3QJFB

Crystal structure of the 2b4 tcr
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
242
structure length
240
Chain Sequence
b'SKVIQTPRYLVKGQGQKAKMRCIPEKGHPVVFWYQQNKNNEFKFLINFQNQEVLQQIDMTEKRFSAECPSNSPCSLEIQSSEAGDSALYLCASSLSQDTQYFGPGTRLLVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2B4 alpha chain
molecule tags Immune system
source organism Mus musculus
publication title Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k).
pubmed doi rcsb
total genus 55
structure length 240
sequence length 242
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qjfB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qjfB01
4MXWL 1C5BL 3NABH 3HC4H 1JE6A 5EOTA 1R5VA 1NL0L 1NCAH 1FSKB 1U42A 5FM8A 2P5EE 4N8CH 4J3TA 4PJFA 2VLJE 4GXVL 1XFPA 4QRTA 4QYOA 5F89A 3IDMA 3NZ8B 1KSRA 4IMLA 3HUJB 5CEYB 3ARGB 2DQUL 2OM5A 2NTFA 3FN3A 2LFGA 1AFVH 1ZAGA 3RTQA 2KBGA 3X3GL 4JRXA 3UBXI 3ULVE 2AJUL 2DICA 4UQ3A 1DBJL 5HYJB 5IFJB 1BIIB 5HHMB 2H3NA 1U92B 4FXGA 4YXKL 1Z5LB 3PL6A 1J8KA 2Q6WB 2QV2A 2A2QT 2QHRL 2BVYA 3MA7A 3V6FB 1YEDB 3T4AB 4OGAC 5H2BA 1FDLL 1M7DA 3LSOB 4YBLB 4Z7VB 3FKUS 2AXFB 4L9LC 1A14L 1MHHB 4DCQA 5GRXG 4ZUUB 4GRMB 1PSKH 1QFWM 5LVEA 3TGXA 3OWEA 4U7SA 1KCSH 5TGBB 3HC4L 3KLSA 3GSUB 4XPTH 2FYYA 1ZGLA 1LE5A 3CU1A 2QSVA 1ACZA 3IETB 3N1GC 4X9GA 5F7HA 4G43B 5KVEL 4LCIL 4M1DH 1ZTXH 2DJ4A 3SDDD 2L0DA 2E7LA 3IDXH 2DLTA 5FYJU 5F1OB 2R1WA 3EW3B 3FN0L 3RDTA 2HFGL 3GBMH 3DVGB 1R5WB 4TUKH 4JPIA 4NDMB 3WKMH 4Y8DC 3TVMA 5J1SC 3THMH 2BHYA 4BM7A 1KLUB 2I26N 5FUZL 3EKCA 1NUGA 3N9GH 1J0JA 3L3KA 3QFDA 5IG7B 4KRMB 4WFGD 3CSPA 1F4WL 2YMXL 3DIFA 3RWFA 4PRHA 3IJHB 4Z7VF 3VXSE 2QSQA 2APXA 5IROA 4C56D 1IE5A 2CDFB 2VKXA 