJA 3AVVA 4LRTB 1VP9A 4ALKA 4RYDA 4NEHB 3A4YA 2IEGA 1R4ZA 3FZQA 3V4ZA 2UVDA 3GRVA 1AO0A 3D4LA 2O2DA 4DG8A 4MAMA 3I30X 3BSFA 3NYWA 4HDRA 1RPZA 2JCBA 1G6Q1 3TNDA 1W85A 3LDGA 2FMIA 2XWJI 5HIJA 2BCGY 1P1JA 2C03A 4LXXA 4ZAZA 2VKQA 2JK1A 3PEVA 1L7DA 4J76A 1QMPA 2H9IA 4JOCA 2VJMB 2EATA 2RGUA 1W0KD 3C3JA 3RBAA 5HKKA 3FX2A 1E99A 1ESEA 1I33A 1R4MA 1QGOA 1Z68A 2D5IA 3ELUA 1YU9A 2RGBA 3H1EA 4Y7CA 5F5NA 1E3JA 3KEQA 3KXDA 3SDBA 4B5KA 2FGJA 3ZU3A 1GAWA 4ETMA 2P79A 5HZHA 1TE2A 3DE2X 1SEPA 2VTDA 1S1CA 3DZBA 3OZSA 2ODNA 4FZ5A 3TVYA 3V8EA 3ZU4A 3B6EA 5FPPA 4WOPA 1U0FA 1XFDA 2JKZA 3TGWA 4ASUA 5IK2D 4G4GA 1E2MA 1UK7A 1IY1A 4LOIA 3KQQA 1OMOA 4MK4A 5FTNA 4G1MB 1Y1TA 5G0SA 2H2HA 4L27A 1N6PA 1SVUA 4R01A 3BL5A 5G4KB 1HDIA 1QZ3A 2C1EA 1V4NA 3MCWA 3NI2A 3OWOA 4OSPA 3TW8A 2QORA 5ECWA 3O4FA 1SHKA 3E58A 2BZ1A 2ZI3A 1AHHA 1WVMA 2HRZA 5AWFC 1DQNA 5GIPE 2VP2A 1YOBA 1PGNA 1QHIA 3LYLA 2HQ1A 1YIOA 1US8A 2I2BA 5EJ7A 1UQTA 3Q0TA 4M22A 1DAFA 5JFOA 4OP1A 3HDGA 2AJDA 1FVFA 3TR5A 5DHAA 3EAQA 3OSZA 1Z5OA 3IQXA 4ZMBA 1ABFA 3GFBA 4XYMA 3H5VA 5BSHA 3W5BA 1NGSA 2BKAA 3N6VA 2B5VA 4MXDA 4BO2A 1IC6A 1LDBA 1XHEA 2EGHA 2NT4A 4KQWA 5EIWA 4B4UA 3RWMB 4E30A 4CM9D 2W8ZA 4MQEB 4D96A 1P7YA 1R5BA 4R0NA 5ALYA 3UHFA 4B6QA 5JH7B 1NRWA 1TJYA 4G5QA 4BNDA 1E9BA 1SGWA 2XNDD 4KXWA 4A8JC 2HSZA 4WZAB 1TT7A 4EELA 2NU7B 1V3VA 2WJ6A 4C4TA 3OIUA 2FDCA 2BJWA 2C4NA 1PQUA 4P5EA 5ICMA 1C3JA 4PYRA 4G5HA 1N0HA 1NBWB 1O95A 1XAGA 4XQ0A 2YOHA 4DA8A 5KEIA 2F4NA 2RGYA 4RLHA 3DVLA 3UN1A 3R5HA 2JLYA 2IZ1A 2OGTA 4KHPB 3N28A 4DCSA 4NWIA 1DC8A 1TO2E 4QTYA 5EYPA 4P34A 5MFZA 3VNVA 4FMBB 4FHEA 1HX7A 3OPQA 1T1SA 3K72B 4TKUB 5G40A 2HQOA 3DYVA 4Q3KA 1WX1A 2H4YA 3FMIA 3FUXA 4AROA 4BVFA 4BEBA 2VZEA 3OJOA 4PR3A 3RU3A 1FX0B 1UJ5A 3WKBA 2PT9A 4G8BA 4G9EA 4OHWA 1N8NA 3AW8A 3AFNA 2BSQA 4DDKA 4LPKA 2JI4A 4LGMA 3UH0A 3SJAA 3U31A 5KKCA 4JLPA 4KC0A 2GYYA 2ZXEA 2B35A 4G65A 1K08A 3G6KA 4D45A 2A67A 4D0NA 1WO8A 5DX1A 4BN0A 2A1TR 3ODPA 2DCMA 4RHCA 3C5CA 3HACA 3FUCA 3CA8A 2VYND 1G18A 2OA0A 2C0PA 2OVFA 4AZWA 5ILOA 1FBTA 4CEJB 3T3NA 1EJ2A 1V9CA 2X5KO 1NJSA 2JGDB 3HABA 4J03A 4KN6A 4PW0A 3V8QA 4NXNB 3SS7X 4J91A 1DWUA 4H17A 2VHYA 1U99A 1XZPA 3ESYA 3TG8A 1I3MA 2I2FA 1Z34A 1G8MA 4CETA 2BAGA 4BGEA 3ER8A 2FPLA 4R7GA 1WDLA 3VSCA 2RHDA 4KI7A 5DZSA 4RGQA 