3QIUC

Crystal structure of the 226 tcr in complex with mcc/i-ek
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
185
structure length
178
Chain Sequence
QVEQSPSALSLHEGTGSALRCNFTTTMRAVQWFRKNSRGSLINLFYLASGTKENGRLKSAFDSKERYSTLHIRDAQLEDSGTYFCAAEPSSGQKLVFGQGTILKVYLHIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQDSDVYITDKCVLDMRSMDFKSNSAVAWSACANAFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS II HISTOCOMPATIBILITY ANTIGEN, E-K alpha chain
publication title Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 34
structure length 178
sequence length 185
ec nomenclature
pdb deposition date 2011-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qiuC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qiuC02
5BS0B 1N26A 5IV2B 3WKML 5D70H 3UTZA 5GS0C 4HMDA 1S7XB 4G6KL 2FO4A 5I1DA 1IZKA 4PRIE 5KVMC 4HJGA 5A3IC 3H42L 3BP6B 1MAMH 1PG7L 5F96L 3B6SA 3HZVA 4JO2H 4PR5B 5BZWB 4OJFH 1OARH 5CBAA 5KVFH 3VFNB 3BP7A 4J23A 5AYQA 2OTUB 3HR5B 5FUCC 4N8VG 4XVUC 4WCYL 1AR2A 3L3GB 1W2KT 4P4RB 2LTQC 1QSFE 1L6ZA 1IEAB 4R8WH 2G9HB 1J0YA 5DJDB 1JE6A 1SYSB 2AI0L 4FA8A 2W65B 5J3HD 1IGML 4NC0B 4WI8A 3ZKNC 2YRLA 5L88L 3K1DA 2IANB 5CHNA 4ZFFA 1QFWH 2AV1A 3TA3B 1U8KB 5IT2H 4OV5A 4FRWA 1HILA 2AJYH 3QBTB 2AJSL 3QEGL 5I1GH 4P4KB 3NMEA 2NXYC 2NY4D 3HC0B 4K3HA 4KRPC 3FB8B 4L29A 1PY4A 4Z77B 4XNMB 2AJXH 4H1LA 1I75A 1BBJA 2GT9B 3FRUB 3OKLA 5KS9A 3H3KA 4F9PA 3OKMA 1S78D 5EIVA 4RFNC 4S1DD 5DJ0B 1XH3A 1INDH 1SYVB 5TH2A 1RFDL 2BZDA 5DURD 3O6FC 3QFJE 1T7YA 1QSEA 3ULVL 3GSNH 4P23D 4BKLA 3TFKC 3TGXA 1CD1A 4OGZA 5DR5H 3FMGH 4Z0BH 4QRQB 3WS6C 2XZAL 4JG1L 1Z6JT 2VIRA 3AREC 3NGBC 4NZRH 3DV6A 3QIWC 5F72S 3P9LA 5ITBH 4U4BA 3MA9H 4HC1L 4JN2B 3SKNA 4GKSB 1NCDH 3PWUB 3JWNC 1EZVX 5TDOA 2O26U 5D7JA 1JWMA 3R1GH 3BYYA 2LAGB 4R3SB 3WNOA 4FN0A 2WBJB 5FYKL 3DV4A 1F4AA 1NCAL 5GS0H 3TH2T 4FTVB 2E7HA 5HI3C 3G6DL 4APQB 1HSAA 5JW5B 1MRFL 1BM3H 1I8MA 4TPRL 1DL7L 1GHFL 3E8UH 1P69B 5FCUH 5GIRB 3EOAB 3Q1SL 5EZIH 5E2VL 4H8WL 3VW3H 4HMEA 4BFEA 1F00I 1ZMYA 1NKOA 4W4NA 3VWKA 3HZYB 1I4FA 3O8XB 1WFNA 2CO7B 3PWVA 1YMHB 2VDMH 4Y4HA 1CICB 3WUZA 3VFRA 3FO0H 2BERA 5E2WH 2HKFL 1DBJH 2VERN 4JGJA 4WTZG 3VG0L 1G7JB 2NLJB 1O7SA 3D69A 4LVNB 2VDOH 4XXDA 3QRGL 4ACPA 1PD6A 3O4LE 4JZOA 4G7YH 3MO1B 3P4LA 5K93A 1FG2B 5HGBB 4D0DA 1AXTH 2DLFL 5D1ZA 4PRHA 1SQ2N 1XF2B 1H15A 3H9SB 5DJYA 1WT5A 3GMNA 5J7CC 1E6JH 4KVNH 2DM7A 5IWLA 3F62A 5EU6A 3ZYIA 3IGAB 3SKOB 3RVTC 4ZO8A 1AKJB 1KCUH 4HFUH 4LLWB 3SO3C 5DHVA 4NGHH 2BX5A 2WWMD 3G6AA 3O41A 4PJ7F 3MQIA 3QULB 1DBKL 4JJ5B 4JN1L 4YHPB 4YAQB 4UIMB 4XVJH 5IFJA 4L8CA 2IH3B 3D18A 5DUPL 5D72H 3MUZ1 3ARDC 1Q9KB 3HG1D 5MP6L 2FGWH 2IPTH 4JFHE 1CFNB 2QQQA 1HOCA 1OAKL 4ZMAT 3MSPA 7FABL 3WFDH 1NDMA 5HYQB 5T1LA 1U95B 3DVIA 4OZGF 1WITA 3LAFA 4K9EC 1E4XI 4G9FD 3MLSH 1HNFA 2EDYA 1KB9K 3AU1A 3T3MF 5IVZB 1NFIB 2ZG1A 4H25B 1UZ8A 1M7XA 2GCYB 5GS0D 4J3SA 3KNBB 1LO3L 4LSPL 2YPVH 4Y8AA 2FYYA 1F42A 5A3ID 1KN2H 2P8LA 1LE5B 3VXRE 1SMAA 1ZVSA 1MVUB 4S1QL 4XI5C 1OCWH 2HTKC 1XGYL 4TSAL 1BJ1H 3MCG1 2HJLB 4HWUA 4XVUD 3MGTB 4FQ1H 4LSTL 4NNPH 3VD9A 1S5IL 5FXCH 1C7TA 1R3IH 2DI9A 5HHNA 3KLAA 5CLTA 2CIIA 1OAQL 3ZKND 3A0OA 5HHVL 1Z5LA 3EOTL 3U83A 4QCIB 3BDXA 4X5XA 3DVGB 3AXLA 4ZUVA 4P2OA 1NCNA 5HGHA 5KVEH 3DSNA 4ODVL 5GRYA 4X5WB 5J9PB 5CSBA 5FUOH 4A6YA 4HG4J 1NCCH 2NXYD 4KRPD 3QWRD 3CVHB 3JV5A 3PP3H 1XF5A 1RK0A 5E8NA 1LEGB 4F9PC 1FFPB 1TPXB 1C5CL 5FECB 32C2A 1R24B 3DETC 3M45A 1ZA3A 5FM8A 3HE6B 1ZT7A 4G6FB 1YMMB 5IMLA 1MRCH 4YK4C 1YQ2A 4QTHB 1A6ZB 3IDUA 3QWOB 4N1HB 1IC5L 5IJVB 3O6FD 5I0DA 1CBVH 2CK0L 3BDYL 3BPNB 3V4PL 3TFKD 5I17B 5E5MA 2UWEB 1MVFA 3CXDH 4QHNB 1FORH 3HA0A 2XOTA 3PXHA 3EYQC 3ARED 2JELL 3IU4L 4HZAA 4OQTL 3IJSB 1HHKA 1T0NA 2FH6A 2EYRB 5I8CB 3VXPB 5F7HA 1P6FA 4NDMB 3GSUA 3QIWD 2R29L 4L3CA 4X6BB 1TFHA 4Z7VE 1BFVL 3MRIA 1CE1L 3CCHB 5D7JC 1WWCA 3HCVA 3VFVA 2OJZH 4K9EH 1YEDB 5B38G 4RMUA 2I24N 5KTEH 1NCUA 2OP4H 1K3ZA 2KQNA 5EO0B 4ZFOA 1PDKA 4Z8FL 3AB0B 3B9KA 2GTWA 1BP3B 2BDNH 2L7UA 2QQKL 4YFDB 3UPRA 3O2WH 3JV4B 4ALAL 4DN3H 3T8XB 1P4LA 1XGTA 5HI3D 4PRIA 1MAJA 4HZLB 5C6TH 1C12B 3GB7A 5ESVA 4X9IA 1MH5A 2Y25A 3DX9A 4L4VE 3IRPX 5DWUH 1RZJC 3O81A 1P4BL 4HKJA 1OM3L 4JQIH 1JGVH 3SJVA 4KC3B 3VWKC 4D9QD 4LMQE 5GGRB 5T5FH 3MXWL 3F58L 1QSFA 3T1FB 1Q9WB 4LEXL 4LKXA 3G08A 3QUML 2OTPA 4RIRB 3VXSB 2DDQH 4Y89A 5HHOD 5CSGA 1OP5K 1LMKA 2VDRH 5IV2A 3ILQD 5FDWB 1AO7D 5D1ZC 1NMCB 1S7XA 2CDGB 5JOFB 3BRGC 4TRPL 2CRYA 1WT5C 4M9PA 4FQJH 3WSQH 1U42A 3BP6A 5IWLC 4J3WA 1KLUB 2AV7B 3QG6B 4OCSH 3K2MC 2P45B 1R6VA 4DAGH 3S4SB 5BZWA 5HYJB 4H1LH 5ADOH 2DF3A 5DRNB 3VFNA 3V6OE 1NGPL 3RVTD 5I8KL 3HR5A 1TENA 3U1SH 4PGJA 1ACZA 2ZNXA 1ED3A 5DFTA 3TYGL 1IEAA 4LOUC 1WLHA 1UXWB 2GTZA 4B5EA 1IC4H 2MQ0A 1IAMA 5TF1H 1UWXK 3HMXL 4TNWK 2PO6B 2W65A 2D7OA 3PHQA 3QFJA 4O02L 5C71A 3ARDD 3MLXH 5BV7L 1RIVH 1NBYB 3LVEA 4IBLT 4KHXH 3Q3GB 4P2YA 5EU7E 1SM3L 1J5OL 4YXKH 5MEND 2FB4L 1FO0A 5F9JB 2EIBA 3ZSTA 2GT9A 2OSLB 3RWHB 3PL6C 5J57B 2FDBP 3CFKB 1EVTC 1NGZB 4JO3H 4ZPTA 1G7QB 3SQBA 4AL8H 1GGYA 4IEFB 1E6OH 4HUXB 1I7UA 5TFSL 4I1NB 1CU4L 4B7IA 3PWJA 1F4YH 1CGVA 2X4RB 4JFXA 3OAZK 1HINL 