3BI9X 5GZOC 2DTSA 4P3WA 5F9DC 1ORSA 1I9RH 3U9PL 4HXAH 4UIKH 4W81A 2XN9B 1U8PA 5DJ2A 3PIQB 1CFNA 1QHOA 4Y1AB 1I3UA 4MD5A 2OR8A 5GS1C 2JJWA 4D0DA 4PRDA 2JCCF 1D5ZA 1FPTL 4C83B 4Z77B 4DEPC 5DDHB 4M1GH 3QULB 2X4NA 5F3BB 3WS3B 4H26A 3INUH 4EIZC 5DK0A 2HLAB 1ULVA 5HI5C 5GHWL 5KJRL 2J6EH 3BEWB 5I1CL 2YA2A 3O8XA 2ESVA 4MB5A 1A3RL 4S1QL 2Z91B 2X1XR 5FXCH 2G9HA 1MFBH 1W8NA 1R5IA 2P8MA 5EOCJ 1EDQA 2FX8L 1RV6X 1I7RB 2BY0A 2J5LB 1A6ZB 3AS0A 1TFHA 4PV9B 3I6GB 3AREB 3VXME 2JLLA 4Y5VA 3UBXB 4OCNC 1Q9LB 1D7FA 1YMHB 1MJ7H 5FKPA 4LSTL 4U1LA 1ZVSA 3HI1A 1KJ2A 3R1GL 4XP9H 5F7LB 3NBNA 4Z7QE 5FDYA 1MQKL 3UJJH 1RHHB 2OI9B 4MVBC 4XXDA 1EHXA 2E6PA 5TE6H 1JUFB 5GS0D 1QLFA 4GRWH 4YGVA 3F7PC 3KPSD 4P2RE 4UTAL 4UT6H 1UM5L 1P69B 3WN5C 1G0YR 32C2B 4N8VA 4OLUH 2JF1A 2A77H 2GFBA 2MPAH 3MZTA 4WWKB 1OQXA 1PYWB 1ZSDB 4B0MM 5I8CB 4X99A 4LCWD 4HW6A 2BP3A 1Q94A 4KI5F 1YEEH 4DAGL 2XT1B 4XRCB 3FB8A 4D0CB 4MJIA 2E5EA 2H26A 3RWIA 5IEKB 1T22A 4NZTH 4C4KT 3PGFL 1LDSA 2FR4B 1S8DB 5CWSA 5IGXH 5E2VH 4HKZA 2FBOJ 4JR9H 4NQVA 1MFCL 4I48A 2ITCA 2Q76A 2VLKD 1UB6A 5E5MB 4Y88A 1N5AB 1IQWH 3HG1E 4MVBD 4BSJA 1E28A 4Z78B 4I18B 3T0EA 3VFGH 4XP9L 4LP5A 4R3SA 1AD0A 5ADOL 4JZJC 4O51A 4DKDC 1QPXA 3FTGB 1BBDL 1A7OL 2CGRH 1SY6A 3AB0C 5CBAA 3I6LD 1FRGL 4GRLD 1ITCA 5D1XB 2YS4A 3W9DA 5F7NC 4ZO6A 5F3HA 1NFKA 4DN3L 1G6VK 1A3RH 3NCBB 4RISH 1IGTB 4PLOB 5E03A 4MNGB 4Y19D 5KW9L 4M7LH 1D6EB 5CGYD 1CGVA 5I18H 4Y4FC 2LABA 3D9AL 2QTEA 5C0CE 5I30H 2VSDA 5D71L 1NEUA 2PYFB 1BPVA 4PRBA 5D7IA 2RFXA 4JRYE 5F8RC 1LK2B 3LKQB 1TNMA 1FH5H 2IQ9H 4HJJH 1LO3H 4A2MA 1FZOB 2CDGB 2VRAA 1X5IA 3BDBA 3TV3L 3IU4L 2AQ2A 2HG5A 1PY9A 2NY4B 2VDLL 2XFXB 3LMJH 1ZLWH 3W81A 2R2HB 1IMHC 1BJMA 