3SJZA 1GPNA 5IKEA 1B1CA 3USES 3DTTA 1FP1D 3FFXA 3MEQA 4UHEA 1NLFA 4P92A 1FSFA 1U28A 2OV3A 4IRMA 4MVWA 3K6SA 1AE1A 3DBRA 5EHIA 4EJ0A 4R3WA 1ANKA 1EP9A 2YY5A 3V8RA 2WIGA 2Z1MA 1PR3A 3WISA 4AMZA 1DKQA 4DLYA 3FNQA 3UJDA 1EFDN 5GTDA 1Z0JA 3F3KA 2HA6A 5IT0A 4HH3C 1S96A 4XX0B 2I3GA 3H18A 2FQ1A 1GRCA 1KU6A 3R44A 2XCRB 1R12A 13PKA 1WXGA 3S1AB 4IKOA 2OCDA 3CTPA 2VT6A 4DSNA 1UH5A 5C5DA 3GLQA 1OH6A 1CR6A 4P84A 3UXMA 3UWKA 4BNGA 5C18A 4UTNA 1XP8A 3EZ9A 1VHWA 1VIYA 3I9NA 1SMKA 4ZZ2A 1QIDA 3ZWWA 2PANA 1KSHA 3LQ2A 5C8YF 4MDEA 1AC5A 3ZY2A 1AMUA 1ZJYA 4V1CA 4F2WA 4ZOQI 1NJ1A 3LBIA 3OZAA 3P9QA 4JYZA 1IBMB 2RB4A 3OM1A 5FADA 3TWOA 4EM6A 4F5DA 1EG7A 1VYTA 3KK0A 2PO5A 4ROSA 2X19A 3KC2A 3C6QA 5D3KA 4S1TA 1FTSA 1LDGA 2JBAB 3DA8A 3NG1A 4JK3A 2EEZA 4GW3A 2WJVA 3OLYA 4V2UA 3T3PB 5CD9A 4CLRA 1UXKA 5JANA 3LUDA 4J16A 2WLTA 4FINA 3TDMA 2V98A 4AFNA 1KH3A 1ND6A 4LTMA 4XGRA 4E1AA 4OM8A 5A4AA 3AF6A 3W3ZB 4FZJA 1RRGA 3DUFA 1X1TA 4XQEA 1WXXA 3DB2A 1P33A 3EZYA 4DCMA 4NATA 5TQ0B 4V0OA 5FH9A 2YJZA 1E9CA 1FNMA 1OGIA 1X8KA 3E18A 1P8JA 2KQUA 4RY8A 1XQVA 4B83A 4TVKA 2WKSA 5C53B 1Z4QA 4R8VA 1V5IA 3LQ4A 4OXQA 3V1TC 2F8LA 1E7YA 4WK2B 1DIGA 4RK0A 5KVVA 1GGHA 3FSJX 4LYEA 4D97A 2NQ2C 5BT8A 3U9TA 1E2QA 3QF4B 3EK2A 4DIMA 4D92A 2Y68A 1JDSA 1U3GA 3KJFA 5GINE 2GBLC 2C5SA 1RS0A 5FLYA 4PX5A 4E5YA 1I32A 3H1TA 2WJWA 3B9PA 3UY4A 1JR2A 4OQEA 3FYUC 1IN5A 1CQWA 2PQ6A 5ECDA 4BVGA 2GEVA 1SHUX 3TKLA 3VV2A 4DL9A 4DMKA 4KN8A 2JASA 2JLBA 3Q7QA 5K7SA 5EUCA 4RD6A 5EVJA 1F0PA 3D7SA 3EARA 2HPAA 3AF1A 1G5FA 4BB5A 3WOVA 4C20A 4JGIA 4YAIA 5IFLA 1N1MA 3B51X 3KYCA 3KXKA 1PZXA 4JFAA 1H0HA 1RWWA 2B4YA 2IA5A 3TIIA 1O87A 2IEAA 4FEYA 4QDOA 3TI7A 4CZ2A 2FPSA 2VPTA 2WWIA 3AI3A 3DO8A 1KEZA 2YFYA 4Y0NA 5M34A 4FR5A 1Z0FA 3AEKA 3CZRA 3ZQ4A 1FPMA 1L4BA 1M6VA 2AR7A 2ZSHA 3AEUA 3AESA 2DLNA 4KKXB 2FX3A 2CNBA 5L45A 2CVQA 3B3AA 4YCAA 4KVAA 1U5BA 3N3BC 1MB0A 4LOHA 3T1NA 1RQGA 3ZDQA 4QG3A 2KX7A 1JFSA 3CLVA 1RCUA 4DIBA 5KYKA 1I2DA 4MUNA 1C30A 4DB2A 5EQDA 5IZ4A 1TTQB 2NYRA 3HNOA 4GPZA 2FOIA 2WI8A 4MDFA 5CPFA 2VDRB 2R8XA 3LA6A 2X0EA 4BEVA 4C0SA 4CDNA 2CKMA 3U26A 5C51B 1YVRA 3LX6A 4YX9A 3R23A 4F5YA 2HBRA 1GVNB 3DP7A 5AOBA 4EGSA 4RZ3A 3X2SA 5M04A 4X65B 1N32B 4LGCA 2GM9A 5M5BA 3GZNA 5KOJB 3V4RA 3K9NA 4KPYA 1G2QA 1QHXA 4UZEA 4B75A 