3QIUB

Crystal structure of the 226 tcr in complex with mcc/i-ek
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
184
structure length
167
Chain Sequence
b'SRPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVYPTLLVCSVSDFYPGNIEVRWFRKEEKTGIVSTGLVRNGDWTFQTLVMLETVYTCQVEHPSLTDPVTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS II HISTOCOMPATIBILITY ANTIGEN, E-K alpha chain
molecule tags Immune system
source organism Mus musculus
publication title Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k).
pubmed doi rcsb
total genus 33
structure length 167
sequence length 184
ec nomenclature
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qiuB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3qiuB01
2AEQH 3MRNA 4J4PA 2DBLL 4E0RA 4MJID 5E6IA 3PWUA 1WVZA 5IOPA 2GYSA 2VLRE 5T3ZD 5JPMB 4R9HA 2Z4QA 3VXOA 5BMFL 4NZTL 4W6WB 1U2HA 3QPQD 2VC2H 4F2MA 3C5SA 1RZFL 1MCNA 3UPAA 4OV5A 2EIZA 2A74A 3BISA 5HYJE 5F9OH 1WLHA 3MCLL 4U1IB 2P5WE 1E6OL 4R4BA 2VUOA 4IRJC 5TDPB 1NJ9A 5E8EB 1FVEB 2YN5A 2YUVA 3CMGA 3P0VL 3UJTL 3GSOA 3GBNL 3UJIL 4ZOEA 3FZUC 4G5ZH 1INQA 4AZ8A 4BUHA 4CL7A 4I3RH 5BQ7B 3VRIA 1QZ1A 1RUQH 3ARUA 4N0YH 4IHOB 3HC3L 5I1GL 1TTFA 3ALPA 4BZ2L 3MXVH 2UVEA 1D6VL 5DJ0A 5FUCE 4G8EA 3ZHDA 1FO0B 5F1SA 4WWKA 1P5VA 1TVBA 1FYTB 2B39A 4WUKL 3TCXA 5C0AA 3GSVB 2FBJH 3S37L 4JKMA 2VDOH 4EI5A 4LIQH 2EH8H 3OXRB 1S9VA 1DVFC 3CFCL 4ELMA 4KHTH 3NAAL 2YHGA 1JL8A 4WW1A 2R2HA 3RWEA 3OG6B 1FG9C 4AT6A 1T1ZB 5EU4A 1E4KC 3S4SG 1CYGA 3RX5A 1KIPB 4RAUB 1EHLL 4Y5VC 1CDGA 1CCZA 4U2YA 4Z95H 3TH3T 4U1GC 2XFXB 4RA0C 5GRXG 1OY3B 5EIIA 1LO0H 1XZ0A 4LSUH 4NN6B 5C0CA 1T2QH 2YPLB 1DBAL 3RVXC 1FZKA 5E8DL 2NY4D 2ITCA 2GK0A 3CZFA 1DVFD 3KPQB 3MRKA 3PIQA 4AH2A 3EKCA 3KPRD 2GK0B 4QTHA 4P23C 4R3SB 4DZ8B 3WIHA 2AXFA 1U8HB 2XTJD 4Z0XB 1MI5E 3T3PE 4R4NC 2ZNWA 3CFEB 1GIGL 3OZ9L 4R3SA 4N8PA 1UJ3C 4HZLA 1OSPL 2R0WH 3JV6B 1C08B 2XKNB 2YPLD 3KPQA 1ZMYA 2BSSA 4C56A 2DDQH 3Q0HA 1CICC 3VFNB 2FECL 4LKXB 4LGPB 1LHZA 3RI5F 5EN2A 5CP7A 5GGQH 4FFVD 5H94B 2BHUA 4R6UA 1ZGLM 2VR5A 3QUKB 3ULVF 3QDGD 3ZKNC 4U4BA 4KK6C 2BVUA 2B2XH 1WFOA 2GKIA 1N5AA 4PJ8C 1R3JB 1E28A 3FN3A 1CFNB 2AQ1A 5FYLE 3ARWA 4M1GL 3JWOL 5B8CC 4KROD 4QHMB 5BOZG 3X3GH 5DUPL 3O2WL 3F62A 3ROOB 4FFVC 3VXNA 1OTTD 4KVCH 3TIDB 1Z6JT 1UXSA 5EU3A 1OAZL 3MGTA 3KPOB 1F4HA 2NY0C 2JB5H 5ETUB 1X5ZA 2FLBT 2GTZB 3M07A 1A14L 3KPOA 4XNUL 2VL4A 3QAZB 2A0LD 3B6SB 4G8FA 1JGDA 4U0QB 1JCKA 5EUOE 3RKDC 4FQLH 3F5WA 2BNQB 1CZ8L 5KVMC 5DHVH 3GSNH 3SDDA 1M4KA 3PDDA 1EZVY 4P5TA 4ZTPH 5C6TL 5E8EA 3O2DH 4Y1AB 1PG7H 4XMKH 1ZANH 3T2NL 2ZUSA 4JY6B 1C1EH 3OF6A 4C4KO 1BD2D 32C2A 1VACA 3C8HA 43CAB 5ESQB 4XNYL 3W0WB 32C2B 1RMFH 4CVUA 4YHNA 5KSBF 2OMNA 5J3HC 3JTTA 4PJ7E 3MRMB 4HIHA 3A6BH 1RJCA 4X7SL 1J88A 5EFIB 3BQUC 4LNRB 1KPRB 2GEEA 4APQB 3PWNA 4U6XB 3FAWA 4KRLB 2P43B 1XGYL 3TZVB 2ZUVA 1I8IA 1W0WA 2YSSA 4ZODA 2R23B 3KYAA 1F11A 1D7FA 4R4FL 4LAJH 4O5LL 4GRWH 3WUZA 5I18H 2Y36H 3MCKB 5DFTA 1ZXQA 2WIIB 2Y7QA 5DFWH 5HI4C 3UZEA 2ZCKL 3BP6B 3L7FA 2D31B 1QBAA 5CJOL 4CU6A 1BBJA 4ZUTA 3LS5L 3V4VH 3TO2A 2I5YL 3EYVA 3T2QA 3RGVC 2EC8A 2W60B 2EYTA 3V0VA 4KTYA 1LP9A 5GZOD 3PABB 5I1EL 3MO1B 1F4WH 4MVBC 4UZGA 1U95B 4KRPD 1FDLH 2EH7L 1S8DA 3KLSA 5TE4H 3F12B 4ZUWA 3OPZH 5ADPH 3H7BB 5E0QA 4H88L 3QQ3B 3MRDB 1KCVH 3BP7A 5KOVC 3CH1A 3NPZB 3E0GA 5LXGL 3HI1B 1JWMB 1NEZA 1Y0LA 4YDKL 5FF6B 1IAIL 4PRPE 5EC2A 4ACPA 3X17A 1F02I 3N1QC 3FJTA 4KMTH 1XMWA 2FIKA 5DZLA 2QQLH 2R0LL 2YRLA 5FA3B 4JEGB 1JPST 1CFVL 3JV4A 3QDMD 4B7LA 3UMTA 3OKLB 4K9EH 3DYPA 2R1WA 3LHPL 2HN7A 4MZ3A 1IT9L 3FO9A 1EGJA 4HXAH 1N4XL 3FFCA 2G2RA 1E0OB 1MFCH 2DD8H 5IK3B 1YN6A 4YWGH 5TF1L 3W39A 2NY0B 1EJOL 4O51B 1VEOA 2X4TB 1YEIL 1EVTC 3OKNB 4M61B 4QTIH 3HLAB 1BFSA 3CK0L 4CADA 5KANI 2LAGB 1FO0L 1QEWB 3QI9C 2RFXA 2VABA 2X40A 3QJFA 4NQED 2ZZUT 1OLZA 2FZ3A 3QUML 4X7CC 4X98A 4NC2B 4LVNC 1IZKA 5TFSL 2DOCA 3T0WA 3O6FB 4S10A 2IPUK 5IMMB 4P46A 1TIUA 2A74B 3FRPG 3L3GA 5HVGB 4XCFH 5AZ2L 3PP3H 3S6CA 3MLWH 4U3XA 4I0KA 2IADA 3LN4A 4QRRA 4G3YH 1R0AH 5B39B 5E7FA 1OTUC 4LHUB 4GRLA 3MLUL 4HKJA 1AD9A 2XZAH 5SWZA 3BT2H 3IXTB 1AGFB 1A6ZB 3IYLW 4ENEC 3C5JA 4Z7NE 5E9DE 4GMTL 2WWKT 2X4PA 4IIQB 3GI8H 3B3IA 1HWHB 4P59L 1ADQH 3TFKC 5GISL 1U8MB 3GBMH 4WEBH 2IPKB 2OM5A 2GJ6B 5F7NC 2Q8AH 1RD6A 2YD5A 2VLKD 1T7YA 5FYJU 4X4YB 4MXVE 1T1YA 1JHTB 3BDXA 5FHAH 2XACC 4YZFE 3RWFB 5CMAB 3I3BA 1AHWC 4KKAD 1JHTA 3F8UB 5AG9A 3EYQC 2VQ1B 1IGTA 4YHKH 4JFHD 5C7XH 1I7UA 4JHZA 2YD9A 4RGOH 4NN6C 4RX4D 4DGVH 1U92B 2VDPL 5B38B 1IGYB 1CFTA 1WWAX 5C0ND 4NIKB 2NY5H 3HMWH 3RRQA 2VERN 4YC2C 1LEGB 3FQUA 4YHYC 1A02N 5I8CA 1HHJB 1J8HD 2HJKA 3QDJD 2G75B 3NFPA 5DMJB 3ARDD 1N0XH 3WL9A 5E08H 1NDGA 1JF6A 4G9DB 1J0JA 1J1PH 3R1GH 2AEPH 3EYQD 1IKFL 2ZUWA 1HXMB 4KXZH 3C6SB 2J2ZA 4XMLL 3S34H 3DUSA 3ULUH 1SYVA 1OGTA 2BVQB 1Q9KB 2FO4B 2F54B 1A3LH 4Z7VF 3KYNA 4YDJB 1U8QA 5CJ5A 4WW2A 5CIPB 4TULL 3WO4C 4KKBD 4Y16D 2IGFH 4UB0L 2DJSA 4XPGH 5BVJA 1WCQA 2VO5A 3SDCB 3MOAH 1PJ9A 3Q5OA 3LN5A 3MLTA 1F3DJ 3NFNB 4B5EA 2J7LA 4NQDE 3GRWL 1JYVA 1QFWM 2ATKA 2NY5C 2VH5L 4V2CB 2WNGA 3QEHB 5EO1A 3WNOA 1I3UA 2GJ6E 1HIMH 1QRND 