1BVLA 3ULVH 4N0UA 4LCCB 1RUPL 1SBSH 2GJ6B 3H42L 4LCYB 4IRSB 4H25A 2HA1A 3UZQA 1GHFL 2HFFA 4RNRA 2RCSL 4NJAL 1N5YL 2E3VA 4LASL 1IGFH 4ZDHB 1VEPA 1A1MB 4ZO8A 5KVGL 4MQ7B 1Q9KB 5F72S 1I85C 5KSBE 3ARFC 2EIZA 2JCCA 4UOW1 4OV5A 4F7EA 2C3WA 4ELME 1QUNA 2J2ZA 2OL3B 5J1TC 4NM4H 2OLDA 4GMTH 5DHXB 1S5IH 3H7LA 4X4YA 4P3CH 1UZ6F 5SWSE 4UINL 1C12B 3ALPA 5TDPA 2H9GA 1A6VH 3B6SB 4BQBA 3CVHL 2D0FA 5IMKA 2VZTA 4XTRC 4IRSD 3OAZK 3QCTH 3QEUB 4K94L 5DJ0A 2NY2D 2V7HA 5JO5B 3VXRB 4RBPH 1RIUH 5DLML 1MH5A 4PJGF 3U7YH 1HNGA 1JPSH 4R2GB 2DWEA 3NCFB 1K5NB 3OPZL 3TA3D 1G7QB 1SMOA 3MLXH 2DQFB 1J8HB 4DGVL 5F9JA 2GAZA 3PWVB 5K9JH 2IH1B 3I3DA 1JRHI 1NGQL 1F58H 1AI1L 2OP4L 2R23A 5HYSG 1NC4D 4M1CD 4MD0B 1T66C 2IAMB 2KQNA 3RZCB 1QSFD 5AAWA 2Y6SC 5I1HL 1R0AH 1CDGA 2BNQA 4YDIH 1AR2A 4NO0A 1BZ7B 3TZVA 2BNUA 3SN6N 1NFDE 1AP2A 2AEIT 4F7PB 4MS8C 2F5BL 2OR7A 3BP6A 3B3IB 5CJBA 5CJOL 3TBTB 5KSAA 2F8XC 4ENEC 1YEJH 3LCYA 5D7LD 1FL5A 1FORH 3BQUA 4FABL 5BZWB 3MRMB 5A2JH 4XWGL 2VLKB 3EYFB 4QF1B 5CFHA 2BC4A 3NCEB 3MBXL 3E3QC 4PJHB 2M1KA 5GS3A 3RWEA 1HH6A 1AGEA 4X6CB 4ZFGH 5A40E 4OJFH 4KK9C 5TQ0L 4LMQI 5E6IB 3JV6A 2NY3D 2L7UA 4OGYH 4DVBA 1IAIL 4KV5E 3IFOB 4P23D 1XGUB 4UAOC 2UWEE 1G9EA 4HWBL 3QHFL 2B20A 4XMPH 4JDZB 3HZKA 5C0NC 5C71A 5IB4A 4P5TB 2FO4B 4K7FB 4YAQB 4POZD 3ETBF 4YHIB 3VRJB 3ZZ1A 3VXTB 4DUVA 1VCAA 3HUJF 2OXHA 5C9JB 4DKFH 1I8KA 3GJFK 3RX7A 5ISZB 1EGJH 2BSTB 4S1SL 5EU3B 4BFGA 1WBXB 4QRSA 4TUKL 1HWHB 1I1YA 4HWNA 1ZS8A 4P99A 1TJGH 1IM3A 2YSSB 5DZNA 4ZFGL 4CADA 3K8MA 1OM3H 5KSBF 5ADPH 4Z7UF 3OAYK 5DHVB 2RIKA 1ZEAL 1I3RB 3GK8L 4ODTH 5IVOA 3IVKA 4G42A 2FIKA 3GM8A 4PRAA 3W0WA 1U3HD 4AEFA 3QUKA 1RUAH 1PSKL 1JL8A 2NXYC 4Z95L 2YRLA 