3QIUB

Crystal structure of the 226 tcr in complex with mcc/i-ek
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
184
structure length
167
Chain Sequence
SRPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVYPTLLVCSVSDFYPGNIEVRWFRKEEKTGIVSTGLVRNGDWTFQTLVMLETVYTCQVEHPSLTDPVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 CLASS II HISTOCOMPATIBILITY ANTIGEN, E-K alpha chain
total genus 33
structure length 167
sequence length 184
ec nomenclature
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qiuB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3qiuB01
4OZHB 3QP3A 2VITB 3VD4A 2NCMA 2V5TA 2CUIA 2YN5A 4OD3H 3BRFA 3A6BL 1OP9A 3EGSB 5I1JL 4N0UA 4PJ8A 3CDFA 3QFJD 4OF5A 4U2YA 1FPTL 1TZGL 4DW2L 3JWDH 3C6LD 5IMKB 1BF8A 3BPNC 3VXSE 5JOFA 5SX5H 4PJXF 4AEIH 1T7YA 2GSIB 2BNRD 1EXUA 2YPVL 3LIZL 2GY7B 5ITBL 2DQJH 1BPVA 3W5NA 4RDQF 1MREH 2OI9C 3U79A 4X6BA 1NC2D 3FRPA 2AJXH 1TLKA 4O02L 5HYSB 2DWEB 4LBEA 4U6YA 3TA3C 4UIMB 2VDNL 2ID5A 2Z31D 3DRQB 2FGZA 3PWVB 4ONHB 3N9GL 5CZKA 1NFDF 4RFOH 4RMWA 3QUZB 4LF3A 2ICEA 4R4FH 4WHTB 3SE9H 2DQTL 4HJGA 4JZNA 4M00A 4JZOA 2JJSA 1IT9H 5DD6A 1KN2H 4KKCD 4YQXL 4DK3A 2VUOA 4JPWL 2A6KB 2DLIA 2X4RA 5SV4A 2GFBA 3IJHB 4OV5B 2JJTC 2YN3A 3L3OB 4L8SC 4RGND 5DJ6A 2ED7A 4G8GA 3Q6GL 3WDIA 2BCKA 1HWHB 1T1WA 5C0EB 1FVDB 4OCRH 3TF7C 4FTVD 3FQTA 3TNNB 5D72H 5C0AD 2XTJB 1VGEL 5CGTA 1MJ7H 3MUGB 4GLRI 1JBJA 3RWGB 4K71B 4NKOB 4I3RL 4DCQB 5MEOB 3KLHD 2BSSA 3GBNH 1ZLVH 5F1NB 3ULVL 5EBLB 3QEQE 4YDKL 4ELKB 3UTTA 4CU7A 1BEYL 3U4BH 3DI2B 3MLPA 4KJQC 1WT5C 3RVWD 4JFXB 3KXFE 2K9UA 1JWMB 5DA0B 5J06A 1C5BH 3FFCE 3PDDA 4YPGB 4CVUA 1QFOA 2DTSA 3OXRB 4P3CH 4CMMB 5CZXD 3Q6FA 4QHMA 3RY6C 3ARSA 4IEFB 4PJFF 1ZANH 1D5XA 5HDBE 3D39D 2OXGA 1MPAH 1QFWI 1G6RH 3O3AA 5FM8A 4JQIL 4HT1H 3CMOH 5I8EA 5KVEH 1XCQA 3ESVF 2K1MA 3L6FA 3VFGH 1AY1L 5DMKA 3SDCB 5EBGA 4XMKL 5JIHA 2BVQB 2VLKE 2FGWL 3QCTL 3V6BR 4AT6A 1FNSH 2KQNA 4KHXL 3N1MC 4UOW0 5ELIA 3PQYB 4HS3A 4BM7A 4LRIA 2R69H 1A4KB 2FX9L 1UM6H 4FHBD 1BOYA 4WV1C 1T7XA 1V7NL 1QLRB 2CK0H 4F33A 5EBLA 2YXMA 5C0CB 3QWOA 1NGYA 4XMLH 5FUZL 4NQED 4UUJA 5ADOH 1ADQA 5BCAA 5D70H 1P4LB 3O45B 3RTQA 2OSLA 3ZYZA 3P40A 5EN2B 4J6RL 3L95B 4XMPH 5C9JA 3TBVB 3D3VE 4FFVC 1G6RB 3WS6C 3FONB 3G5XB 4YH6A 1IKNA 1VPOL 2DIBA 3NAAL 4Z7VA 3D87B 5DD5H 1GSMA 2XFXA 6CGTA 2XOTA 2X9WA 5T3ZE 2CIIA 4NUGL 4GXUN 5BRZE 4YDLC 4JG0H 4GQ9H 4PJDE 3FQWB 1KG0A 5D2NB 4BH8A 3TNMA 5GGUA 3H9YA 2HVJA 5D1XB 1AH1A 3PL6D 2GSGB 3DPBA 3WUZA 3NVQA 3G6JF 1HNFA 1U93A 3N1FC 1QKZL 3KPSE 1MH5B 3UJIH 1D6EB 2VAJA 5J6GA 3UTQB 3KXFA 3G5YB 1QSZA 4HLZG 2R39A 4JKLA 5KSBA 2FZ3B 3L3GB 1KULA 1GVIA 3WNMA 1U0QA 2XYCA 3BPNB 2MOVA 4L29B 1OQOA 1J8HB 2KZWA 3BKMH 4WDIA 3OKDB 3GSQA 4ZOEA 1A6AB 1AQDB 5FA4B 1GAFL 5C0GA 5FECB 1W72A 4YHNB 4KZDL 4IBLT 2YRLA 1NSNL 5C0ND 3MJ9L 4ZO9A 5C07A 3W9DA 4P2QD 3NFNA 3ZYOA 1KTRL 2V2WA 4QRRA 3MOBL 1O7SA 3T0VA 1KIPB 5ESVB 5B38B 1NUDA 3ZKMC 1FH5L 3T3MF 4QHNA 4XNYH 2YC1A 3OKEA 1HSAB 1JRHI 1G7LA 1H3XA 3VJ6B 3S3PA 1IC4L 1PYWB 3GSVB 5CWSB 5DGRA 2VRAA 2ZUSA 5TE6L 4R0LA 3BQUC 3T4AA 3V4PL 1NGXA 4HFUL 4PJ5A 1FYTA 5ADPH 5I8KH 4K94H 4OUUA 3U0PA 1UWEL 3EYOB 3FCTB 4K3EL 4YXLL 1AC6A 2VLKB 3QZWB 1L6ZA 2BY1A 2BFVH 2C7UB 3QIUA 3C60B 3ZDXE 3FTGA 5T1KA 1J1XH 3MBEB 5HYQB 1FVEB 3QNXA 1G7PB 1RFDH 5AZEL 4ZXBC 1I7TB 4G9FB 3OG6B 4ODSH 3P11H 2ESVE 1QOKA 2EDOA 2CH8A 2OMBA 1IGIH 1JZ8A 3MFGB 3C2AH 2MNUA 3HLAA 1PDKA 1IC5L 4XPAL 4XVJL 3MUZ1 1MJJB 3TIDA 2P8PA 3H9SD 3CCHA 1EMTL 4H26B 3MRDB 4P57A 3EJYD 4JFQA 1KCKA 3AM8A 5C92A 2IALA 2WZPD 2WIMA 1OAUH 4U1JB 3IGAB 2HFEB 4TTGA 3TH2T 1HHHA 1DQQB 3VXSA 3CFDB 4KTDL 3TVMB 1JYXA 5JIPA 4OLEA 5FO9A 5DZNA 3BPLC 4JRWA 4Z7UF 5F6IC 4IJ3B 1IQWH 3MNZB 4Y5XC 5DJYA 2X4QA 1ZA3B 1EAPA 4JVWA 2E7LA 3NZ8B 2FHFA 4DTGH 4XBPA 1YECL 4KK5C 4Y5YB 5I1IH 5DYOB 3HMXA 5B39G 4F7PA 1KJ3H 4H1LB 3MZTA 2UV3A 4R7DA 5E2UH 5IFHL 1MFCH 2COQA 5INCA 3CFKB 3BEWA 2HT4D 2OZ4H 3JTSA 3OV6A 3BKCH 3DUHA 5KS9E 5HYQA 4GW5A 1KV3A 3VWKA 4LCWB 1RHFA 2ZNXA 5C1MB 5ID1A 4GG6E 2QL1A 1ZHNA 3D39E 1SHMA 5ITFB 1DANU 2VO5A 1QP1A 4HIJB 4JRXA 1HYSC 3CCHB 1WJ3A 3ALXA 4QOKA 2MCPL 5C0CD 1LO2L 5CJBA 1IGYB 1AP2A 1HHJA 1TNMA 5MI0C 2GJ6A 2F19L 3MYJA 5JDSA 3MLSL 3GI8H 5GGTL 4XI5C 3CU7A 1IKFL 4L8SB 5DUPL 4PRPD 5GZOD 2X4UB 2JIXB 5FOBA 2FD6H 4GO6B 1IVLA 1IARB 4L1HA 4OZFB 1EERB 4JDZB 1S7UA 3THML 4Y8AA 4NP4L 3QXUA 3KHQA 3PWUB 4X4YA 4X6CE 5FYJH 5SWSE 2VDLH 3SGDI 5I1KH 1BJ8A 5KSUB 4IRSD 1UACH 1NAKH 2G2RA 2P4AB 1NLDL 4PBXA 3SQOL 4I48B 1DSFH 1NL0L 2X05A 3QFJE 3CDCA 3KPOA 2Q76B 2ZP0T 2VMFA 5HHOD 3T2NH 5EN2A 3TO4B 4ZPVB 3UX9B 3DV4A 4JJ5A 5DJ2A 3V52L 4M6OL 3GIZL 2J5LC 3KPLA 5HGGS 3X14A 2R2EA 2DICA 1OY3B 5GRZA 4MD0B 2HA1A 1Y6MR 1YNTB 5KN5A 3A0OA 4OGAC 1LEIB 1TPXB 4NN7C 3WFZA 2XWJA 2I26N 2X89D 1T5WB 1D9KC 3D3VD 4F57H 4G6FD 5IEHB 2Z8WC 1DBML 4P2QB 1U8KA 3ZT5A 1CXFA 5IG7B 5ICXA 4PREB 2HH0H 4GS7B 5L0QC 2YD9A 1QR1A 4WEBL 2AXHA 4PJ7F 1AJ7H 5DMGD 3U9UA 4B7IA 1MFBH 1F4WL 1MRDH 1EVUA 1FNHA 4G7VL 1OD9A 1S7VA 3C6LA 5CLTA 2X1WL 3ES6A 4QRPE 1JPFA 2F53B 4LPUA 1B6DA 5HYSG 3VGHA 3KWWA 3PHSA 2AABL 3ARBB 2DM4A 3MUHL 4NNYB 3UTPD 