3MJ8A 4Q2ZA 3S37H 3EO9H 1FFNA 2DQUL 4ORZC 4XI5D 5E8DL 1NLDL 2HTKD 5GQBA 4FXGA 1WEJL 4DGYH 1X4YA 5C70A 4QRQA 1AI1L 3G5XB 4XCCL 3RVUC 1RZJH 2XRAH 4P2QB 2UY6A 4NHCL 2E3VA 4G6ML 4I13B 3RP1A 5FGSA 3MROA 4GKSA 1OD7A 3MV9B 3AMKA 3PWUA 4P2OC 4LAQH 2KDGA 2BOBB 2IAMB 5CGTA 2A1WH 3T1WA 4G6AC 5EZIL 5HSFA 4R3SA 4Z7QE 1S9VB 2WBJA 4CRPA 4ZD3H 1OAUL 3LPGA 3Q6GH 5EOTB 1FAKT 1UH3A 4GXUM 5E03A 1ZT4A 1KTDB 5IROA 3TT3L 5JW5A 4GRWE 2Q8AL 1JZ6A 2A0LC 1EEZB 1Q1JH 2RJMA 3DETD 3S35L 3KXFE 4KKNA 1FVEA 5K59E 3RAJL 3EOAA 1DSFH 3KLDA 1QSED 1BVKB 1R5IB 4BZ2H 2NXZC 1J18A 1PQZA 4XPTH 1OAYL 1AE6L 5EIIB 1IAOA 1YMHA 4DGVH 5I1JL 1CICA 1ZTXH 3RNQB 3WFBH 4PJXB 2G5RA 5CJXA 3OQ3B 2XWTB 3UYRL 3EYQD 4O4YH 5HYFA 2NY1C 3P3YA 1VPOH 4ZOAA 2GK0A 2RCSL 4FFZL 3MCKA 4YX2L 3AS1A 3EYFB 3MO1A 4X9FA 4PTTB 5CEXA 3WNKA 1WVZA 1XF2A 4PJFB 4RMVA 5D7JD 4R4NC 3IGAA 3RGHA 3SKOA 1I3RA 4HXBH 1T1WA 1N0XH 1AKJA 2JJTA 5ITFB 3RWEB 4MMZC 3B9KC 4I8DA 1JNHB 2HKHL 5C6PB 2WP3O 1AFVL 3V4VH 1RMFL 1Q0YL 2NTFB 5GS2H 1NAML 5E0QA 4Z7VF 2XZZA 5J8OA 2ZUSA 5A40E 5IQ9B 2IH3A 2E9BA 1IAIL 1I8IA 4HKZB 1J1XL 2ZUXA 1RZFH 2EKJA 1X44A 2MNUA 2X10A 2B1HL 5FGCE 4GW1A 3U6RA 2YPVL 4XPBH 1JVKA 1KN2L 3VWKD 5HYQA 1W8OA 1WFTA 1V3JA 5F1KC 2PYFA 3I6GB 1CGTA 3TV3L 5D6DA 4OSUL 4PY8I 1J1OH 5DUBB 2GSGA 5IVZA 1U8MB 4QXUH 4G43A 2GCYA 5D1ZD 4PRHD 3KG5A 4LKCB 3KNBA 4A6YH 3Q5OA 1QR4A 4WW2B 1OP5H 2NY5L 1AGEB 5DYOA 1W0WA 2A9MH 1LE5A 3D85D 3TBYA 4DN4L 5IF0B 5HPMB 1JTPA 3D25B 3VFPB 1KJMB 3MBEA 3VXUB 4U33A 3I50H 4DKFH 5KVEL 3OKKA 4MVBC 4DKDC 2HJLA 1NLBH 5LWYH 1HYRC 2HA1A 4KTYA 4LPVA 3BZ4B 4AJ0A 4E0RA 1NCCL 2E27L 4BJLA 1AC6A 4LOUD 1A7QH 4YC2C 1ZHKA 3DJ9A 4OZIE 2EECA 1EHAA 1TNMA 4ZAKB 3L5JA 4LSRL 4LHUB 3VMPA 3TA3C 1BQLL 4QCIA 3DVGA 1DN0A 4X5WA 1UWXH 5T1LD 3O6ML 5DQDL 5J9PA 2W59A 3ARBA 4UINL 1MLCB 1OPGH 2HFEB 4LLMB 2K9UA 3JV6B 2I5YH 4JPWL 1IFHH 4RISH 5DD1H 4Z7VA 3DPBA 3PL6D 4WHTB 5GRWA 3O3AB 4LHQB 1I1FB 3HE6A 3HPJA 2UZIL 3QDMB 4UNVA 5GS2D 3U7WH 1ZV5A 3C8HA 4QTHA 4Q7DA 1WC7B 3CDGB 1B6DA 5E7BA 3U7YL 1YEEL 4RNRA 5MEPB 3CX5K 5D71H 1MCWM 2UWEA 1T89A 3LS4H 4O58L 5B21A 4N0YL 5JDJA 3TZVB 2V2XA 3SKUD 3B5GA 1MF2L 2EYRA 2YPKB 3RVUD 4LU5H 4G8IB 2EEDA 1X7QB 3M1BA 1K8DA 4XP1H 3N1QC 1HH6B 3UXFA 4M7ZB 3CCHA 4C56E 4NWUL 4EQ3A 4P2OD 3ARFA 1RK1B 5DWUL 3VFSB 2C3XA 4M1CC 4G6AD 1I3GH 2WBJC 5EO0A 2PCPA 1OTSC 3FZUC 5IROC 4J7RA 1FYHB 1A6TB 4OZ4B 3JV4A 4QRPE 4QXTB 3T8XA 4DZBA 4RMRA 4TN9A 1X6LA 3OAYK 3H8NA 4MA7L 4KDWA 5DJ2B 2A0LD 4P99A 2VXSH 3BUTA 2BVPB 3V6OA 5LKNA 1MFDL 1JNNL 4OFYA 4Q97A 2Y06H 5KANG 1NL0L 4Z7QF 5GGRA 1F02I 4WO4B 5HDLA 2NXZD 1CICC 3CDCA 3S88L 1AIFA 5LXGL 2BJMH 3BXNB 2EH8L 5FDYA 4YPGB 4GRWF 3U1SL 1EHNA 4LVNC 1W72A 4YE4L 2NY1D 3EJYC 25C8H 4YHYB 1FJ1B 3PGCB 1UM5L 4Z78A 5K59F 5JPMB 4KTDL 5E1AB 3WDJA 4XNQB 5HDOA 3TIEB 2X4UA 4JFZL 1KLUA 1DR9A 3AFLA 4R4ND 5D6CB 2JJTC 1NSNH 3GSOB 5DRNA 1F3DH 3MJ9L 1JGLH 3FAXA 5CUSH 1A4JB 3B9KD 4LLYB 3CUPB 5SV3A 1QEWB 5GGRY 3HMWL 4J1UB 3GBNL 3QXVA 2P24A 2XZQH 1T1XA 4ZO9A 2AW2A 4OLVH 4ZG1A 1GOFA 5GGTA 2PO6A 1NCTA 3EUUA 3S36X 3V7AE 4FFVC 1FAIH 3SJVD 3FHQA 4O00A 3SQOL 1NBYA 4QOKD 2A74A 5IMOB 5ICZA 2A73B 1RURH 2JB5L 3VGBA 1RZGB 2E5EA 5EU3A 5F93C 2BSSA 2VLLA 2B4CL 4ISVA 4R6UA 2EDTA 5F9JA 1CYGA 2HN7A 1X5GA 1Z2KA 5ESQB 4ODTL 2OSLA 5F6HI 3RWHA 1I3UA 2DIJA 2YUWA 3CFJB 4WFHD 4NO0B 3CIQA 2ERJB 3RVXC 2XNAA 2Z0BA 4AIXA 3MLYH 2APXA 4D3CL 2ZKHH 5I1AB 2JE8A 2I07A 5E99L 5FKPA 1OWWA 5EO1A 1X9QA 3TH3T 5DRXA 1UWEL 1I1CA 5IR1A 3FOLB 3X12B 4AK1A 4MVBD 3N50A 4I77L 4WFED 2APBA 3KXFA 5DVKA 2ESVB 3H6JA 3SCMA 1XF3B 1CDUA 5IJKA 4KAQH 4UT6L 2R15A 5BW7A 1NCWL 3IJYB 4Y88A 4M8QB 3BE1H 1U8PB 3TA3D 3BZFB 3MLUH 2V9RA 1U93A 3TPUB 1S9VA 3DRQB 3QZWA 3SKMB 3U79A 1A7RL 2HWZL 3G6JE 4U6YA 4X4ME 1H0DB 5J6HB 5HHXL 1N6QL 1H3TA 2MOVA 1FYTB 1KTDA 4OZIF 3JTTA 1E27B 3HC3L 3HE6C 4WHYH 1EEZA 1XR9B 3V5HA 1QLFB 4UQ3A 3PGDA 2VITA 2FBOJ 5E8EB 3TNNA 4EBQH 4GUPB 3VJ6A 5IIEB 1RUKL 3U46B 1BVKA 3BPNC 2M2DA 2FECI 1OT2A 1T89C 1B0RA 2VN7A 1KUMA 4YDKL 4HCRH 4MQSB 3KPPA 2H1PH 1RVFH 2CRMA 1MY5A 4B0MM 3MLRL 4Q9QL 1JGDB 1UQSA 1RZ8A 2ZSWB 4PTTA 2W60A 4G42B 4LF3A 4YDLB 4M6MH 4XVTL 2DQDH 1NBVL 3QJHB 4ONGH 5DC4B 5I75B 2CIKB 4LRNH 4RQQB 3O3BA 1NMBH 4M1CD 3CSGA 2WBJD 2R2BB 2YHGA 3TWCL 3AB0C 4HF5H 5D5ME 1OTSD 3FZUD 4FTVD 3WO3B 1T20B 2X4PA 3U0TA 1DBBL 3ULUE 3SO5A 3VWJA 1K5NA 2NW3B 4JRXB 4MNQB 5IQ9A 4Q9RH 3V6OC 4FNLH 5B8CB 1FDLL 2OR7A 5EFIB 3ZTJH 2Z91B 1FBIH 4Y1AB 2GHWB 4N5UA 1CICD 4OLWL 3C5SB 5FO7B 2Q8BL 4X5LA 3C8KB 1A5FL 2O5ZL 2Z92B 4KXZH 4OZIA 3KR3L 2EE9A 1BLNB 2BSTB 1YQVL 1KJ2B 2XI9A 3U4EB 1NMCC 2ZG2A 3EJYD 4RA0C 5DUBA 5EA0L 3RI5F 3IDYC 1U8MA 2E7CA 3HB3C 3RDTB 1J11A 1XCQB 4LKCA 3U0WL 2NY0B 2A9NL 4PJBB 2O5XH 4X4YB 5CP3A 4WW2A 1GH7A 2FATH 3MRBB 3VFMB 3V6BR 4YEFA 5IF0A 1J8HB 5HPMA 1AKJD 3VXUA 2QADC 1ITBB 3UTSE 5EPMB 3T0XA 3TT1H 2ED8A 4HKXB 2E9JA 4N8CH 1JGUL 3D3VB 4YDIH 4YHZH 4X4ZA 3FT3B 2NQCA 4L8DA 2Y6SC 3TNMB 1IGCL 3S3JA 3DGCR 5H37H 3VFWA 3HPLB 2JJUA 2ZWLT 2PO6C 5DS8B 5JO5B 4X98B 2ATKB 2P47B 4FFVD 4KZEL 4HT1L 1BQSA 4I9WE 3WHE0 3QJFB 1KB5B 5E8OA 2W07A 1DBML 4WFGE 3IDIB 3RY5A 2DM3A 4LLMA 1HE7A 1NFDB 4Q9CA 1BFOB 1P4IH 2NY6B 