2J1KA 3D39E 4BSWA 1BZ9B 2F5BH 1F8TL 4JFDB 5I1LB 3FQRB 1UM6L 2IQAA 3P9LB 5HD8D 4CJ0A 2A6JA 1PG7L 4JQXA 4HWEH 4R90H 1QP1A 2P5WE 4Z7NF 3P40A 3ECBA 3HNVL 4OCSH 1T6VN 3V6OC 2VC2L 5IT2L 5DXWA 2QLVB 3C9NB 1KACB 2YN3A 5CAYB 3QJFB 4FRWA 3B2UC 4U3CA 1UKSA 1KGCE 1QLRA 3SDAA 3P11L 5AZEH 4JGUA 1U8OB 1WVZA 3VFOA 2VDRH 1G1CA 3F65A 2AJUH 3K0WA 4KAQL 4NYLA 4RFOL 2X10A 4LAQL 3B9KD 5CEZD 4PJ8D 1OSZB 1RZJC 2CRMA 4Q9RL 5IIEB 1KC5H 1RUML 1SYVB 3O3BB 1EJ6A 3P0VL 5F7YC 4W6YB 5FKAB 2BMKA 2NNAB 1MCWW 3NIGF 4HDIA 4N8CL 3D3VD 4CVUA 4O4YH 4XMLH 3KR3L 3KPTA 3DRQA 4X5WB 3ARUA 3C87A 3B9KB 3OKYA 3LPWA 3NCJL 3SDDB 2O26U 1WZ1L 5IB1A 4WI4A 3RL2B 2LE9A 2P8LB 4JY4A 1P2CB 3V52H 3C08L 4FQQB 3BP4A 4EN3C 3DMMD 1Q38A 2XPGB 3MRNB 3WLWC 3PNWB 3C2AL 1CTNA 1RJZA 1T0MB 5J6GB 1FIGH 2ESVE 4UT7L 3D69B 2D2OA 4MJIE 3QEGL 4QY8B 2WAHA 2YKLL 1EO8L 2YK1L 5K59E 4XNQB 3O6KH 5JIPA 3C60C 4F9LA 4IBLT 1Z0NA 4HWBH 3FCTA 2GSIB 3NGBC 1MNUH 2D4FA 4XPGL 3F12A 2IALB 4PRHD 4GRWE 3LZFL 3DX7A 1QRNB 3CSYA 2AERT 4RGNE 1GIGH 2YXFA 2EDTA 2VZUA 4NRZB 1KEGH 3KLAA 2FHBA 4G8GD 3DX8B 3TBWB 1MCPL 4EEEA 2QR0A 4UNVA 5T1MB 2O5XL 3DRTB 4LPXA 2A83A 4XCYA 5IBLC 1XR8A 5BW7C 1Q9WB 4WUUA 4R4BA 3O2WH 1HHIB 5EIIB 3TC9A 3DUUA 5FHBL 4D3CL 3PHQB 3FAWA 2C3HA 3MRRA 2XWJA 3GHEH 1ORQA 1P7KB 1T1XA 1CVRA 1J7VR 3D5OF 3FONB 1NDGA 1JGEA 2UUDK 4RGND 1UG9A 3QNXB 1YA5A 3WN5A 1A7NL 2VLJD 3B8SA 3IDJB 4I4WA 2F8VA 4KUZL 1JK8A 3PDDA 4P57A 4KQ4L 1NGQH 1GPOL 4GOSA 4RGNC 1OLLA 3DO7B 4YLQT 3K2MC 1DUZB 1CG9B 4JFZL 2XOTA 4ZXBD 5KG9A 3DTXB 1TQBC 4L1HA 4M5ZL 1KPUB 1MCLA 4Y4HC 5EUOA 3SE9L 3RGVA 2G2RB 3T0EC 4YX2H 3L1OH 2FEDC 4DFHA 3ZMRA 4WHTB 5H37H 4ETQA 4LGRB 1D5IH 2ZSVB 2BCKB 4LRNH 4X0KA 3CX5J 5HDQH 5I74C 