2GPAA 1FEZA 4TYPA 4WLUA 4FC7A 5J2TB 3I6YA 1JG6A 1D4AA 2X0FA 4HWRA 1M75A 4CE6A 2GUGA 3I32A 1C9DB 2VOJA 1ZUIA 3HMQA 3IIMA 2OCBA 3O9MA 5DCYA 4AN4A 2XD4A 4MCJA 5EYPB 5AIBA 2Y4OA 2WC1A 3TFWA 2ROQA 1GUFA 2XDAA 1JU4A 3K1ZA 3NHYA 1NVMB 4YRJA 1YACA 2C5BA 1GFIA 1Z82A 2JIBA 2QKYA 2VI5A 1RXEA 2WYWA 2AR0A 2WINI 3R2JA 3ZBTA 4IWXA 2VXCA 5BN4A 5C8DA 1WLSA 1IWOA 3ENNA 3HJCA 1NSYA 5JI2E 4IMIB 2YV1A 3KWMA 2GK6A 16PKA 1IY9A 3QVWA 1ZAKA 3V00A 1JLRA 2DHQA 1IOWA 5GV7A 4Y6LA 1Z17A 3PFHA 4HX5A 4COOA 5JXHA 3IAEA 1XQ9A 4C21A 2I9PA 3G8BA 4QTXA 1KI1A 5AHOA 4QPNA 1F8XA 3P52A 5JNVA 3RTCA 3PX2A 4U5XA 1EVLA 4AO6A 4C0WA 2RB5A 1CE8B 3LT5A 1R18A 4UHJA 2ZRNA 5CB4A 3LX8A 3OBIA 4P2GA 3RTBA 4Y6GB 1XL0A 4KBGA 3LOQA 1J0CA 3U49A 4B33A 5CD1A 1MABA 1QHFA 2CDCA 4B0PA 4KAXA 2DULA 3E2PA 1I0IA 2HI0A 3H13A 3LQFA 1V11A 3HR8A 4QPCA 2BEWA 1X77A 2ZS7A 4FI3C 3BMQB 4HRVA 1W0JD 3DMRA 4L16A 1RZRD 3IELA 5IPFA 1KDTA 2VK4A 1Q7BA 1IY8A 2GZ2A 2WHQA 3A58B 3HDHA 4BFCA 2QN1A 3K6SB 3DBRB 3FN4A 5A06A 5BR8B 1DGQA 1S4MA 5CIWA 3JQQA 1PGOA 2WY2D 3CMMA 4RK4A 2R6ZA 1Y1QA 2ZFUA 4YT8A 3AUYA 3IDQA 1XKLA 3G2OA 4R2HA 2X40A 4QU8A 3PGKA 2YIJA 3TAHA 5DLEA 2AOWA 2IXDA 3HTXA 2Q21A 3ONDA 3ZIUA 3JAWB 3RJ5A 5C8YB 1ZFNA 2P30A 2WK1A 2FY8A 5GMOA 3FDJA 2CHGA 4P7BA 3RBZA 3QX3A 1XWWA 1PQWA 4TVSA 2HCTA 5DM70 3R3XA 2H7YA 4MB2A 4QGFA 5U4QA 5IDWA 3B1KA 1G20A 3GGPA 3H5LA 4GL4A 3UNXA 4U8GA 2XBUA 2BELA 2NADA 2G9UA 5IKPA 3ZX5A 4AUNA 1SHTX 2IXEA 2JNWA 3Q6NA 1V6CA 4Y2UA 5AW3A 3PUHA 4KR6A 3Q3GE 4QGGA 1QVAA 4NDAA 5DM0A 1SKBA 4AO8A 2GCOB 3AJ9A 4UMVA 3FOFC 2K2QB 3NHRA 3HC7A 4GWGA 4R51A 4RJTA 5HM6A 2PVCA 2Z08A 3ESRA 1EGQA 2O2XA 4H1TA 4KN9S 1TIBA 1K7CA 1U02A 2CXRA 4IX9A 1ORWA 1YO6A 3FCAA 2ST1A 4LSZA 3DOFA 3Q8XB 4DOMA 3LPNA 4ZT3A 1IQ0A 3IULA 1J0XO 3CTMA 5DV9A 1FYVA 1RXCA 1O8BA 3C8DA 4FFLA 4ZREA 1OI4A 4Z51A 4MPPA 2BHNA 2NUAB 2NP6A 1OTHA 1DIHA 4MW1A 5KU7A 4C78A 1R9MA 2V7VA 2VYCA 5CBKA 3D3JA 3BAZA 4B3TB 4LTNA 2VXYA 1D1TA 2BLNA 1S3GA 1HOTA 2HMWA 4TMWA 4G84A 4JEMA 1K7EB 1N57A 4CV2A 5DGDA 1M33A 4XWWA 3VHXA 4OO3A 1W93A 4LNUA 3DFIA 4LWZA 4R1PA 5JJCA 2WMYA 3IPRA 3RK4A 1PIWA 2EAUA 3H87A 2NU9A 5A3QA 3G0GA 1NX6A 4UNPA 4XPIA 1GTRA 1BWQA 1NFFA 2R47A 4F8JA 2MIIA 3EF0A 1K66A 1W29A 4FD2A 1A2BA 1HI9A 3QZUA 1R3UA 2HNBA 2WA2A 2DWOA 5I7WA 1VL0A 2AMFA 3ZWNA 