3PWJB 4QRUB 4OFKA 4X6FB 5F9JB 5J1SC 1UJ3A 4O2FB 2FNBA 4LF3A 5MERA 2ZPKL 1NGXB 1CD1A 5TQ2H 1XIWD 3HB3D 4KXZI 4YQXL 5DJ0B 4Y4HC 2ZNXA 2XOTA 1BLNB 4I2XB 1JZ7A 3MQIA 4YLQT 1OQXA 3MCG1 1C16A 4HS3B 1P4BL 4HLJA 5FO8B 3F7YB 1F3DH 3UBXB 2DQFB 4LBEA 1JPGA 1KJVA 3D85A 1IM9B 5E4EB 1ZT1A 3VI3F 3BPLB 5DFVD 3K4ZA 3T1FB 1NDMB 1R24B 4KJYA 3I3DA 3KPTA 4GG8B 3DTXA 3NFSH 4NJAH 2Y5TA 1AO7A 1U8MA 5F1NB 5BO1L 4HK3N 4JQXC 3V0WH 3CFBA 1HE7A 1UADC 2Y5TB 4N8CL 4XXDA 3PL6A 3QRGL 4L4VE 3SN6N 4HJGB 1NCUA 1P4LB 2JIXB 3ZL4H 2F54E 1EO7A 4QXTA 5T1KA 3MNZA 5MENA 1P53A 3V6OE 1KLGA 3DV4B 4X7FC 2YUWA 3SGDI 4YHOH 1NQBA 3RKDD 1FN4A 2E7LC 4J23A 4R7DA 1A6TA 1I9JH 2YC1B 4NPYB 4R90H 5ERWA 1Y6NR 5FO7B 1LEGA 4K07A 1KJ2H 1IGJB 4U6XA 4XNMA 5HGHB 4X8XA 2DMKA 1MIML 1KFAH 3SDDC 1NUGA 4QRPE 2ICWA 3RX8A 1T0MA 3ULUC 4X6DB 4X4MA 3VD9A 2CIKB 3UCRA 2DI7A 5I8OL 5I1DA 4Z95L 4PRBA 2WZPD 3DOSA 4FQXB 3BP4B 5D7LA 5JXAL 3LY6A 1F58H 4FG6D 4D9RD 1T2QL 3ARGC 4PJFF 3HI6L 3GMPA 2Q1EA 7FABH 2XZCL 3SGJA 1TQCB 3HRZB 1L7TH 1RIVH 1CTOA 2GIYA 1A7RL 1NMCC 5BV7C 4WNQB 2V17H 5EC1A 1FC2D 1F5WA 4X5WB 3WIFA 1IZJA 5ISZD 2R4RL 4UILL 1UH3A 3F7VA 5C0JA 2R2CA 4AG4L 1A9EA 3LKQB 1UCTA 1Z9LA 3F6LA 3MRPA 1HINL 2QQNH 1KV3A 1U91B 1S9XA 3RX7A 2H6PA 4D0DB 2C3VA 2EZ0C 2IAMC 1U93A 1K8IB 3BUYB 3F7QA 1S7WA 4RISH 5CZXD 1YMMA 1FC1A 1AXTH 3O0RH 1YY8B 5GGQL 3WIFB 5FA4B 2EDWA 4G42B 4HV8B 3WKMH 35C8L 1RUPL 2YEZB 3FB6B 2DWDB 3KS0J 1BECA 3R4DA 4MHHG 4HG4J 1G6VK 1CE1H 3W9EB 4BYHA 2Z8WC 4ZO7A 1D9KB 1G7IB 1X7QA 3EHBC 3HC4H 2MQCA 1MFDH 4OD3H 4PJ5D 4JAMB 2ICEA 3ARBB 3TIDA 2SEBB 5A2JH 3SDCD 2YXFA 3DX7B 2MWCA 5I1AB 1WAAE 3H7LA 4Y1AE 2I9TB 4O02H 4JFXA 3HC0A 4PTTB 2AI0L 4AT6B 1VEPA 5L2KA 4KRMB 2BNQE 2F54D 1PGRB 3DV6B 2IG2L 2Y6SD 4Y2DB 3OWEA 4AK1A 3N1MC 1FVCB 4M7JL 3FQWA 4MQSB 4Z7OF 2NXYD 1ND0A 1UWGH 3L95B 3GK8L 4RWYL 2EEDA 3FO1A 4Y8DC 4DK6A 5ICYA 2HLFC 2E6QA 3IETB 1ZANL 1NLDL 4PD4J 4K3HA 1P7KB 5JR1L 2HLAA 4YE4H 4HPYH 1CF8H 1HHKB 1I85A 1N2RB 3DXAE 4X6CA 3C5ZC 2H8PA 2DN7A 1CK0H 3BKYL 3JVGC 3S37X 1E27A 2PW2A 4FTVB 1CFTB 4UI2A 3VCLB 3MRRB 3F6IA 4TQEH 4ZDHB 3ZDXE 5FECA 15C8L 2R1YA 3UTPD 4G43B 1NC4A 4H25B 2CQVA 5F1KC 1MRDL 3TO2B 4QT5A 3S36H 3K2UH 5FECB 3QHFL 2ZWLT 3L1OH 3U9UB 2VAAA 4GRLC 3WL9B 1U58A 2HH0L 2H8PB 4MJ5A 3P9MA 4Q7DA 3LKSA 3OGOE 5ADOH 1CIDA 2OZ4H 3O9WD 4XVSL 1DQTA 3GIZL 1J7VR 3SQOL 1DBBH 3PE9A 4Q58C 3D39B 4LLUB 1IM3A 3OKDA 3TBSA 2JCCE 5HGBB 1AR1D 2BDNH 2HT4C 2WBJC 3MV9A 4P23B 2Y06H 3MNVA 3I2CH 2E7MA 4G6FB 2KQNA 4B53A 1NFDB 1A6PA 4QCIB 1I7TA 3LEVH 4ZO9A 1ZGLA 3MREA 1IM3B 4JG0L 4PLKD 4PRAA 2JJSC 5DLML 4NRZB 4HWEH 3UYRH 3F12A 1IJ9A 2QSTA 4ZUWB 4GBXD 3E8UH 4NUJB 1XGQA 1HSBA 4Z7WB 2QQKL 3NZ8A 4NDMA 2FWOA 4PS4L 4ZOCA 5H37H 4ZPVB 1KULA 1Q0XL 1QSEA 5LBSL 1B0WA 4XNXH 5CUSL 4QHLA 2HP4A 3T0VA 1UACH 1CDHA 4KMLB 5KVFL 2CRMA 4KHXL 1AKJA 4E0RB 2X05A 5DUMH 4WWID 1OQOA 5D9SB 4ESKA 1KTKE 2YUXA 4UOW1 1Q1JL 4RGMB 3KPPB 3S35H 1ZA6A 1IT9H 1NUNB 2V7HB 3C2AL 1UGNA 3B9KC 3LB6C 1ZLSH 3HMXA 4UIMB 4P46B 1FGNH 2VXQL 4HWNA 3TT3L 3QDMB 4F58H 1RZFH 1NGZB 1D9KA 1X7QB 2PR4L 3OBAA 3UTZB 1WEJH 4ZFFA 1BOGA 3QCTL 2WAHA 2I07A 3ZE2E 1N8ZB 1KLFA 4S1SH 4XCCL 1CU4H 1KJMB 3KYKH 2C1OA 1MUJA 1NAMH 1U8PA 5EPMA 3H9SB 3TV3L 2FX8L 3ZTNL 1TJHH 3O11A 1AY1H 3MRBB 4M1DL 4XWGH 4FQCH 5D71L 1J18A 1BJ1H 1R5IB 3RAJL 1AD9B 4PGCB 3HC3H 1DJSA 1DDHB 1CD0A 3DV6A 1D6VH 1UEMA 2A6KA 3WIHH 4BSWB 3QIUA 2I60H 3BJLA 3LZFL 4NFCA 2PCPA 5ICXB 5IEKA 3B5TA 5HXMA 3U1SL 1U3HA 4NHUB 4HF5H 5ALBL 4L8DA 2M8XA 3OKKB 1UEYA 3O3BB 4OD2B 4GMSH 5JOFB 3UYOD 3NBNA 4Y4HA 3UTTB 4LRIA 3D1MC 5DK2A 5FHBL 5F88B 3L3IB 1CL7I 1J12A 3HI1A 3MXWL 5CEYB 4WHTB 1JTTA 5E2UH 2G60L 5AZEH 5I75C 4KMQA 3SKMA 2DWEB 5DHXB 3UZQA 5I1DB 2XPGA 5IB3A 4PJCB 4LSPH 1FAIL 5FHAL 4JG1L 4OV6F 1F11B 2FEDC 3BQUB 3RVTD 3CSPA 3WNKA 1GJIA 1RZKC 4HIJA 2OJZH 3EW3B 4ZG1A 4YHKL 3HG1E 5IHUH 1PZ5B 1CFBA 1K5NB 1S9WB 1V3MA 4JFYA 1JPFB 4MD5B 3QCVL 3OKOA 3VXUA 3VE0A 3HE6C 3V6OC 2FECI 4CNIA 1FG2A 2W65A 4EXPX 3L3JB 3VD7A 3STLB 3HMWL 5HHMB 1FL3B 1KJ3L 2EICA 2ARJQ 3TNMA 5IQ9B 1JZ5A 3HE7C 3QFJB 3QNXB 2APVA 4HKXA 1OM3L 5K59E 3U0WL 4YFEA 1M7DA 1OSPH 1X9QA 3TH2T 3CVIL 3WEXB 3H7BA 3ZT5A 1FNSH 5DR5L 4ZD3L 3QA3B 2D7PA 1HHGA 1WICA 4PUBH 1RHHA 4XCEA 4HS8H 3RPIA 4IHOA 3ZZ1A 4JREB 1A0QH 1A3LL 4GW1A 5LGJB 5B4MD 3QULB 3C6LB 3PHOA 4F15C 1JZ8A 4C57C 2YBRA 4JFQA 3N0PB 3IFPB 2VLME 4X9GA 2OS7A 4XPGL 3T0AA 5E8PA 3L7EB 4PJDB 3HZYA 3ZDXF 4HCRA 2DTSA 4L8SB 3P30H 2IQAB 3V5DA 3MJ8A 5DURD 3LH2H 4FS0A 4U6HA 3JWOH 1UWEH 4V1DB 4QWWC 2R8SL 4PJ7F 2ICWI 4L8BB 4PJCF 2F53E 3VXPB 2OI9B 2VH5H 1MUJB 1IAII 3EAKA 1DBMH 5EBWA 1YEFH 3VXOB 3MV8B 3TM6A 2AJYL 2BERA 3RBGA 3D87B 4PY8J 3MRGA 3S88H 1R5IA 3MGTB 4TVPL 3FQWB 5IFAH 2XYCA 5DS8A 3TYFA 4BH7A 1ITBB 4J3TA 3U6RA 4Z78A 1K9TA 4TVPE 2IAMA 3IAQA 2PO6B 3O4OC 4XP4L 3LEXA 1J5OL 1QSFA 1P84K 4WWKB 2B0SH 3WNPA 1C5DA 3HZVB 4L3ED 4JFFA 1MHPL 2XTJB 2WWMD 4P5TB 3CFJA 1VFUA 3ZLQC 3GM0A 5ID1A 4XH2A 4OTXH 3RWDB 2BZDA 1LE5A 2DIAA 1HWGB 2OTPA 4BH8B 4OZ4B 4LK4A 2OK0L 5A2LH 4PV8B 3OJDB 5JW4Q 1FBIL 4N0UB 1MF2L 4QY8B 2AJ3A 5IHZA 3MA7B 4UINL 1FNHA 1R3HB 1INDH 1Q9LA 1U0QA 3ZL4L 4HHAB 4KROB 2XWJA 2VLKE 