1KPVA 3U2SA 5C0BE 4NKDB 3ARGC 1SJEA 3UTSA 4YBQC 3OJMB 3VH8B 4OF0A 4P2QA 3SDCC 5EOCL 2XZAL 2VXUL 1EZVX 1KGCD 4PV8B 1X5JA 5T1DH 2B2XL 5TH2A 5JUEH 1DANT 1NEZG 1NCCL 4IIQB 4Y5XB 1J0HA 3WFHB 2ICWJ 4HUNB 1OCWL 5C0BB 5HYSB 1G7LA 3BO8A 1CR9H 4ACPA 4PJBA 3OKNA 1HHGA 2A74B 5F9OH 4HT1H 2APVA 3P4NB 4KHXL 2JK5B 5FGCE 1K9TA 4NZUL 3UTPE 3BPNB 2J8UF 1QEWB 3O6LH 5I16A 1MFBL 1CBVH 2ZUTA 3JV0A 2FB4L 3KXFD 3CUPB 5HHQA 4C57C 4JVWA 4DUWA 2FBJL 3PWPA 4ZAKA 4ZS7H 1ZA3B 2AK4B 2NY2B 4PRIA 5C6PB 1H8SA 1Z3GL 5D7LB 3W5MA 1TETL 4LPUA 3LEXA 4DOHE 2BSRB 4WI7A 4E0RB 1FPTH 3DHJA 4DKEH 3O8XC 5MENB 4K7PX 2FJGA 4J6RH 2X4TB 4L8CA 5FIEA 4NQXB 2E7LC 4PJ7E 3U6RA 4F9PA 5JHDD 2NY0D 3O41A 5HI3C 1TQCB 5IQ9B 5L9DL 4S0TD 4TOYH 5CIPH 1VFAB 4TYUA 2O5ZH 3L5JA 3O45A 2ZJSH 3EDDA 2CPCA 5A16B 4EI6B 1EGJA 1DQML 1K2DA 3FQUA 4PJGB 3QHZL 2CGRL 4H1LG 3RVUC 1KTRL 2NW2A 1CR9L 3V6ZA 3QDME 1LO0L 3DGGA 1DDHB 1MHPH 5KANG 1JWMB 5AUMA 3BP7A 2BX5A 4H1LB 2PO6A 1EBPA 3F7QA 2ZUVA 5EZIH 4JQIH 4J8RA 4X4ME 1UWEL 1ZV5A 4D0BA 4U1JA 1ZTXL 3HZMA 2XTJE 3Q3GA 5HD8C 3LEYH 1A6TA 4BJLA 1BD2E 3PGFH 1SYSA 1ZLWK 2ADGB 3MUGA 3IXAA 4LHUD 3F7VB 1QACA 1A4KB 3VMOA 1BQLL 1JMZA 4S1RH 4ZSOB 3MZGB 5HVGB 2BY2A 4LPVA 4CBPA 2OJZL 2AVGA 1UC6A 3VXNB 7FABH 1MAKA 5DD0H 1KTLA 3SCMD 4KI5E 4KJPD 4LHUA 3OAZH 4F2MA 2OZ4A 3ULUF 4NPYA 3FOLB 4CJ1A 4JFXB 4TVPH 1TITA 3NFPB 3V7MA 3TLRA 3WXWH 1AY1H 3D6GA 4K9EC 5DT1H 3VXSB 3AREC 1NC4A 4HIJB 4BYHA 4OZFA 5J12C 3T0VA 3TYFA 4NKQB 1FL3B 2ENYA 1RUQL 2DQEL 2VDMH 4NGHL 1BFOB 1FAIH 4X6CF 3I2CL 2EKJA 3H9SB 1AXTH 1WBZB 3MRQB 1KT2A 4H8WL 3PWLB 4JDTL 2JKXA 1YNKH 2A9MH 3TBYB 4OZ4A 2A0LD 4LLYA 2F58H 4EUPA 3KNBB 2EDWA 1F6AA 1HEZB 4PGBA 1WITA 2XV6B 2XXMB 4XMKH 4X7TB 