1ZD1A 3A1UA 4IEFB 3Q3EA 4D9BA 2HW8A 3OTGA 1VE6A 3LKDA 1X80B 1KVRA 1T9BA 1CYDA 2I71A 3GCGA 1KF0A 2BFCA 4K9PA 6NULA 2HADA 1JQAA 3YASA 2OV2A 2JGFA 4N40A 3WL5A 5KS2A 2FUEA 4UASA 4US0R 5EESA 3OKPA 3L79A 1Z36A 4LAFA 4F2GA 1SA0B 5BWBA 5GP1A 2CGEA 2XWSA 4M9ZA 3ONFA 1WULS 2WVAA 2F6RA 4HDNA 3UB3A 4CXMA 4AY6A 4XIYA 3OE5A 2VHJA 5IX8A 2QX9A 3B53X 4ALIA 3TSOA 5LQMA 1U5BB 3VSDA 1Y4UA 3NIDB 3NHPA 3QMPA 1SULA 1ZM9A 3M82A 1RRPA 2NGRA 2RHCA 5THQA 4UU7A 1A72A 1F8FA 2PIAA 5JDCC 2Q4DA 3PRHA 5D6OA 4GGMX 5LYYA 5EIXA 1YR8A 3PE6A 2I6UA 3TLGA 3W5HA 1M73E 3HU3A 3WLEA 3HA2A 1F2TB 4X85A 2HM7A 3MAAC 5EXTA 4XWOA 1DAPA 3P26A 4EY8A 2CBGA 2G67A 4KL8S 1MO6A 1RXYA 5HW0A 1MH1A 3BBLA 4BO8A 2GAJA 2C1XA 1I7LA 3OUTA 1YZVA 3RIMA 1P77A 1ZGJA 4LNHA 2K7ZA 2C84A 4L4XA 3OEEA 3IFSA 4WJKB 3MTAA 3CLRD 1LH0A 3AERA 3U4CA 1DC4A 4PX9A 2GPYA 4C7JA 3VX4A 1SC4A 1NM5C 5EZQA 4W6QA 3PDWA 4ACBA 1USIA 4X7BA 3N0WA 4YXWA 3T3HA 5C46F 2IYOA 4RTNA 2MSNA 2OHOA 5IC5A 4YNBA 4Q4LA 4C7OB 5EZ5A 1TJ5A 2HUPA 1UCFA 3FGNA 1XF1A 2AXEA 2PL3A 2YV4A 1EIZA 2B4TO 2VCHA 5GJVC 3RIEA 3M9WA 1P3Y1 3S7ZA 3A06A 2R2AA 4MCIA 5HRAA 1FDIA 1IYZA 4CL2A 2V9ZA 2RG7A 4DBVO 4H3SA 3JD1A 5JZMA 1GDDA 3DB1A 4S1PA 1Z5GA 4G63A 5ICCA 3LL4A 3DQZA 2QRJA 4IMRA 4MNTA 1ADFA 3EC1A 4BX2A 3ES9A 3EXHA 3JWEA 1WHSB 3SG0A 4JP1A 3FTEA 5FPYA 4E15A 5KHOC 3FE2A 1DXYA 1EZ1A 3HCOA 4YAUA 4DIFA 5JECA 1KO7A 5TV2A 1U7UA 5JS2A 4IYRA 2OO7A 2IDJA 1D2CA 1K88A 3SFVA 2VP3A 4Y2JA 3UT5B 1CNMA 4EQ6A 1AKRA 4MUIA 3EBOA 3F6BX 3VJRA 1Z0ZA 1MG0A 3KEOA 4KQ1A 5F4BA 5K03A 5AW9A 3EPHA 1CUAA 3UGKA 4TTJA 3QY0A 4F6RA 3SZRA 2NNLD 2GBIA 3RBVA 2XUDA 1KKMA 2FEKA 2PH1A 2V58A 3EZGA 4N5LA 1S2OA 1W35A 1KO1A 2IEIA 2WWRA 2ZPAA 1BWRA 4J4BA 2BCJQ 1XDUA 1MOSA 2RK4A 5B6JA 2P65A 4TV9F 1T35A 2QWXA 1USUA 2NVUB 1KDOA 2OQ2A 4RVCA 1JKMA 5KQSA 3HR4A 3PXCX 4QSMA 5F7XA 1QQ6A 1AZTA 1Z2AA 3IVRA 3W5VA 3AZOA 2EJVA 3GEGA 3ZWMA 3N7TA 1OLOA 3A7DA 5ISMA 3MQFA 4NS1A 5HBRA 3TSCA 2X77A 4JKIA 4WY5A 3SQLA 3TSWA 1B6SA 3RD5A 1A9SA 2FPMA 5CFOA 4TTVA 1JEJA 1DVRA 5CMLA 4D4GA 2G7ZA 1DQYA 1H8HA 3VHRA 1N75A 1RM0A 1Y6RA 2J7PD 3GZ4A 1ECFA 4U3JA 4XEHA 4YRDA 1UXOA 2R5WA 1NASA 4X8LA 3TMAA 2NO9A 4OXNA 4ZIRA 2HWYA 3VC3A 1XMPA 4D42A 2IGTA 1ZVVA 4DANA 3HE3A 5FWYB 5TR9A 2CKDA 4ZYUA 3FW1A 3VA7A 5K8CA 3PX3A 3K96A 3S55A 4JL6A 1VIAA 