2P5EE 3DGGA 3U4BL 4CUCA 3QEHB 3WO4C 3RVXD 4YO0B 5J1TC 4EKXA 1FNFA 4K7PL 3S5LB 5C0CE 5C0JB 1QSVA 5CEYB 1WC7A 3CDGA 5GZNC 1BD2B 1QFWM 4R7DA 3QQNA 4P49A 4MB5A 3CLEL 4I3RH 1ROWA 5DZNA 2PR4L 1XGRA 4H5SB 4U1IA 2CH8A 1VENA 3SCMC 1T80A 5IJKC 4CMHC 2Q6WB 1XF4B 4G8IA 2WZPD 4GG6B 5BW7C 2VDLH 2EYSB 2UVFA 3FO9A 3MFGB 4F8QA 1U8NB 4OI8A 2DWDA 5LBSH 2IAMC 1HH6A 4BSVB 2DB8A 4OM1L 2ZOLB 4M02A 1A21A 5IHUL 1W72H 3MODL 2MSPA 2VL4A 2XA8L 2HTLC 4U1SB 5IVXB 3V0AC 1H3GA 2CDFA 5HY9B 3OKDB 4C54A 1A6TA 1QQDB 3QPXL 4QXTA 1X5KA 3BRFA 3EAKA 4NJAL 5BJTA 1MCCA 1SBSH 3HE6D 4G5ZL 4XCEB 3Q5TA 4G6FD 4XMKH 2EDHA 3GHBH 1IBGL 3HI1B 4PJ5E 3L95B 5SX4H 2CSPA 4XGZA 1U6AH 3NFNB 4OGAC 3MBXH 3IDXH 4G8GE 3G6JF 1JHKL 1YEIL 3QFDB 4MYWB 4XXCA 2CQVA 5GGTH 15C8L 4KJYB 4X6EB 4B50A 4MCZB 4PV8B 4XP6H 5CZVH 1CXKA 4UU9B 3TBVA 5C7XH 3L7EB 4LMQI 5JPMA 1A7PL 5ANMB 1TETH 4XNQA 3EOBB 1BEYH 4JRYE 5FAAA 3U48A 5FUZH 4K23L 1I8KA 4JFDB 3GSOA 3DYMA 2D4DA 3FCTA 1S3KL 3FHAA 1A9BA 1A4JA 4HLZG 5EOQH 4IIQB 4LLYA 5GGVL 1LNUB 4HLJA 4J1UA 2HVJA 2QTEA 2EDFA 3BGAA 4OD1H 4Z7NE 4IM8A 4JDVB 1I1AA 3V5DB 3NFPB 4ODSH 5TE4L 3X13A 1MEXL 3SDYL 3I3BA 4TYUA 2DRUA 5DVMA 1N7ML 2EE6A 3RQ3A 1C8PA 4OFYD 1FFQA 5CJ8A 1FIGL 4XC1L 4KTEL 3C08H 5EZOH 3H7LA 5ALCH 3FRPA 4PRBB 3L3IB 5D5MF 3RNKB 1WWBX 4DOHE 4PGCA 1YPZB 3ULUF 1AJ7H 2BRRH 5ESQA 1F11B 2JLLA 4ZOEA 3ZT6A 3CFJA 4NO0A 3LQAC 3W39B 1AXSA 4OBRA 3VFOB 5C6WH 3HB3D 4WW2C 4LL9A 4FXKB 4QHKI 2CKNA 3MA7A 5HYEA 5IBUG 2E6PA 3G6JA 4X4MA 4IMKA 4JB9H 1JPFB 2QADD 4GMSL 2IPUG 1F4HA 3FOLA 4U05A 2OR8A 5EOCH 1T66C 6FABL 4KRMB 3S8WA 2V5MA 4XWGL 2EDXA 1FNSL 2VISA 3RWFA 3U4AA 5KVGL 2Y6SD 4BH7B 4I0CC 3BQUA 1EMTL 4HKBA 3DI2B 4V1DB 3WKNA 3OB8A 1XF3A 3QDJE 2PO6D 3P73B 4X80L 1MI5B 4RWHA 3GFUA 3IJYA 4C4KT 1F4XL 1TJHH 35C8L 1OP3K 3BZFA 4AT6B 4DUVA 1QO3B 3DHJA 1IQWH 5HDBE 4F58H 3DRQA 2OI9C 2YKLH 1S9XB 3C5JA 5CCKL 1S7WA 3LKQB 4JPVH 1WJ3A 1FYTA 3S37X 4DW2L 4QTIL 1CGXA 1JF1B 1IKNA 2BC4B 4RMQA 1XR9A 3HTLX 1QLFA 3EDJA 1KCRL 1WGOA 5E8EA 3LEVL 1QKZL 4MA3B 2XXMB 1PX4A 5JOPD 4KKLC 4GUPA 3RZCB 2YMXH 1AH1A 4R90L 1GGBL 1BMGA 3D0LA 3ECBA 5GZND 5K9JL 3DRTB 5JHDB 4FFYH 2NY7H 1A6VH 1J1PL 2VXVL 1SY6H 3HE7B 5F3BA 1F2XK 3KXFD 3DUUB 4HF5L 3W2DL 4FOMA 1RJZB 1I7RB 3SCMD 1L7TH 1PYWA 2ZSWA 1A0QH 4G42A 4J3TA 5DLML 1GPOH 2IAMD 5CD3B 5GRJH 5IGXH 1YUHB 4WNQB 4B7LA 5C0NC 4RQQA 3X3GL 5IB5A 1KPUB 2BVEA 2HTLD 2R2BA 2MCPL 3MRPA 3B5TA 4GRMB 3VRJB 3LQAH 1T20A 2ICEA 2VLME 4RFOL 4X8XA 1INEH 3CFIC 2R56H 3HNVH 4MNQA 5C0RL 1NCBL 3EYOB 1DFBH 5EFIA 3UTSA 3CGTA 2ARJB 4OGAD 1A64A 4WO4C 5M94B 2Z91A 3UEZA 4NM8H 2X70B 4XXCC 1FVDB 2CK2A 3CVHL 4G9DA 4NNYB 5FO7A 4S11A 1NBQA 3C8KA 3ORJA 4YXHH 3HI6L 3KPSE 3QNZB 5SWZB 2O5YH 4YHYC 5T1DL 2BSTA 1LVEA 1LDPH 3EHBC 4IJ3B 4OZFB 4KQ3H 4N8VA 4CN6A 2CRIA 4WY7H 1ZS8B 1MREL 1R5VB 1QA9A 1A6UH 4EUPB 2R0ZL 5F7EH 4F9LA 4Y0GA 1TZGL 4XP5L 1TCRA 2VJXA 5ADPL 5EPMA 2P5EA 3F7VB 3UMTA 2YOCA 1N3NA 4XBEL 2W0FB 1JHTB 3FT3A 1GAFL 5GISL 2X1PA 4PTUB 4YJZL 2A6IA 2PTVA 2VDQH 3UYPA 5FKAB 1JRHH 4X98A 1JZ5A 2YRZA 1TMCB 1WIOA 2O93L 4S2SA 3QJFA 4NZDA 5JIKA 2VQTA 4JAMB 1OLLA 3IDGA 5IESL 3QHZL 4U1KB 4H0IA 3RL2B 4XNXH 3DBXA 3WIIL 4Z7NF 1M6OA 1NFDA 1BFOA 1EFXB 1X5IA 4ZFZB 1G9EA 1A14L 2ERJC 2QQNH 3QI9B 7CGTA 5B3NA 3WXWL 1KGCE 2H32B 5SWSE 2X7LA 4FQHA 1VGEH 2EDDA 3MFFA 2Q7YB 2R4RH 4MSWB 3VXUD 4ZO7A 4HK3J 3BEWA 1HNGA 3OX8B 1BD2A 4YBHA 5JTWA 4U1GC 4NNXA 1LD9A 3UZEA 4WTXA 1T66D 1NUDA 4NZUH 2ZUQB 3BQUC 1IEBA 1P2CA 3ZE2E 5JLZB 1K2DB 2DM2A 3BH9A 1GGIL 4PJ5A 1R3KA 3ARZA 2EYSA 2VQ1A 4FQLH 2D9CA 2N56A 5EZLA 1MRDL 4LFHD 1U8NA 4LHUD 2BRQA 4G8GA 2NR6C 3KPTA 5DDHA 2ZOLA 3OR7B 3F12B 2P7TB 4U1SA 5IVXA 4JZJB 4JO1L 3WFZA 1RZIB 3BWAB 5ID1A 1QQDA 1IKNC 5CIPB 1CDYA 1UZ6E 5C09B 1MCDA 1VDGA 4XCEA 3U36B 5CJQL 1IZJA 3E6HB 1TJIH 5C07B 3L95A 2H26B 4KKLD 1UA6L 4WTZA 3BKML 4LLVA 3QQ3A 1TETL 4PB0L 3QEQB 5HDBF 1QPXA 2IWGA 3SE8L 5I0ZA 2YEZB 5D2NB 3QUZA 8FABA 3T4YA 3DXAE 3CMGA 4N0UB 3LMJH 5TE7H 4X6EA 4MCZA 4ZQKA 3BGMA 4PV8A 2XT1B 1N59A 3PHOA 3MYZA 1Q38A 4OD1L 1S9WA 4UU9A 1NC4A 4YDLC 1E4WH 1WBYA 2BXZA 5ANMA 4P3WA 4FZ8H 4IRJB 1ZSDB 4W68A 5I75C 2VZUA 4GMTL 2WIIB 2VDPL 2DMCA 3Q48A 4JFDA 2RHEA 5C0ND 3GGWB 1MCNA 3ARPA 4HULB 3ZT7A 4M1DL 3LKRA 4ELMB 1LNUA 4DVRH 4EVNB 4DTGL 5HHME 2Q86A 3IB4A 2ITCB 4JDVA 3UZQA 5ID0B 5I1IL 3EYVB 3VH8B 5E56A 3N1GC 4NKDA 5CINH 3W5MA 5EC2A 1IM9B 4XPAH 1MLBB 2ITDB 3VMNA 3QCTH 4R96A 3TBWB 4TULH 4XNYH 5T3ZE 5AZ2H 1N2RB 3JV0A 1CFBA 5B39B 2V6HA 4K3EL 5D7IB 3L3DA 3RKPA 2DTML 4WO4D 2QLVB 2XWBB 2GFBB 4PRBA 3RNKA 5I16A 1JYXA 3RIFK 3LKOB 1YPZA 1CGSL 5GRVL 3G5YA 3QDJA 4Y5XA 4P5TB 4YQXH 1F11A 1E4XL 3EHBD 2BNQE 3RDTC 2VUOA 4HFWB 3ELAT 2NY0C 4OCLC 5E5RB 4I18B 1S8DA 3FQUB 4P3CL 3LRGA 2VXQL 2HFGL 1JV5B 4F9LC 1U8IA 2A2QT 3X3FH 3HC4H 4C55A 4D0BB 1HKFA 1SJEB 5CZKA 2AP2A 5JUEL 2YUXA 3NPZB 1F90H 3I6KB 2MPAH 3BW9B 4DQOL 2ZJSL 2OR9L 4IRZL 1T7VA 3B43A 4TUJB 4V1DA 3H7BB 4EJ1C 1NUGA 3BSZL 3EFFA 4M48H 3P73A 1MI5A 4YH6A 3O3EB 4NQCE 2OK0L 4LSQH 4Y2DB 1HEZB 1VADA 1KYOJ 4P2RB 3LV3B 2ICWA 1BQHG 3QDGB 2R9HC 3VGHA 1QO3A 2YMXL 4QHMA 1DCLA 1FSKC 2R2CA 4BA8A 4NQTA 1OGAE 1V3MA 3WHXA 1BGXL 4PS4L 2VUYA 2JK5B 2NY6C 3BD3A 