4U05A 5C0CB 2FHFA 5I17A 2VISA 3UTPE 3V6ZB 3GSQA 4FMKA 4I3RL 4Y19D 1CLOH 4AM0A 3KXFD 4NN7C 1YMHA 1OL0A 5DJXB 2NXYC 4QYOA 3FQNB 4YDVA 1LEIA 2AEWA 4CN4A 5L2JB 5KSAD 3FQXB 3HAEB 5E8OA 1BQHG 4PG2A 4DW2L 4C56B 25C8H 1JMZA 4AIOA 2BX5A 1T3FA 5FEBA 4S2SA 5IW6B 1MCKA 4NC1C 5F7DA 5DEGA 2EH8L 3UTSB 5T1MA 4RFOH 1IE5A 2EDEA 4Z0XA 3QA3A 2YD1A 1W2KT 3FRUA 4PJ8D 4JFDB 1SY6L 1VESA 3VH8G 4PJAE 3QT2A 3SOBL 3EZ8A 2ESVD 2AEIT 1AGEA 1GGTA 3LKOB 3BHBB 1R3JA 4H20H 4LDEB 4U1LB 3HA0A 5GS0D 1FFPB 1OTSD 4LSUL 5DEGB 5FYKL 4XHJD 2HTKC 2WBWB 3VFMA 1DBAH 4OUOA 4IRJB 5BZWB 4LRNL 1FLRH 3Q5YA 1RSFA 1JI1A 4CJ1A 4JPVH 4KZDH 3HRPA 3DRTA 4L1HA 1BQSA 2LV4A 5GRJL 1RFDH 1ZHLB 5HGDA 1C5CH 4LOUD 4NZRL 3GMOB 3E3QC 2BC4B 1BEYH 5I15L 1QEWA 3NCBB 5I30L 4M6OH 2ZUTA 5CIPH 5GS0L 3AAZB 1GIGH 3OZ9H 2Q8BH 4FQ2H 3QULA 1BIHA 4K71C 5GS0C 1MIEL 4RISL 3KHQA 1GHFH 4MJIB 3T0BA 5IK3A 1ORQB 4WHDA 5JZ7C 1IEAB 1UWXH 4FQQB 4QXTB 1NUDA 1J0YA 1C5BL 1RJZB 5HHNB 4J3UA 4XZUA 5C9KA 4ELMB 3OKNA 4M61A 4Q9BA 1CE1L 1YNKL 4WEMB 3NGBC 1AXSA 4W81A 3MJ7A 5IMLB 2RR3A 5JHDD 3VGGA 1OWRM 2QADB 4IRSC 3QZWB 2A6DA 3MJ7B 3KGRA 5IMLA 3KJ6H 1JF5A 1G0YR 1A6AA 5IKCA 1UKTA 2YD4A 2YRZA 1DN0B 3O4OB 3DARA 1U8KB 5IJKA 3EYFB 4ZTOL 4DQOH 5E5UB 3T0ED 4YNYB 2UZIH 1B0GA 5DRXB 2R29L 5DC4B 4NO3A 4Z78B 1CL7L 4IDJL 4JE4B 2DKSA 2DQIH 1IGIH 1ND0B 2A83B 2J8HA 4MA7H 1HILB 5HYQB 2LE9A 4ZXBC 4MAYA 1F6AB 2OR8A 4Z7UE 5GGRA 4EJ1C 1T0NB 5D96C 3K80A 2XQYK 1MLCA 4NNXB 1Z9MA 3TT1H 3MRDA 2JJWA 4M8VA 2DWEA 3EJZC 3QUZB 4CBPA 1A14H 1YPZB 2ZJSL 5E99L 1RZ8A 2X1OA 4P3DB 1MCBA 2MFNA 4JVPA 5HHVL 3TYGH 1KELH 3BP6A 3L7FB 4PJ9D 4QGYA 3WUWG 1IC4L 4MYWB 3B83A 1UVQB 3MOBH 2DJ4A 5HI3D 1KTLB 3O8XD 5SX5K 1JZ4A 1KEGH 2YD8A 2HN7B 4HK0B 3E6FB 2I25N 4TUKH 4JM2B 3QBTB 5I16B 1EFXD 2B1HH 2RCSH 3BGAA 3QNZA 3MCKA 4LCYA 1JGEA 5EU5B 2OCFD 3CU7A 4PV9B 1KJ2B 5E5RB 1R3IH 2H26B 5LGKA 2XRAL 3RY4A 1B6UA 1JWUA 3QUYC 1N0XL 3BE1L 1XGYH 1U6AH 8FABB 2KDGA 4OAWA 3MSPA 1MOEA 4M5ZL 4M6NH 4LU5H 4Y5XC 4MNQA 1QSFE 4XMLH 1T1XA 3NVQA 4U1HB 1HOCA 3LSOA 4Z77B 4JGUA 4M5YH 4JRXE 4EVNB 1QG3A 4OBSA 5ICZA 4NUGH 2BY3A 1KNOB 3IVKB 5J6HB 4XP6H 5EOTB 3VFTB 2A1WH 3AB0C 3WDIA 5LQBH 4QRPD 4U1NB 2HTLC 1SQ2N 3QJFB 5CD3B 5CEZL 1UWXK 3R8BB 3SDAC 4LCCA 4LCIL 2P7TA 2QBWA 1RUML 2NTFA 3PXHA 3S36X 4C54A 5KS9B 1BFOB 1UM4H 4JZJC 3QPXL 1R3LA 5AUMA 3AXLA 2NX5B 3IU3B 1FV1A 3L3OB 1YN7A 3KXFE 5IB4B 2BHYA 4U1MA 2PTUA 2GJ6A 3JV5A 2YPVL 4EDXA 4WUUD 2VITB 2R0KL 1T20A 2IH1A 1J05A 1AR2A 3BWAB 3O2DA 5SV4A 2OSLA 1JUFB 4KQ3L 2DQFA 1G0DA 3EGSA 2HTLD 1A6AB 4APQA 3KYOA 1XIWB 3L6FB 4JRXD 4JHWL 4H5SB 4YR6A 5IESL 1A9BA 2Q20A 1GC1L 4WU7B 5CFHA 3QHZH 5F1NA 5H8DA 3S35L 4BQBA 4HMDA 3IKCB 1CD9B 4YPGB 4LLAA 3ALWA 1F97A 3MPCA 4L9LC 3UDWA 3MV8A 5HJ3A 1P4BH 3QSKB 1A6UL 1MREH 4ALAL 2CIIA 1WEJL 4X6BA 2NXZC 4QHKJ 3WFDH 1MFCL 4JRXB 1CI5A 3VFRA 5ESAA 1U8JA 3C60B 3IF1A 4M8QB 3KYKL 2AJUH 4BUGA 3NABH 3MCLH 4XVTH 4Q6YA 2GHWB 3V6FB 2X70A 5JNYA 2PYEA 3I9GH 5CEZE 3FHAA 3BW9A 3X14B 5K9QI 2WLZA 3BZEB 2EDFA 1QSVA 1WTLA 2Y23A 4QGTA 4S1RL 1OPGL 4AENB 3AS1A 4JFED 4JHBA 1U58B 2BCKA 4OBRA 1OARH 3V6FA 2X4UA 2AW2A 1CD8A 1SVCP 3B5HA 5D1XC 4HDIA 3REWA 3LN5B 3MLTB 4BJLA 5JMRA 3T08A 1QQDB 3QDJB 4ZAKA 3TVMD 4PP1D 2XA3A 3G6DH 4XBGB 1H8NA 2BNUB 1AGCB 4R26H 4Q6IB 5IQ9A 4UNVA 1W0YT 1CFQA 4RRPG 2DQJH 4X99A 5IWLA 3NIFF 1LK3L 1CFSB 4P59H 3GBML 4X99B 3MNWA 4OCNC 3W9DA 1IEBB 3HAEA 2F15A 4BQ6A 1D5IH 2BNUA 5GXBB 4X5LA 3N50A 4WW2C 1C8PA 3MRNB 3N1GC 3MZTA 3IFNH 5DJ2A 2Z91A 4XCYA 2QHRL 5FB8A 5IJVB 4PRDB 1RPQA 1MEXL 4MX7A 3OB0K 4WUUE 3LPWA 4JPIB 3KYNB 4YDJA 1UB5A 2V5SA 4ORZC 3HI5H 5ITFB 1AJ7L 1G9MH 5D8JL 3MV7D 2VDPH 5IR1A 2HG5A 2R4SH 4OLEA 3WXVH 2YPKA 3BI9X 5SWSB 1DANU 3IFPA 3U0WH 1FZJB 1FZOB 4NQSB 1YJDL 2MCPH 4K7PH 1DSFH 3BH8B 3FN0L 4U1IA 4NQCD 3VGDA 4DZBB 4K2UL 4N90E 4PRID 4EVNA 5CKAA 3DUUA 4Z7VA 2R0WL 1IAKB 5D7KD 1BWWA 5DVMA 4F2MB 1HHGB 5KN5B 5D2NE 2W07A 1A0QL 1L4IA 2J1KA 1YEHH 4LSRL 4PG9B 3N06B 1CFNA 5LAXA 3S34L 3MBED 2GY5A 1UG9A 2YEZA 1REIA 1ZV5A 2PO6A 2EIZB 1TJIH 4DFIA 5DVNA 1A6TB 3W2DL 2NXZB 3LKPB 4NQEB 1TVDA 3TN0A 5DS8B 3T4AA 4P99A 5CJXA 3PJSA 1MHEA 3BVNA 5TPWH 3K3QA 4KK9C 3RVVC 3OKYA 4JY6A 3QNYB 4KTEL 5DF0A 4UQ2A 4JQVC 1RURL 1G7QA 4IOIA 3BOVA 1FO0A 2EXYC 1TMCB 2XI9A 1MHCA 3ROLB 2X42A 3WHXB 3X3GL 4KGLA 3PL6B 3MUHL 3F58L 5EBMA 3LEXB 5DT1H 2HJFA 5IROC 1AI1L 1IAMA 4WUUB 3PWPA 4NBYB 1HQRA 4NYLB 4JFPA 5GJTH 4D9LH 1OAZH 1CT8A 2L4OA 2A73A 4M7JH 1RZJC 2VNCA 1NC2A 5CLTA 1IM9A 5T1DH 1CDBA 3IXTA 1KC5L 3O3DA 4MD5A 5IVXE 4XNUH 4FFWD 1WITA 4NNPL 3UZVB 1V7MH 3V52H 1NC4B 5AEAA 4WFFE 2WP3T 1NCWH 3WFCL 2ZCLL 2A2QT 3TIEA 4OZFA 1CZ8H 3BEVB 3ZDZF 1QLEH 3OX8A 1YY9D 5GRYA 3GJEB 4NJ9L 4R7DB 4PJGE 1ZOXA 5F3BA 3BEVA 1NFDF 4LLDA 5DTFB 4KI1A 3TBYA 1WSST 5EU7C 1KLGB 1F3RB 5DJ6A 1KYOJ 1A8JH 2PKDA 4M02A 3C60D 3G6JF 2GCYB 4KI5C 1XGPA 4I1NB 5IHBA 3K2UL 5FA4A 3N1FC 5KANG 5C07D 3DXAA 3WFHB 4I0CC 1T66D 3VG9B 2OR9L 1KCSH 4UNTA 1NCBH 4LLYA 3SGJC 3PQYD 4QOKA 1OAXL 5ADOL 1IGML 4LDLB 3TA3A 1BD2E 3UTSD 1FCCA 2DI8A 5TH2B 1DBBL 5IQ7L 5GZNC 2GJZB 4ODVH 3G5YA 1DEEA 2J8OA 4MNGB 4JM2D 3TZVD 2XG5A 3QH3A 3E6HB 5H35B 3EO0A 2BDNL 4NM4L 1G0XA 