1ZHLA 2A73B 2HJFA 4NN5C 5C0BA 1JZ6A 4XNXL 1KTLB 3MCG1 1MCPL 5FM5O 3G5ZA 2CDFA 1CICC 4WRLA 3NFNB 2Z31A 3MJ7B 5KZCD 4WDIB 4Q6IC 3DGGB 3REWB 3SO3B 3QBTB 4KMTH 4P9ML 1T7WA 3S35X 2P8LA 3H9SB 5HGAA 3GNML 5GS0H 3PV7A 4UOW1 5DC9B 1QSFE 3CMGA 3T3PF 1FL3B 2HT4C 1S5IL 4OUUB 3MMEA 5KOMC 1S7RB 1D6VL 4NDMA 2YPVH 1I1YA 5DJXA 4MJ5A 4PGCA 4JDVA 3KYMB 4F37K 3QDJA 3REVA 2DQJL 4Y0GA 1SJXA 3MV8B 2Y72A 2G9HA 4R0LB 1CD1A 1S7WA 4RFEB 3MZGB 3T4AB 1EUTA 1F8TL 3DX9A 4Z7OE 4JFED 4JM4H 5DR5H 1KXVC 2G5BA 3RNKB 1ITBB 3MLRL 4TPRL 4YK4B 3GMLB 3HZKB 2P24B 5T1DL 1EO5A 5D5MA 2XTJC 4FZEL 3VXRB 1OF2B 4BZ2L 1BJ1J 3CNKA 2HKFH 4ALAL 5KVGH 1RJCA 1N5AB 3SCMA 3KPMA 2P47B 1AD9A 4JEGB 4RGNE 2CDFB 1KYOK 3DHJA 1LGVA 1TQCC 3GM8A 3ZE2E 4FRWA 3BVNB 4JN1L 1BBJB 1FLRH 1OPGH 3BDYL 3T65A 2R56H 4PJ5E 4RMSA 3BWAA 8FABB 1LO5B 4Y5VB 1ZKAA 2ZPKL 1I8MA 5EBWB 5D2LF 1KACB 1YEIH 3NFPB 4MS8D 5JQ6H 4X6EB 3C6SB 4XTRD 3E3QC 4HWBL 4OD1L 2RCSH 4Y4FD 4NCC2 1GHFL 4JY5L 4OZIA 1S7RA 4NDMB 1PKOA 3G6JB 3RVUC 2HWZL 4KXZH 4Y4HB 3OF6D 3DMMA 2ARJA 4NWUH 3VW3L 3E6FA 1H3TA 3LQAH 2LE9A 4LCYA 3BKJL 4MDJB 2OTWB 4GAYB 1X4YA 2IC2A 4HIIA 1MCEA 1WZ1L 3GMLA 4JO4L 5FM5M 3MBEA 1YJDC 3NACL 1WZLA 2BNQA 2A74B 2NZ9C 4JO2L 1I4FB 3JVGA 4OAWA 4BFGA 4BQBA 1CDCA 4ODHH 2I9TA 5K9KA 3TZVD 4JR9L 1A5FH 4QOKB 1EJOL 2IGFL 4JHBA 4G9DA 1I7UB 1NBYA 4HLJA 4XP1H 3VWJD 3JWNC 2O93L 3GSUA 5SWZD 3VRIA 3NIFE 5BV7C 1CTNA 1FCGA 1MF2L 4MA3B 3QCUH 3MRGB 3BHBA 5IB4B 1ONQA 5TE7H 4JGMA 2AK1L 4S10A 1JK8A 3IYLW 3QI9C 4TVPE 3EFFB 1P1ZA 3HNTL 2J6EH 5F9OH 1GH7A 3MCKA 3CH1A 2EDXA 4Q9CA 4NYLA 2A77L 5I76A 4PRIA 4ORZC 3MODH 3QIBD 2DQDH 3PJSA 4NZTL 4FXKA 4XX1G 3H3PH 3UO1H 4Z0XB 3VG0L 3C9NA 1CGVA 4ZTOH 1UM6L 4CMHC 3DURA 4XCCH 1V7NH 2B1AL 4LLQA 5IW1A 3PWPA 4JLRA 3IFOB 3DO3A 3DX6A 4XMLL 2CDEB 2VLJD 4HULB 3GSOB 3O3BB 3W39A 1KPVB 1H5BA 3RDTD 3KXFD 2DF3A 1IM9B 2F53D 3TA3B 1CXHA 5IVZA 4J6RH 2HMIC 1EV2E 2QSQA 3OKOB 4DQOH 3P4OB 5IB5A 3IGAA 1XGUA 3I6KB 4D9RD 5I1LA 4S1SL 1KJ2A 4XI5D 4EUPB 1QRKA 4AY0A 3KPOB 2ZUQC 3DYMA 3RGHA 2A6IB 4RZCA 4OZFH 2ZUXA 2BOBA 1YPZE 2DWEA 4LBEB 4GRWH 4UDTB 2AXGB 4N0UE 5D8JH 3GMNA 3WO4B 5DD0L 4P2QA 4Y19E 2CD0A 3KLAB 4MA8L 1MPAL 2JB6B 2DTMH 1PSKH 4NPYA 5F96H 1YMHA 2JJUA 25C8H 1RJLB 2FYYA 3UJIL 4J4PA 5E03A 4PRNB 1FYTD 3OAUH 4FQIL 3WCYA 5JOFB 2NTFB 4S0SD 2DL9A 2W9EL 2V5RA 1F3DH 4UI2A 4AQOA 4I18C 5JXAL 4HUVA 3QRGH 4HJJL 4XPBL 5JW5B 3QO1B 4NM8L 5T1KD 1B4JH 4BKLA 5CAYB 3O3BA 3MLYH 1UWXH 4DZ8A 3IDIB 4WGVB 4F2MB 1MOEA 3K8MA 3DGGA 2AJUL 5D70L 2IG2L 5KSVB 2ADFL 3V4UH 4OCYL 1MCWM 3VXRD 4P2RA 3QIWB 5SV3A 4XP4H 1AR2A 5J89A 3PG2A 4KJQD 3RVWC 1O5DT 4JFDB 1GZPA 1IGCH 3GMNB 3QUMB 1OP3K 4YFLI 4M02A 4W4OA 5D96C 2XNAB 3VXSD 2IBZX 4NNXB 1BWMA 1SJHB 2NY6C 3CFJA 2YD6A 3AB0B 5DRZA 3MUGA 4WTWA 4MAYA 4OFVA 5IB1A 3S37X 3Q6FB 4QYOB 4LVEA 4DKFH 2BCKB 2Y7QB 5CCKH 2ICWJ 5CUSH 3OSKA 1DBJH 3BP4B 4LMQI 5B39A 5GGRB 12E8H 2ZUWA 3RX8A 1LE9B 3V5HA 3WFHA 5I8EB 4MX7B 2NX5D 3SE3A 1IAMA 1V7MH 4X8JA 5A2KH 4JCLA 4JFHE 5D7SH 5CD5C 2HRLA 3VWKD 5J8OA 2X1PA 3HE7A 1FN4B 1UM5L 4QHMB 1HXMB 5SWQB 4NJAH 1L9MA 2JTDA 3QXAB 1WEJL 4XXCC 3RVXC 4FFYH 4LCCC 5HVHC 1UJ3B 4O9HL 1AFVH 4LSSH 3QB7C 1JWMA 3VDAA 3EJJX 1TENA 4JRXD 1H3UA 2F58H 4QOKD 4ODVH 3L3IB 2Z31C 5C0CA 4XVUC 3MRRA 5C0RH 4ZYKA 5M7QA 3MV7A 3MGTA 4JY6A 3W82A 2R4SL 4U1IB 1S5HA 1PBYA 1LO5A 3T2OA 5HHXL 4PRPA 2Q20A 1QTYT 3N06B 1Z9MA 1IAOB 4XPGH 4Z77A 1Q9KA 5E2UL 4CW1A 3ARWA 2R8SH 4TVPL 5IP4A 1INDL 3KG5A 2DKUA 2XWBA 1C5DB 1F4YH 3LCYA 3MV9A 2FEDD 5GGQH 3P9LA 4CAGA 4OD2A 2BFVL 1YN7A 5F1IA 1J0ZA 3IDGA 1UWXK 1KXTB 1NC2B 5BZWA 4IRSA 4UNUA 3X3GL 1VKXB 4ODSL 2PNDA 2WP3T 4S0TD 1H8SA 2CIKA 3EOBA 3HHRB 3PWNB 4CUCA 3WXVH 1A64A 4HXBH 3LEYH 4G3YH 3QHZL 1S9XA 4LSPL 4D3CH 3VXNA 2VR5A 1KB5A 1I3RB 1KCSL 3T2QA 2GTZB 3LPGA 5IWLA 4KWUA 3MRRB 3MLUL 5E1HB 2QHRH 1E6JL 4TVSa 2CIIB 3D3VA 2NY2B 2YPLE 4OLUH 1L7TH 5E99H 4PB0L 1FNEB 4DTGL 1CFQA 5KSBE 4FQCL 3KYNA 4JPIB 1U91B 2XN9E 3CH1B 1UCBH 5HDQH 5FIEA 2P24A 3QUKA 4L29A 1ZT7B 4P2YA 4Y1AE 3SY0B 2XA8H 3QDAA 3TC9A 3QO0A 1VFAB 3G6DH 1MWAL 4WUKL 3EOYG 3GBML 1NDGA 5C09D 4XNQB 2EXWC 1M7IB 2D9CA 4AEFA 4CU6A 1OB1A 2KKQA 3QZWA 1U3YA 1OTTC 3P77A 1IL1A 3SDDB 2HFFA 3O9WC 5GRUH 2I9TB 3CVHB 3IDMA 4LDEB 3A67L 3I84A 3C8KB 4F9LC 2IQ9H 1M7XA 4JM2B 5KOVC 4XWGH 2VABA 4U6HA 2F19H 2E9BA 2JLLA 2DQFA 3DJ9A 4PLOB 1HH6A 1KIPA 1IKFH 4OCXL 4R2GB 1ONQB 5GJTL 4HXAH 2IMMA 4JFYB 4NGHL 2F74A 4JFDD 5DK2B 1QYGL 2IAMD 1RVFH 2CLVA 2VZTA 2ADGA 2JF1A 5I16A 5IMMA 1YDPB 3IFPB 3QXVA 2EYRA 1FBIH 4X5WA 5DC4B 4MQXC 3UTZB 4ZO8A 4NBXB 2VXQL 4A6YB 1L7IL 4MAUH 3S34H 1F58L 3TIEA 5JA9A 4QRPD 4KUZH 1SBSL 3QUYC 1B3JA 5HJ3A 4M7KL 4AL8H 3QUZA 1CXEA 2E9WA 5HI5D 2ZKHH 1CDUA 5L2JB 2UY7A 1Z3GH 2YEZA 4G6MH 3HR5A 3U2SA 1FNLA 1MJJA 5F7EH 1AXTL 2G5RA 3QUMA 2FBJH 1GC1H 5ID1B 4F58H 1TETH 4F15B 1JYNA 1FNGB 3QIWC 1AE6L 3L3OA 1ZHBA 3DXAB 3LN5B 4OZ4B 1KLGA 4MQSB 2DB8A 1Q1JL 1MJUH 4YNYB 2R0KH 4GFTB 1F13A 1MQKH 1JYVA 3GSNL 3CX5J 4XPFL 1Y6KR 1HHJB 3QDGD 4UQ3B 4ELMA 4G8IA 3TN0C 4APQD 5HHMB 3SGKC 2HH0L 3QRFM 4LLYB 3KYOA 5IROA 4UT9L 2FIKA 5F9JA 1T6VN 2X10A 2EC9T 4PJAF 2HP4A 1A47A 2E9JA 1ZA6B 1S78C 