1O7VA 5EBLB 5HI5C 4YNYB 4EI5B 5CBEB 1YA5A 4NO0D 1NEZB 5FK9B 2BC4A 4TVPL 5TJWK 4AEIH 1QR1B 4ZUUA 5D1QA 5LGKA 3T04D 5JXAH 4M7JL 4QRSB 4Q0XH 1H3WM 3GMQA 4WUUB 1G9ML 4KROB 3GIZL 2ENSA 2AAVA 3AVEA 5FYJL 2JTDA 3EKCA 1DQLL 2D31A 4BK5A 3V52L 4UT9L 3HNSH 1DQJB 3BP4B 4M3JA 3T0EE 3EYUL 2CJUL 4D94A 4LPUA 2WINA 5B38A 2W1NA 3BKCH 3DUUA 2E8YA 2ESVD 2YD9A 3BQUD 3ARGB 1I7RA 43CAB 1QVOB 1RIHH 3LQAL 4TSBH 4ODWA 1CWVA 3E3QC 1YNLH 3KPMA 1NGXA 3HNTH 4ODBD 4XT1C 3M07A 5CD3A 5EIQA 3TN0B 5D1XA 5ALBH 4FXLA 2FZ3B 2NR6D 1ONQB 1FL3B 1MFCH 1KJ2H 3GJEB 1KPUA 1U3JA 5JMOC 3BKYL 3P2TA 4CNIB 3ZE2F 1FFOA 5GXBB 1FYTD 4GRMA 1RULH 3V8OA 3VRJA 5C0IA 4LARH 2VZTA 4RGNB 1XT5A 2J8OA 3CZFB 4F2MB 1LWRA 4KUCD 4CKVX 1DBAL 5BXFA 5E24E 5ACLA 3SDXE 5INCB 1MHPH 5IB3B 1OGTA 3BJLA 2ORBL 1Y18B 3ABZA 5EC1B 4OM0H 2V2TB 3QUZC 2X70A 4PRPB 4KRNA 3P4OB 2XN9B 3GKWH 1KENL 3IDMB 1O0VA 1G7HA 1FRGL 1HDMB 1UZ6F 2AJ3A 2OM5A 3NIDE 1KOAA 4GJTB 2FHBA 5IB2A 4KKAC 1Z9LA 1R5VA 2CLZA 4KZDH 1B4RA 2IGFL 4IDJL 4WEUD 2Q1EA 5F88A 3V4UL 3GBLA 4Y4KB 3NCJH 4AZ8A 5HYSB 1WFOA 1JPSL 3PWNA 5T3XE 3ZKXB 2AXGB 4IIQC 2P8MA 3GMLA 3FO2B 2AEPL 1UB5A 4WV1B 4RCAA 2W0FA 1JHTA 1KCSH 3GSRB 4PJIE 5SWSA 3UC0L 4JFQB 2BCKA 4JRXD 4PTUA 3SE9H 4MNQD 4HGMA 3WFHA 3HRZB 4OLYL 3QNYA 3U0PB 3E6FB 1A6AA 2XWJB 3UAJC 4GO6B 3UTSD 4JFEE 3B9DA 3PIQB 1UVQB 4POUB 1P5VA 1TVHB 5D7SL 2D03H 1T3FB 3IFLL 3B9VA 3FL7A 2N1KA 5I66B 4PJ8A 1D5IH 4MNGB 4PG9A 5FHAH 5IK3A 4Y5XC 1EFXA 2BHZA 5DZLA 5HI4C 4JZNA 5HBBA 2JB6A 3PWLA 1VCAA 3KYMB 5AUMB 5DVLA 3RTQB 2WV3A 1Q8MA 3MOBH 3VDCA 2PTTB 4I9WD 3RDTD 4PGEB 4HK0B 3PGFH 2NY0D 1CR9L 1G6RB 4G6JL 5I19H 2IALA 4Z18A 4UT7L 4M5ZL 4UTBH 3PQYB 2RFXB 3O6KL 4M3KB 1BVZA 1U8LB 2N7BA 3PDGA 4KUZH 1LK3L 2P5ED 2GJJA 5FA3B 2IH1A 1YN7A 3D3VD 4XVSH 4EIGB 3HUJB 4R97B 3P77B 4HV8A 3CNKA 1M71B 2HG5B 1K2DA 3AMLA 3EJZC 2VLKB 2FX8L 3CMOL 3DMMB 4R26H 4YBLB 3WCYA 2DWEB 2V7HB 4JRWA 4NM4L 3RPIB 3GEWB 2SEBB 4Y19E 3BX7C 4WUKH 2AJUL 2EEBA 4HJJH 2R9HD 3FTGB 3KGRA 4LPTA 1UB6A 4OCYL 3TVMB 2DKMA 3GRWL 3MRRA 4EN3B 2NY6D 1DDHB 5C08B 3W9DA 5J6GB 1HSBB 2QKIA 3UX9B 3GMOB 4HUUA 1I9RL 5HI5D 1BZ7B 3CLFL 1F4WL 3KHQA 5C09A 3LB6C 3U36A 4K7FB 5D1QC 3RZCC 1GXEA 3QXDA 2J2ZA 3FT4A 5FYLL 5I2IB 1EHLH 5F97E 3WEXA 2X4TB 4LP4A 4ONFL 5GSVA 3QEQA 2RAMA 1BD2D 4G8FB 3SKJL 5D2NA 1DQMH 4LPCA 3HE7C 4D9LL 1U3HB 3OKOB 4KJPC 5HGDA 1IQDB 4N0UA 3ULVE 2R2HA 3CC5B 2F5BH 3S96B 4PJ5D 4NRZB 1SJVA 2YK1H 4TUOB 1UADC 4PJEE 1N5AA 5DSCA 2L0DA 1IGYB 1MHCA 4PD4J 1CE6B 4YFEA 1CT8B 3DOSA 2J6EA 4ZUTB 5D2LE 4TUKH 3GGWA 2OTWB 3EYSL 1QYGH 4LEOA 4UV4H 4RMTA 3UTPD 4L4TB 3MXVL 5EULV 3F7PC 5C9JA 4ELMA 4M7KH 4PJ9A 5FYKE 4JFPB 2ITCA 2NPLX 3EYVA 3TBSB 2VDKH 3KPQB 1WAAE 1JF5A 2R4SH 5AD0B 1MLBA 2ITDA 2R0WL 4OLZH 2AEQL 1FZKA 1GYAA 1IC7H 2CD0A 1II4E 1N2RA 5B39A 3L3OB 4U1MB 2HJFA 1LO0L 2OL3L 4LLAA 3A6CH 5JQ6H 2XWBA 2GFBA 4CDHA 5SWQB 2QHRL 3QUZD 3MREB 2YZ1A 3ARYA 3O0RL 5EG6C 3WXVL 1JP5A 1FQ9C 1YEFL 3KPRB 3ARXA 3QT2A 5DMKB 4LP5A 4NQCA 1NC4D 4HIIB 1MAKA 5KN5B 3QYCA 1HXMA 1TVDA 4KKAD 4PJGB 3SDXF 3QDAA 1PEZA 1KIQB 3AY4A 4JFDD 1OGAA 2PYEB 4Z7WE 4KFZC 4D0BA 4M62H 2Z4QA 1YEKL 1SJEA 1G9NC 5DEFB 1X5JA 3MYJB 3IJHB 1JTTA 1OSPL 2PN5A 3I6KA 1ZA6A 3NIDF 5ILTL 1IM3B 4JFFB 1JNJA 3P0YH 3GI9H 4X0KA 1FN4B 4Q58C 4EI6B 4TUJA 3H7BA 5C2UB 5DK0B 3VXTB 3O2DA 2B39A 3UAJD 3NFSH 1OAZL 4M5YH 1Y0LB 2WAHA 3DLQR 4KI5C 1JPTL 4KPHL 3K4ZA 3QDGA 3T0EA 4YHLL 4PJ8C 4XPHL 3A67H 3BISA 2JK5A 3MRJB 2FLRT 3CPLA 3QDJD 4PJIF 4ERSL 1FV1A 5HI4D 4YNYA 4JE4B 1NEZA 1XR8B 1NMAL 3JWOC 2BNRB 1QR1A 3QO1B 3NABH 3UBXB 3W0WB 3DHMA 5H35A 4GAGH 2W38A 1YYLL 1NGYB 1U2HA 4K2UL 5CJ5A 3QCUL 1DQJA 1MFCL 2ZUQC 3BP4A 1D3CA 4WHYG 3BPOC 4OLUH 1ZGLB 3AROA 3NN8B 4GXVL 3ARGA 3EJZD 4S0TD 4V1DD 3J8F7 43CAA 4IOFC 4M43H 1QVOA 1UEYA 3WFCH 3LDBB 1QNZH 1MI5D 4JANA 2W9EH 3IFNL 4MA8L 1UM6H 2M26A 2K7PA 3TN0A 2ICWI 3DX7B 1KV3A 3C6SB 3ZSSA 3PP4H 4U7KA 2BVTA 3QUXB 1HWHB 4NBZB 1IC1A 3GJEA 3MLPA 1ZHNB 1DLFL 3LKNB 1KELH 2UVEA 4GAJL 5D9SA 1V3KA 1CG9B 1QUNA 4JQVA 4TSCL 1BJ1J 4WHCA 4U7MA 3QUKB 2EICA 4U6TA 4OGXL 2PW2A 3LB6D 1MCPL 4GSDL 4B53A 5D1QD 3RZCD 3GIVB 1KB5L 1KFAL 1MIMH 1G9NH 5INCA 2DM4A 3P4NB 5DRZB 1ZANH 2I60L 1AY1L 1DQQB 1Y18A 5D2NC 3AS3A 3MUGB 5CILL 5J06A 4IMLB 1PZUB 4PRPA 1RZKL 4YHML 4NKMB 2Z93B 3HE7D 3P4OA 4PJIA 5GRUH 2XN9A 4JPKH 4XBPA 1JNLL 1YYML 2ZSVA 4JDTL 1FIEA 1MCEA 3UO1H 3ZTJG 3SGDH 4P48A 2H45A 1CFVL 5DEGA 1BIIB 2IQAA 3BD5A 5T33H 5J12C 2COQA 4Y4KA 4S1RH 1XCTA 2ZNWA 4WTWA 4YUEH 3ULVF 2D03L 4LVEA 4LRIA 4JO4H 3FO2A 1NH6A 5I8OL 3IXAA 3QUMB 4WV1A 1GC1C 2H32H 3JWOH 4PJEF 3ZZ1A 4UDTB 2DKSA 1JWSA 1Z0MA 2FHCA 3MLWH 3FFCB 1TXKA 3DROB 4HS6A 5DHYB 1NAKL 3E6FA 4MJ5B 2XWJA 5LGHH 5D2LF 3MOBL 2OMNA 1F6FB 1FNHA 4Y4FB 2BFVH 5CKGA 1F5WA 1TVHA 3MACH 2QSCL 2YA2A 4MD0B 5JHLH 5I66A 4OQ1A 3WV0A 5H37G 4O5LL 1RUMH 2D9QB 1CD9B 4HIEB 1EGJH 4HUVA 1EX0A 5AUMA 5SV4A 5L6YH 3RTQA 1WAAF 4GW4B 3RBSA 3WFEH 1RZ7H 3D2UB 4MJ6B 4XP9L 5GJSL 4PGEA 4Y19A 3AY4C 4G3YH 4XP4L 3PQYA 4G80A 1OHQA 2NYYC 4U0QB 2V17H 1HQ4A 1OAXH 1U8LA 2FL5A 5CIPH 4I3SH 4YWGL 5FA3A 4PJAB 2VQUA 2Y4SA 3DYPA 5E9DE 4QNPE 4OLEA 5T1KB 2YPLB 5F7DB 3I75B 4H20H 2W9LA 3ES6A 1VKXA 4V2BA 