5DJXB 3PV6B 2HWZH 1I7ZB 4XVUD 2QQLL 5ETUB 1JF1B 4GW4A 1B0RB 2HT4C 4IRJD 2NY3C 2J8UE 4Z0BH 2DD8H 4E5XA 4TPRH 3VFSA 5CZKA 2RB8A 3A0OA 1N7MH 4NKOA 3VWJB 4A6YB 3DI2B 2RJMA 2UWEA 5D1XD 1T1YB 1IT9H 3BIKB 5GGSY 4W70A 1UJ3C 3IT8D 4GXUM 1HYSD 1VGKB 4KDTC 1H8OA 5D7JA 4D9RD 5J7CC 1ND0B 5DJZA 3ROLA 1NDMB 4GFTB 5T3ZH 5L2KE 4U1NA 4JN1L 3AB0B 4QOKE 3GJFH 3FB5A 5IJVA 3FQTA 4MS8D 3K4ZA 3ES6B 4OCWL 4HGKC 3EOBB 3O6FC 1A2YB 4RIRA 1NCNA 4FNLH 4P9MH 4O58L 2VLRD 2W60B 4Z9KB 1VENA 5J3HD 1H5BA 4LLVB 3S5LB 4Y4FB 3IDNA 1WWWX 5DUML 2G75A 1QQDB 1X4XA 3U30C 2ERJC 4KUCF 2CKBH 5E2JA 2W9EH 3MUJA 1RZJL 1WZ1H 2FZ3A 4FQLL 1PX3A 1X5ZA 5ANMB 4M6NL 4ORGA 5E8OA 2D7TL 3I02B 5MEOB 4NBYB 4PGDB 2ARWA 1CIDA 3KPSB 2GTZA 1GOFA 5EFIA 4JO3L 1CFVL 1G9ML 4XPTL 1KJVA 5DJ6A 3QUML 2Z93B 2X4SA 5EC1A 3FFCD 1IGIL 3CVHB 3EJYD 4N9OB 5JW4N 2Z4QB 4OF8A 4XMKL 2C4XA 4MAYB 5EU5B 2VXVL 3GHBL 5FUOH 2K1MA 2Y4SA 4FFZH 4HLZH 2WIIA 4TSAH 4PBXA 1UVQB 5FK9A 3L6FA 1DN0B 2A9ML 2IJ0C 4OFYD 1L7IH 2JELH 5F6IC 1AQKH 2VDRL 1KB5H 4DZ8A 1FYTE 3LKPA 1QBAA 1J18A 5JXEC 3VE0A 1ZLUK 3LN4B 4NRXB 2P49B 2AV1A 4X7SH 5I76B 2B4CC 1TVHB 4MNQA 4CU6A 2OMNA 3EGSB 2PW1A 4FOMA 2FD6L 5KVDL 3UAJD 5CBEA 4KJWC 1JRHL 4AL8H 4U7KA 1AFVL 1RZGB 3O4OB 5EBLA 5FA4B 3VFUB 2APWA 1F3RB 2E9IA 3MMEB 3PDGA 3CZFA 1RIUL 4I3SH 5B3JE 3QZWB 1OVZA 1H15B 3MPCA 5B3NA 3P2TA 1ZKAA 4QOKA 2OJZH 1T5XB 3P9WB 3TWCH 4I5BB 4NUGL 4O2CA 2OSLA 3AGVA 1KG0A 4G6FD 2NX5E 4P46A 3UPRA 1QR1B 1UEMA 1Z9MA 4R26H 6FABL 3ULUH 4UINH 1U41A 1P4LA 4DZBA 5EZLA 3LRGA 4F7TA 5I8KL 1ONQA 4HUUB 3Q6FB 1RJYA 3NZHH 2FX9H 4M02A 3EDJA 2ZG2A 2ZG1A 3HZYB 5H8DA 3KPPA 3X11B 5FYJD 2P45B 4D9QE 3VD4A 5LCVL 3LKSB 4OI8A 2J88H 1R3IL 5HYJD 3O9WC 3GSNB 