2PGLA 2QU8A 1XCLA 2REQB 3B48A 3MJRA 4GX5A 4HLQB 5AVVA 5KOHA 3H5IA 4RV4A 1FTGA 3A1VA 3IUNA 3KSAC 4US1R 3CX3A 1L4HA 1PBNA 4EJFA 1YR9A 2H1VA 2C07A 2WPNA 4JJ6A 3TLYA 2JL1A 2PBLA 3R09A 1AZLA 3K15A 3KTAB 3N6RA 1L4UA 3ZZ0A 5IHPA 4JAVC 1OA0A 3P27A 2ANCA 1RWMA 2GM3A 4IJUA 3LVQE 3GLFE 3JXEA 2XZPA 3GEHA 3B3GA 3X1WA 1OE0A 1Y7TA 1CFZA 4HXFB 2X42A 2A94A 4MS4B 1X39A 1XZFA 4G5SA 1NPDA 3IAFA 3RSFA 3T1TA 3KB1A 3KPVA 4JSRA 1HF3A 1XIVA 2OM2A 4EPRA 1S7CA 4RMGA 5IM5A 3WIEA 4H7HA 2ZI9A 4NL4H 3RABA 2IXGA 3H75A 4JYPA 2B6NA 1J42A 2HJHA 5FBZA 4QX6A 2NU9B 1ZINA 3D4OA 2BUCA 3VOBA 2WG0A 2E87A 1Z7BA 4R1SA 2DLDA 1O6ZA 3NX4A 1QCDA 5EGNA 2VP0A 3QBJA 2IU0A 3R0ZA 1K86A 3TECE 1YS4A 1Z07A 1DLJA 1GAEO 4IV0A 1QGAA 3ICPA 1TEXA 3H1PA 1W94A 2QYSA 3MWJA 1PJQA 2BGIA 2V5UA 3PFWO 3ED5A 4R8RA 2COKA 3G23A 4EWLA 3T1HB 3HSYA 3WB0A 5KYXB 1EFRD 2C9OA 3RI3A 1ZVQA 1NMEA 2W22A 4AT1A 5JAMA 3RCBA 1B8VA 1JT9A 3P2OA 1I2MA 4UJ5A 2D13A 3BFJA 4Q00A 4QPZA 1KMMA 5CT9A 4N47A 2IHNA 2I65A 4DHEA 3RVOA 1T26A 3OQOA 4ZQCB 3KT6A 4AL4A 3TM5A 2Y66A 3JARA 2JGKA 1KVUA 1KZGB 3AU8A 4N0QA 4PIVA 3M1YA 5HK8A 2QSYA 3A28A 2QTAA 2XF8A 4HGZA 3O95A 3K31A 1S2NA 1WCWA 1Y6QA 1ZDMA 4M55A 4TTAA 4WUTA 3ZWBA 1Q6YA 3UGQA 3O82A 3QYPA 1NU6A 4A8PA 4N5IX 1SBZA 1CB0A 2QT0A 2JEOA 4IHJF 4ZRNA 3UWMA 1DXQA 1EUDB 4G4SP 2BE7A 3H2SA 1VL6A 1JXQA 4M2LA 2HF8A 1Q0TA 4URFA 4JKOA 1RRFA 1O6FA 1NMYA 4LNAA 2DE0X 2JZOA 5E2IA 4AICA 1XRRA 5TPWB 2XRYA 4L4RA 2I9KA 5LP6F 4KO3S 1RVDA 4ADSG 2BBSA 3I3SR 1EM6A 4WIAA 3AJRA 1P61B 3L4SO 4FI3F 1T5SA 2XI4A 4NBVA 1ZR4A 2OFPA 3QU7A 1NNI1 1U0LA 1V6AA 5ALHA 4RMNA 2P6OA 1R5NA 1NVDA 1HT2E 1P0QA 4IJ6A 3JY6A 2DTDA 1LNSA 1WDWB 1VL8A 5TGDA 3S1LA 5L3ZA 4EG5A 1N6LA 1JSXA 4EY7A 2RONA 4GI2A 4BLTA 4C7OA 1L7OA 3HR7A 4OFWA 3S28A 3A2MA 1EE1A 4MV6A 3PENA 1QP0A 2GPTA 2XAUA 4KIWA 4MS3B 4ZAFA 1P72A 1Z4OA 2V45A 2C9YA 4GE0A 1JG2A 3QMWA 1HNWB 3G0CA 1GPDG 3G3EA 5F1OA 4CL0A 2YV2A 3M5PA 3MLEA 2RH8A 2XDQA 2IEYA 4B3HA 2BKVA 2EFDB 3IUSA 5DTEA 3THSA 1AQUA 5FEUA 1FF9A 4YJHA 4BCCA 4GEGA 2X6QA 2QA5A 5DNYB 2ZJZA 4JYAB 3PVSA 1EAMA 2JEZA 3GO4A 1G3MA 5B3AA 5SZHB 1DE0A 4PSVA 2HA5A 2JLSA 1Q20A 1SU4A 4QM7A 4B84A 1D6NA 3LGAA 4LSWA 5UKDA 1XMXA 5AI4A 1Q0UA 5AH0A 3KSRA 1NWHA 2C2HA 2ID7A 5C35A 5IEJA 3U40A 4JQOA 5DW0A 3NKLA 3GJ3A 3V1UA 1B6GA 2WU4A 4RCZA 