4LCIH 1FP5A 2ZZUT 1HHGB 1G7MB 2R0LH 3CH1A 5GJTH 1WSST 1PGRB 4YHOL 2V7HA 3K74B 1REIA 3SOBL 3NAAL 3GM8A 2J88H 4UDUB 4Z7WF 5TDPA 4I48A 2SEBA 3T0EC 3MRNB 4KI5D 2E7MA 3SGEI 2C1PA 3FTGA 4PJ8D 2IG2H 5DRWA 2CKBL 1XZ0B 1ZEAH 3CH8A 4WIQA 5L2KB 3MNZA 1EFXD 2AXFB 4PJEA 3NTCH 3RUGB 5J6GA 4JLRA 3M8OH 4LCCA 1BZ7A 3NH7L 3G9VA 1HHJA 4LSVH 3RHWF 3ROLB 3PWPB 2R23B 4HC1A 5E8PA 2ZCLH 2X4QB 5IOPA 2GAZB 3K4AA 2BNUA 4XNUH 4WRLA 3HFML 3HG1E 4KROC 2VXUL 5DC9B 2X4TA 4HPYL 1TZHB 1ZVYA 5JNYB 4E41B 1DE4B 4NUJA 4I4WA 1I9IH 1GC1H 4CBPA 1EBAA 1S7VA 1WUNT 2EE2A 3QAZB 1U3HA 4HWEH 4OCXL 3N85L 2CGRH 1EEYB 4ZYKB 1HN1A 2FECL 4EIZC 3ARGC 4PP2A 3S4SG 3CC5A 4J6RH 4G9FE 4LNRB 1F58L 4NRZA 3FB6B 4J8RB 2V5SA 4IOFD 3IETA 3KPOB 1MCBA 1MFBH 3U2SA 1IGYA 4TOYH 1XGPB 3FAWA 4FABH 3TN0C 4S1SH 3WD5L 4K3DH 4BUHA 3OBAA 4AM0B 4ZUTA 4UTAL 4PJDB 1A7OL 1KB9J 2OTWA 4NKIL 1EO8H 1KTRL 4JM2F 4L4TA 3H9HB 3SDCB 4JQVC 1DEDA 4RGNC 1G7LB 4OBSA 4JFPA 4YXLH 3OG4B 4CVZB 5C09D 5IM7B 4RMSA 2GSIA 5C0AE 3KPQA 5BVJA 4K3JH 4ZTPL 1T04B 2QJDA 3EDEA 3L5XH 3V5KA 1AP2B 3L3OA 3BYTA 3QEQD 2LABA 4U1MA 3I2CH 5DA4A 5HHMD 3LZFH 4L3EB 3MREA 3GDBA 4MB3A 3STZB 4NZTH 4OGYH 2LVEA 3IFOB 4NCC2 4PB9L 1DQDL 3O2DH 4C4KO 3KPRA 1PZ5A 1D6VH 1T0MA 3IXTA 3KYOB 1UKSA 2HJKB 3PV6A 4JHAL 1NAMB 4M7LT 4N0FB 2YSSB 4DKAA 1OL0A 8CGTA 4HIIA 1FL5B 4M4PA 2WLZA 2FRGP 1OOAA 2VXTH 3JWDC 4Y4KC 4ZTOH 1KIQA 4G7VL 4JY5L 3TYFB 4LRIC 4HXAL 4WDIB 4YHIB 4YGVB 5GS1B 1IGJB 4WV1C 4UZGA 3MYJA 3IJHA 4PJ9D 1NKRA 4QXGH 1QBMH 4MQXC 4YIQB 1HWGB 1IM3A 3BAEH 4HH9A 1EUTA 4JFFA 4JFOB 4Y5YB 3MLVL 1FN4A 3QIBB 4EI6A 3MOAH 1KEML 4U6XB 5DK0A 3NACH 1WWAX 1AGCB 1L6XA 2XQYK 4XCYA 4MAYB 1TTFA 3P0GB 4NRYA 2WBWB 3OKEB 3MLZL 2DQEH 1D6EB 1I7TA 1T2XA 4P0DA 4KJQC 2D2OA 1EIBA 1RSFA 3LS5L 3H9ZA 4BQBA 1UM4L 1XGQB 2C7UA 2JF1A 4MDIB 3MRJA 5IW1B 5TQ2L 3B2UC 3ARWA 3RTQC 4NQCD 4Y5VB 1XR8A 4KMQA 4XMLL 4PLOB 4PJCE 1CQYA 2AABL 1WQVT 4KDVA 1YNKL 5F7KC 4C57C 1OGAD 2NYYD 4FQ2H 4RAVB 4MQ7B 1MJ7H 4EDXA 1YEJL 1NGYA 3K8LA 4G8EB 3DYOA 3SN6N 1S7SA 2ZCHH 3RKDC 5IHZA 5E4EB 4R2GC 2VC2L 1NPUA 1HH9B 2KBGA 3DMMC 1C1EL 2R2EB 2DI8A 1UACH 1T83A 1BVLB 1BWWA 1MIEH 1T1YB 4F7CB 1L7IH 3MRMA 1RQ5A 1UENA 2AK1L 5DD0H 3RHWK 1W0VA 3ET9F 3R8QA 1KT2B 1ACYH 3ULVC 2YN3A 1EO7A 3QDGD 4NOFA 1T1ZA 3T0ED 5A1AA 3QUXA 4XC3L 3TVMC 2PNDA 5CEZH 3FOMB 4NJ9H 4QNPF 3LKNA 3DVNB 5KG9B 3UP1A 3QNXA 4LCCC 1NC2B 4OQTA 3RIAK 2D3VA 3U9UA 2EIEA 3JWDH 1IT9L 2C4XA 2R0KH 2EDLA 2P44B 3HAEB 1IGTA 4OV6F 5HVFB 4KROD 4R0LB 4ODHL 4UIKH 4WJ5A 5EO9B 2RBLA 5K9OA 4U0RB 3MUGA 2HFFB 3WKMH 1U3HC 5J0BA 4NKMA 5DVNA 1PKQE 4G6KH 5EUOB 3NPSB 4PG2A 2OZ4L 4NT6B 2M1KA 2YS4A 3B3IB 2H3NB 3ARGD 3H42H 1PG7H 5F96H 4DCQB 4OFIA 1JJUA 5FYJU 1E0OB 4P5KB 2X4OA 3NIGE 4HUKB 3RU8L 2P5WB 2EKSB 3HZMB 3MUJA 3TN0D 4WCYH 1X5AA 1WBZB 3HI5L 2EDOA 5DMGC 2D0GA 4TTGA 4MJ4A 4PRNB 5GRZA 4JFYB 4LFHG 4LHUG 2AI0H 2WK2A 1KIPA 5KANI 1JWUB 4HWBL 4AG4L 1S7QA 3C2SA 4JGMA 1IGMH 4RGND 3MRQB 2CDEB 1RUML 1YEHL 1L0YA 3QQ4B 1ZT1A 3DROA 3JSSA 4FS0A 3L3JB 4OIIL 5I1EL 1EGJL 1G0YR 5JR1L 4X7SL 2AJSH 1B2WL 3L5WB 3QEGH 4BZ1L 2Z31A 1JGEB 2VLRB 3GHEL 1RZ7L 3L3HA 2DQHL 4F15B 5C0GB 4Y4FA 4F7EB 4YPJA 3IF1A 4Y7MA 3GMRA 4G3YL 3TLRA 4CJ0A 1PFCA 3Q6FA 2V17L 2X4NA 4PRPD 1A47A 5E9DA 1MFAL 2XN9D 1N5YH 4GRLB 5EWIL 1DTUA 5IG7A 1QRNB 3GSVB 1PG7W 3TO4B 3H3PL 4HIEA 1CDCA 5CEZD 4NN5B 4OD3L 3IAPA 1RFDH 4FMFA 4GW4A 2X1XR 3ULVH 3HMXA 3MMEA 3X14B 3JUYA 5GJTL 1A1MB 3OGCA 1NDGA 5AZEH 3UZVB 4Y4KD 1D5XA 2FIRT 2XZAH 4JG1H 3FO1A 1QSEE 5KSAB 1WV7T 2FIKB 4PJAA 5LG1A 1T22A 1J7VR 4HC1H 4NQEB 1JF6A 4MQXD 1BOYA 1UG9A 2YPLA 3HN3A 5F7DA 1Z0NA 1OSZB 5HVHB 3A6OA 4HAGA 1QFUL 4OUUA 5FYKH 5BO1L 4UDUA 3PDOB 3T2QA 1NCAH 2IEPA 3MRNA 1T6WA 2VE6A 3G6DH 1MRFH 5CD5C 1XZ0A 4MZ2A 4TPRH 4G9FA 1GHFH 4KJQD 5L2KA 5AWNL 1F3DJ 2UY7A 2CMRL 3RUGA 3T77B 1YECL 2R8SL 5HGAB 4QRUA 3B2UD 3Q1SH 3O45B 5E2UL 3RTQD 1IRAY 2XZCL 5IQ7L 3EO0B 2FR4B 4Y19D 1MCQA 4AEFA 3QWQB 3PQYD 5KBNC 5C0DA 4I3GA 1RHHA 2FJFB 3T0WA 1IL1B 2XG5A 2HLAB 2OCFD 4S1SL 5JNYA 3V7AG 2HKFH 3G5VA 4GQPH 3SY0B 3VG0H 1KTKE 1KULA 3P30L 4P46A 5T1MB 3QRGH 3QG7L 43C9B 3RKDD 1HKLL 1MJ8L 4MS8C 4RFEB 1A8JH 1VHPA 2DLFH 2DL2A 3MNWA 3OPZL 4R2GD 4XH2B 4ZYKA 5E08L 3T08A 5C0AA 2VLKD 3VGDA 3K1KC 1T83C 3LDBC 5DQJB 3DMMD 4LNRA 4PJCF 2VAJA 5T5NG 4PRHE 1MCRA 2FHFA 4AM0A 3QUXC 2JIXA 4HD9A 3ULVD 1TCMA 1DBKH 2XKNA 2DJSA 5DTFB 4JN1H 3TVMD 1RV6X 3QWRA 1CD0A 3I2CL 5J1AA 2IADA 1EBPA 5DUPH 3H9HA 3WLBA 2JKXA 4MXWL 4PPTA 1RY7B 1UCBL 2MHAB 4X7CC 5C08D 3B9AA 3U9PL 5MP6H 4LAJH 2ED9A 4CVZA 1OAKH 3FRPG 4DK6A 5IM7A 7FABH 4GKNB 2GITB 4PGBB 4J12A 5ISZB 1Q72L 5D7KD 1D5MB 4RDQG 1T04A 5I76B 3C6LB 4L8SB 4UOW1 4POYA 1AP2A 4O9HL 1NGWB 2G5BB 2Q87A 5ACMA 2D7PA 5FYKD 1H3PL 4L3EA 1FNEB 4PG2C 1U3HD 4YR6A 1FG9C 2HT3C 1DUZA 4D9RE 1Z9MA 1LO3H 3I02A 2DYPB 2BVYA 4LSPH 3F7QA 2HJKA 4N0FA 1ETZB 1NAMA 2YSSA 4ONHA 1U8HA 5ERWB 3REVB 1FL5A 3BAEL 4NCDA 4ZDHB 3O3DA 3T65B 4S1QH 1XGYH 4HIXL 1FL6B 4HUWA 4R4BA 4TSAH 3VGAB 4M6AA 4JY4A 2FX7L 3LCYA 4LSTH 4NFDA 1S5IH 1HHHB 4EOWL 2AQ3A 5DMGD 5TGBB 3NA9L 4HS3A 4WDIA 4L4TD 1P84K 5ICXB 4YGVA 4YIQA 4BSWA 1OAQH 1R3JB 3SDAB 3OAUL 5HHVH 5C3LD 3EOTH 3NIGF 3QIBA 