4DZ8A 3SDAA 5D6DC 2O61B 2B4CL 4F7TA 1RUAL 1ZA3B 1A7OL 3C6SA 3BD5A 3LEYL 3MLYL 4YBHA 4NKDB 3SGKC 3QXVA 1NAKL 3NH7H 4LCCB 4JZJA 1MELA 1NL0L 4I0PD 5C9JA 4QHLB 4OFVA 3ARPA 2BSTB 3FB8B 2IANB 4TOYL 4YBQC 4HCRL 2P8MB 3GMQA 5CZKA 4ONFL 4EZMA 1OW0A 1W72A 3MRQA 4JZOA 1BVKB 5FYKH 5JXAH 2B1AL 2XNAB 2J4WL 4JKKA 5IB5B 4W70A 1JGLH 4LSSL 4OGZA 2BC4A 3O6KL 1NGWA 4LRNH 2G5RA 1OAYH 2W0PA 3S8WA 4MDJA 2BSTA 4Q9CA 3L9RA 2GSGB 5GRJH 2AAVA 3OR6B 2F53B 5E6IC 5KVFH 2JIXA 3DX9A 4GKZA 4Y1AA 5JOEA 1BZQK 2D0FA 4HLZG 2RIKA 3K8MA 1A6WH 1IEHA 2HVKB 1D5XB 2Q8BL 1YMME 3RNKA 4OLUH 3MROB 2H1PL 2BVOA 4Z0BH 4NP4H 5CD5D 3V7AE 4BSVB 3LIZL 3O6MH 4FQJH 3IDYB 2HWZL 4NKOB 3O4LD 1TZGH 3B5GA 1H5BC 2DD8L 4KTDL 3G9VA 3B3IB 4WI4A 3TO4C 2A6DB 3WJLA 3OJVC 1PW3A 1TTGA 3X11A 1QVOA 3RVXD 2EIDA 3B6SA 4K23L 3ILQC 1AXSB 3O8XB 2VLJA 4JKLA 5ESQA 2EIBA 4QXGH 4GUPA 3VRJA 4P4KC 4Y2OA 1NCNA 3KJ6L 2VUYA 4P3DA 3G5ZA 5TE6H 1UKSA 1MFDL 4PJ9B 2EC9U 1PKQA 2FR4A 2C7UA 2DLTA 5F71A 4POYA 1KTRL 1XFPA 4L5FL 4XCFL 5AZ2H 3LKNA 3V95A 2VLJB 1CICA 1VGEH 1ZTXL 4EUPG 5I1JH 1GAFL 1IGIL 3MYJB 3D69B 4Z7QF 3V5HA 3C6LD 3S7GA 2F74B 1RZ7H 4OKDA 2VDNL 4X4YA 2Z35B 5D7JB 3BZ4B 3CLEL 4P4KD 5E00B 4QY8A 1KGCD 1FJ1B 2BNRB 4NC0B 1G7MA 4G43A 1I1FA 1S5IL 1LE9B 1GOFA 3DRQB 2FBOJ 4EUPH 4QOKE 2DLHA 3CDGB 1YEDA 2XTJC 2L0DA 1DVFB 4Y4FB 3C5ZD 4NQUA 5DD1H 3QIBA 1FGVL 1HI6A 2Q7YA 3ZMRA 2GJZA 3VI4E 7CGTA 3VH8B 2WUBH 4WFFD 1NLDH 3LS4H 1ZS8B 1OGAE 2BNRA 5C0AE 4CMHB 1EMTH 3BP5A 5D7KE 5IVOA 5I1CH 3EOYG 1FFNB 4NFDA 4K7FB 4M03A 1NFDA 5C09B 1OSZA 2YN3A 4MA1B 1WQVT 4XNQA 3OTTA 2LFGA 1T80A 4P23A 1UFUA 5CINH 1RZIA 2HFEB 3VU2A 4E9LA 5MEPB 4IOFD 4DGYL 3O3EA 1MPAH 3TBSB 3QIWA 3C08L 5KZCD 4TTGA 5IVXA 4OCSL 2VLLB 1RI8A 2ZUUA 1KCUL 1NCTA 1T22A 4OM0L 3TJEL 1UYWL 1F13A 1XGTA 4XPAH 1CS6A 1F8TH 4WTZG 1KXQE 3KS0H 1GGUA 2X89D 2QQQA 5HHOD 3IDMB 4QHNA 2EO1A 1SM3H 4PGEB 2MPAH 1N59B 4GW5A 3UO1L 4DUVA 1LO4L 5IBUB 3GM8A 1RK0A 3WFZA 2A1WL 2VXUH 1I1AA 5EUOF 5L8JB 4H1LH 1P9MC 4CAGA 2X4TA 1X6NA 5F6HI 2BVOB 4ZS7H 4MJIE 5K59F 3GIVA 4FZEH 2OYPA 4UB0H 3LH2L 3NIDE 1T1YB 3RTQA 3KWWA 1KUMA 3FMGH 1EO5A 4JM4L 2Y25A 3C5JB 1EAJA 5IROA 2F53A 4LCUB 1CVSC 5JZ7D 5DI8B 3V79C 3QQNA 2BSRB 4HKJB 1YN7B 3L3OA 2DM4A 1YNLH 2KKQA 1FL5A 4QNPF 1CVRA 4U7KA 3T2PA 5TF0A 5FDYA 1JHKH 2YS4A 3GSVA 5A2KH 5MHSD 3VGAC 3BD3A 3QIUC 3FT2B 2F5BH 3H9HB 3F7RA 2I07B 3BQUD 4ZFGH 1PZ5A 4HKZB 4NO0D 4OD1L 1C12A 1MFBL 5C0EA 2IADB 3S97C 5CSZA 1MHPH 5J1AA 3C2AH 5GJSL 4GAFB 3OB0H 5JOFA 5I9QB 3PWVA 3HG1A 4U3HA 4OT1H 1HQRB 3BO8B 5DRWB 3K8LA 2Z31D 2R2BA 2YA2A 3PWVB 3WN5B 3QCTH 2DM2A 4U33A 4ODSH 1BAFL 1G6RH 1QRKA 2YOCA 5GHWH 3WN5A 4YDIL 2MTPA 3QUZA 3UAJC 1TJHL 3PGFH 3BPCB 5MHSE 4JQVA 1AFVL 1EEYA 4PGBA 3VFUA 3JV0A 4UDTB 2YC1A 3I75B 3AS2A 5ELIA 3BGMB 3SE4C 3U79A 3L5WB 1BIIB 4OGYH 4ODHL 4N68A 1NFIB 1EJ6A 4G6KH 4LHJB 2EE9A 5E2WL 2Z31B 3KPRE 5HI3C 4YXHH 3CD4A 4FFWC 3P73B 4CW1A 5FYKD 3H9SD 4KKCD 4FNLH 3RZCA 5IOPB 3SGKA 4MJ4A 2XG4A 4ERSL 4W4NA 3F7VB 3W82A 3WFHA 3D39D 2E5EA 3ZDYF 4YK4B 4F8QA 2BFVH 3FQUB 1PFCA 3T0XA 3ESVF 1NMBH 1YY9C 4XI5D 2AABL 2NZ9D 2A77L 2QSCH 3HZKA 4IJ3B 4DEPB 5JOPE 43C9B 3BH8A 3MJ9A 1OW0C 5E2UL 1VGKA 2D7OA 3P4MA 1CQYA 1NGZA 2GT9A 2NCMA 1A7NH 5EH1A 1NGQH 2JJUA 2AV7A 3O3AB 4Q0XL 4JCLA 3SJVE 4PLJD 3BSZH 2YBRB 5TGBB 1UB5B 4HT1L 3LDBB 3ROOA 4F7CB 2P8LA 1CLZH 4XCEB 3RPIB 3UTTD 3HNTL 5JA8B 1I1AB 5FB8B 1IAIM 4Q9RL 4OLYL 1E4XL 4J2XA 3HFML 3U2SA 5F9DC 2M2DA 3BRGC 3QCVH 2HFFB 5IFHL 1SEBA 5E6YA 2R4SL 3WXVL 4O2FA 4YDLC 2CDGB 2E7HA 3MV8E 2CO6B 1C5CL 3SCMB 4YPJA 3D0LA 4MJ6A 5CJQH 3QNYA 4ZSOB 3QWRA 2PYFA 5IBTH 2XICA 2C3XA 2PCPB 4DN4L 3I02B 4WENB 3TO4A 3JWDL 3SKUD 5D6CA 1RK0B 4DKFH 1YEGL 5FOBA 5HHOB 1IGCH 1A1NA 1X6LA 3QXWA 2ZSVA 4XT1C 4ZOBA 5E56A 4RGNE 5FO8A 3GSNA 4XBPA 4EN3A 3RA7L 4WHYG 1C5BH 1S9VB 4UAOC 1TLKA 1XF4B 2OBGA 3KLAB 1AXTL 3SY0B 3E2HC 2NY6B 4WO4D 1LEKA 1O0VA 2NY2B 3FTGB 3KYMB 1PG7W 5EO0A 5C0BD 1TPXB 3V4UL 2BOBA 1ZSDB 5CP3A 1DLHB 3B2UC 2NY1D 4I9WD 4Z6AT 2X1XR 4S1DD 4ONGH 4P46C 1QHOA 3GKWH 3BMWA 3P30L 3CFDA 3ARBD 1JV5A 2P8PB 2WV3A 4OIAA 4X9BA 5IEHA 5INDB 2IQ9H 2FATL 4L3CA 3VWJB 3CFEA 4NQVB 3L5JA 5F3HB 5LGHH 3ARDC 4WO4C 1FRGL 1P69B 1ETZA 5J12B 1MHHA 4X80H 1WFNA 1U8LA 1FAKT 1H0DB 3MR9A 1D6EA 5TQ0H 3H3PL 3LKOA 2XY1A 5CD5C 4FZ8H 4J3VA 1JBJA 2VKXA 1RUKH 4WU5A 2GUOB 2YPLA 5CLWA 3T8XB 1M6OA 2IF7A 4GBXB 3OXRA 2ZUQC 2H9GB 1P1ZA 4JFOA 4CMHC 3B2VL 1UT9A 4FP8L 5CSGA 1G7PA 2ESVE 1LP9E 3U30B 5ISZB 5L0QC 4Y89A 1JP5A 1CF8L 1UC6A 4XP9L 4K94H 2XN9A 5E1AA 4N9GA 4NOFA 1QSZA 3VDAA 3NCJH 1A7PH 2RAMA 2QR0B 3PABA 4G80B 2VZ3A 4LSTL 5F7DB 1YEEL 1LDPH 4LKXA 5D7JC 5BVPH 1MCWW 4PRNA 2AQ3A 4CVXA 1INDL 2H32B 3DMMA 2NTSP 3WSQL 1DQJB 1A7QL 4LU5L 4PJ7A 1OF2A 3PNWB 2ERJC 3VXNB 3EDEA 3W5NA 3RKPA 4MNGA 1Z0MA 2E6PA 3MRQB 4GOSA 4PRDA 1ZT4A 3RWCB 3FQRB 2X4QB 3DSFL 1EERB 3ECBB 2IANA 3L3HA 1CXLA 1PZUB 1QLFA 3OQ3B 1NAKH 3ARVA 3NH7L 2P5EA 3QDAA 1YEKH 5FUZL 2ID5A 4JZOB 4TUJB 1R5VA 5D6CB 1L9MA 4O4YL 4UT9H 4WJ5A 1NCDH 4H1LG 4RQQB 3NACL 3G5VA 3QDME 5HD8C 3S9DB 2R56H 1T03H 1PSKH 3P40A 3LEVL 4NOBA 5I73C 5F89A 1UKQA 4H20L 3LQAH 2NY7L 2GFBB 3V8OA 3O6KH 2VDLH 2YPVH 1K2DA 5IFJB 4BQ9A 