4DEVA 4HFRA 3AETB 3BJRA 3OCUA 5H4GA 3E22B 3F8SA 3EQZA 1U1GA 1ZITA 4HRAA 4LOKA 4ZO8A 3ZZTA 5HG0A 5ES3A 2JFBA 3TE7A 3JQAD 1NL3A 1EP3B 3W8DA 1E79D 2TMGA 1CZKA 2O20A 4QEZA 3RHFA 3QE9Y 3AXTA 2ZAYA 3WRWA 2PUJA 2FQWA 1DO0A 2FPXA 1R1DA 2CL0X 4RPHA 1PS9A 2R68A 4ZVKA 4I55A 1WDTA 2RKOA 3RFVA 3S2GA 4V0QA 5JH7A 3CRRA 1N6OA 1ZU4A 3H2KA 4FYHA 1URPA 2DUNA 3EIEA 2B3TA 1G291 2LPMA 4M0DA 4P2BA 4LMPA 3GDHA 4BPRA 1T24A 4LSMA 1PJLA 2LXNA 1GG2A 3AJEA 3D6MA 1CS0A 2FPPB 2H08A 4UM9D 4TYYA 1JV2B 4C0HA 3KPJA 5IKMA 5A6SB 4JLJA 1OFHA 2CFIA 4KEAA 3IQEA 2V3WA 3LV8A 1BS9A 1EESA 4RM3A 3UB4A 4CQMA 2HXYA 3I8SA 4JQSA 2V4UA 3R41A 4UEQA 1S9DA 3EDOA 4H7PA 3VR3D 1W36B 2GO7A 3BGDA 3VPXA 2GLUA 2OBYA 2XVYA 3VU9A 1KJYA 3VMFA 4DMGA 4EVQA 3NHKA 1ENYA 2BEUA 4GPD1 1YNSA 4MQUA 1OBHA 4AG5A 2H0RA 3T9EA 3ANMA 1F5NA 1G5TA 1GG9A 4IIHA 4S3MA 4C5CA 2CZGA 1HWYA 2K2WA 3GLHA 1OU4A 4V03A 3OQMA 1R4NA 1BU5A 4RCYA 2I91A 1GZ4A 1BXRB 3FYUB 5JS6A 5LQKA 1YMQA 3F3SA 3THYB 3BX1A 2QVBA 3HKCB 3PUXA 3GT4A 4FSHA 4JC5A 1DAEA 2QS9A 5IK2A 5AVXA 5JSYA 1AGYA 1J7JA 3GRYA 4URWR 4KOAA 5DBFA 2A9VA 1TLTA 2R7MA 2GFIA 1OREA 2AG8A 3VVMA 4KQGA 1KEUA 1PT9A 4FMPA 3GUVA 3IHLA 4RQTA 1QDLB 2PSHA 3HRIA 3IP1A 3RUHA 4W4TA 1VE1A 1OQAA 4YFYA 3ZHUA 2HWKA 3PNPA 1CUJA 3N76A 4AJHA 3UCFA 1PF7E 5HKKD 1MV8A 1XU9A 1E1RA 1KJ9A 2C97A 4GKAA 2YIDA 2PUFA 4GYYA 4LJ9A 4JVNA 3JTEA 4QGAA 4TSRA 2W6ZA 2A1IA 4G0VA 3DDWA 1DBWA 3L8EA 1YK0A 1VC2A 2DFNA 2JLAA 2LVBA 1JMKC 1QGZA 4OQXA 4R4JA 4BO0A 2HA7A 4DR4B 3IDFA 4BZZA 1Y3DE 2GJKA 4FR0A 2EJTA 2ZAMA 3GGCA 4KMMA 3UQYS 4KWCA 4X7MA 3N86A 5BN3A 2AUTA 2WZBA 5LPNA 1JL3A 3DV2A 4TVBA 4HQKA 1NSFA 2PU7A 1PQYA 2Q3CA 3KB8A 3OZCA 1R0BA 3W3AA 5KNCD 2VAPA 2PJDA 2ONKA 2LV8A 1Q1EA 1G5PA 3CNBA 3CNEA 5AW6A 5JCJD 1F5SA 1TM3E 1E79A 1VOTA 1R0CA 2PFGA 3BZBA 3QXCA 5CFMA 1CR4A 1IXYA 3HB0A 3W8EA 3PKIA 1ZH6A 3M34A 3WZMA 3C4JA 3E3MA 1C8BA 1PFWA 4YCLA 1TF5A 5FUXA 1L5FA 4I6GA 2ZUTA 1Z0AA 2R44A 1HT0A 2R7NA 2YOFA 3IV7A 2M2IA 3PVCA 4WFKA 4D8TA 3WFJA 1IZZA 3LCMA 4WGGA 3VR2D 4AS1A 2VDWB 1G16A 1NJFA 2HPVA 3H7AA 4H1UA 2NW6A 2YL2A 3GAMA 3IUYA 1RMQA 1EUDA 2KLHA 3MMNA 4C4AA 2G77B 4R98A 3JQFC 4UDXX 1Z5WA 2WQ7A 3CNQS 2JH9A 1PV1A 2QOEA 5DWDA 1DMSA 5E4FA 2VXOA 2EFCB 3KFLA 1V35A 6AT1A 2W2MA 1IONA 3PDUA 1U8UA 3KQUA 1NAHA 4Y1FA 1XQ6A 2D0IA 1TAGA 