3FONB 1QG3A 4OUOA 1OWRM 2C26A 1FH5L 4ODVH 4U6XA 1AQDB 3CX5J 2Z31C 4MAYA 5I1CL 4Y4FC 1FGVL 3IDNA 4HQQL 3T2NL 4X6DE 4FQXB 2ADIB 3OKEA 5MEOB 2XTJB 2EIZB 2J4WL 3BHBA 2CUIA 1D6EA 5CMAB 3F7RA 1C5CH 1VFAA 3DVFA 1P7KB 3BUYA 4LCWB 3KPRD 4MDIA 5FB8B 4JY6B 3T0DA 3RWDA 1IGIL 4OLXL 1IC5H 2DN7A 2C3VB 5L7XL 4P9ML 4X8JB 1UWGL 4RAUB 2CK0H 5D93B 2H2SC 3BDYH 1DQTA 5BV7C 3OB0K 3V4PH 4AIZA 1R3LB 3BPCB 5BOZG 1X5YA 3NIFE 4PJHE 4MQ7A 2ICES 3WLWC 3IU4H 2EXYC 1LP9B 3IU3A 1GGTA 2DQFB 2FD6H 12E8L 5EU4B 2R29H 3MGOB 1LDSA 1AQKL 4NPYB 4Y16B 2CO6B 2VZOA 4JFFD 1BFVH 1X3DA 3U30B 1CE1H 4MAUL 2ARWA 2W0KA 4WI4A 3RWGA 1BVLA 5F3HA 1T1YA 5C8JA 1HCFX 1INQB 4OTXL 1ERNA 1WZMA 3P9WB 1JFQL 1LO4L 4MD4B 2VABB 1P9MA 2BVOA 1HQRA 3LKPB 3FB7B 3A6BL 4M61B 1FPTL 4Z8FH 2QQKH 3GMMB 1PKQA 4LASL 4ALAH 1IVLA 2BY0A 3VFGL 5LCVL 5I73B 3IDJB 3MRGB 5CD5D 5JXEA 1H9VA 2XV6B 4F7TA 4E9LA 5DD6B 3DVNA 3QH3A 5KJRL 1P4BH 1OM3H 5F9AC 4ZXBB 1RJCA 1WISA 4AENA 3DIFA 4F33B 3MXWH 3HAEA 4RRPG 3F58H 5DJAB 4ZSOA 2HLFC 1U0QA 4LEXH 4KMLB 2MQCA 3SJVE 3QUMH 1A3QA 4P46C 4PY7B 4MB4A 3QO0A 2CXGA 4QOKE 1WCBA 3TCLB 3OKNB 2ZUUA 5GZOC 3AGVA 5EUOA 4TRPH 4MS8D 2H3NA 1DLHA 5DJZA 4DCQA 1G6RL 4MX7B 5BS0E 3GI8H 5IKCB 2F15A 1YY8B 4AY0A 4CU7A 4P5KA 1AGBA 4CN1A 5DQ9B 5MHSD 1NGPH 4WFHE 2Y5EA 5JPNA 3BZDA 4HUNB 5I8KH 5FA4B 1RUAH 5HVGB 1JYWA 3IKKA 1Z9OA 2F54B 5ACZB 3QUXD 3ME0A 1WBZA 4GKZA 3BO8B 4GG8B 3B9EA 5AAWA 4KVCL 3TYGH 1A6WL 2VH5H 4NO5A 1CLYL 1LO5B 4NO2B 3HMXH 1JWUA 1AHWB 3IAGC 2VL5B 4O02H 1N5YL 4JCLA 2LQRA 5IVNA 1P7HL 3ULSA 4WFEE 1KNOB 4X6FB 5BV7H 2XIDA 3HS0B 5CLWA 5F89B 2QV2A 4HHAB 2BVQA 1I1RA 1SM3H 1MCOL 1J5OH 3WE6B 3F8UB 1PAMA 2FB4H 2IANE 1CTOA 5AZEL 1IGFL 5GGUB 3MJ9A 2EC9U 4ZUSA 3MV7B 3S5LG 1J05B 2WUBL 3UJTL 2GW5A 2HT3D 3EO1A 2DKUA 3F6IA 3TO4A 5TFSH 5HGGS 1CU4H 1U36A 3L1OL 1HINH 2YBRA 4QHKJ 4LLQB 2DQUH 5E8DH 1NLDH 1MCKA 3PDDA 1BZ9A 3ZDYE 1WEJH 4YHKL 2HH0L 4KKCC 3K2UL 4KK6C 1AI1H 4XCCH 5GS1C 5ETUB 3P4MB 2FIKA 4NHCH 4G6MH 1OF2B 4OF0A 3GNML 4NN7B 4WFFD 2UV3A 3KDMB 3FB5A 3WS3B 4OCRL 5GSRA 3ZE0E 3CVIL 4ZS7L 2RIKA 3QIBC 5GGSB 5A43C 3VA2C 1BQHA 1U8QB 3FFCD 1OSZA 3BWUC 4OT1L 4MAYC 4QY8A 4RGOL 2Z31D 3C9NA 2NY5C 4Y4FD 3ARSA 1OAUH 5I8EB 1CK0L 3CFEB 3PDOA 1EV2E 3INUL 2DLHA 3TT3H 3STLB 5E9DD 5FM4A 1QFWI 2Q8AH 5IMMA 2Z9TA 4Q6IB 3FN0L 5I6XB 2AS5M 5ESAB 3S35H 2H6PB 3T77A 1MJJB 1XGUB 4IRSA 3DI3B 5HGAA 1E28B 4FTVE 5KSUB 3RAJH 3EO0A 5LGJA 1CLCA 4X6DF 1OAYH 1AE6H 2H2SD 1A7BA 3D85A 5I1JH 2FJFA 4QRRB 4QWWC 3QEUB 1MCFA 3ZO0A 4NKOA 1BZQK 1I7ZA 3UYRH 3WLWD 1NFKA 3SY0A 2EXYD 2FSEB 1GJIA 1GZQB 4QXWA 2RCSH 3OB0H 1OW0A 4FFZH 4HAFA 2AJZA 4YX2H 1J12A 5BCAA 4RFEA 4OAWB 2YPLD 1U3ZA 1MHHA 4XHJC 4RWYL 3ROOA 2Q7NA 1IAKB 1K4DB 4NO3A 1LEKA 1TZIA 4XMPL 1P9MC 4PRDA 4UNUA 1A4KB 3TIDB 3NIFF 5B3JE 3H9SE 4PJHF 2V5YA 2HKHH 4JR9L 5C0BB 3SDDB 1LEIB 1AFVH 4HGWB 4I2XB 1RMFH 1Q0YH 3W82A 1FZMA 3EZ8A 5IW3A 3K0WA 5JXEC 1NAMH 5DTFA 5L2KD 2B0SL 1IAIH 4PBXA 1J1XH 4TNWF 3SPVB 3PL6A 5EOCJ 3V95A 2B1HH 1A3RL 2AK4B 4JJHA 4GKNA 2DS4A 4JG0L 1S7RB 4O2FB 5TDNA 1D5MA 2HLFD 4R0LC 2LU4A 5F6IC 5I76A 3C6LA 4L8SA 4NCC1 5HDQL 1JN6A 1H3XA 3HZKA 4BQ6A 3TV3H 3MGAA 4P46D 4QRTB 4O51B 1LO2L 4OSUH 1RIUL 1SEBB 1UFUA 3LSOB 3NPSC 1T4KB 4UAOB 2HRPH 5GZOD 1C08A 3OJDA 4F37K 3K3QA 3Q0HA 5KOVC 5JIIA 1KPRA 2DYPA 5C0AD 5E94B 5HYIA 3ULUL 2D0HA 1Q9LA 5JW4N 4Z76B 2NY5H 1ETZA 1DJSA 1MSPA 5ERWA 5I15L 3REVA 4NQDB 4X6DA 4BH8B 4ZDHA 4DN4H 3OR6B 3VXNB 3VXMB 2FEEI 1YJDL 3W81A 4U1HB 2JIXD 1I1YB 4NC2B 4KY1L 2DD8L 2G2RB 4OZHB 1HHHA 3GUTA 4M9OA 4LVHB 2E27H 3VRIB 4LVOB 4PREA 5DJXB 2AJVL 4RGMC 4XPFL 5CS7A 2DI7A 3LH2L 4LSRH 3L3KB 4M4RA 4XBGA 1BQLH 2Q20A 2W9DL 3CFCL 4NUGL 3O6MH 4PJHA 5DQDH 4F15C 4UINH 3W9EB 3CZJA 1UEMA 3QIUA 4FQXA 4ETQB 3BT2L 1TTGA 4JQXA 2KQMA 4JPWH 5INDA 3FQXB 4L3ED 4A2LA 3TF7C 4PGZA 1GZPB 3GSWA 3D0VB 2UZIH 3BEVB 2BSRA 2FD6L 3TO4C 4BQCA 3D5OF 2P1YA 2WLYA 1VFBB 1ZLUK 5HHPB 3U7YH 1YEEH 4HWZA 2VDNL 3MC0A 4X8JA 3CFBA 3F7YB 4MMXC 1R3LA 3MRKA 4S0SD 1B0GB 4O58H 1UJ3A 4N0YH 2ADFL 4TTDC 4ORGA 3DX8B 1G7IB 1G0XA 3EFDL 5BMFL 1FCGA 1LP9A 1N4XL 4KKCD 4DFHA 4C83A 1MF2H 4KK6D 2B4CC 3RL1B 4ELKB 2UWEE 2R1WB 3HAEH 3ZE1E 2N7AA 5HVHC 3QIBD 4BZYA 4NWUH 2DQIL 5TQ0L 5JIHA 4MAYD 1KCVL 3ZDYF 5F7LB 1FGNL 3O11A 4OB5L 4TVSa 4WU7A 4CDGC 4QOKA 2F5AL 3FB7A 3DARA 1CVSC 1WF5A 3GMMA 2B2XH 3ARTA 3GO1L 2IFFL 5JZ7C 3ZE0F 4MA7H 4F7MA 1GGUA 4IRSC 1DUYB 1S9KC 3IKCB 3MUHL 5DD6A 5BS0A 1KLGB 3VFTB 1QBBA 4WHDA 1MFDH 1JNNH 1V8HA 3GK8L 5H8DA 1KF9B 2CR3A 1NL0H 1VSCA 4F33A 3BH8B 2EH7L 4PR5A 3GI8L 3S88H 5E95B 5LXGH 1B9ZA 4OZFG 2OTUA 2EH8H 1RUAL 4QWWD 1BX2B 4PY7A 2VTFA 1OW0C 4K7PY 4YE4H 3L3GA 3D39B 3OKNA 4P4RA 1RJYB 1UM5H 1K4CB 2G9HA 4N1CA 5DJDA 3RFZC 2VH5L 1JPST 3U7AA 1U3YA 4KTDH 3BRDA 3K8KA 3VXSE 1SYSA 5A2JH 4JFZH 4XHJD 2H2PC 4YFLF 5HHQB 2J8UB 1YY8A 3DSFL 2VRAA 4HBQA 3HLAB 3ZL4H 2IANA 5E70A 2VNCA 3MJ9H 5FA4A 3TA3A 1U8KA 1JYVA 3WDHA 4I5BB 2F54A 3QA3B 3HMWH 5ACZA 1RHFA 3GBNH 1NQBA 3MJ6A 5IFHL 4P4KA 4UBDC 5HYJE 3HC0A 3FB8A 4Z77A 4XNMA 5JXED 4QHUB 3MRHB 5FO9B 3P0VL 4KMTL 3FRUA 1AHWA 2ZPKL 1NC2D 2VL5A 2LFGA 1KNOA 4JM4L 4QLRA 3SQOH 5DJ0A 1ULVA 3HS0A 4KQ4L 2ZOKB 1SYVA 5F89A 4P57B 5B3JF 