1FFNA 4M48H 2W1NA 3NCCB 4Z76A 3KWWA 5AYUH 1KN2L 4JPWL 1IGJB 5JNYB 5E8PB 5T5NG 4YHYC 4JFYA 3MV7D 1EAPB 5BXFA 3QIWA 2KZ1B 1OAQL 1DEEB 4QEGA 5DUPL 1RFDL 1IAKA 1S7XA 3LMJL 4JFPA 3H2WA 3EYVB 5C0CA 5DMKB 4YO0A 1RU9H 1EZVY 3TO2B 1GGTA 4C56A 1EHAA 3BRGC 5BV7H 3O11A 4RRPG 4XNYL 2AXGB 4PJ7A 5DEFB 4LFHD 4D9LL 4F57L 3PHOA 4OLXH 3FRPA 1TETH 4F9PC 1TZHA 4MD4B 3MRJB 5IEHB 4ZS7L 1QSZA 1T1ZB 4FXKB 3WMSA 1U3HB 4POUB 3WEXA 2FX7L 3ZSTA 1TJHH 3SGDI 2AJZB 3QDHA 4M00A 4EI5A 2UUDH 3Q5OA 1I4FA 4GW5A 3HS0B 4JM2C 4L4TA 5HHMD 5BCAA 3ZDZF 1VB9A 3C5SA 4OQTH 3FT2B 2VAAB 1MCSA 4OBRA 1NPUA 5L7XL 1JGVL 3VG9C 2X1PA 3GI8H 2YZ1A 1CTOA 4LLWB 5CEZL 1P7QB 5KN5B 3K3QA 1KIQA 3ZYIA 4KTYA 5HDOA 3I85A 2XKNA 1HZHL 1MCEA 4P2YA 5DF0A 5FYLD 1LEIB 2I07A 4N0RA 4RFNB 1G9MC 5ITFA 2ZUXA 4APQC 1OAUL 1F3DJ 4MZ2A 1Q9OA 3VXMD 3VG0L 5IHUL 5J9PA 1CE1L 4R96A 1RJLB 3RPIA 4Y5VC 3U7YL 2ZUSA 2Y5TB 4AJ0A 4N9GB 1U93B 4UNTA 5FYKE 3FFCE 3MLRL 5DWUL 3LN5A 2JIXD 4KRLB 3WFBL 2W0FA 5MEQB 1JWSB 1U2CA 3GSXB 1OTSD 4YHNB 2ZOKB 5BMFL 4BFIA 3QH3A 2I9LA 3WE6B 3NCYP 4MA8H 3MR9A 3EHBD 2X4QA 4J7RA 4TRPH 3OL2A 5GGVY 4HIXH 4WW2A 2GITB 3UDWA 2YUWA 3ZT5A 2FJFA 3BH8A 3S37L 3G5ZA 3GMQA 4UT9H 3JSSA 4MDJB 4XCFL 1M4KA 1L4IA 5GISL 3DV6A 5DVLA 4WO4B 5T3ZE 4AQ1B 3NCMA 1A1NB 3ULVD 1U3YA 5F71A 4HBCL 4JZOB 3D1MC 5E2WH 4OZIA 1XGRA 4P4RA 5HHNA 3VXSD 1H8NA 1QSEB 1DQMH 2K7PA 3ELAT 4UQ2B 1MRDH 1VADA 2FX8H 4HK3N 3WJLC 5HHME 3VFWA 1J5OH 2W59A 4RRPA 4HZLA 5D5ME 3CC5B 4LVHB 2BZDA 3BVNB 1H9VA 3ULVL 1FNGA 1AKJA 2H41A 4ODUA 3MGTB 1OPGH 3T0WA 4MQXD 1U8IA 4JGMA 5JHDA 3L3DA 3VFRA 5IFHH 5IHZB 1KB9K 3IB4A 3BE1H 5DHVH 1FZKA 4XNUL 1IZKA 2FHCA 3IGAB 5FHAL 2UV3A 4M8VA 2ZCHL 4OCYH 1B88A 1U8KB 1XF5B 4HFWA 