1WMDA 1H1DA 3O8QA 3I6BA 1U8FO 4D9EA 2FSFA 2DUMA 3KQLA 4ZCLA 3ONWA 5AW5A 4PU0A 4R2IA 3TOCA 3GUUA 3IXQA 3UPUA 2GRAA 1NHGA 1ZZEA 3GWZA 3A0UA 4MPDA 4WK0B 2CNOA 2GDJA 3KJNA 4D4HA 4P86A 4CKCB 5D3QA 4C5BA 3CCCA 3NJRA 4MGHA 4CKWA 1ZNXA 4Q47A 4KOEC 1YOVB 4Q5IA 4N9QA 4BNFA 2FHPA 3PZRA 1Q3KA 1MRSA 2C8JA 3UWDA 4BMCA 1GM5A 1MX9A 2ZEJA 2P1RA 4CQJA 4FFMA 2FQYA 1WD5A 4KITB 1T9AA 2H1HA 4MWDA 1G6HA 3H8JA 5GY7A 2P0YA 1DG1G 2R9VA 3JATA 1XD2A 4R54A 5ICEA 1RCFA 1V41E 3LFTA 3RC9A 1BC5A 5HJ7A 2OXEA 3KZCA 2ONZA 4D8UA 3OUZA 2Y9MB 1TUEA 3QF4A 3PT5A 4D98A 3HXKA 2YJTD 2DUUA 2IOQA 3KPUA 1E2JA 3COPA 4BQSA 4BRUA 1JAZA 2XDQB 4MVJD 1A5BB 2D1TA 3HXQA 4ZEWA 3EDYA 1GQQA 1G19A 1VBNA 3OF5A 3SNKA 4OX9B 2G5CA 3EE6A 4F9EA 2HBYA 1VE7A 4M7PA 3U3RA 4B3FX 5K45A 2QIOA 1K89A 3SR4A 5LB2A 1GEGA 3AY0A 3ANLA 1OX4A 4Q3DA 4Q3BA 4O2BA 3B20A 4TSFD 3ZC3A 3BPSA 4EI2A 2FW6A 1WB6A 3EGDB 3FB1A 5BURA 1SH7A 4EOGA 2FZCA 2G9ZA 1M2OA 1QH0A 1RMYA 1VB5A 3PNSA 3ZDRA 2RGRA 2BUAA 2B1RA 1FP2A 4MGYR 5DYYA 1PR6A 1RJWA 3PNYA 4KKVA 4A6XA 4O8CA 4JI3B 2XMQA 3HCWA 3NJ8A 4DNFA 1ZA1A 1W48A 2J3QA 3ILHA 1SCJA 4QUHA 5CTAA 4YV0A 3DQPA 4GNRA 4QA9A 3M6WA 4QRDA 4DCUA 4PN7A 3G2MA 4FNGA 5DK4A 1ZG3A 1KDZA 4O4LA 4FQ7A 5FPKA 2ZR8A 4JCCA 4XM0A 4A8JB 2WWTA 3PC2A 1I4WA 2RIPA 2YVLA 4M21A 5ICGA 3LY9A 3OZXA 4OKIA 4QRIA 3LP5A 4KVGA 4UCQA 5EHQA 3GLUA 2GO1A 5EKUA 2VEOA 2PBZA 4D9JA 4MO2A 1M2VB 2YTZA 2O52A 1CTQA 1LNZA 2A9JA 2VFAA 3F6PA 1PSWA 3FLBA 3WMGA 1RZ3A 3BIWA 3RRBA 4AW9A 2J0SA 1G5IA 1JZSA 1B16A 1NPYA 2BKXA 3S5UA 4RKRA 1QFJA 2XUGA 3ENKA 5FBVB 2P9ZA 2Q9AA 3MNFA 2X0JA 3CH4B 3HVHA 5KWJA 3DEFA 5KOJA 1CP2A 2CVOA 3MT9A 3VPDA 4II3A 2Z6VA 2GYVA 2IBMA 2QTVB 3TBFA 3FLMA 5L3QA 3H6GA 4JC8A 5AW8A 2GFQA 2HUNA 3SR3A 3PNVA 4FIZA 1YK1A 3X3HA 2FN7A 3O8OB 3BB3A 2XUHA 4V1CI 3WIDA 3AEZA 4UU1A 3IT0A 1G8PA 2PRJA 5LZ2A 4BJ6A 4ND6A 1V1RA 3I2KA 2IEZA 3BHMA 1ATIA 3GOQA 1EMDA 3IJPA 1YBVA 4WZAE 3WLFA 4NZZA 2P9CA 4XYLA 4WQMA 1JEEA 1W34A 2E4UA 2FQXA 1N7GA 4ABYA 3FJOA 5I5GA 4PXYA 1F20A 3F71A 4MIYA 4ZCSA 2EERA 4CW7A 4ZK6A 1UBKS 1E66A 1HDCA 4FSXA 2EKZA 1NYRA 4BLSA 3PNOA 2R65A 2IZ7A 3DO6A 3H2ZA 4L9AA 4EB6A 3VI3B 4J2OA 4EHBA 2P35A 3PYXA 3PJDA 4QJ5A 3WLHA 2Y93A 2WIBA 4BNNA 5BN5A 3COWA 4DV2B 4R1MA 1IK6A 1TPZA 4ZTZB 3ITEA 3ROTA 4ZPXA 2AMVA 3RTAA 3B78A 3OURA 2OZEA 2PG3A 