3ME0A 3MBEC 3GMRB 2HFGL 3QIWC 5EBLB 5F97E 3QG6B 3V4PH 4QHUB 1BREA 3BKMH 1JYWA 1XF1A 3REVA 1BVZA 3EJZD 4CU7A 3O9WB 5T3ZH 2GTZA 2CLZA 3EYVB 1BJ8A 3RUGF 5EZJB 3D3VD 2VR9A 5D7SH 4DFHA 4OIIH 2YA1A 5L9DH 3CZFB 4LHUA 2YXMA 2XA8L 4ZXBA 1A6UH 4OZHE 4WFHE 3MRRA 1KEML 2EO9A 5AYUL 1MVUB 1DLHA 2NYYC 5HHPA 3OX8B 1AP2A 4X8JA 1I8IB 1CXFA 1T2JA 1VFAB 2X7LA 4PJXB 4OSUL 4AMKH 4Q9QH 2F8VA 4M93C 4YNYA 1M71B 4HIIA 1ES0B 3RTQC 2CKBH 3RWGB 3D39E 4U2ZA 3EHBD 1AY1L 1A1OB 5F1OB 1IAOB 4FQCL 5FA3A 3FZUD 5CJBA 4ZUSB 4M7KH 3D3VB 5F72S 3R0NA 2O61A 1WK0A 1O7SA 4RZCB 4RNRB 5DUPH 2LVEA 5EC2B 2NW3A 2Q3ZA 4HGWA 1ZT7B 3ORJA 3QEQB 1U91A 4Y16B 1M71A 1ULVA 3SQBA 4OM1H 1UM6L 4W6XB 2OTWB 1HH6B 3T4YB 3G6DL 4N0CC 4AQOA 4RRPA 5CZVL 4WGVB 1D5MA 5ALBH 4RGND 4PRHB 3QNXA 1X3DA 4FTVE 4PJHE 4LCYB 2V5TA 4GAJH 2CJUH 3ARGB 5FOJA 2O5ZL 3DXAB 5E8NB 1NANH 2N4IA 1KYOK 1S9YA 1MCSA 4L29B 1I7ZB 1UCBH 1TVHA 3SBWC 2OJEA 3VD3A 3MRLA 3H2WA 2PXYA 2HG5B 1MCHA 4HXBL 2WUBL 5DMKA 3T2NH 1AO7E 3RGVD 1KELL 1SJVA 1QA9A 1J0KA 5F96H 2ADIB 5KTEL 1QNZL 1Y6MR 4LLVB 1W72L 1YUHA 3DUUB 4Z7VB 3F5WB 1NBYB 4GQPH 5CBEA 3PGDB 4JO4L 5DK0A 3QCUL 4TUKL 3RDTD 4P49A 4G7VL 5MEPA 1ZHKB 4ODUA 1Q8MA 3GO1L 1CGWA 1V7NH 5HYJA 4X6CF 3X11B 2YA0A 2Q76B 3MBEB 5DJCA 4DOHB 2WSKA 4K2UH 4MWFA 3H6JA 4O5LH 1E6JH 1FYTA 5C3TA 3CXDL 4F80A 4GS7B 1QLFB 5C6PB 2FX7H 1A4JA 2FSEA 3MZGB 5FYLL 1KJVB 5K9OB 5ANME 4DOHE 3FONB 3RDTC 3S98A 2P5WA 3BKCL 4MLIA 4EI5C 1UH2A 2WUCL 4OLZH 3FB5A 2F5AH 3MLVH 5C0GB 2X4UB 4NKIL 4JO2L 4JRYD 3WIIH 3W11D 4QRTA 1TJIL 5DD6B 3PP4L 3W2DH 4DN3L 4XP6L 3VI3E 2UY7A 4FQXD 1X5XA 1FVEA 2WIMA 5E00A 4CMMA 2GY7B 4N9OB 5F44A 3ZE1F 1AGBB 1BF2A 3MMEA 4Z7VE 4YHYB 1G7LB 2IBBA 3DURA 3FO2A 1RUMH 4MQ7B 4ZFFB 4UMGA 1UWEL 4RX4A 1H8SA 3DNKA 4YDKH 4JVUA 1F4XH 2X4OB 1OD9A 5FGRA 3VFPB 1R5WA 2Z92B 1OTTC 3WS6A 1A5FH 5IG7B 1MCDA 1FL5B 1U8HA 1Q9LB 2GUOA 3VMPA 2EDLA 2AEQL 5BS0D 4ELMF 4KU1A 4X83A 3QDJA 1MJ8L 2P8PA 1JVKA 1JPSL 3MUY1 4OD1H 4LP5A 3HPJB 4F57L 3VWJD 4NNPH 3QHZL 2XIDA 3AC0A 5IVNA 4XVJL 1NUFA 4EN3C 3BX7C 2DQEL 1MFEL 4NC1E 4KJPD 4XP1H 3T3MF 5CP7B 2DF3A 3JXAA 4PGZA 5IMKB 2FH8A 1HHIB 2NY1B 4AQ1B 1CGUA 4NJ9H 5FDWB 2LABA 5FYJD 3M1BB 3DWTA 2VXVH 4HDIB 1B88A 3RY5A 1UB6B 1G9NC 2Z35A 5D7JA 5D1QB 2BMKA 2NY6D 2VLMD 2YD2A 1MCWM 1CXHA 4JZNB 5GHWL 4KQ4H 4RNRA 4G9DA 4UTAL 1NBZB 3VXMD 5C08A 1AFVH 3IGAB 4PLOB 4X4ZA 2H32H 2X10A 2Y1VA 1RJYA 5E8OB 1NCBL 1BM3H 4GXVL 5B8CA 4UINH 5F93C 4L4TE 2VJXA 1Z9OA 5L88L 5CEXA 1INEH 4GBXC 5I0DA 3VXQA 4L9DA 3ZKSD 4EDXB 4YGVB 5GS1B 3QO1B 3B9KD 2G75A 3LB6D 3NFPB 3O3UN 3TLRA 3C5SB 5KOMC 4MXVF 4P9HC 5T5NF 1UXWA 3MJGX 4L4VB 4WUKH 1XIWA 3L6FA 5DEFA 3JTSB 1NMBL 3WHE1 3VWKD 3R06B 1IFHH 1A7OH 4PYGA 1K4DB 3DMMB 1XF2A 2UUDH 4HJ0D 1L0YA 2CR6A 1MJJB 2DM3A 3DROA 3FL7A 4XPTL 3HZVA 3RIFF 2VDKL 5ITBL 1IVLA 4GW1B 5ICZB 5SWZE 1CLCA 2JJSA 2Y4SA 4Q0XH 2VXTL 1T1WB 4ONHB 3CDCA 2AV7B 4MCZB 4X7TA 2X4PB 4HT1H 1YY8A 4XPHH 5ESAB 1LO0L 1X5FA 2NX5D 1K2DB 3VGAB 4BSWA 1TCRA 1EA9C 2FJHB 4JFXB 4LSSH 4XPBL 1U8IA 3IFNL 5JPMA 4GRWB 2QHRH 4HUWA 4UAOB 3K4DA 2X5PA 3EOAB 4KZEL 5T1KD 4OZHF 4BH7B 1YDPA 2Z8VC 1DUZB 3NCCB 2EYSA 3QWOA 4F7PB 1TJGL 1A6WL 4DN4H 3LQAC 3IS1X 5DD5L 2ICWJ 1EXUB 2AP2A 3SKMB 4XXCC 1TXKA 1WBXB 4S11A 1OP9A 1YC8A 2HWZH 3HC0B 1QSEE 3BXNA 3AGVA 3TBWB 1AP2B 1MIEH 1KT2B 5E5MB 1YDPB 3AREB 4WI8A 5C8JA 4J8RB 3ULUL 1CN4A 2OQJA 4HPOL 3BDYL 1PEWA 1ZVSA 4OZ4A 4P0DA 1OCWH 5B4MC 1O5DT 4S1QL 3HE6A 3VDCA 5C8JB 4HW6A 1LO3H 1WWCA 3B43A 2OMBA 3FCTB 3AMLA 5DMGC 4DEPC 2C3WA 5C70A 3CIQA 1KPUB 1C12B 5FKAA 4JFFB 1XGUA 1CGYA 1UVQA 4MNQE 4M6ML 2MQ0A 5GRWA 5GQBA 3EO9H 1GGBH 5JNYB 3MRMA 1ZT7A 1KGCE 3QFJA 1YC7A 1JFQL 3RWHB 3N85L 3VGHA 3GRWH 1JZ6A 5BW7A 1KG0B 1SYSB 1BQLL 3HR5A 3QDGB 5B21A 1FFOB 3P11H 2C3HA 1U3HC 2GCYA 4D0DA 1EK3A 5ISZA 5FCUH 5DD0L 5JXED 2A9NL 4JN2B 4M3JA 3QUXB 4F8TA 3SBWA 1TENA 1C7SA 4MA7L 1HNFA 4AEHH 4IOSD 4XTRC 1P7QD 3TPUB 4D9LL 2X4NB 4XPFL 1GZPA 2Z93B 4LFHD 3I75A 3PUCA 5D1ZD 3VXQB 4ETYA 5DRZB 5MI0B 2DICA 3AFLA 1V7ML 3V52L 5GRZA 4BZ1L 3GSWA 3AM8A 4LSQH 5GGTA 4NZTH 2A6JA 3K1KC 5ETUA 2FGWH 2CDFB 4LLVA 1FIGH 4NM8H 4J4PC 4PRPD 4KKCC 3OKMA 5I73B 1LGVA 2AXFB 4X6CE 1JGDB 3MOBL 5C0RL 5IW1B 4U1SA 1NEZG 1S3KL 3EO0B 4EI6B 1NCAL 2Z9TA 4CRPA 1HNGA 5EA0H 3AAZA 1QKZL 2W59A 3MLXL 1L9NA 4GW5B 1A2YB 3T77B 1DN0A 1DE4B 1I7TB 4UQ2B 3WMSA 4G5ZL 1PQZA 4PB9H 5EO0B 2BP3A 4AEEA 4DCQA 4UU9B 1A7QH 5I18L 2HRPL 4U7MA 3NZHL 5HDLA 3IETA 5C0AD 3NA9L 2YZ8A 4OF6A 1JNHA 5HVHB 3X3FH 2FB4L 3UO1H 3H0TA 1FP5A 2QADC 4YPGA 1WAAA 3B8YA 1CICB 1SEQH 3MRBA 5FKPA 3QZWA 3LEYH 3MLYH 3NACH 3WLWD 3U4EA 2V7HA 1FDLL 1QBML 2E27L 4QRQA 3U0PB 3MA7A 1VPOH 4I3SL 4FOMA 2I9LA 5TE4L 5EZOL 4PGDB 1T21B 4YIQA 3IDJB 4ETQA 1AHWA 1MFAH 2ILLA 1FZMB 3MA9H 4IS6A 3SJVB 1DVFA 1VERA 5DD6A 5JIPA 4PG2C 5ISZE 2ZCHL 2ESVB 3LVEA 1FPTL 1JN6A 4MA3B 1OAYL 2R0KH 4LVOB 2VMFA 4UILH 1OP3H 2J5LB 1MI5A 2ADGA 1L7IH 3DURB 3ZSSA 4XMPL 5FV1L 1P2CA 5IESH 2QQNL 1IGJA 4OFYA 5T1MB 4WEUD 3LQZA 4C56D 1CGSL 1YEDB 5J56B 5DJDA 5K9JL 3LQZB 3CSYA 3WKML 1MREL 5EN2B 3U7YH 2E7CA 3W0WD 2LVCA 2R9HC 3LKQA 4R8WL 2APWA 4YEFA 5C09D 3KPSE 2P47B 1F6LL 3GSXA 4HBCH 2FJFA 1FH5H 5CWSB 