5HJ3B 1GVIA 4HHAA 2JB5H 5IW6B 2JCCB 1PG7X 3C6LC 4L8SC 5DJ8B 2B4CH 3V0WH 3SE3A 5L9DL 1MFEL 2XKUA 4ODTH 2FLBT 3MV7A 3BN9C 4GS7C 4ODUB 2Y36L 1CDIA 1MQ8A 2DLTA 2XKSA 5E5UB 4D3CH 5E99H 2AGJL 4JN2A 1S5HB 3TESA 1KPVB 3GSNB 4O2EB 2P5WD 2R69L 2NY2C 3TC9A 1UWEH 4P9HL 5I1KH 3H2WA 1OD9A 1GOGA 2WNGA 5JOPE 5IFAL 1H5BB 4I77H 1YY9C 3P4MA 3RA7L 3VI3E 1OF2A 1WFUA 4FTVA 5GHWL 5B4MC 4APQA 4M6OL 4UT6H 4H88L 1E4JA 1NCWH 2AERT 1EXUB 1MWAL 1U8QA 5GGVY 4P2QE 5GIRA 4UUJB 1D5BB 5F1NB 2DLIA 3QIUC 4FQXC 4JQXC 3DUSB 2Y1VA 1A7RH 2HWZH 3D48R 3MV9E 3CFEA 2OBGA 3HZYA 3O8XA 1N6QH 5HHXH 1PVHA 2F8OA 3STLA 3ALXA 3QRFM 2BOCB 2IFGA 3HC3H 1P7QB 4Q6IA 5IBTL 3MNVB 1TJGL 3P11L 2EDEA 1G7JA 2NLJA 3QP3A 3WIHL 1Y6MR 1MJJA 3QUYB 3TO4D 5IHBA 3ZHDA 4D8PB 1E28A 2DBLL 5KSUA 1FG2A 5HGBA 1RUKH 3H9SA 2X9XA 5D93C 1ZWIB 1A3LL 3WUWB 4NQSB 4TQEL 1UJ3C 4LQFL 4YDKH 1ZLUH 3QEUA 4LLWA 4TTDD 4XZUB 2ZCKL 1CLZL 1NBZB 5DT1L 2XTLA 3MCLL 3MLRH 5IBLC 4Q9QH 4Y16C 3QULA 1DEEB 3DTXB 4NQED 4FG6C 3S9DB 4JJ5A 4PJXE 4OKDA 3U30C 4YHPA 4YAQA 4UIMA 1A1NB 1IKFL 1U8OB 5FO8B 2NXYB 4HCRA 4NSKB 4XVTH 5MI0B 3ZLQC 1K4DA 1Q9KA 1NBVH 5C2BL 1CFNA 3D9AL 1PSKL 1A4KA 3TIDA 3TWCH 4PJFE 3L5HA 4NWTH 3X11B 4RFNB 1U95A 3VH8G 2YD6A 2DQGL 2WSKA 1ZHLB 1DBBH 2XPGB 5D7LB 4E42B 2XA3A 4UV7L 3VGGA 2UWEF 1I9JL 1UKQA 5JZ7D 3ZE1F 4Z7UB 1QFPA 4IRSD 4O2CB 4QGYA 4DZ8B 5B39G 2C4FU 1NFIA 4H25A 5ICYB 1FDLH 2HRPL 4LQ1A 5F1SA 1YN6B 3IYLW 1LGVA 1U8JB 3RX8A 4AQOA 1BQUA 4NZJA 3PABB 4YHNB 4OLWH 1H8SA 1MVUA 3QIWB 3DX6B 2Q8BH 1F13A 3BDBA 1A5FH 4P5MB 2O5ZH 3NVQA 3O2VL 3DURB 3KR3H 3CSYB 4D2NA 1N6VA 4O51A 1YQVH 3MGTA 5F1IB 4IHOB 3BP5B 5EA0H 1HK6A 2D7TL 4YZFE 5FM5O 2WM0A 3B2VL 1AD9B 3PJSB 3U0WH 2A9NH 2EZ0C 3NA4A 2H2PD 4FZEL 3H0TB 4BH8A 3OR6A 1SEQL 3PNWB 1BBDH 1V05A 2BY1A 1JGUH 3HR6A 4P4KC 2GJ6B 2FBJL 3C60B 5E6ZA 1I1YA 1CLOL 1CZ8L 4QT5B 4D9RD 1TDQA 2G2RA 1A7NL 4U3CA 1IGCH 4UBDD 1FNAA 3VXUE 3VRIA 3CVHA 2GJZB 1QACA 1LEGA 1AHWC 2X09A 1FFPA 5FECA 1R24A 1EA9C 3G04B 4WGVB 3L3KA 4KZEH 2Q3AA 4HT1H 2XFXB 1YMMA 3LEYL 1K6QL 1DBMH 1YNTB 4DFIA 1CDHA 4JVWA 5HHOB 1MHEB 1A6ZA 4KRLB 3QWOA 5IJVA 1AO7B 3LPFA 4DK3A 3C6LD 4OF3A 4GW5B 4NN6B 3QCVL 5IEHB 3SE3C 1NEZG 3MV8B 1UYWL 5IB4B 5I17A 1P6AB 4QHNA 3FQXA 5DD5L 3U4BH 3OAZH 1BAFL 3BN9D 3I9GL 3IJSA 5I8CA 2DYPD 5KSBB 3VXPA 4NDMA 1E4KA 2EYTB 4K7PH 4X6BA 3SO3B 4UILL 1VFBA 2ZUWA 5BRZB 5HHPA 2C1OB 4F3FB 2NY2D 3F7YA 4HJ0C 2PXYB 3QDME 1YEDA 4FQCL 1T03L 2WQ8A 3CLEH 4ZPVB 4CMMB 4U6HB 1BF2A 1KC5L 2PR4H 5DK3A 3ARDB 1G7IA 4NN7C 1YY9D 4APQC 5FOJA 2B2XL 1CI5A 3RL1A 2FJHB 3TH4T 3KAAA 2ARJQ 5B4MD 4ELKA 4HZLA 4QF1B 2R1WA 1TITA 2FEDC 5C0EB 1C12A 4XB8A 4JHWL 2DJ4A 3VFUB 1H8NA 5MENB 4OM1H 5IHUH 3GMPB 2YWZA 3MODH 4BYHA 2XA8H 2Y07L 4I0KA 1V7NL 5I1DB 3O8XC 3MOQA 3QIUD 4FQXD 4OFKA 4F57L 2FO1A 4HJGB 1HI6B 2PKDA 3T1FA 3VI3F 3QPXH 3B6SB 1Q9WA 3HZVB 4Q6IC 3LRHA 4F80A 2EC9T 5I6XC 4NJAH 2P42B 1UH4A 2NX5B 4RIRA 5CBAB 3VXSA 1K9TA 4G5ZH 1DUYA 3RX7A 1HXYB 1KLGA 1IBGH 5FDWA 3LY6A 2CDGA 1H3VA 4M93B 5JOFA 1MPAL 1U41A 5CJOL 3LHPL 3PXJA 5F9OL 4X6CB 1ES0B 2AV7A 3QG6A 1B4JH 4GBXB 5F8QC 1NANH 3QPQC 1G6VK 1JHKH 1YEIH 3S4SA 1JMXA 5HYJA 3DNKA 5E7FA 3ZL4L 3LRSB 1HIML 15C8H 2Q3ZA 4KJWC 5CHNB 3D39A 4WI7A 2AV1B 4OV5B 3OSKA 1BWMA 3AAZB 4NQVB 1HILB 5IBLD 4Y16D 4FG6D 1UXWA 1A7PH 5HYSG 3V0VB 2HVKB 2F19L 4H1LB 5HHQA 5DD3L 4K23H 1XMWA 5JW4R 5KS9B 4N9GB 3OKMB 1S3KH 3FQWB 3Q3GA 1WZKA 5GGVH 1XH3B 2ZUTA 3RWCB 3RJDA 2YRPA 4YK4B 3V0WL 1T5XB 5TE4H 2GIYA 4PJXF 1MEXH 3SDYH 2PTUA 4BKLB 5BS0D 3PV7A 1N7MH 2FGZA 1CD1B 1FNLA 4GQ9L 4JKWA 3CFKA 1NGZA 2VIRB 1G7QA 1KJ3L 1GIGL 1FIGH 4P57A 4XC1H 4HUXA 4KTEH 5HJ3A 4ETYA 4PJFF 5IHLB 4NKQB 1CFTB 2X4RA 5DJ8A 4J3OC 5I1KL 1RPQA 4M7LL 3KYNB 3T2OA 4GXUN 5FYLE 2I9LB 4MJIB 4PRAB 5TDOB 5D7JB 1QSZA 2Y7QB 3BIAX 1R0AL 1RD6A 1U2CA 3OWEA 3G5XA 2XQBL 4P2QA 3DV4B 2EZ0D 5DJ6B 3SHSA 1A9EB 3MV9A 3G5ZB 4O2EA 2IAND 5BVPL 4BSJA 1I8MB 2BOBA 2IAMA 1X6NA 3GSXB 4GMSH 2QHLA 4LHJB 4R9HA 5T3ZL 2F54D 4LNVA 3NCYP 4UMGA 4P4KD 6FABH 4LVHC 3TJEL 1J86A 2J6EL 4XWGH 1FNSH 2OL3B 4X7EC 5EOTA 4LVOC 5KVGH 4YZFF 1EMTH 1TPXC 1Q0XL 3VWKB 4X80H 5I30L 4Y4HB 3B8YA 4WU5B 1F4XH 4PUBL 35C8H 2ESVE 5TF0A 3D69B 4XXDB 5CKAA 1D5BA 2VLJB 3LN5B 4WW2F 1R5IA 5F1NA 4JZOB 5FHBL 5EIIA 1C7SA 4MGXA 5DJYB 4HS8L 4ZOBA 5CCKH 1G7PB 3RNQA 3GMNB 4DW2H 4QTIH 4XTRC 4PJXA 4AMKL 1K3IA 5I18L 3MV7D 5EU6B 1P7QA 4CGTA 2XWTA 2HAZA 1E4KC 1KCRH 2KKQA 5GPRA 3LEVH 1QKZH 4PGDB 5DHVB 1JCKA 4D8PA 1FYTE 3EYFA 3OXSB 4R90H 1GGBH 4PJFA 3GZKA 4H26B 1ZWIA 5K9JH 2FX9L 5IFJB 4AEHL 3WUWA 4NQSA 4L8CB 4HJ0D 3D18B 1J1PH 2VXVH 4HMCA 2XQYG 3RWEA 5ITFA 4X9HA 2FH8A 1JNHA 4XZUA 4NHUB 3RVWC 4NWTL 3W2DH 4APQD 2NTFA 5T1LB 3VI4F 1L4IA 2FEDD 4YFLI 5DLMH 1SY6A 5IB1B 4JKPL 4CVXB 4HKZA 4NSKA 3UTTB 2BVUA 4KK9C 2ADJB 1WTGT 4HK3N 1A6PA 3VRLE 3AU1B 5DMYA 3OAYH 3X3GH 2ICWJ 3OF6A 3W11C 3O8XD 2MCPH 3X11A 1ZGLP 2BXYA 4N90E 2P8LB 4LLUB 2BHUA 3KJ6L 4RFOH 5D7LA 1BFTA 3I6GA 5F7FA 4JGUA 1CGWA 5C0RH 4O2CA 3TJHC 1NCBH 2X9YA 2B8OT 5JOEA 4FP8L 1YN6A 3H9SD 5GRVK 1EERB 4JEGB 1ADQL 4JRXE 1AGEA 5HHNB 4MNQE 5DUML 4ZNEE 3CVHH 4NBYB 3QPQD 3S3SA 3D25A 4NC1E 3KLAB 3VFPA 1KJMA 4P5MA 3EZJB 1MNUL 3HI6H 4EDWL 