3S98A 3DMMD 3TV3H 3ULSA 1QLRA 3A6CL 5CINH 3WXWH 4JFEE 4MLIA 4P2RE 2LU4A 5KBNC 4JPKL 5IVXF 4NFCA 3WJJC 3WLWD 5LWYL 3HZVA 1K85A 2EC9U 5EDXA 3K4DA 2W0KA 3GJFB 5EC1A 4GBXB 5K59F 4JN1H 4PGEB 1S7SB 5DRXB 5HI3D 4TSCH 2FSEB 2BDNL 4U3CA 3CUPA 5C0IA 3KPQB 2FH6A 3MRLA 4OLXL 3D25B 4GG6A 4NO0B 1HI6A 1YEIL 2Q3ZA 3V5DA 3VWJA 3G6AB 3HE7B 2VXSL 5SWZA 3PIQA 5DEFA 5C09E 3I02A 1SEBB 4ONOA 4KK6C 1YUHB 5MHSD 3BH9A 3VH8A 4KKAD 3F6LA 2KDGA 4WV1A 1VCAA 1HOCB 3EO1A 4DN3H 3SDYH 4X5XB 1I8IB 4NQVB 1F11A 1FJ1A 4Q6YA 3SGJC 3V9FA 2GJ6E 3UPCA 4NZJA 3VW3H 1D6VH 5F44A 1HHKA 5FAAA 1JNHB 4JDZA 3K1DA 1TMCB 3VI4F 1WLHA 1LNUB 5ISZB 1AGBB 4IRJC 1PX3A 2DI9A 4K3DL 1JJUA 4PFEA 4JM2C 4EI5B 3BEWB 4G9FD 2J8HA 3PWPD 5FF6B 1P7QD 4MJID 5I74C 3ZT7A 2ICCA 5JZ7D 4S1RH 1DQLH 3OJVC 4YE4L 5D7IE 1J1OH 1NGPH 3U46B 2Q7NA 4M1GL 2DBJA 2J7LA 4YAQA 2FX7L 4GKSA 4YIQB 2FX8H 2F53A 4ODUA 3L95A 3BW9A 3GRWH 5C09B 1K4DB 4ZPVA 3U4BL 3TO2A 4D0BB 4MXQD 3DWTA 2NXYC 2HJFB 1WQVT 4AG4L 5EA0H 1G9EA 3OPZL 3MRBB 3O0RH 3LMJH 4UINL 2ZCLH 3FO9B 3T4YB 3MRIA 3GO1L 1P4IL 5CWSA 4ZFFB 3MODL 4U1SA 4NZTH 5LGJA 1IGFH 4U0QB 2AJVL 1S7VB 5DMYA 1RZ8B 1F4XH 3FB6B 4JKWA 1SYVA 2B1AH 3DI3B 3SKNA 4JQIH 5ICXB 5F7DA 4ZUSB 1ZWIA 3BKYL 5FYKE 3HC3H 4MD4A 3EYSL 4PJCE 4OM0L 2HFGH 1LO4H 3FO1B 3VFGL 1F00I 1N64L 3ILQC 1YYLL 4Y2DA 5CEZH 5DSCB 2R69L 1MIMH 3TLRA 3REWA 1W72B 4JO2H 4YHNA 3DSFH 3VDCA 4DGYL 1KT2A 3BQUA 4QCIA 4HQQH 1I1AC 1OQXA 3QZWG 3QPQD 5AD0B 1TJIH 3I85A 2PXYD 4PJAE 5K9QI 1OB1B 3FO0H 4JFOA 3PWNA 1Q9WA 1X6LA 2R2HB 3ZKXC 5JR1L 4KDWA 4OZGA 5CSZA 3GSVA 3UPAA 1UB6A 3V2AR 2YWYA 3RL2B 25C8L 2FO4B 2XRAH 4MNQD 4BK4A 3IETB 1A6WL 4ZSOB 1A7BA 5I1GH 1MCQA 4U6HB 3HNTH 1QD0A 2LTQC 1VADA 1ZVSB 3T0AA 4MZ3A 5LGHH 2XWBB 3W11D 4GRWE 1KN4L 3VFPA 2C7UA 3O2DH 3QIUB 4WW2B 2DQDL 2OJZH 3TH4T 4JFYA 4I5BA 4GRLA 3RIAK 1XR9B 4YHZL 1VACA 3MJGX 3RUGE 2OR9L 1MRFL 3O2WL 3WL9B 4NKIL 5C0AB 2GJJA 2HLFC 2NY0B 4YFEA 3I75A 2QEJA 2NX5A 5IVXE 1UZ6E 2IBZY 3HUJF 1KIRA 5D2LE 3DX8A 5EUOF 2HFEA 2Z91B 3F7YA 5J1AA 2I24N 4WU7A 3JBG7 5IM7B 3VGGA 4PRAA 4L8BB 1P9MC 4U1LB 2APVA 3D2UA 4YNYA 1OAYL 5AWNL 5KG9B 2XIDA 5GGTA 1ZXQA 5IESL 3RTQC 4TNWK 3CC5A 4PJCA 1QG3A 1QNZL 1T2QH 1IKNC 3N1GC 3VFNA 1N4XL 4Y89A 1LK2B 1XGPB 3L3JA 1TNNA 3OJDA 4Z7OF 4R97B 1SVCP 4CMHB 4FXGB 2P5EE 1HHGA 3HG1B 4UQ3A 4ELMB 3TPUB 2XN9B 1KLUB 4K3EH 3ARBD 4YXLH 5LJYH 2L7JA 3HC4L 3MNVA 4FQXD 1AO7E 2XPGB 3LRHA 1QR4A 5DQJA 3WD5L 3RL1A 1ZHKA 3DETD 5A16A 4K9EL 4LEOA 4PJBA 2OQJA 1KCLA 3MLVL 2X4SB 4HZLB 4RIRA 4TOYL 2BVEA 1FYHB 4LVHC 5E00A 4WNQB 4DZBB 2YPLD 3IT8D 4ETYA 5F6IB 1J87A 2HJKB 5KZCB 3ESUF 1QA9B 2PYEE 1OLLA 4RMTA 1JL8A 1A1MA 2N7BA 2VZ3A 4GRMA 3OBAA 3QUZC 2B0SH 4KHTH 4XC1L 2AI0L 4XBEL 1UXWB 2XZQH 3WO4C 3VFUB 4KV5F 3CFEA 1BFSA 1H9VA 4KRMB 1FC1A 3ULUE 1M05A 4OCNC 1TVBA 2BP3A 3HMWH 1F4HA 2DBLL 2OK0L 4QGYA 5ESAB 1RZGB 4OLVH 5DTFA 1IMHC 4PG2A 3UAJD 5T33L 5L88L 4P59H 1KCUL 2VC2L 4OCMC 3VGEA 5E8PB 5IROC 1DBJL 5D2LA 12E8L 1DLFH 3O3DA 3D85A 4C59B 2AEIT 2OTWA 3O2VL 4D9LH 1OAZH 2WBJC 4X6CF 4YBLC 1ZLUH 1IGTB 3IFLH 1VEMA 1DLHA 5CHNB 1HYRC 2RAMA 3TFKD 3QHZH 5C09A 1D9KB 4XB7A 2BOBB 3VD9A 2Z93A 4LLMB 5TGBB 1QZ1A 2JK5B 4HGWA 2R0LL 2ATPB 1K5NB 1RK0A 4LARH 4NM4H 2CRYA 1WIPA 1AFVL 3MLUH 3F58L 4BKLB 2W65A 1MHPH 1KJ2H 1CGTA 4KJWD 3GMPB 4Z6AT 4D0CB 4F2MA 4Z5RA 5JLZB 3GJFK 2LTQB 2AXGA 5HXMA 1FFNA 4ONFL 4OB5L 1I1RA 5CGYD 1P5VA 4YDVB 4HWEH 3BT2H 4U1KB 5DFVD 1NKOA 4XPGL 4G42B 5FHBL 4JB9L 5ESAA 4MJ6B 2EDBA 2C1PB 1T2JA 1XGRB 3D69A 5DLML 3SDCC 3L6FB 2APBA 3PL6B 1EJ6A 5C0BB 5AYUH 2FHCA 3CGTA 4K7PY 3EYQD 2WAHA 3QDMA 4X9BA 1T03H 2FNBA 3QO1A 1A4KA 1R6VA 1YQVH 5JNYB 3BSZL 3CUPB 3OKNB 4WHTA 1Q0YL 3MREB 4LNRA 2XKSA 2Q8BH 1ORQB 5FCUL 2VUYA 3O4OB 5IV2A 2VLME 4XWGL 1J8HD 1G1YA 5HSFA 4YIQA 3T2NL 3LEYL 4G3YL 5D93C 2VDKL 1W0WB 3OKYA 2FECI 4LOUD 1A2YA 2FO4A 4HW6A 3M8OH 1MCCA 4LSPH 5FGSA 3D0VB 5DO2D 3ET9F 1LDPH 2FBOJ 3M1BA 3CSYB 1GIGH 4HIXH 2X4NB 5H94B 1N3NB 1JGLH 4V1DD 3ARGA 4CU8A 4CN6A 3P9WB 3MCLH 3O6KH 4OCLC 3ARBC 4AT6B 1WCBA 4Y4HA 4HV8A 5GGUB 2CUHA 1DDHB 3HS0A 4O51A 1KG0B 2HYMA 1Z9OA 2AJXL 2AJZA 2EC8A 4DGVL 1FO0A 3HZKA 1JMZA 1I7ZB 4DOHB 1Y6NR 1MCWW 4UT7H 1PKQA 3G5YA 3AS3A 3FO1A 3WFHB 3P2TA 1IM9D 4Y5XB 1BGXL 5BZDA 3VD5A 1G7IB 2OL3B 3KDMB 4EI6A 3WKNA 1GRWA 4XGZA 3VXQA 2J8OA 3F7VA 1IT9L 1BBJA 5B4MD 5L2KB 3VFOB 1YNLL 4Z7QF 2JJSC 5TJWK 3C5JA 1F45A 2Q6WB 1TITA 2HN7B 1NMBL 3RWFB 1QBML 2Y5TB 4MYWB 4Y4KD 1CYGA 2VQUA 1GZPB 3FAWA 4HS6B 1TVHB 4JKPH 3VFSB 1WBYB 1HXYA 1JGEA 4HBCL 3R8QA 2X40A 3MV9B 2KBGA 1VGEH 2HJLA 3TBSA 1K8IB 2EE6A 4UV4H 3QXTA 2PYFA 3CLEL 1RVFL 3BZEB 1AGEA 1FYTB 3VMOA 1MNUL 1Q9KB 1INEL 4KVNL 2XWTA 1W72H 2BK8A 4LASH 1B0RA 5LVEA 1CLCA 4RNRA 5D1ZB 2E7MA 3JUZA 3RWHA 4JZJB 5EO9A 4NQEE 1MREL 1QLEL 5GSVA 2Y36H 2DMCA 4U6XA 2CJUL 2EEAA 3WFBH 4BUGA 1T1ZB 5EZLB 4LNVA 5CZVL 4O02H 3FZUC 4JHWH 3MJ6A 5DK0B 4POYA 2VDNH 4YC2B 2X4TB 1RUML 1A1MB 4EZMA 2AXFB 4AL8L 5EOCJ 3MBXL 3PDOA 5DEZA 3N9GH 4K07A 4UTBL 3VG9C 3SDDC 3SGEH 3V0VA 3JUYA 1BZ7B 2ICWI 4WEUD 3F5WA 4R4FL 5IBLC 5AAWA 5E00B 1T66C 5DJ8B 1HQRB 1J12A 1G6VK 4YQXH 1SEQH 1RZKH 5AZ2L 2KH2B 3CK0L 1U91A 1NMCC 4J3SA 