4XVTL 4HZAA 4HZLB 3MFGB 2V9TA 4NGHL 5J11B 4GBXA 1JNNH 5DMIH 5GS3A 1KBGH 3BPCA 4Y16C 5ILTL 3GJFK 1FNLA 2QSVA 1ZWIB 3ARFA 5INCA 3E6FA 2W9DH 1Q9KA 4M7ZB 4OI8A 1FSKB 4NCDA 1F4YH 1I1FB 1LE9A 4Y4FD 1OT1A 4MSWA 4M1GH 1ODAA 4KK8C 1TQBB 5HYSG 1UM5L 4IMKA 3W9EA 4L5FH 1BZ7B 4OQTA 1CIUA 2R9HD 3FT4B 3OR7A 2DJUA 2XY2A 4I18C 3I50L 3KLDA 5ITFA 5I1JL 1J1XL 2HTKD 4PJ7B 5ECJE 5IF0B 4G6AD 4GMTH 2NY4B 4OZIF 2X9WA 1XH3B 3MUGA 1FCGA 3GI9H 2C3GA 2P46B 3G6JB 2EYRA 4DVBA 5MENE 3KHOA 4NQCE 4RWYH 4PRNB 4GG6F 2IBZX 5HDQH 5IB5A 1N6UA 5HJ3B 4FQLL 3M8OL 1A7NL 5IJKC 1SY6A 3IDXL 4P48A 4P2RE 2A9MH 1JYXA 1N0LA 3GEWB 1QA9B 2PYFB 1FLTX 2G5BB 3BD4A 4F33A 4FG6C 4H5SA 1QHPA 4X9IA 3O8XC 3QXDB 5D2LE 1FL6A 4OCLC 1E4XH 5I1CL 2DQDL 4UQ3B 1J05B 4WW2F 2H3NA 2XNAA 3V6BR 2IFFL 3JUYA 1LO2H 2MHAA 3U0PA 3I85A 2J6EH 4XXCA 5FYJH 5GGVL 1H3WM 3QIUD 1M7IA 3D0LB 5D8JH 2DYPA 4OKVA 1E4XI 1NDMA 4G8GE 1I3RB 4GKSB 3WJJA 3VWKC 1CG9A 1DTUA 4FQIH 4DTGH 5BRZE 3PHSA 4K7PL 5C07B 6FABH 1DSFL 3ARED 3SJVD 3BPNB 5FOBB 1BGXL 4NYLA 1ACZA 2FEEI 1ZVSB 2AERT 2E9IA 3KPRB 2H2PC 2D7TL 3CVHL 3P4OA 3WIIL 4BFBD 2RQ8A 1LP9F 1HHHA 4LQFL 1BF8A 4PJCA 2QKIB 4TULH 4YHIA 5MEOA 5FYLD 2IGFL 5EWIH 5GGRY 3KR3L 3UAJD 4Z76B 1A6VL 1IMHC 3VXRE 5MEOB 2AJ3B 2UV3A 5IHZB 1MY5A 5GSVA 3GJEA 3QUYA 4HUMB 1HKLH 4GUPB 2D0GA 4MQTB 1CT8B 3ARGA 4PJBA 4YBLB 2A0LC 5C0AB 4ZUVB 1S7SB 3IJHA 4HBQA 1M1SA 1L6XA 5J13B 3D18B 5LXGH 3P4NA 1Q0XH 1AIFA 3AVEA 5LBSH 5CUSH 4HUXA 1EHAA 5IIEA 1G7HB 2IPKA 4MHHI 3ULSB 4WW2B 4F57H 4QOKB 4TVSa 3CUPA 5GJTL 3AM8C 1Q1JH 3ZKMC 1CFVH 5L0QB 4F37K 1OGTB 5HVHC 3L5IA 3X13B 4H8WL 1SBSH 2HFFA 4FP8H 2J88H 4N1CA 3BESR 3BGFB 1RQ5A 1VFOA 4CVXB 4PJFA 4Y4KB 1N4XH 1QOKA 2IFGA 4QRSB 4XC3L 1PLGH 3MV01 3F7PC 1JZ2A 3M17B 2AK4A 5F7LB 4UBDC 2UWEB 4N9GB 1T22B 3CK0H 1QACA 5LWYH 3RI5K 1FO0H 1WZ1L 4LSTH 4IRZL 4XB7A 4OZFG 1FYTE 4X98B 5JIHA 2EDYA 2Z4QB 2ZOKB 4UTBH 3PGFL 2RGSA 1RJYB 2XWTB 5TFSH 4QRUA 2AJXH 3BFOA 1T5WA 1Z5LA 1FNFA 2W92A 1I3GL 1U8NA 4B7IA 4JQIH 2O5XL 4GRLD 2RJMA 4R7NB 3HUJF 5M7QA 5EU6D 3U1SH 5E2WH 1IGMH 3S5LA 2AXGB 3B9EA 4G6JH 1FZOA 1S7RA 4NQSA 4KV5E 2DKMA 1FIEA 4OGAC 3RJDA 4LARH 3DSFH 4G7YL 5DDHB 2Y9RT 1JK8A 1RJZA 3VFVA 1KFAL 1X4ZA 1QFPA 3G08A 4JFFD 2J8UE 4J4PD 3S37H 3AMKA 1LQSR 3LMJL 3U9PH 2AABH 2QSCL 1I8KB 5HYJB 2BRRL 4E41E 4GG8A 4WEBL 3STZA 3PDGA 4P2RA 4U0RC 4WJ5B 2R56L 3O11B 3DI3B 6CGTA 2GSGA 1VEMA 3TBWA 1U41A 3FKUS 4B41A 1S7TA 3LKRB 3P0GB 3RWJA 4L4VD 4WDIA 1IEAA 5DGQA 2VOTA 5FGBC 3CFKB 3MLPA 1P1ZB 3H9ZA 1JN6B 3THMH 4YHLL 1HILA 2HFGH 5KSVA 3W11C 3HFMH 1GC1C 2VAAB 3MOQA 4EN3B 1TJGH 2R4RH 1CDUA 3KPSA 5IWLC 3RWJB 5I74C 1KTDB 2EYTB 4EQ3A 2CPCA 2VL5B 4ORGB 2PN5A 5T1KB 3CVHB 3ARDA 2FJGA 4JFEB 3VXMB 3T65B 3TC9A 1U8KA 4PJEE 5JDJA 2QTEA 5D7SL 1KXVC 5IBTL 5L9DL 1ZSDA 2WIIA 3RIAF 3O0RL 4FQHB 1F90H 1YEGH 1HSAA 5DMYA 5T5FH 1B90A 3BHBA 2BRQA 5IUSA 1TZGL 1SMOA 1VFMA 3BWUC 2DLGA 4Y16A 2PTTA 4NCC1 2VDML 4JFDA 4GQ9L 1MJUL 5BZDB 1BX2A 1I1YB 2XKSA 4K23H 1AD0B 2CR3A 2OLDA 4H1LB 4OD3L 1S7VA 3N1PC 4MD0B 1IAOA 5BS0B 4QTHB 1OGAD 4FTVD 2KZ1B 5I2IB 1ZKAA 3ULUE 1XF2B 3CAFA 3P11L 5D1XB 2DLIA 3VFNA 2HRLA 5DZNA 3JWOC 5HY9A 1S5HB 4GT7A 2OL3A 5D1XA 4OLVH 1JTOA 1KIQA 4D8PA 5KBNC 4HIXL 4JDTH 4ZFZB 3V8CA 2A9NH 3T3ME 1HI6B 1HOCB 4KRNA 3WDHA 5TQ0L 4JRYE 4U6VL 2GSIA 3ARQA 1U93B 2SEBA 3DMMC 1ZA6B 4GAJL 4KKAC 2JB5L 3VFGH 2CGRL 5JQ6H 4H8WC 3PWLB 1DZBA 5HDBF 2I9TA 5CJXC 2AKRA 5E6IB 1I7ZA 4XNZB 4PJ5E 4YQXH 1XR8A 4HFUH 3VXSD 2AV1A 3EDJA 4HXBH 4JKPH 3HR6A 3MJ9H 5D1QD 4M3KB 3MUJA 1ZLUK 3HZKB 4PJDF 2W9EH 1FGVH 1J1OH 3B2VH 1PQZB 4G42A 5IVZB 4ZTPL 4Q97A 4PTUB 5FGCE 3O2DL 1QNZH 5BRZD 1EHXA 1ZLVK 3SCMA 4Y4KC 2OK0H 1ZEAL 5A3ID 2VXSL 1LNUB 4UQ3A 1A2YA 3T77A 4I3GA 3TP4A 2OXGA 4D3CL 1T5WB 2GFBA 2N56A 3OAYK 5KSBA 1C5DB 2WQ8A 1KNOA 3KNBB 2FDBP 2FIRT 2X6MA 3R0MA 3ARFC 4ZYKA 1YYMH 3WJJC 4F7CA 2EE2A 3V0WL 5JW4N 2CK0H 3FO0H 4N8CH 4HIEA 2R69H 5D72H 4W4OC 4DGYH 12E8H 3SDYH 3S3JA 2JCCF 1YECH 4HIIB 1IKNC 2EDNA 4N5EC 5D2NB 1P4IH 4G8GD 4MAYD 2EXYD 3D9AL 4MXWL 2RFXB 2VABB 2Y5EA 4MA8L 5D2NC 2FB4H 5LVEA 4IMLB 4YDLB 3I84A 3MROA 3MC0A 4ODWB 1EBPA 2APXA 4P3CH 5IGXH 1F6FB 4HH8A 1SM3L 2F5AL 3O6FA 4PJIB 3IJSB 3SPVA 4CDGC 4LCWD 4F9PA 4NQVA 1LO4H 4RWHA 1NGYB 5FGSA 3ARYA 5D7IA 3G5ZB 3IAGC 2OTWA 4YFLI 5D70L 3UPRB 2E7LA 3MRKB 3IDGB 1G9NH 4UT9L 4JG0H 4ZS7L 2I9LB 3SDDD 2FRGP 3O8XA 4QHUA 5C1MB 3ZE1E 3V2AR 5I8OH 3IJHB 5JDSA 3MA9L 1ED3B 1GZPB 2Z93A 2D0HA 4M9PA 4X7DC 1EEQA 4WFED 4RZCA 4LSDA 4IIQA 1W0WB 2ADJB 4PJGB 4BK5A 1NPUA 5D5MA 4X4XB 1IL1A 2V2WA 1KCVL 1P7HL 1FPTH 5FF6A 1B0GB 2XZCH 5DRXA 5E2JA 4KZDL 1IAIH 3ZYOA 1CE6A 1L7IL 3EJYD 5SWQA 5FM8A 5DRWA 1JHKL 4PJBB 3VMOA 2FLRT 4TSCH 3HHRB 3IAPA 1U8OA 4YZFF 1JE6A 1FNEB 4FQ2L 2CLRA 5SX4I 3TCLB 1WIOA 1MFBH 3KLHC 3FB8A 2VIRA 4GS7C 5JHDB 4LLWB 3TBVB 2CRYA 3KPNB 4JM2C 3TWCH 4QRPA 4L29A 4GW4B 2XKUA 3U46B 3U9UA 4Z7NF 2FX8H 3ZTNH 3OXSA 3K4AA 5JO5B 2Q6WB 5HVWA 4M1DH 5F70A 2R2EA 2H2SD 5I1HH 1JNNL 1JWSB 5HYFA 2X2YA 1XT5A 2BY2A 5ILTH 3O3AA 2NQCA 3SDCA 2OL3B 2P49B 5CD3A 2J8UA 3IDNB 4M4PA 4ZPVA 4PRHD 2RB8A 3EIFA 3PHQA 4F33B 1P6FA 1JF1B 4RGNC 1RZIB 4P9ML 4Z7WA 4HEME 4F9LC 4HV8A 2F54A 3I50H 