4F0JA 1XNGA 1GL7A 3PUWA 3K3PA 1UC5B 1J21A 2WYOA 1UUFA 1M2WA 2WFZA 4QOGA 2GVDC 3V8NA 1HFWA 1AX9A 1GZVA 4Y2RA 4JOBA 5TRTA 4E7OA 3NAMA 3I9V1 3D64A 3U7GA 1YZFA 3HZZA 1PKEA 3WBJA 4A92A 3B9BA 5K8IA 3C74A 2DT8A 2G9RA 1EDOA 1MJGM 3IKJA 4J0JA 2EX0A 1E89A 4RELA 3KR9A 2J9RA 1LQ2A 4FOTA 5GPBA 2CSXA 3Q11A 4IXNA 4ITUA 5IVHA 3C3YA 4A2CA 5JNWA 2H4JA 1E3WA 3CE9A 1OXMA 3N5KA 2V3VA 3OCVA 2VNHA 2IYFA 1HMYA 3ZD7A 3U1BA 1EQ2A 3OTIA 1ZK3A 4RVGA 4PZ0A 4R69A 4A8HA 4AJJA 1ICEA 3OPMA 3FFBA 3GEBA 3QU4A 5ILGA 1PWXA 3W5SA 4BVLA 5KQLA 3L6BA 4JVLA 1BCRB 2FWBA 3CZPA 4QEDA 1PE0A 1XZHA 1ZVMA 1N2ZA 1NVGA 2C82A 2QVXX 3TIFA 3AFOA 4OYRA 4DQKA 5A03A 1C0KA 5BRJA 2FPUA 1T9ZA 1X1EA 2WDZA 4G2TA 5DGCA 4K03A 2PY6A 1JKIA 2AD5A 2QJFA 4ZOLB 4G86A 3ZWYA 2NXNA 2HR1A 4ARUA 1JBKA 3L84A 1E94E 4OH1A 2ZIFA 4BFLA 1D0SA 1YVEI 3WGJA 4OU4A 1Z6TA 4JB8A 2FZ5A 4PNEA 1K8ZB 3TDNA 3UUEA 2PTHA 3HV0A 5FHRA 4ON9A 4DKXA 3QENA 3DC7A 3D4PA 3LCUA 3O8QB 2VA8A 4G4IA 4CLXA 4W8OA 3W90A 4BOYA 1P39A 1E4EB 3DDZX 5IABA 2B25A 1II8A 2PA0A 5JSHA 4YJ2F 5EUBA 4F1JA 1K4MA 1A9XA 4S04A 3FCSB 2QP3A 2V4MA 3V7UA 5J40A 4AJPA 1FFHA 2V6GA 1GLVA 4C03A 5LZ9A 4YBRA 4XSHA 3G9UA 1DC7A 4BNTA 3DV0B 4JX8A 2E37A 1B41A 1JDNA 2KS6A 3F3YA 1IVSA 2DEUA 4XD2A 4PSDA 4QFDA 3D5TA 1X9HA 1I2ZA 4UULA 4EKEA 4DNXA 2GK7A 3SU8A 2HT6A 4OL9A 1QTRA 2HL6A 2Q29A 2CXQA 4ZFNA 3HYNA 4IFTA 1JEQB 4B44A 4DF3A 1KJJA 3ZJTA 3GWGA 2OEPA 4Q21A 1XNHA 4FFBA 4MV5A 5DTMA 1U5AA 1E1DA 4JR1A 4Z1MA 1S4QA 4B17A 4OLAA 3R5FA 1XMSA 1WDMA 1T2DA 1K4KA 2R6HA 3MWEA 2VR1A 4BV2A 1KOJA 1UJCA 1KORA 5EP4A 1BJTA 4MKZA 1M3SA 1G59A 4EUKA 1SD2A 2IUYA 3PHBE 3ZYCA 2CVFA 3FD8A 4OF4A 1JTFA 2VHUA 3WAKA 1L8OA 5BW5A 3ETDA 4MS1B 2C2ZA 3OOWA 3F7TA 3WI7A 1GP2A 2HJWA 4NNJA 5H9WA 3CN9A 1NQAO 4JX9A 5AW7A 4Y6QA 1DELA 2FX5A 1Z7WA 4BQQA 1H23A 3N0VA 4WKBA 2CCKA 1E9VA 2H8KA 2Z1NA 3QUCA 3DGFC 3MBIA 4PO1A 3HJHA 1JJIA 1VB3A 2X0RA 2Q6OA 4M7RA 5H7XA 3C4VA 2Q28A 2O2JA 4H7EA 4NU5A 3Q6MA 1PBTA 3FDFA 3VZBA 3O31A 3GVIA 3UG6A 4BFYA 5EEHA 3NM4A 3NWJA 3I6ZA 3OEWA 4EH1A 1YR3A 1DP4A 4LRWA 2OFFA 1DX6A 1NQUA 1RHUA 4A8JA 3ENVA 4HNSA 3ZHSA 5EP3A 4BECA 4BVBA 3H83A 1QAQA 3PICA 2VNKA 4JI8B 1A9ZA 4RPLA 5ALKA 4DG9A 1PT8A 1RLUA 2FGKA 3C6KA 4PBRA 4EKYA 3QEKA 3EVCA 3PS9A 2PKQP 2C1ZA 2GZRA 1P8AA 5DPMA 1MEOA 4WH0A 2AC2A 4MIEA 3S1SA