4XMKH 2CKBA 1CLZL 3SO5A 3LDBB 2NLJB 3U36A 3V0WH 5GHWL 4ODBD 1BVZA 4E0RB 2UWEE 1QFHA 3H3KA 1DN2A 5D1QD 1RZKC 5DJYB 4CW1B 4OCRL 5IJKA 1LP9E 3AY4C 3FFCD 4XNQA 1GHFH 4HKJA 3TJHD 5D72L 1KXQE 5KJRL 3QEUB 2ZZUT 3HFMH 5JW4M 5EPMB 1CGWA 4RNRB 3QUKB 3RNQA 5HGBA 4GT7A 4FQHA 3O11A 3RWEA 2RQ8A 1VFAA 2ZWLT 2XN9A 1ULVA 3MROB 1DBBH 3IFPA 4R4BB 4JFQB 4HS8H 2C4XA 1AR1D 2EYRB 4ORGB 5DT1L 1NC4D 1BX2A 2W9DL 3MO1A 4E5XA 2QSCL 3F7PC 4L8BA 4PJHF 5L9DH 2CGRL 5JO5B 4BZ1H 5CHNA 1A7RL 4GQPH 3FB5A 2QQLH 3L5XH 1RJZB 1HH6B 4QRSA 1P4IH 1A5FL 3H7LA 5I1AA 1GCFA 4YHPB 1MI5B 1KBGH 2PXYA 4KRLB 4P3CL 2WINB 3DVNB 5HI5C 2H45A 3I6GB 2MQCA 3UDWC 3T8XB 2GJ6B 2VABB 1KC5H 5DHVB 1G6RL 4PY8I 5EZIH 7FABH 2D31A 5HHNB 3CMOL 3FHQA 1R5VA 2Q7YA 3MRKB 4FP8L 4P99A 1BJ1H 1WAAE 3O41A 2HFGL 3BZ4A 1HHGB 3HG1A 5D5ME 1O0VA 3BH8A 4YBQC 4YFLF 4NN5B 5DHXB 1KLGB 4LCWA 3SPVB 2AW2A 1XIWB 4WUUB 1J0HA 2XZZA 1BAFH 3BDXA 3IXAB 5HY9A 1ZT7A 1QPXA 1C5CL 4RRPG 3V95A 5KSUA 2NY5H 4LEXL 4Z76A 3STBA 2R15A 4KZDH 4YHOH 4S1RL 4LVHB 3ARED 3QXAA 4Y16D 3GSXA 2NY4B 2NY2C 1AP2B 2ZCKH 4JCMA 1HKLL 6FABL 2YBRB 2NY7H 4R3SB 2XRAL 4NZDA 3WIIL 4I3SH 1X5KA 1HDMB 2X4UA 2A9NL 3JVGC 3HB3D 4FQJH 4U1MB 5I1GL 4ETQA 1FHGA 4KROB 2ZCLL 1JHKL 1W8OA 5ADPL 3GO1H 2EO1A 1PY4A 1NCCH 1IGFL 3PWUA 4X4YB 4HJ0C 5FKAA 4OLZL 3VFWB 1LD9B 2P48B 2ZJSL 4M8QA 4O51B 4K8RD 5FHAL 1RUAH 5DK2A 1KSRA 2J8UB 3BZ4B 2P8MA 2ADGB 1P2CB 5I16B 1X3DA 2OR9H 1MVFA 3WIFB 5EU6B 2H2PC 3NCBB 3RWJB 5GS2D 2NW3A 5D7LE 3GMMA 2VJXA 2FJFB 4K3HA 3IXAA 4YHLH 5HY9B 3QG7L 5IHBA 4K3GA 1NCDH 5EUOB 1FZOB 2KZ1B 3IU4H 4IS6B 1L0QA 5MHSE 4FQXA 2NXZB 3KYKL 3HAEG 3FQUB 4EDWL 5KANG 5D7KD 3O4LE 3DIFB 3ZTNL 2NY1B 3WJLA 5GZOC 1S9XB 15C8H 4KH2A 2V9RA 1S7SA 5DRXA 1LO3H 3LKPA 4QXWA 2OR8A 3U1SL 4PV8A 5GSRB 1K4CA 3VFSA 4KTEH 1JGEB 4LIQL 1EEZA 4HUUB 3S6CA 3BZFA 3T3PE 4ZS6D 1T4KA 3DV6B 4FFWD 4YWGL 2Y5TA 1ZGLM 3QFJB 2O5YH 2NQCA 5ISZA 1M6OB 1RUPH 3PV6A 3KYNB 5HTSA 5LGHL 2BNRB 1N7ML 1FVDA 4F7TB 1BD2E 1C1EL 2FIKB 3HC4H 3BO8B 1GPOH 3LAFA 1HHKB 2IBGA 5GSVB 3U46A 5HYEA 4UV7L 2Q76A 1I8LA 4Z9KB 1WC7B 3GSWB 3JV6B 4N1CA 4QRPB 1NDGB 2IADA 2VL4A 4K7FA 3RVXD 3M07A 2QTEA 32C2A 2B39A 4NZUH 3CVHH 1IGIL 4QHUA 2UVEA 2UZYB 3MLWH 4LU5L 4LSDA 3EO0A 1VFOA 2Y25A 1QRNE 4M3JA 3ZYJA 2OL3A 3SE4C 3KPMB 4L3EA 4MQ7B 1A7PL 1S7TA 4PJ7E 3WN5C 5E9DD 5IB3A 2GCYA 1CE1H 1BREA 2O26U 3TPKA 3FT3A 3CLFL 2N4IA 4M48H 1I1FB 5DJAB 4NNPH 4Y19D 5D2NC 4JFOB 1X5GA 4APQB 5C0RL 4XP6H 1OARL 5J1TC 1U6AL 3RRQA 2ICWA 3G9VA 2GUOB 1N4XH 1A0QL 4HFWA 1WICA 2M26A 1FAKT 2OZ4A 5IQ7H 4N68A 1HSAA 4J3UA 3SQOH 1PKQB 1RV6X 3BMWA 5F9WB 5DD3L 1OAZL 5C08B 2R23A 3B9KB 5JORA 4F8TA 2CLZA 1ETZA 1F4YL 1NCAL 4V2CB 2HKHL 3K0WA 4ERSH 4HIIB 1XIWD 1LE5A 3QDMD 3AAZA 4X6DA 3OXSB 1A21A 4MB5A 1T04B 3CVHA 3IDMB 3U2SB 4FN0A 4MB3A 5K9KB 3TA3D 1QHPA 4OAWB 5ANMA 2ZSVB 1CICB 3IETA 1LO2H 5GRYA 3RWDA 3WXVL 2J88L 3DROB 3LN5A 1IC7H 3IDNA 3BAEL 4XVTH 4XBEH 4QHLA 3HI1B 5E8DL 5AUMB 4Z7UE 4YEFA 5EU4B 4M61A 3BHBB 4GAJL 4OQTL 2FIRT 1OGAB 2YR3A 4KKCC 4YUEL 3DX9B 4RMUA 3BH8B 3TNMB 3U4EB 2ATKB 1H3PH 3FQWA 2XTJD 2DQHL 3SGEI 2H32H 5IOPB 1U93B 1RUQL 5I76B 5MP6H 4OKDA 5HHNA 4JM2F 1DVFB 4YO0B 1EIBA 5DQ9A 2LU3A 1Q9OB 5DUML 3TT1L 1AHWC 3WNOA 1OLZA 1P7QB 4MJIB 2OR7A 3DX6B 5C07E 3L3GA 1IQDB 5EU6D 4QRRE 3O2VH 4D9LL 4EIGB 4CN4A 4LGPB 7CGTA 3FTGB 4WW2F 2Z8SA 3OXSA 5FECA 2ICEB 4Q6IA 3M8OL 5ERWB 1PJ9A 1MHHA 3BJLA 3BZDA 4ZUWB 5EOTA 4PJGE 1DR9A 5I1LB 2R0LH 4Y4FC 3GRWA 1YA5A 5CD3B 1U8JA 5A16B 3QJFB 5L8LB 3IXTB 2AV7A 3E6HB 2YWZA 3DARA 3MCLL 3O6KL 1K2DB 3IDNB 2EZ0C 3L7EA 2IQ9L 3ZTJH 2BSTB 4YBQD 2GAZA 2C1OA 1DBMH 4AH2A 1WISA 3HKFA 1J10A 5TE4L 1KIQA 3QPXH 5I1DA 2G75A 4FQLH 5DR5L 4KV5E 3U4EA 3WN5A 4NFDA 1KCRL 2EKJA 2APFA 5KVDH 4S2SA 3MLRH 4J7RA 1K9TA 3F12B 4GLRH 1KIUA 3G04B 4NZRL 5FHBH 4L5FH 5DI8A 4ZFZB 1ZLSL 3GFUA 1CVSC 1P5UA 3BRGC 3O11B 3RWEB 5T3ZD 2HT3C 4ODXB 1EAPB 4NO5A 3T77A 4OCWH 3Q2CA 1EFXA 3MFFB 3DSNA 3AVEA 4MMXC 2WW8A 4CL7A 4H88L 1G0DA 5DTFB 1T03L 4EUPA 4NSKA 1A7NH 4ZPTA 1FLRL 3QT2A 5EUOE 4D94A 3P4NB 3OXRA 4CMMA 1MLCA 1E4XH 1AO7A 3QUYB 4Q6IB 4ZOAA 2DQUL 5D7LB 4FZ8L 2YPKA 5FYKU 1ZHNB 4NKQB 3T4YA 4RFOL 4G6ML 4HWBH 4ONGH 3K74B 4RA0C 5DJ0A 5IHZB 3TN0D 4PJGB 5F7EL 4APQC 2V7HA 4FMFA 1PEWA 4WY7H 3D1MC 3NPSC 1K5NA 1RK0B 5FM4A 1INEH 3SDCA 1FFOA 1F6FB 1S5IH 4Z0BH 5CJOH 3LQAL 3UJJL 1NBVH 2AKRA 1ES0A 3QQ3A 3EFDL 4RX4A 2XZAL 5LCVH 1RZGA 3ULVD 3H0TB 3SKOA 5FF6A 1EEUA 3WS6A 1QUNA 1DUYB 5BW7C 4QRUA 4A2LA 4GRWB 2ORBH 2MWCA 3ZO0A 1XGYL 4KMLB 3ES6B 1CQKA 2GT9A 2HKFL 1MF2H 1YEGH 2ZG2A 3JWOC 5TPWH 3SDAB 4BYHA 4HIJA 4PS4H 5FGCB 5D7IF 1NC4A 4LLMA 3KNBA 3ZDYE 1HXMA 5TGBA 4Q97A 3QDMB 2OS7A 4QT5B 2DDQL 4TSCL 3TO4C 5F7YC 4OZIE 2HTLC 3IJSB 1CLZH 5F89B 4PRDB 1UXWA 3RVVC 2YUXA 2X1XR 2VXSH 1WBZA 3L3IA 5TQ0L 3O4OC 2XKUA 5CILH 5JQ6L 3OKKA 1S7TB 4LPXA 2J8UA 2P42B 4YXHL 2DQEH 1CL7H 1T0MA 4HBCH 1ZWIB 2QADB 4OD1H 3VFPB 3VGFA 1BJMA 5K9JL 2Z92B 3WHE1 4D9QD 3BP4A 4OZFA 5KJRH 4NHCL 4AM0A 3QFJA 3ZDYF 5JHLH 4PV9A 3HG1D 4HKBA 2QSVA 4ODTH 3KGRA 4M7ZC 2ERJB 4M6ML 4PLJC 5EUOA 3VE0B 4W6YB 2VR9A 1NFDE 4OFKA 4LCWD 3PABB 3I75B 5F7WC 5IK3B 4FQ2H 4M3KB 1C08B 5EZOH 