3QEHA 2DQIL 5CGYC 1J1XH 1RZGA 4ODTH 4O02L 4XC1H 2BXZA 5HBBA 4EBQL 2AJVH 4TUJA 3D85B 1FVDA 2DQTH 1IC5H 3EJJX 4XVUC 2K7PA 2IG2H 3GI9L 4E41A 4EI5D 4ERSH 5CHNA 5LKNA 3S5LG 1LVEA 3UTZA 5EOCH 4P2OD 3P2TA 3QI9A 4WU7A 1N5YH 2ORBL 1M05B 4WTXA 3MFFA 1VACB 5JIIA 3IDXH 1KJMA 5FGBA 1SJEA 1QRNB 1SEBB 2Q8AL 3HPJA 3WBDA 1LK2A 3BAEH 2UYLB 4N90D 2Q7NA 2VLRD 5T3ZE 4HK3J 1U36A 4YBLC 2B8OT 5AUMB 1RJLB 3BUTA 2WLYA 4NO2B 2V6HA 1F42A 1TZHB 2AJZB 3C09C 3KPPA 1LO2L 3KPRA 2EXWC 4NWUL 4U0RB 3VFPA 1WCBA 3WDJA 2V9RA 1XEDA 3GKZA 3LKPA 4NQEA 4JO4H 5INDA 4L4TB 4MQXC 4JFEA 1MRDH 3SE9L 4LASH 1PKQB 4N1EA 2FR4B 3QIBC 2ITCB 1QR1B 3QFDB 3ZTJH 4JLRB 4NQDA 3B8SA 3OL2A 5IG7A 3RFZC 4FHBD 4ZAKD 4ZD3H 1E6JL 1L6ZA 1X44A 2J5LC 2DKUA 1XR9B 2FX7L 4LVOC 4HHAA 5DO2C 1FORH 5L6YH 1D5BB 1OCWL 4HUNB 5SWQB 5FYLH 3VDBA 4MQXD 1J8HB 2NMSA 1JWUB 1D5BA 2LAAA 4YAQB 4MD0A 5E1HB 1A22B 3P3YA 1U8LB 1EEYB 4PGBB 3VFUB 1B0RB 1H15B 3N85H 5KVGH 1R3HA 3HE7B 5EU7E 5HHQB 3OHXA 4LVHC 1CDYA 1DBML 2ZSWA 4NO5B 1MCEA 3MV7A 1CBVL 2KPNA 4RA3A 2GJJA 3I6KB 4KQ3H 5SV3A 4X80L 1NBQA 2ED7A 2ZUYA 3GMNA 4TVPH 2KZWA 1Z9SA 5KSAB 5B38G 4HX1B 1ZHBB 5FK9B 1T5XB 3HNSL 1GSMA 2W9LA 4XCYB 4AL8H 3QO1A 4Q6IA 1EBAA 3ARZA 3MLRL 4ZUUB 2OTUA 3SCMC 1HQ4B 3A6CL 1ONQA 4ALAH 1I4FB 1WBZB 1UJTA 4U6TA 1VKXB 1S9YB 3CX2A 3MNWB 4XP1L 1DQDL 5I6XB 5GGUB 3GJFH 3HCVB 4NM8L 1Q38A 5C2BL 1KCRH 2NX5E 3V5DB 1EAPB 4J3WA 1S7UA 3LDBC 3NABL 4LEXH 4R4ND 5ALCL 3L3DB 2XQBH 1PBYA 1PX3A 1WZ1H 5B39A 1QKZH 1VENA 5BO1H 4XCNB 3STZB 4X7TB 1YUHB 4XXDB 4P4RA 4XWGL 5D71H 1LO5B 4HSQA 3GIVB 1LDPL 4PTUA 2IC2A 3KYOB 4QRRE 3E3QE 1N3NB 4LHUG 2ED8A 2ARJA 5D7IF 2HRPH 4PBVC 1NLBL 4JRWA 4PTTA 2DQGH 3MGOB 3NA9H 1S7RB 3VJ6A 1NC2D 4G7YH 2WINA 1WTGT 3A67L 2EKSB 4XWOD 3QXAB 4J8RA 1NANI 1QFWL 3CLFH 3WE6B 4PJHF 4D2NA 3SDXE 1SEQL 4CN1A 3NTCH 2CKBA 2A6KB 1G84A 3SY0A 4UNUA 1Q9OB 2VZSA 3VJ6B 3EDFA 4QRQB 4HIHB 3VD4A 1A1NB 2AK1L 4ZUTB 4RAVB 4WO4B 2M26A 4X8JB 2BOBB 2VXTH 4YFDB 5GGTH 1NC2B 4JG1H 5TJWK 1A1MA 3RL2B 1WIPA 3SKNA 4LRIC 5HDOA 1TNNA 5JORA 4WHYH 1LEKB 1FVCA 1NBZA 2WM0A 3EYUL 2IWGA 4YHLH 3QWQB 3RUGE 5IHUL 3PG2A 4WHTA 4NSKB 7FABL 4JPVL 1AJ7H 1G9ML 1DBJH 5M94B 3RPKA 3TA3B 1KG0A 2OP4L 4KY1H 4X5WA 3TA3D 3UTSA 4M6OL 1AGDA 3TCLA 1HSAB 1B9ZA 3CDGA 4MZ2A 1IRAY 3NN8B 2X44D 3CDFA 4EUPA 1OM3H 1KB5A 5F7KC 4AG4H 5H2BB 4JM2A 2VYRE 4U1HA 1DBKL 3FQTB 4O2CB 4OZIB 1GHFL 1HH9A 3SE3A 1T6WA 1V3LA 3P73A 4CW1B 4AEFA 2NPLX 3P9LB 3Q6FB 3HN3A 1WIUA 4GQ9H 4I0PA 2XTLA 4Y5YA 5DRZA 2LTQB 3HR5B 3WCYA 5KZCB 4ZFZA 4OZHB 2UWEA 4XI5C 5DJ2B 3ZYZA 1ONQB 3VG0H 3GMOA 4HMCA 2D03H 1RIHH 4P46D 5DZOA 3ZE0F 3MTRA 2H6PB 4PG9A 3QEUA 4GLRH 1F4YL 4LAQH 1ZT4B 3RWCA 2FJHA 3IGAA 1HEZB 5B22A 4XTRD 1BQLH 1JJUA 4LHQB 4JDTL 2X1QA 1AQDA 1T66C 4BKLB 2COQA 4Y1AD 1B6DA 3HE7D 5EBLA 4Y19E 2UVFA 4OAWB 4OM1L 3B9AA 4M9OA 2P5EE 1FE8L 4XAKD 1GYAA 4H0IA 2BNQD 5TE7L 3VFGL 5DDHA 4LBEB 4AEHL 1ZGLB 1ADQA 5I66A 5ACMA 1AC0A 3WFEL 4DKDC 5F89B 4YX2H 3G04B 3H42H 1Y18B 1S7UB 4GG6B 3MJ9L 3W5MA 4ENED 5E2VL 1UCBL 2W9EL 2EKJA 4L9LB 4AJ0A 1G1CA 3QRFM 2Q86A 2VL5A 4ORGA 4R97B 3BZFA 1ZHKA 1YMMD 4ODUB 4P5MB 2VLJD 4LFHG 5KSBE 1N8ZA 3RP1A 2HKFL 5C2UB 1FIGL 4O2EB 1EUUA 3X12B 4X6DF 3SPVB 2DQDH 4PBWD 1KIRA 4HUUB 4YHMH 1H0DA 1R3KA 4PJAB 2CK0L 4PR5A 4PJDE 5CAYB 3GB7A 1T1ZA 5D72L 3C87A 3FO2B 3QCUH 4Y19A 1KCSL 3TPKA 5I76A 4G7VH 1FZMA 4PJ5A 4HUKB 4HKZA 3ZT6A 2GK2A 3QXUA 4O9HH 1RIUL 2EECA 3L95A 3LPGA 4PGDA 4WY7L 1H3TA 3IKCA 4JFOB 4M5ZH 4MXWH 4OF8A 1S78C 2A83A 5AG8A 1UQSA 3OJ2C 3QG6A 3D2UA 5L2KD 1OT2A 4QWWD 3BZEA 1I85C 4LLUA 1NSNL 1J0IA 2VR4A 4JO1L 1S7QA 4YXKL 2XN9B 2VN4A 5E1AB 4NUGL 3C5ZA 3QFJE 3BKCH 1WBYB 1QR4A 1WT5C 1RZKL 4OLZL 1A4KA 1A6VH 1KN4L 2IMNA 5CEZH 1J10A 2ESVA 1MCIA 3K46A 4TOYH 2BNRD 3QB7C 4DN3H 4HCRH 3CGTA 3QUYB 4JANA 4W6YB 4PJEA 5EULV 2G9HA 1YYLH 1ERNA 2J4WH 3ARRA 1P2CB 3OKDB 1DQQB 4P23D 5J6HA 1QLRB 3NCYP 1NMCB 5BV7B 4HWUA 5F7YC 3MLZH 4DVRL 1F4XL 4Y2DD 4MB3A 2XTJE 5DJDB 3GBLA 1A5FL 3T0EE 4JANB 3FRPA 4R96B 4N0RA 4P9HL 4X7EC 2F58L 4IMKC 2JKXA 1FFNA 3N9GH 4H8WH 1BEYL 3DRQA 2ADFL 4I18A 1G9EA 4NO5A 4U1MB 4K3JH 5C0JB 2J88L 4FQJL 3CX5K 1JPTL 1NGPH 1HK6A 5EOTA 4O51A 1MFEH 3WFDL 3O4LB 5EU6E 5TGBA 4OKVB 5GS1C 3TWCL 4YR6B 3NCMA 1DQML 3RY6A 2AJUL 1G6RB 3WD5L 5I66B 2J8UB 3IDNA 5J9PA 3BWAA 2OL3L 1AE6L 3SDXA 4AIXA 5HHOE 4NCC2 1KENL 1M7DB 4IRZH 3C60C 1CU4L 2DWDA 3TN0C 3IU3A 4UTAH 3DVGA 4WI3A 5IW1A 2VAJA 3VRIB 1AQDB 2F53D 1P5UA 1NBYA 1BFOA 4WIQA 1JNJA 3DO7B 4JQIL 3CSGA 4F15B 5EPMB 5J06A 2W9DL 3DX9B 2QHLA 4ZTOH 3NIGE 1NJ9B 4KUCF 3RHWF 2V2XA 3IDGA 3C2SA 1EZVX 3LV3A 1U2CA 2J3SA 5HYQA 5KN5A 5HHPB 1F3JA 4L4TA 1S5IH 3JUZA 5E4EC 1N64H 4HMEA 4M43H 3SO3C 2AK4E 1RZJL 3GNMH 5GPRA 4PLNC 4U1JB 3LMJH 3U9PL 5KVEH 3VG9C 1IFHL 4BM7A 3QDHA 2G60H 5HHME 2P24B 3CNKA 4N8VB 4JDVB 5E99H 4KAQH 4GKSA 3D25B 4Y4HB 4H25A 2K9UA 2R1XB 1DFBL 3HTLX 3LN9A 3H9HA 1NAMA 2Z8SA 1BPVA 1D9KD 4KV5F 3T09A 4IMLA 5C0GA 3GSXB 1EFXA 4BA8A 1X5GA 2CUHA 1QBLL 3O6LL 4MNHA 3GMMB 4JDVA 3ZHKA 1OVZA 4F7EB 5KSUA 1YEJH 5KJRH 1WZMA 3L5HA 2R2BB 4F7EA 1VADB 4OJFL 4XAKE 3R8QA 1H8OA 3SE3C 2PUQT 3CSYB 2X4SA 1TETH 1JI2A 3ZKMD 1HKFA 1YJDH 4HWBH 4R0LA 4XP5H 3UTTE 