3DURA 1Z5LB 1BBDL 4W6YB 2GUOB 5T1DH 4KJWD 5HGHB 2UZXB 2X44D 3BP5A 4Y1AE 1VB9A 3BZ4A 4HBCL 4LSSL 4A6YB 3K80A 3QHTC 1MREH 4PJ7B 2VZVA 2QQLL 3BKJL 1XF5B 1RK0B 5E8NB 4ZAKA 2IBZY 2R0ZH 3F5WB 4LHUA 1TZGH 3S34L 4XP5H 32C2B 4K3GA 5ADPH 4YLQT 5FFLA 4PJBE 3PNWA 5C0BD 1ZT7B 2GJ6A 3C60A 4HWNA 5E2TL 5JW4M 3ESUF 4QT5A 2F8VA 4XBEH 1ZLSL 3L9RB 1GAFH 1MLCA 4Y8DC 5MEQB 1J8HE 2HFEA 4MNHB 5GISH 3JV6A 2GJZA 3IFPB 4OZGB 4KDTC 5DFVC 1M1SA 3D3VE 4WHTA 1OLZA 3O3AA 5E5MB 1SMOA 3ARRA 1I1FA 3G04A 2ZG3A 3C5ZB 3QDMA 2F53B 1HHKB 5CAYB 1C5DB 1MHEA 3UJJL 5IESH 4L3CB 3QHZH 4X99B 3H3BC 5MEPA 5KSVB 3WIIH 5IEHA 3MRIB 5T3XL 5KAQG 5IB4A 1DANU 1A14H 3TZVA 5JORB 5T5NF 3UBXG 2F58H 5E4IA 5KSBA 2YPKA 3WXWH 1NFDE 4L1DA 1X7QA 4ZFOB 4KXZI 3B9KB 2AEIT 1KIRB 2Z8RA 3UPRB 1M05B 4PV9B 5BRZA 1P4LB 4F3FA 1N0LA 3ARUA 4PRIB 5TE6L 3VXMD 3GB7B 4J3VA 5ESVB 1RK1A 2PXYA 5EUKB 3VFSA 5JW3L 4CMMA 1V7ML 4Z0XB 1GGIH 1BD2E 1UC6A 1X4XA 1XIWB 3UJIL 4NQXB 2FJHA 4OZ4A 1CFQB 1QSFB 4RDQF 5C0EA 1MRDH 3BGFB 2X1OA 4LKXB 5DJ2A 4ZFGL 5AG9A 3VFUA 1YMMD 3C09B 1Z3GL 2BVPA 1RU9L 3S36H 4GG6E 3GMPA 1TIUA 3E3QE 3KPLB 2NZIA 1CF8H 4JO1H 2H8PB 5DK2B 4WO4A 1B4JL 1HI6A 4WI9A 4WEBL 3T0BA 1Y6NR 3BXNA 4XTRD 4YPGA 5IVXE 2NX5A 2VN4A 2DMBA 5CJQH 3QUYC 1HXYA 3UTPE 5L8KB 1FJ1A 3PGCA 4W81A 1UA6H 1ED3B 3BKMH 2WUCH 5E1AA 4PB0H 4X6CA 3TIEA 2GTZB 1ES0A 3SE8H 2J7LA 4GBXA 4YC2B 5D6CA 3PHQB 3LRSA 3QFJB 4MCYB 3CUPA 1QEWA 3RVWD 3PP3K 2CKBB 3AAZA 4NQVA 1CIDA 4L5FL 1ZE3C 3GRWA 2BHYA 2EC8A 1KN4L 1PLGL 2B7DT 3LIZL 3N9GL 5MI0C 2LVCA 3V0VA 2FJGB 2HVKA 1WZ1L 3CK0L 4YEEA 1DZBA 1EEQA 1FO0B 5A2FA 4LGRB 4GMTH 4KUCF 4KK9D 2VDPH 3TO2B 1OP9A 4N9GA 1RUQL 3FQWA 5IMOA 4M1DH 2A73A 5ANME 5EORL 1G9MC 4ZPTB 3W11D 1RZGA 5CGMA 4X7FC 4DTGH 1I7UB 3RWCA 1NGQL 3OZ9H 4JFDE 3PWJB 5I1IH 3ALWA 1YC7A 3VXSD 1T5XA 4JFXB 3MJ8B 4Q2ZB 5HXMA 1CDGA 4JHBA 5FGRA 1FFNB 4DKEL 1J0KA 2J8HA 4FXGB 3TJHD 3QHFL 3EDFA 1MJUL 2YA1A 3VRLF 4K3EH 2DTMH 2ZUYA 5I1AA 5FIEA 1MQKL 2OXHA 5HYJD 4U3HA 5J11B 2GYSA 1FC2D 1CFTA 4K94L 5SX4I 1CGSH 3MROB 3JUZA 3KYNA 4W4OC 3CFDB 5ECJE 3X12A 4UB0H 3D39D 2I9LA 4MJIA 4PRAA 1E4XH 2Y7QA 1YPZE 2ESVA 2FCBA 3V79C 1YEGL 3GSQB 4P3CH 5DJ6A 1IAIM 2VKXA 4ZAKC 2VXQH 2HFGH 3O4LB 1CXFA 1ZT4B 1A9EA 4U6VL 3G5ZA 4M8QA 1U8PA 2E9IA 3GSXA 3NCMA 1NUFA 3C60C 5C9KA 3MRFB 5JUEH 1V3LA 3TPUA 1FVEB 3T0AA 3SKMA 2OL3A 4DQOH 2ZJSH 1H0DA 5J6HA 2OR9H 4IRZH 4K55A 3EDKA 4GAFB 1PQZB 3BSZH 2B1AL 1E27A 2C4FT 1IAOB 5DFVD 1OQXA 2OK0H 4XRCB 4WU5A 2MKLC 4V1DE 3KWWB 2GK0B 3ILQC 4PJBF 4Z95H 5IIEA 1JZ2A 3MCKB 2VLJA 3U46A 1MI5E 3LN5A 1I85A 4NN6C 4WEMB 3LQMA 3CAFA 1BGXH 5CEXB 4PS4H 2QL1A 2CLVB 1G1CA 1G7PA 2Y5TB 3TZVC 1NJ9B 1VACB 4TVPH 1I3RB 2VR5A 4P2QD 1T1WB 3JZ7A 4PGDA 1KXVC 1JGDA 2PF6A 4M7JH 4RBPK 1BJ8A 4M7ZC 3OXSA 1SHMA 3MV9D 1G9MH 4H26A 2PXYC 3GIZH 5FYJH 1MCHA 3QJHA 4WWKB 1DQLH 1X4ZA 2CIKA 3V52H 1I8IB 4UT9H 3VXRB 3R0NA 3M17B 4LCYB 3EYUH 2CJUH 5DF0A 1LHZA 4K8RL 4GW1B 4NHUA 2KPNA 4N0RA 3U6RB 1KEGL 5AG8A 5JHDE 1V5JA 1NFDF 3N1MC 3C2AL 4GFTB 3IT8D 2NW3A 5FEBA 4JRXA 5IB1A 4CVXA 2PYFB 4ZNEA 2XYCA 4C59B 3UTTA 5B8CA 2ADJA 2VZ1A 4KK8C 2OYPA 2GSGB 3IRZA 1T2QL 3TCXA 4G43B 3BKYH 5KW9L 4R4FL 4RX4D 4Y1AA 4LPYA 3C5SA 2VWEC 4N8PA 5DYOB 1W0WB 3L6FB 4LLUA 1P7QD 2Z92A 1CL7L 4RRPA 3TBYB 4S10A 4U1JB 3O6LL 3MBEB 1BLNA 1KJ2A 3QUYD 3U4EA 1DBAH 3OKKB 4M93C 4XCFL 3RDTA 4GG6F 1XCQA 3WHE1 4PJBA 4E0RB 3KS0H 2R1XB 4X4YA 2ORBH 2BY2A 4GBXC 1ZHKB 3MRBA 1SJXA 4HH8A 3E2HB 3VFMA 1J8HA 4HPOL 2AQ2A 3RIFF 1KENH 4LGSB 3LN9A 4LIQL 3T4AB 4HKXA 5IVXF 1FRGH 2GUOA 4KHTL 1K8IB 3D3VA 1DN0B 2APWA 5E00B 3TNMA 2X41A 3TM6A 4BFIB 3HPLA 1F8TL 4FQIL 3ARBB 3VA6A 3VDAA 1HZHL 1WBXB 4PJ7A 5SWZE 1JHLL 3RWJB 5DS8A 5JO5A 3CJJA 2IGFH 4IDJH 4TVPD 3V4UH 2ATKA 4Z7VB 1CFSB 1JPSH 3F5WA 3OF6D 5C3TA 1KB5A 2IQ9L 3MX0A 3HPJB 3IDIA 4W70A 2AEPH 3L9RA 4DGIL 5D7LD 5FYJD 5MEQA 1J8KA 4MNHA 4XAKE 3UC0H 4RNRB 3IFPA 4OZGA 5JA8B 4OLYH 2J5LB 4FMKA 3QEHA 4P59L 1BFSA 2F58L 4YO0A 5GGQL 5DMIL 2V2XB 4HIHB 3C5ZA 5D7SH 3S5LA 4PBVC 2F53A 3IFLH 4L4VB 5C0JA 1C5DA 5CEYA 1LILA 3M1BB 2CR6A 4X99A 5KSVA 1K8DB 2C5DC 3MV11 4OI7A 3ARFB 4KI5E 3QDHA 1CXEA 5LAXB 4H5SA 5JORA 5LQBL 3B5HA 1CR9H 4G6JH 3KYKL 2PCPB 2PW1B 4WI3A 4UT7H 1XF4A 4M5ZH 4M6NL 2Q6WA 3SE4A 4GG6A 2E7BA 4ZAKD 1KIRA 1M05A 3O6KH 4PV9A 4DZBB 4KWUA 1FE8L 4BSVA 1LK3H 5EUKA 3S36L 2GJ6D 3C60D 4ZNCD 3NZ8B 5D70L 2OJEB 1CF8L 4Z0XA 3HKFA 5HY9A 3OKDA 1OP3H 4IOIB 2UYLB 3WN5B 2FX8H 1XIWA 3CMOH 1MAML 1YPZF 4NQXA 4Y4HC 4JO2L 1CFQA 4NM4H 4OJFL 1AIFB 1OARL 5KVFL 1CIUA 3IS0X 3QDMD 1KG0B 3HI1A 5EBGA 1W72B 2NW2B 1I85C 2AJUH 2WUCL 4K7PX 3NFNA 4OCYH 3KPLA 4R8WL 3JTSB 4B41A 4Z78B 1JRHI 2H8PA 3IDYB 3ZHLA 5DK2A 3GRWH 3MV8D 3QFDA 2X4UB 4CU8A 3TZVD 1I9RH 3HAEG 3CLFH 1F4WH 5A16B 4KJYA 2F74B 2Z8WC 1PEWA 1QFWL 1CGYA 5IT2L 2QADB 5FYLH 5SX5K 2AJYL 2WWKT 5JW4Q 3L7EA 5BRZD 5I1GL 2P24B 4KV5E 3RGVB 1T1XB 5KOMC 3LKSB 4ONFH 5C09E 3EOBA 1P1ZB 2AJXL 2PXYD 3SKJH 2GK2A 5C07E 2HP4A 2ILLA 4RBPH 4D9LH 3K81A 4PLKC 2ICCA 5L8JB 3T0VA 4MCYA 4QHLB 4IIQA 3QEQE 1INDL 3WIFB 2A74B 2CKBA 5D2NE 5ICZB 5FM5M 3OZ9L 2YD3A 3BPLB 5EU3B 3NFPA 3V5DA 3CSPA 4N0UE 2HFTA 2BSSB 2VLLB 3GSNL 2GEEA 2FJGA 4ISVB 5B8CC 3MLTB 4NC1C