5BZWB 1R3HA 2CJUH 3WFBL 1NC2A 4XPTH 3UAJC 2G9HB 3MUJA 2HRPL 3NZHH 1SJVA 4P23B 5J1AB 3KPLB 1EJOH 4KQ3L 2A6JB 2CIKB 4XP1L 4Y16A 1Q72H 5LQBH 4WJ5B 3EO0B 3RDTC 5B3NA 4UTBH 4JRYB 1J7VR 4LDOB 1R5IB 5D1XC 1NGQH 4JFPA 1A3QA 4HZAA 1BLNA 2AJ3A 4NO2A 4TUJA 2J6EA 5TDNB 4ZSOA 3KS0J 2YUVA 2WNGA 4OF3A 4Z7QE 2IANB 4JANB 1JZ5A 3IJYB 5GIRA 1R3LB 5EU3B 3BISA 3BO8A 1DL7H 1UT9A 2A77H 1NAMH 2W1NA 5DHVH 4GQ9L 2NR6C 3RVTD 5GGVH 1AI1L 2ICWB 3ARFB 1CK0H 4FTVA 3RPIA 3MLYL 3BDBA 1FL3A 2NNAA 3WL9A 1OTSD 5C0AA 5MEQB 3MNVB 5D9SB 1IQDA 2DRUA 3OR6B 5FGBC 3S37L 4YDLB 1ZLVK 2B1HL 5DVNA 2PO6B 2NW2B 3NIDF 1CGUA 4HLZH 1YPZA 3CDYA 3KVQA 3DXAE 5CBEB 4FNLH 5EOTB 4D2NA 3RWFA 2HJKA 4DQOL 1ED3A 4OFDA 3AAZB 5L9DL 4NRYA 1BP3B 3NCFB 3QDME 5IGXL 5L2KA 1A7RH 1OF2A 1JGVH 5HGDA 3DUUB 4ZNEE 4NJ9H 3L7EB 3MJ9H 5F3HB 3KJ6H 3CSYA 5DXWA 5D7LD 4RISH 4AIOA 4F7CA 3CPLA 4PUBH 1FGNL 5CGMA 4WENB 1PSKL 5F96L 3PGDB 2V5YA 1X44A 4H1LA 2GY5A 2R2BB 4U7MA 1IM3A 3REVB 3O6FB 4AIZB 4JDVB 3V4PH 4ZAKD 1KTKE 2AQ1A 3WMSA 5I8KL 1NCDL 2LAGB 2R0WL 3VXMD 2XTLA 1UWEH 3KYKH 2F5BL 4PYGA 3IU3B 1FL6B 1JF6A 5DQ9B 4HF5H 3SKUD 1QFUH 3DMMB 1GC1C 4KRPD 4WI4A 3V6ZA 1QA9A 5BO1H 3P11L 2ZNWA 3HMXL 2F58L 5F72S 1RJYB 4NQEA 3SKMA 4XAKD 2AJUH 3FO2A 4JO1L 2BY3A 4OGYL 4OCYH 4NSKB 3RTQD 1WV7T 3RWIA 1JI2A 5KSAC 4MGXA 3VWKC 4L3ED 1VA9A 5EBWA 4MDIA 3EOTH 1AIFA 5FK9B 5HVGB 4B41A 3U82B 1Q9LB 4MHHI 4OGAD 5E9DA 3T1FA 2VXTH 4P2OA 2WBJA 4RMRA 2Y6SD 2D7QA 3LQMA 4NKMA 5MEPB 5IESH 2MHAA 1LHZA 1J88A 4P2QE 4Y19A 2NLJA 4WFFD 1RUAL 3S7GA 1CDGA 4DKFL 3C2SA 5E5UB 5IR1A 3OAZH 5C7XL 1PVHA 3AROA 2CLRB 1WIUA 4Z78B 5MI0B 4AEHL 4JZJA 5EO9B 1X7QB 1QO3B 3QG7H 2ZCHH 1FORL 1UFUA 1MHEA 5D7SL 2EH8L 2V2XA 1SVZA 2CMRH 1U2HA 4JLRB 5BRZD 1DFBL 3V6ZB 1NJ9B 1JE6A 1QBLL 2X4TA 2ARJQ 3VRIB 1R3JB 4HK3J 4I0PA 2FL5B 1CU4L 3VRJB 4MCZB 4U7KA 2B5IC 4OI9A 2QHRL 4Z76B 3JWDC 1MI5E 5IEHA 5FYKH 4TQEL 1NH6A 3SJVB 1N3NA 4NNPL 5JQHC 4OLUL 2EH7H 3CZJA 2EDKA 1KUMA 3RI5F 2VLRE 4JRYD 1YEFH 1RZIA 3UZVB 3GMOB 4HIHA 4D8PB 1I1AB 5IQ7L 4WUUA 1RD6A 5HHXH 1XCQB 4HCRH 3MRKA 2Q7YB 2ENYA 1QFWM 5FGRA 3HMWL 4PJEB 3U9PH 4HJ0D 2J5LB 1EX0A 3Q1SH 5C3TA 1KJMA 5J9PA 2BX5A 3WBDA 3G5VB 1OP5K 1EK3A 1C08A 1E0OB 3QIUD 1DQJA 3O8XB 2DQIH 4GBXC 1G9ML 1KCUH 4R7NB 3WJLC 3QUYA 5SX4I 1DLFL 1T7VA 4LCWE 3SDXA 1NLDH 5EU6A 1S7QB 1QSEA 3CVHL 3VWJB 4CRPA 3OQ3B 4ZQKB 4I9WE 3LKNB 4JFFB 3U7AA 5E9DE 4J3WA 1F6AA 1T5XB 3SGDH 4HWNA 4HXBL 5FO8A 3GDBA 1S7XB 4ELKA 4QY8B 3V52H 5HHQB 3GIZH 2I07A 1FZOA 2HTKC 1A6UL 5AYQA 4NQCA 5DFVC 2QQQA 3NCJH 4JAMB 1R5IA 3T8XA 4Y4FB 4K55A 1CE1L 4ZFFA 4YPGA 2HFTA 3FO9A 1MCJA 1B2WL 3D9AL 1IC1A 2VZ1A 2YXFA 5DA4A 3S88L 5D1QB 2DD8L 1AGCB 1INQA 1I8LC 5A40E 5F7KC 1F58H 4ZS6C 3RX5A 3UTTB 5BV7B 2Z92A 5EO1B 4IS6A 3C08L 1OAQH 3LZFH 1MWAA 4PRIE 3WE6B 3FQUA 3NCMA 5MENE 3W0WD 1EFQA 3C60D 5F7NC 1FYTE 3GMMB 3QDGE 1GGBH 4X7SH 1EEYB 4W81A 4X7DC 2GTWB 4FFZH 1ACYH 3MRLB 2FB4L 2AQ3A 1DANT 2BVQA 2H41A 4W4OC 4JFDE 5GRJL 4EDXB 5DJCA 5HPOA 3KPRE 3MRHA 1J1PH 1AO7D 3U0WH 1Q1JH 3VDBA 5IJVA 4M1DH 1KJVA 3B2UC 4OT1L 3C6SA 3GSNH 1VGKA 4U6VL 2VERN 2GJ6D 2EECA 1BD2A 4G7YH 2XA3A 4NQSB 4UIKH 5ID0A 4UTAH 3TN0A 1DZBA 3MPCA 4XP9L 1OSPH 1VFUA 5GJTH 4WFGD 3VGDA 3S96A 1ROWA 2GSGA 2RHEA 3ARFC 3Q5TA 3C5ZC 4JY6B 2J2ZA 5IB2B 5EO0A 5CP7B 4M7JL 4M62H 4IRJA 4NHUB 1YQ2A 3OHXA 4CGTA 1A6TB 1F8TH 4WEMB 4A6YL 5I0ZA 3TBVA 4RAHA 3UTSE 4JPIA 5KTEL 3AREB 3P9LB 1DE4A 4PJ9B 1TXKA 1NPUA 4JQXA 1FZMA 3DMMC 5HYJD 4FZEH 4H20H 4J12A 1YPZB 3UZEA 3ZHDA 3KS0H 4ALAH 5KVGL 3HTLX 1QVOB 4KPHH 4P46C 3T08A 1IGMH 3O4LB 2R1YB 3LKRA 1IE5A 3DOSA 1AE6H 3MV7B 3JV4A 5CJOL 2NTSP 1JWUB 2Y07L 4IDLA 4LL9A 5GS1A 1RPQA 4PJDB 1R3KB 1UQSA 1MQKL 5TE4H 1VENA 4HK3N 3U7WL 1MCIA 4UT9H 5A2IH 2WBJB 2GJZB 1I7RB 2EDLA 2J1KA 1IM3B 2LAAA 4HEPG 35C8L 4FMKA 4FFWC 2N56A 3CU1A 3LHPH 2HWZH 1H3GA 3PP3K 3K7UA 1YEDB 2FX7H 1X6NA 2ZG3A 4HIEB 3MROA 4RAUA 2AAVA 1GZQA 2K7PA 2CO7B 2X70A 4PJXA 1P4BL 1XF5B 5I1CH 2VISA 3EDFA 4I0KA 1IFHL 1D5ZA 1TJHH 5FUOH 4QXTB 5JXED 5C0BD 4NBYB 4QRRB 4W68A 5IBLD 3IVKA 3BN9D 1A7NL 3I3BA 1RJZA 3MUY1 1MQ8A 4RIRB 2DDQH 1CZ8H 4HZLA 2OYPA 5I8OH 3HNSH 2IALB 2ADIA 4JRXB 4HWUA 1PAMA 2DM3A 4LQFL 2IGFH 5EG6C 5HJ3B 5E2WL 2AJVH 4N0YL 2WQ8A 5I0DA 4O2CA 3NN8B 1UH4A 5J6HB 3B9EA 4JFFE 1GGUA 3QH3B 1ZEAL 3VFUA 1SBBA 4OGXH 1IEAA 2IF7A 3L1OL 4PYHA 5F8QC 1F5WA 5E8NB 3WYRA 3KJ4B 1YEEH 4U1JA 1RIHH 3S5LA 4ZXBD 2LU7A 1FNEA 1RQ5A 4MHHG 5GQBA 3HN3A 1CFQB 5AZ2H 1KB9J 4Y5YA 4XVSL 4ZOCA 5F93C 3WNKA 4KKLD 3EFDH 2WM0A 1J0JA 3QDJD 4RFNB 5GHWH 4IMLA 3WHXB 3LS5L 2X5PA 4ZTPL 5EZOL 2EIZA 3H3PL 2GAZB 2YMXL 3LS4H 3CDGA 4UT6L 4DZ8B 5L7XH 5JPMA 5JORB 2MMXA 5DWUH 3NIFF 3HFML 4PR5B 4J1UB 3SOBH 1KEGL 2IBBA 3BIBX 4TSAH 2OBGA 3ARDD 4JN2A 4KI1A 4NQCB 2C1OB 4MD5B 2CGRH 4XCFL 5DVOA 3LB6D 3FB8B 3LV3A 3LKOB 5L2KD 5EA0L 2O5ZL 5DJZB 4DEPB 3O0RL 4XRCB 3WEXB 1N59A 4OZFG 3QPQC 2VZOA 3VXPB 2OJZL 4KQ4H 4FXGA 3RIFK 1CT8B 3QQ9D 2YPKB 3MRPA 1DBKL 4LSQH 1CK0L 2J4WL 4YGVA 1KIQB 4NQDD 4RRPA 4PJXE 2QKIB 1FG9C 1ZHKB 3HC3L 4NKIH 4XCEA 4HPOH 1NLBH 3GBLA 3X11A 3EO1B 2K7QA 5D7JC 3LEVL 1QRNB 3VXMA 2I9LA 4PG9B 3ZE2F 5C0JA 4AIXA 4GRMB 2ATPA 4HJJH 