3RZCD 3RVWD 1TZIA 3DVFA 1G9MC 1L0QA 1T0PB 1JWMA 4IRSD 4WFGD 1K5NA 1S9WA 4JFYB 5BOPA 4KPHL 3V0VB 1HYSC 1KXTB 1BGXH 5I1LA 4PRIB 3MODH 4A6YA 1XH3A 3MUGB 5GZND 5C92A 3VXRB 5J89A 3HNVH 4JGJA 5JQHC 3CVHH 4M5YL 2EZ0D 2IJ0C 2JK5A 5SWSD 1KB5B 4AENA 1LO3L 5D93B 3ILQD 2ARWA 4L3EE 4M6AA 4QNPE 5JW4R 1MWAA 1BZ7A 2Z31C 4DAGH 5FCSH 3L3JA 5EIQA 3FFCB 2OZ4A 3AUVA 4RFEA 3VXRA 3QUXC 3H9SE 1N59A 5EO9B 4M6MH 5KG9B 1ZK9A 5T33H 1JMXA 43C9A 1LMKA 3ELAT 1CXIA 1NCCH 2MKLC 4G8GB 1OHQA 1I8LC 5T1LA 4IRJA 3VXTA 1GPOL 3I3EA 1AI1H 3EOAA 3PQYB 5TH2A 4LCCC 1X5LA 5HHNA 2EDKA 3EOTH 5FCUL 3IJYB 1ZHLA 2JB6A 4GAGL 2DBLH 1UH4A 2CGRH 5DHYB 3BMVA 3GGWA 3SO3B 3IJYA 1CG9B 4K3DL 4D0BA 3CH8A 4RQQA 4PJIF 2CH8A 4X5XA 3PQYE 1WAAF 3CFBB 2Q3AA 5HI5C 1QLEL 5CGYD 2IH1B 4GKOA 3WJLC 1R24A 4XCNA 2DRUA 4XZUB 1BAFH 4D3CH 5D5MF 4NQCB 3DUHA 3ZKXB 4YDIH 3UJTH 1NC4D 2KQMA 2G5BA 1I9RH 4KKLD 4GFTB 1N3NA 4NO2A 4BQ8A 9CGTA 1N6QH 4DZBA 4FQ1L 5CZXC 3FO0L 5DJAB 2WQRA 1NFDE 3QXTA 5C0DB 4C55A 2JELH 4HC1H 1FNGB 4P2QA 2JCCB 4QXUL 1XF3A 1KB9K 2HA1A 1IGTB 1KACB 3DETC 1WT5A 3OJDA 4HKBA 4M62H 4YHNB 3GSQB 4P57A 4RMTA 1QFWH 3RVUD 2BFVL 2EKSA 2FBJL 3T65A 3ILPB 4WDIB 1FFQA 1OGAB 2VDOL 3X3FL 25C8L 4HQQH 4X9HA 1AH1A 3KPSB 4URTB 4YXLL 3CMOH 3OKEB 1G7PB 5IT2L 1P84J 4N0UA 3QDGA 4PJHA 5D70H 1Q0YL 4MS8D 3U0TB 1LK3H 2XKNA 4HKBB 2F8XC 5GGTL 2PW1A 5TDNA 3STBA 1KPUA 3P4LA 4U1KA 4XGZB 2I27N 1CLZL 3WO4B 3EYUH 1DQJA 4Q9RH 5CILL 4PJXF 1DN2A 2FO1A 1W8OA 4QCIA 5IFHH 1MWAB 1MNUH 2VLJE 4M7LH 4OCYL 2CMRL 5BV7H 2DQCH 2VZTA 4D0CA 2X41A 2OP4H 4KY1L 5DC9B 5DEFB 1RHHB 5TDNB 4QRPB 4NT6A 3D5OF 1I9IL 4OCWH 4RMUA 1HSBB 1OB1A 5MEQB 5D5ME 5JIKA 2AK4B 4PRIA 4A6YB 4DK3A 1IQDA 4QHMA 4D8PB 4XMPH 1B4JL 4ZFOL 5CEXB 1DL7H 4ZUUA 3LIZH 4D9QE 4DUXA 3RA7H 2DDQL 3FOLA 2EDTA 4H0HB 4JHAL 3P0YL 4OZHA 4FRWA 4YUEL 3OMZA 1WUNT 4JJ5B 5A3IC 3SDAB 1YEHL 1S7WB 2NW2B 2GITB 4TNVK 1Z5LB 3GGWB 1PX4A 1N6VA 3QEUB 4OZGA 3L9RB 4RCAA 3MRPB 5A43C 5I1HL 4WCYL 4KJQC 2RHEA 2D03L 2O26U 5I6XC 5A16A 3CC5B 4J6RH 4ZNEA 3HPLB 1ZVYA 2IPTL 3ETBF 4P5TC 5DMIL 1I7RB 3EZJB 3OG4B 1EO8H 1R3LB 5BQ7A 3MJ8B 3PHQB 3S4SA 3MFFB 4KTEH 1ORSB 5MI0C 1VGEL 3GMLA 2W0FA 4DQOL 2PO6C 2VWEE 4ODTL 3UPRA 3O4LE 5EU6B 3H3PH 4NKDA 1BFVL 1GRWA 1JNHB 2VDNH 4K7PX 4U1NA 4K7PY 5EBWB 4HH9A 1N26A 5DT1L 3IDMA 3OV6A 4QHNB 2FHBA 4JY5L 4PGEA 4FFZH 4ODWA 5F1IA 2PTVA 2NTFB 4LHUD 5F8RC 5FKPB 4X6CB 1N5YL 5IVXF 4PJAA 2IANE 4FA8A 5JQ6L 3QI9B 1YPZA 3RWGA 2ZJSH 1K85A 5C6TH 1PEZA 1JHLL 5BW7C 3ZTJG 1H3PL 3RY6C 3O6FC 2VITA 3QQ9D 1JRHL 2W91A 4RMVA 3L3IA 5I8KH 4XP9H 3SGEH 5GIRB 4M7LT 1H3GA 2D31A 1U8OB 4RBPH 1DUYA 5C0DA 4LEOB 1A3RL 4NNYB 3UP1A 3WN5C 1AD0A 4NWUH 3QUZC 4R0LC 5C07A 1YEEH 2IMMA 5DMGD 1J11A 1MH5A 1AO7D 3EJYC 5JHDA 1MCCA 2B1HL 4X6DE 5EZIH 5JHLL 4HC1A 4QOKD 3VRLE 1MH5B 4HEPG 4PB0L 4LNRA 4O9HL 4PV9A 1BMGA 2OR9H 5AD0A 2XN9E 3D2UB 4D94A 5D96B 1NKRA 1SBBA 3FFCD 2Y36L 5DA0B 1G7HA 4KDTA 4AIZA 6FABL 1WZKA 4ZS6D 1K3ZA 4MNQB 1FORL 1T0MB 3D9AH 5L6YL 4ODVL 4JO1H 5DRNA 3FQNA 4YDVB 1LEIB 1CR9H 1XCTA 3Q5TA 3G6JA 3BN3B 1E4WL 1ROWA 3HUJA 4M1CC 2NLJA 1S8DB 2B4CH 2H26A 1RZGB 4MJ2A 3TA3C 1XGTB 5I19H 5DEZA 4L3AA 3GMNB 1CTNA 4J7RA 5FM4A 3MO1A 2EH7H 3BRFA 4NRZA 1QLRA 5IVXB 3BUYA 1I8LA 2DI9A 4LPUA 3HRZA 1N5AB 1G9NL 1YYLL 4JM4H 4MSWB 2HFEA 3CXHJ 2PF6A 5D6DA 1PDKA 4ONFH 1QBBA 1NFKA 1JWSA 1ZWIA 3ARFB 5INCB 3IB4A 1YNLL 4PY8I 1ZLWK 4F7TB 4LLMA 3GRWA 1R5VB 3PWPE 5SWZD 4OF7A 4Y5XA 3BKML 1RK1A 5DQJA 3WNNA 1ZLVH 5IMOB 4GG6E 3T4YA 3FONA 5T3ZL 1UA6L 2IAMD 2QADD 3N9GL 4F9LA 2WP3O 1SJHA 2HMIC 2CRZA 5BMFH 5DJCB 1BHGA 1K6QH 3PJSB 3Q1SH 4Y5XB 4OLUL 1KEMH 5AYUH 4NP4L 3INUH 1EJOH 1YEIH 4Y88A 1IBGL 4JB9L 4XC3H 4NQDB 1PLGL 4QRRB 5EU3B 1TCMA 4AMKL 3BPNC 4Q9QL 2CKBL 2JTDA 4NHCH 1R5WB 4M00A 2CUMA 1BFTA 3MRJB 2DTMH 3UTOA 2HMID 5A40E 1MRFL 2HVJA 5F3HA 5TE6L 1H5BA 2MJWA 1J8HA 2X09A 5AYQA 3JWDC 1AR1C 4BFGA 1R0AL 3ARBC 3DVNB 3L3KB 2DQGL 2O5XH 4N8VA 5EBGA 3ESUF 1UM6H 3UDWC 5C08E 2YUZA 4NBXB 2PW2B 1QVOB 1GAFH 4H26A 3O3BA 4OD2A 5CP3H 3S3SA 5DO2D 2E9WA 3LAFA 4OLXL 2GI7A 4WUUA 4OQ1A 4EBQH 4CUCA 2RBLA 3H8NA 2DQTL 2BVEA 3CLFL 4QT5B 1RZ7L 1RZJH 3GNML 4JLRA 4WWKD 2O5ZH 2XXMB 4GSDL 4I77H 1P6AB 3QIUB 1CDIA 4KROC 3QYCA 2X70B 5JLZA 2J6EA 2VE6A 1H9VA 5CGMA 4UIKL 1YPZF 3K7UA 4F3FB 5DD1L 1NGQL 5TDOA 1UZ8B 3STLA 3MV8D 1EPFA 3UXFA 1KIUA 1PYWB 5E7BA 5MP6L 3CFDB 1JPFA 3T8XA 3VXMA 3BAEL 1I1YA 4NWTH 3QDJE 4ZFOB 5C08D 2P44B 1URLA 5C0FA 1LD9B 4DUWA 1FZKB 4KUZL 5K93A 1AXIB 4ZFOA 4OLWL 3U7AA 5C0CD 3THML 1TQCC 3QIWD 4LIQE 4IJ3C 5CINL 3QJHB 1J8HE 3IU4H 1D5ZA 1OOAA 1MCLA 3DJ9A 3SE9H 2APFA 1S9XB 5ABDE 5C0FB 3GJFA 4J3SA 3BP5B 4IOFC 4DKFL 3EO1A 3DRTB 4KPHH 3FN0H 4I9WE 4O2CA 4OZIA 4KFZC 1F8TL 2R2EB 2YMXH 3MBXH 2H2PD 5DQDH 3MACL 5H35A 1F90L 2MPAL 3ULSA 3ZKND 5DXWA 2GAZA 4AEIH 1UB6A 2X4RB 4PLKC 3NCFB 2DAVA 1HYRC 2VDMH 2H3NB 4R4BB 1BQHA 4J3XA 5E9DD 1GGYA 3S5LB 5T3XD 5E2TL 4FZEL 4G9FD 1WC7B 3WFBL 5EORL 3VFWA 4PJAF 3TYFB 1BVKA 1NCCL 2P7TB 3QZWG 5J3HD 5GGUA 4QRTB 4U6HB 2XWTA 1Z2KA 1RURH 5HDBE 1QRNE 1HIML 1EVUA 5ANMA 1E4JA 5LJYH 4V1DD 4BFIB 3KXFB 5GZOC 2NY2C 2MKWA 4PPTA 1WZLA 1QSED 3FQRA 4ZSOA 3L5XL 3HE6B 2DQUH 3H42L 1D5XA