4LLWA 4DWHA 3NBNA 4P4KA 4XPTL 2W07A 4OFIA 2BNQD 1UXSB 2HRPH 3RAJL 3BGFC 3B6SB 2EDWA 3D0LA 4XHQA 4ZD3L 2EE3A 2F8XC 2CRMA 5AWNH 3MREA 4EKXA 3BPOB 4KQ3H 2R0ZL 4JDTL 5FOBB 3NMEA 5GS2H 1SY6L 1E6OL 4UBDC 1MSPA 1BD2B 4CJ0A 3FB8A 3O3EB 2NY7L 1A22B 4NRZB 3ARTA 5EIVA 1B0GB 2GFBB 3IJHA 1Y0LA 1II4E 3E6HA 1K2DA 5CEZD 5H94A 3P9MB 3X14B 4V2BA 3KNBB 3H0TA 4Z95L 1UZ8A 3VXRE 4ZNCD 3RVVD 1WBXB 5DJXB 1EGJH 5EUKB 3O2DL 4PRID 5ID0B 1RMFH 4YGVB 3ZE0E 2ZJSH 3HE6D 4WI5A 5LGJB 1N6VA 1WBZB 5FB8A 1J18A 5DD1L 2FX9H 2DKMA 3P30H 2JELH 4KKBC 2BSSB 2X9YA 4ODXA 4JQVA 3IRPX 1FSKB 4HUXA 3RHWK 2VLJA 1DQMH 1TCRA 2AQ2A 3RDTA 1YNTA 2O61B 4V1DE 4MSWB 1LQSR 2VLLB 1CBVL 1BZ9B 5BRZA 3TZVB 5EFIA 5I71B 1RZFL 1VPOH 3NAAH 1UB5B 1LO0L 4FFYL 4I0PD 4KI5E 5DURB 2Y1VA 1SEBA 3QIBC 3O3EA 5F71A 1YUHA 2Q3AA 1G9NH 3UTPE 3O81A 5EIIB 4LKXA 4LPYA 1JGUH 4XZUB 2AJYL 4YPJA 4ZDHB 4HK0B 1NFDA 4DOHE 1T0MB 1T7ZA 4PJHB 3TBSB 1E4JA 1UKTA 2F54B 1UQSB 2E9IA 2F53E 4TVPH 1FORH 4LPWA 2GIYA 1ZT4B 5HHPA 1N7MH 1KYOJ 4PLKD 1LMKA 3PXHA 1GPOL 5EO0B 4QRUB 1T0NA 3NH7H 3KYAA 1ZT1B 1Q0XH 1QFUL 3C5JB 4EVNB 1ZLWH 4LCUA 4Y2OA 1KJ2L 5F3BB 1UG9A 2GT9B 3QUYD 4LRNL 2XV6B 4GG6F 4TQEH 1M1SA 3SDAA 4PTTB 1XF5A 1NBYB 4Y1AB 4LU5H 2YRPA 1FZMB 2BNUA 5DSCA 3QYCA 3IVKB 4QHLB 1SJEA 4TVPD 3VXRA 1XGTA 5J13C 3LOWA 3MRBA 2YD1A 4WW1A 1ZAGA 1MI5D 1V5JA 2YK1L 1DN0B 3ULUF 1A9EA 3QDGB 4L9LA 4NQCD 2UZXB 4O2CB 1IZKA 3BVNA 3U30C 4PGJA 2R1XB 3C09C 5IM7A 1UEYA 5E7BA 2C4FT 3Q1SL 2WUCH 2DBLH 4NYLB 1HWGB 2A9ML 4MAYD 1NFDB 3G6JA 3CX2A 4OLVL 5DS8B 5CP3H 1KB9K 4Y4HC 4ZUSA 2PCPB 5GGSB 3DNKA 3BI9X 1UH3A 1TCMA 1KB5L 5EB9A 3TYFA 4ELMF 1X5YA 4UQ2A 1RFDL 2MFNA 4FQCH 4OFPA 3BSZH 5F21B 5KSBF 4N0CD 2DM7A 1Q0YH 5DDHB 5SX4H 2EKSA 3QEUA 4W6XB 3FL7A 1U92B 1UEMA 4JE4B 4KXZI 3W0WA 2B2XL 1XR9A 2EE9A 4Z7VF 1S9WA 4MS8C 5SX5K 3KAAA 4DKEH 2BHYA 1E28B 2E5EA 4G9DB 3WLWC 3HE7D 4NFBA 5F9DC 2IANE 4XWOD 3VFVB 3KPNA 4ZODA 4LARL 4RWYL 3HLAB 2BNQB 4HKXB 4EN3C 4F3FB 3QULB 3FQXA 5GRUL 2GHWB 2BSTA 2WINA 3DVNA 3A67H 4YHPA 4OV6F 4WW1B 3FOLA 2A83A 2DD8H 4DVRL 1AGDB 5JOEA 4J8RA 4KKLC 1KFAL 2QADD 3BAEH 1NUGA 1BD2D 4KK6D 5E8DH 1F42A 1E4KA 5I1IL 4MA3A 4ISVA 1ES0B 3QQ3B 4HWEL 3C08H 4WW2A 4ZFGH 5J11B 4NT6A 4OCXH 2D31B 4CADA 1HH9B 1RIVH 3FZUD 3MOQA 1D5MA 4M1CC 3V8CA 2A0LD 4X4ZA 4JZJC 1QYGH 4EI5D 1Q9LA 4PD4K 1CGYA 1LEGB 3ZE0F 4I4WB 1MCOL 1TFHA 1M05B 4HGKC 4X7SL 3GMRA 1TVBB 4KJPC 4YZFE 4PBWD 5MP6L 4JRXE 2FH8A 3MSPA 3QXWA 5HHVH 2WUBL 4X9HA 4KK5D 3ILPB 2EIZB 5I1EL 3ALPA 4QLRA 4TNVK 4NUJA 4EQ2A 4P23D 4GW4A 3BEVB 1BZ7A 2JCCE 4JFHD 1BQHA 5E5MA 3IDYB 2MCPH 4N5ED 5E7FA 3GSXB 4K23L 4H8WL 4X4ME 1RURL 4MVBC 5KAQF 5HYJA 2KQMA 3SKJH 1M7DA 4KU1A 5T1MB 1P1ZB 1MHCA 2E7HA 2ZKHL 2EIEA 1YY9D 2V7HB 2BNRE 2V2XB 1MY5A 5BS0D 4HKXA 1BFOA 4XP9H 4Q9QL 5GGRY 5J0BA 4MNQB 1U8OA 5HGHA 3EO9H 5FYLE 3CLEH 5FDWA 4P3DB 5LG1A 1N0XL 1ZVYA 3QI9A 1R3JA 1BWWA 4I0PB 2XG5A 5DURD 3C87A 1XF1A 4GW1B 1UJTA 4E41D 4IMLB 2H1PL 5JPNA 1NCTA 1B2WH 3D9AH 1JRHH 3VFNB 3LKSA 4PRNA 5I1KL 4X6DE 3QPXL 3H9SE 5CZVH 4HBQA 2AJSL 1NGZB 1RZIB 4KMQA 1YMHB 3LZFL 5ANME 4NZRH 2NW3B 1TCRB 1NMAH 3RWJA 4DCQA 3CFBA 3BYYA 4H20L 1CD8A 4MCZA 4H26A 3RUGA 4UDTA 4IRSC 1YY8B 3RX7A 3SKMB 4YHYC 5I8CB 4KKAC 4GUPB 4OF6A 4IOIB 3ZL4H 2H3NA 3L5WA 3VRLF 4OLXH 1NFKA 4YXKH 5BV7H 3FB7A 4Y1AD 1FDLL 4OKVA 3LN4A 4HUMB 4OD3L 3CH8A 3EYVB 3S36L 2BRRH 3HE6C 3T0DA 5ECJE 3A6BH 4QY8A 5I9QC 1U8MA 4PGZA 4GW1A 1I1AA 1CR9H 1P84K 2IAMA 4Y19B 1OGAD 2O5XH 4LSRL 2VLRA 4XCYA 4DKDC 1BZQK 4NNXA 3RI5K 1XAUA 4KVNH 1I8KA 1JCKA 4EN3B 3VH8G 1IFHH 5FUOL 4BFIB 1YN7B 5F1IB 5LCVL 5DT1H 1MRCH 4XPHL 1CGSL 4X99B 1AKJD 1HILB 3JV6A 2FECL 2VYRE 3GSWA 4QRPA 1AC0A 1YEHH 3FOMB 2RB8A 2YPLB 5EO1A 5KTEH 4JJ5B 5DJ2B 5L0QB 4LLDB 1KBGL 4YE4H 1RUMH 4G8EB 1NGPL 4N0YH 3SDXB 5FYJD 4O00A 1S7QA 1XFPA 5C0BE 4RCAA 3TP4A 3EZJB 4NRZA 1FLTX 5IB1B 4PJAB 5BZDB 3IRZA 3MC0A 4K94C 5DRZB 2X44D 4NN6B 2BVYA 3LQZA 3KLDA 5J1SC 1U9KA 4D0CA 2VL5B 2A0LC 1I3RA 1D5IL 4Q74A 3OPZH 2JCCB 1RZKL 4HAFA 3TH3T 5CIPA 1KF9B 2Q6WA 4KROC 4ENEC 2PCPA 3TVMC 5TQ0H 2H8PB 1JV5B 4NQCE 5CD5D 2FATH 4Z7NE 3QDGA 4G42A 4APQA 4LFHG 4GSDL 2OL3L 2HT2D 4HK0A 4U6TA 2R1XA 3O6LH 3ZE1E 4G6AC 1WBYA 4G5ZL 2VZSA 3OR6A 5IT2H 4NHCH 1HNGA 4YHOL 2CXKA 1A4JA 3K46A 3IDGB 5JW3H 3IU3A 2D2OA 3LHPL 5JHLL 4R0LC 3AMLA 3GBNL 1DVFD 1HKFA 4YDKH 4S1QL 1H8NA 3WFDH 2Z91A 3MOAL 3MYZA 1TJHL 1I3GL 1Y18B 5CEZL 3U7YH 3H7BA 1HE7A 1S5HB 1WGOA 4LCUB 4P5MA 2QQLL 1E4XI 3L5XL 5HYIA 4JVPA 3QNYA 3U48A 2Y4SA 3VA6A 4RGNC 3Q48A 3AREC 1XR8B 4KQ4L 1AGDA 3FN3A 3N1PC 2EDRA 2D7PA 4TUOB 1DBKH 1NGQL 2VIRA 2DQFB 3CFCH 2W60B 3BGMB 1JF1B 2FRGP 2E7CA 1ITCA 4OD2B 2YD5A 2F54A 1CE6A 2YUWA 5GRVK 5T1LB 4LSTL 4BQ9A 1AD0B 4R8WL 3E2HC 1NCBL 1B9ZA 4PY7B 2YD3A 2WSKA 1HXYB 2C26A 2V9QA 5CJXC 4U31A 1EO7A 3BKJH 1HZHH 3HE6A 2PYEB 1WZ1H 3IS0X 5GGVL 4UT6H 1JWSB 4C4KT 4FFVD 4UQ2B 2C3HA 2YA1A 3WNLA 4YHKL 3S4SA 15C8L 1VEPA 5JOPE 4WHYH 1MRFH 3P4LA 4XXCA 3OZ9L 4XCNA 3CVIL 4QEGA 1M7DB 1SY6H 3EDJA 2ZCKL 1RULL 1XCTA 3QUMH 3QJHA 1LK3L 4AYFA 5L2JA 1X4XA 1EAJA 3QCUL 1I9RL 2D03L 1AQKH 4G6FB 2GITB 3WIIH 2DM2A 4Z95H 4FQJL 3PHOA 2ICES 3R06A 4HS6A 1RUKH 2YD4A 4V1DB 5GZND 3U6RA 1RUPL 4LGRB 4JHAL 4BFEA 2AGJH 4NJ9L 4X7FC 2OP4H 3UEZA 3LKRB 1E27A 2BHUA 3GI9H 3IDXH 1OWWA 4C4KO 4JG0L 1QSFD 2H26A 4L9DA 3VCLA 3C8KA 4KUCF 1EUUA 4X80H 3MV8A 4RFEA 4PLNC 1R3KA 2PYFB 3EZ8A 3QQ4A 5FO7B 3KYOB 1AGEB 2X4OA 1GZQB 3RY5A 2UUDK 3ALWA 1BVLA 1CDBA 4UILH 3RJDA 3U36B 1DQML 5AG8A 1R24B 3MLWL 4X4XA 1WAAA 3RWHB 3L3KB 5HYJE 3M17A 1JFQH 4BA8A 3BPOC 1QQDA 2GK0B 1IAIL 1YEDA 1XF4B 4NO5B 4ZS7L 3MFFA 4WTZA 4N8PA 3OR7B 3PWPE 3PWPB 1AD9B 3FMGH 4Y2DD 5E08H 4OLWL 3RU8H 4ONHA 2AXFA 5JMOC 3VRJA 5HBBA 3PGFL 1ZK9A 3IDJA 3F65A 3BEVA 3BQUD 4KK8D 5BS0E 4XC3L 4TULH 3D5OF 5BO1L 5HYSA 5D8JL 2AEQL 3SDAD 4N0UB 4PJ8B 4JDTH 4C83B 5K33A 2A83B 2CO6B 3QUXD 4MA8H 1TQBB 2DOCA 3INUL 3X3FH 4H0GA 4QWWD 3MLXL 3F7QA 4P5TB 1H0DA 5DMJB 1PG7L 3T0EA 3UTZA 1OSZA 3WHXA 3BUYB 2O5YL 5DD6B 1V05A 4Z0XA 3VCLB 3QI9B 1U8LB 5IUSA 5LAXB 1HN1A 3ILQD 4Q0XL 4JY4A 1RMFL 3PWVA 4GAYA 4XPBH 2CDEA 4HSQA 1R0AH 4GRLD 1B4JL 5E0QA 3RGVA 4HDIB 5T33H 2AEWA 1EEYA 5AZEH 2VC2H 2YS4A 1NGZA 5HGBB 3RNQB 1I8KB 2YKLH 4PJ9D 3I6LE 5MENB 1FAIH 4KJWC 3GSUB 5DZOA 4C58B 3IFLL 1DUZB 2ZCHL 5JO5A 3DBXA 1UGNA 2PO6D 1MJ8L 4TNWF 3V79C 3K1KC 4XVTL 4CDGC 5IEKB 5BOZG 1OAUL 2VL5A 5FDWB 2MSPA 3DTXA 5GS0D 3B9AA 2ZUUA 5IMLB 5I18H 4PRDA 1K8DB 1TQCB 2LV4A 4OQ1A 4LF3B 1INQB 4JVUA 3V5DB 3NPZB 4YC2C 4UOJA 3SKOB 1YEFL 2AEPH 1U6AH 1RY7B 5FYJU 1P69B 2DLGA 3D18B 3NABL 3MRPB 3BT2L 3NGBB 3QG6B 4NIKB 3GJFA 4Y5VC 5T3ZH 4IRJB 5DD3H 1V7ML 2B2XH 5I1HL 1KCVH 2OJEA 3U9PL 3T2PA 1QBBA 1WFUA 1X5ZA 4DKEL 1ADQH 3ARBA 2IFGA 3WHE0 4E42B 3TYGL 4NJAL 1LE9A 1WEJH 5F1OB 3RWCB 5DJCB 1JZ2A 2R29H 1S8DB 4O9HH 2H2SD 4BSJA 1K4DA 2A2QT 1WFOA 3W2DH 2YPLA 4CJ1A 1QLFB 3X12B 4K7FB 1F11B 1FJ1B 1SM3L 3VWJC 3E0GA 3OG4B 4P9HL 2SEBA 2VDRH 3BGMA 4G6JL 2XFXB 5TF0A 3V6OC 2IQAB 1SJHA 1G7JB 1JIBA 1N59B 3W81A 4WU5A 5DUPH 4ZFGL 1DCLA 1V8HA 1LDPL 3QNYB 2Q8AH 4GAJH 4OQTH 1GIGL 4HIXL 4ZXBB 5EFIB 2VDMH 1JPST 4XCYB 1CG9B 2PUQT 1MCOH 1T20B 4XVUD 3FKUS 2WUCL 1OGTB 3KYMA 5CIPB 3C60C 1WUNT 4E41A 1NGYB 4YFDB 4K3JH 2VLJB 5I1EH 4U6XB 1T83C 5DJAA 4LKXB 4QRQB 5CMAA 5DUMH 3S4SB 4R4NC 1NANH 3MX0A 4ZAKB 2Z4QB 4PY8J 5JA8B 1E4XL 1A4JB 3MV9E 3D85D 3GMQA 4UT7L 3T1WA 4H8WH 4PJDF 2HG5B 4NRXA 4UAOB 4L1DA 4FZ8H 2VWEC 3BUTA 5DZLA 2D4DA 4P2RB 3MA9H 2O61A 1J8KA 3PP3H 1BQLH 1TTFA 4LAJH 1A3LL 4FG6D 3EO9L 4Y2DB 4B53A 1KCSH 5IIEB 1OVZA 4QHUB 4U4BA 1N0XH 4M9PA 4KRNA 2SEBB 1XF3B 3OKLA 4W70A 1PZUB 4Z0BL 4X6FA 3VFMB 5KG9A 4R9HA 3TJEL 3UJJH 4L3EB 5HPMA 1TIUA 1MAML 2DQGH 3R0NA 4Y1AA 3UTQA 4DVBB 3FFDA 1Q9WB 4FQQB 1KTDB 4L3CA 4JKPL 5F7UA 1AXSA 5A3IC 4NQXB 4XZUA 2PETA 4UTAL 2R2BA 1AJ7L 1KCRH 3WIHL 1XGPA 1F4WH 3OGCA 1I1AD 4K9EC 3MRCB 5JPMB 2J12B 5C2UB 1MNUH 2BVPA 3ZSTA 3GUTA 4QRQA 1KLUA 4OCWL 1YEGL 4M93B 5A2LH 2N1KA 3UBXG 4PS4L 4I8DA 3BIAX 2EXYD 4WI7A 5GGSA 1QLEH 4GRLB 1AKJA 3IS1X 4P5MB 3DECA 3EJZD 1YEKL 4GAGH 3QNZA 2VXVH 1D9KD 4CDHA 3FT2A 1NKRA 4Y16C 3BP5A 1FDLH 1J8HA 4PJFE 5CILL 3SKJL 4C56D 3BPCB 4X6DB 4F7CB 2NR6D 5D5MF 3RBGA 4RFNC 4U1IA 5IB3B 5EOQL 2VLKA 3CFEB 1OT2A 3V5KB 3X13A 5J6GB 5E4EB 4I9WD 1OL0A 1UZ6F 3HUJE 5ILTL 4GXVL 5TQ2L 2HTLD 4X7TB 4YBLB 1AXSB 1KENH 3FRUA 4IRZH 3T0EB 4AK1A 3MGAA 3GHEH 3I3DA 3UDWA 2NX5B 3ZT6A 4ODWA 2H6PA 3SE8L 3QHFH 2FZ3A 3IFOA 2OM5A 5ETUA 5D93B 2X1QA 1BOGB 4H0HB 3VFTA 4X5WB 4F9LA 4NRYB 1FSKC 4ZFZA 1DVFA 3D2UB 2ARWA 4YO0A 1XGYH 3B6SA 1PD6A 5HDBF 3OWEA 2PKDA 1R5WB 1WZMA 1DBBL 1IILE 4BQ6A 1XGUB 3I6KA 1NGXB 2XXCB 4F58L 5FK9A 1L0YA 1ZA3A 3P4MB 5E9DB 1OPGL 3CPLB 4LEOB 4JPWH 4GKNB 4Q9RL 4HH9A 2CSPA 1G7LB 1DL7L 4MVBD 5D7JA 3VJ6A 5AUMA 4YXKL 4C83A 3MXWH 3WNPA 2BVOB 4XPFH 5M95B 1EO8L 2CLVB 2DQEL 4FQXC 3MTRA 1T22A 1ZEAH 1S7UB 1YDPA 2FCBA 5EZIL 2EO9A 3P0YL 7FABL 1MJ7L 2ZG1A 2F54D 2WWKT 2PW2A 4HKZA 3KPPA 3S37H 1CDYA 2B1HH 2D7OA 2IPUK 5GS1C 1G7PA 1PG7W 5IF0A 3B5TA 4HUWA 5DRWA 4OQTA 3LS5H 4ZTPH 1U3HC 3BXNA 4XPHH 3PWJA 2VQ1B 4G8FB 1U8HA 3BJ91 3EDEA 1VERA 4URTB 4OIBA 3RWIB 4LEXH 3DV4B 1YN6B 2HFFB 4IHOA 4M7LL 2C3GA 1R5WA 3S9DB 1PKQE 4DGIH 2Y6SC 2H9GB 3AU1B 4ZOBA 4HH8A 5E1AA 5GISL 1JNJA 3PGCB 3AS1A 5FO9B 1EDQA 1OM3H 2CPCA 4GRWF 5TE7L 1W8NA 2I07B 4N8VG 3SDYL 1U8QA 4XAKE 2BXZA 4HG4J 5FKPA 4PJEA 1JHKH 4XXDB 4BQCA 4JY4B 1I75A 2P5WD 1T22B 3UBXA 1U2CA 3TWCL 4OLZH 1QSFA 1IGTA 1CWVA 4OTXL 4XH2A 4GMSH 1NAMA 4LSQL 5B8CA 1MHEB 5C6TL 2QADC 3FFCA 3KWWB 1MWAB 1WAAF 1FFRA 1J1OL 2EE2A 2H2SC 1CF8L 1S3KH 2X09A 4KC3B 4M1GH 4QHKJ 5INDA 4DUWA 2G60L 4AM0B 1LNUA 4OM1H 3STZA 4ZAKC 1LEKA 4IOIA 4HKBB 4WI9A 3S3SA 2VAAA 2H3NB 3AB0C 4M5YH 4AQ1B 4XGZB 1MLCB 3VXQB 2FSEA 4O2EA 3MBEC 2ADJB 4BH7A 3K81A 1J9CT 5E70A 3V7AE 2VDQL 1P7HL 2L4OA 3K4AA 4OKVB 5J7CC 5D96B 4K71C 3LMJL 3OKLB 4HIHB 2F5AL 3GK8L 1U8PB 4NN6C 5LKNA 4PJHE 3V4VL 3L5WB 2X4NA 4F9PA 4U3XA 4PJGA 1ZTXL 5D1QC 4P49A 2IAMB 2A6JA 5ALCL 3EIFA 1JHTB 2XQYG 3B43A 3MRFB 1XGQB 2FJHB 4NKDA 4YEEA 3PDGA 5FA3A 4UZGA 4LSTH 2BSRA 3OKMB 4OZHE 3GB7A 1UJ3C 1LO4L 4AEHH 4IMKC 2NY1C 4R7NA 3OKNA 1JFQL 2ERJC 3GUTB 1MCFA 5IG7A 4ZUVA 3OGOE 4E42A 2DLFL 3R1GL 1GOFA 3QRGL 4OLWH 3VG9B 1G84A 3OGCB 5B22A 1VFBB 1T1XA 3BKML 1A6TA 1YYML 1T83A 5LXGH 2NY3D 3UROR 1LP9A 4L4JA 3NFSH 1S7XA 1WZKA 3SBWA 3ECBB 3QAZB 2ZSVA 3OZ9H 2E27L 1DE4B 4PJ9A 4M6NL 2R2EB 3FO0L 2DL2A 3AREA 3VFOA 5AAMA 4WFGE 3SO3C 1AHWB 1X9QA 4WFFE 2IWGA 2FO1A 4OGYH 3RFZC 4K7PL 4BQ8A 5BS0B 2V9TA 3T0WA 1CXLA 1X5HA 3TN0B 2DLTA 3WSQL 1A9EB 4L9LB 2MTPA 3RA7L 2VXUL 4MNGA 3FB7B 4L4VD 5HVWA 5DEGB 4WJ5A 2AGJL 2I60H 3HC0A 1KN4H 4E41B 5CJXA 4WWKC 3FAXA 1D5MB 4Q7DA 3AC0A 2V2TA 3BZEA 5FA3B 4MZ2A 1G7MA 4PBVC 1JUFB 1LDSA 3GGWB 1AGFB 4HUNB 2NY4C 5EU3A 4NC0B 2EKSB 2YKLL 1IGJB 4P4RA 3VE0A 4EN3A 5T5NF 1T2XA 4NQDB 1CLYH 3L7FB 2NYYC 3LSOA 4XVJH 2H6PB 1V3KA 2HN7A 1MJ8H 2Q87A 5ERWA 4BELD 4F7EA 3UYPA 3EDKA 4RMQA 3KPNB 4FS0A 5JIIA 4FXLA 5IBUB 1DFBH 1D5BA 2WLZA 3MO1B 3PGFH 4LHUB 4NQSA 1IEHA 1FGVL 3VFRA 5D7JB 5HI3C 4WUUE 1HYSD 5GPRA 5DK0A 3P73B 3ARDB 4YHML 1I9IL 4OZHA 5F7MC 3E8UH 3LD8C 1ND0A 3DVGA 3P4MA 1T2QL 2I25N 2J88H 5E94B 4OLYH 2WBWB 4G43A 4NT6B 4JGUA 3VRLE 3DUUA 4BZYA 4MJ5B 3F12A 3NA9L 5FYLH 3KPPB 1B90A 3K4ZA 1URLA 5ISZD 4A2MA 3IB4A 3S5LB 3QWRD 1F2XK 2ITCB 1G9MC 4XB8A 2A6DB 5TH2A 5EORH 2LVEA 1DEDA 5FYKD 4XNUH 1EA9C 4GMTH 4ENED 3L5JA 3EHBC 1KEML 3X17A 1G7HB 3S97C 1G9MH 2WMPA 4EBQH 3FQNA 4ZNEA 5E95B 1W0YT 2HT2C 1CDJA 1H8OA 2X4OB 1HQ4B 1D7FA 4HKJB 4IDJH 3RP1A 3U0WL 5KVMC 4WWID 2LVCA 3STLB 4OT1H 3VA2C 1Y18A 4J1UA 1A3RL 2QR0A 3TBYA 2VDRL 2J3SA 1B88A 5JUEL 5GS3A 5I74B 3O3UN 4F7MA 1QQDB 2GK0A 2B4CC 3WDHA 3GI8L 5GGTH 4WCYL 3ZKND 3BGAA 4P46A 5DJZA 3DURB 4KJYB 3UYRH 3D39B 3LKOA 3CXDH 3D48R 1E6JH 4U1GB 2PR4H 5BVPL 2OK0H 2A6IA 4RZCB 3UMTA 1H15B 2HT3D 4MNHB 5DJDA 4R90H 1J05A 2P7TA 1CT8A 4MA7H 4M62L 4WFED 3MV01 2VLRB 4Q9BA 4LPCA 4G8IB 1ZE3C 1FG2A 2RFXB 4KGJA 3T1FB 5ETUB 3AY4A 3LY6A 4DAGH 1B0WA 1YNKH 4MDJA 5IVNA 2VN7A 5ISZE 3X11B 1DSFL 5DQJB 1ZLSH 2I27N 1MIEL 5I1HH 3BPLB 5F1KC 1JP5A 1MWAH 2VDPH 5DVMA 3VD3A 5F1NA 2VDOL 3KPRA 2EEBA 4G6KL 4IIQC 1GGBL 1ADQL 4PLJD 3QDHA 3W9EB 3H3BC 2FB4H 2W0FB 2PXYB 2E6JA 2HLAB 2I5YH 1RJYA 4NQEB 4I3GA 1WSST 4NM4L 3HI5H 4P9HC 1QFWH 1UENA 3QCVL 1OWRM 3TA3A 3N50A 5ABDE 3T0EE 3MLZH 3ARRA 5E8NA 2Y07H 2IAND 4M1DL 2PXYC 3SDXE 3VXPA 1MAMH 3CC5B 4C56A 4UU9B 1EEZB 1ERNA 1NBZB 5ACLA 3SPVA 4Q9QH 2EDEA 2QKIA 5DQDL 4HXAL 1JHLH 5IWLC 3C5SA 5MEPA 4NKMB 1I85A 4FXKB 4PV9B 2NYYD 1FPTH 1TZGH 3OJDB 4D0DB 1H15A 3HRPA 4MNHA 1V3JA 3VXUA 2KPNA 4OI8A 2JB6A 3P4OA 3VXMB 3RZCC 3T0BA 2PYED 3O3DB 1I9EA 5I2IB 3HAEB 3PWJB 4G8FA 1OTTD 4LSUH 1CFSB 3KPSD 1K6QH 2CLRA 3LN9A 5FB8B 5C08D 1HSBB 4RBPH 2X2YA 1GJIA 1TZIB 2Q8BL 2NTFA 3EOAA 3QG6A 2Z93B 4OSUH 4LQFH 2ORBL 2XKNA 4QO1A 4N1EA 1KGCD 4GJTB 2R1WB 5MENA 2VDKH 3RKDD 3O45A 3RTQB 1FZJA 1HHIB 2E7BA 3IDIA 2E8YA 3GNMH 3F6IA 4OFYA 5GS0L 1XR8A 5FKAB 3IJYA 1LD9A 1GC1L 1K4CB 2VIRB 1TETL 3O9WA 1IAKB 5IMOB 3PE9A 3SJVA 4HUUA 4ZYKB 1CICD 2NY6B 1MJUL 3KLHC 4DN4L 4HUVB 2R0KL 3O6FD 5D7JD 1U42A 3RBSA 3V5HB 2YZ1A 4NC1C 3MACH 4LOUC 4Z77B 3Q6GH 2YMXH 4WI2A 1I1CA 5DEGA 1BECA 3U7WH 4L4TA 4DGVH 1ZGLB 4LAQH 2P46B 1M71B 1TQBC 4FQXB 4MAYB 4ZUTA 4OIIL 1FCCA 1JTPA 3LPFA 1TJGH 5DUBA 2O5XL 4LSRH 4I3RH 5HHPB 4TRPL 3A6CH 3SOBL 4ODTL 4KI5D 1EFXD 4PP2A 5DHYA 5LWYH 3LKPB 1R3IH 3RQ3A 3VXTB 4M8VA 3ROLA 4HMCA 5CP3A 5EU7C 4R4ND 3JV0A 4MNGE 4JFFA 5LBSL 4MB4A 3KR3L 3VMNA 2OSLB 4Q9RH 4JO3L 1YEKH 3JTTA 3UTTE 4ZG1A 1YEHL 1HINH 3H9HB 4FOMA 3S3JA 3DV6A 2GTWA 4LLUA 3VGBA 3OAYK 5FGBA 3QDJE 3QUXB 4PJCF 1F3JB 4LK4A 4N8VB 5E2WH 3ZHLA 4PTUB 1ND0B 3DVGB 2DS4A 2GTZA 2BMKA 4UAOC 3TVMD 1IAKA 1XGTB 2YC1B 3BIKA 3OKEB 1J86A 3VFRB 1MLBA 4JY5H 4OGXL 1MAKA 3L1OH 4LLVA 1D5IH 1KNOB 1RIHL 2B5IB 5HI4D 2HVJB 2QJDA 4OBSA 4Y4KC 3C5ZB 3HC0B 2ZOLA 5E94A 5B3JE 2NY5C 4LVOC 1H5BC 32C2B 1JN6B 2FR4A 1G7HA 2FEEL 3PP4H 1T0NB 1T1XB 1FL6A 5GRXG 1Z9SA 2VR4A 5C0DA 5CEZE 5GS1B 3LS4L 3P0VL 3SE8H 3UPRA 2CLZB 2FWOA 1IAIM 5GGVY 4MQ7A 2QLVB 3MRMB 5IT2L 5DWUL 2IH1B 2P43B 3MJ8A 3R4DA 4YK4C 2CKNA 1HEZA 5ACZA 5CP7A 5C6PB 1AQDA 4Z7WB 1T04A 4POZC 3EYFB 3HI6L 3UJTH 3WFDL 3TFKC 3WUWG 2ZOKB 4EOWH 3VD7A 1E4WH 1S9WB 3QEQA 4J2XA 2Z35B 4PJEF 4FA8A 5EC2B 3QEGL 4LKCA 3RZCB 1MCNA 2VISB 2AK1H 3O6ML 4XCFH 1N5YL 2UWEA 3DROA 3TZVC 5I71C 4PTUA 5DD5L 2NXYB 2J6EL 3FQXB 5F9OL 4F3FA 2ZSWB 1KPUA 1YMMB 3KJ6L 3ULVC 3QQ4B 4PB9L 4RISL 4EUPH 3B9KC 3S96B 1U8NA 1NCUA 4XCCL 1FGNH 1CIUA 2J4WH 3UTSA 4TN9A 1PQZB 1S9YA 3AXLA 3QH3A 3OKDA 3L7FA 1JNLH 1CF8H 1S3KL 3O8XD 5CSBA 4HPOL 4PJDA 3M17B 4OM0H 2ZUYA 3RGVB 3B83A 1RZ7H 4NHUA 5IKCB 1NCBH 2MPAH 3IDUA 3LEVH 3T77B 3MNWB 3BD3A 3GMRB 1B6UA 1WTGT 2GJZA 1JGDA 2EIDA 3VGAB 4JM2A 3QIUC 1F90H 2VDQH 1KPRA 5JTWA 3C8HA 3DBXB 4NRXB 4QXGH 3TO4D 3RAJH 2F5AH 3MV7E 4ZUWA 1AO7B 2GK2A 3O6FC 4M61B 1FIEA 1FVCA 3HMXH 4PJFB 4R4BA 5DD0H 3WUWB 2WBKA 5GGSY 2XZCH 4O58L 3MOBH 1RULH 4X6EA 4MAYC 5DF0A 2Y06L 1OCWH 4WIQA 1FH5H 1CL7I 2C3VA 1OM3L 4OZ4A 1UCTA 3FB5B 5DS8A 2EYTB 1IC4H 3ETBF 2JJTA 1EHNA 3VXUB 1QACA 1EEQA 5LAXA 2ARJB 2OP4L 2NY6D 1U8NB 1PZ5A 4WI3A 1X5LA 2F8VA 3EGSA 4X6DF 3LH2L 4X80L 3W0WB 5TFSH 1OTUC 4NQTA 4YHZH 2JELL 3A6OA 3V6FA 2BVPB 1OP5H 4P5TC 2E27H 3G08A 4R96A 4UILL 4LRNH 1A1NA 4H25A 3VFVA 4EN3D 3C2AL 4HKZB 3QJFA 1S8DA 1PX4A 2ADFH 5T3XL 3V4UL 1KPRB 3P4NA 1BIIA 4ZS7H 2CR3A 3QUXC 1HKLH 1XF2B 3RUGB 2EH8H 3LRSB 3WLBA 4Q2ZB 5C0IB 1U3HD