4PRHE 4M61B 5BVJB 5IVXA 4O2FB 3C8HA 4JHWH 5DA4A 2HKHL 5KSUB 4IS6A 3JWDC 1TCRA 3OJVC 4Y16A 5GS1A 3DURB 3PQYD 1T0PB 3BEVB 3CSBA 4GG8A 3VFPB 5ABDE 4U3XA 3OB8A 2HJFA 4XP4H 3HAEA 1HCVA 2VE6B 3MRBB 3GIZL 1BD2B 4L9LA 1KCRL 1SY6L 4Z6AT 4OD3L 5J57B 4QGTA 2WQ8A 5SV3A 2EDLA 1ETZB 1OCWH 5DJYA 4CN4A 3G6JB 4KRPB 4XB8A 2Q1EA 3MRBA 2ZSWA 3HAEB 5DK3A 1QZ1A 2HJFB 2X4PA 3C09B 3VFPA 3BEVA 3DURA 2EC9T 2VL5A 2IPTH 3L7FB 4Y16B 3RWHB 2DB8A 1K8DA 3IXTB 4IS6B 1XGPA 1XR9A 2VQUA 3QUZB 4O2FA 5IVXB 1Y18A 4O9HL 5BVJA 1U8KA 1XF5A 3EYQC 4ZNEA 1NBQA 3TWCL 1SQ2N 1FZKB 4WW2F 3QDAA 1NAML 5FOBB 5F7EH 5IHZA 3VFRB 4I3SL 3P3YA 1U8IB 4N1CA 2APFA 2VR4A 3MGTA 4ODUB 4Y1AE 1UA6H 1AKJB 4LDLB 1PFCA 2X1QA 5FO9A 3FJTA 3BVNA 1RHFA 3SOBL 4UTAH 5HVWA 2DMCA 1TVBA 4LSPH 5JXAH 4RWHA 3RX5A 5DR5H 5TE6L 1VADB 4GMSH 4U31A 1KJ2H 1X3DA 1RJCA 4JFOB 4KQ4H 1S5HA 1XGRB 4P4RB 4OZIB 4JREB 3GRWA 4JZOA 2YPLB 1PDKA 1A7BA 1PBYA 4HWEL 2EXWD 3LN9A 2P7TB 3DV6B 3CD4A 4QCIB 2B1AL 4DFIA 3OG4B 4MDJA 1IAMA 3GMQB 1DQQA 1XMWA 4FFYH 1I3GL 2FH6A 2FJFB 4YDKL 3ZHLA 43CAA 2GITA 1G7IB 4WW2B 4NZJA 5I74B 2WLYA 4HUMB 1BX2A 3MR9B 4PP1D 3HAEG 1J11A 1II4E 2ZOKA 3IDIA 3NH7L 2PF6A 4D9LH 2W0FB 4YDLC 3BE1L 1RZJH 3OR7B 4YFLI 3U4EA 1CDIA 4N9GA 4OM0H 3SKOB 3RPIB 2FDBP 1RJLA 4LLMB 4LSRL 2ILLA 4R96B 5J9PB 3O4LD 2FSEB 4IIQC 3ARRA 4AG4H 3D39D 4Y5XC 1Q9OB 3B2VL 5IW6B 3SE4A 3U9PH 3CXDH 5I1IL 2HH0H 1LEIA 3WIHA 1MY7A 2BY3A 2UYLB 2EZ0D 1IGYB 4RZCB 5KN5A 1WEJH 5TE4H 1P7QA 1FO0A 5GRJL 4M48L 4LLWA 1J0YA 4RA0C 2OBGA 3X13B 3B9VA 1B6UA 2VAAA 5FAAA 3C2AH 2C26A 1BF8A 2R0WH 3C5SB 3QWRD 3HS0A 4L4TB 1I4FB 4GW5B 3C08H 4EI5B 5ICXB 4PGEB 4KWUA 3WEXB 3QQ4A 2YHGA 3ZYJA 3O3AA 1T1ZA 4FXKA 1MCDA 5IEHA 1YMMD 1OTUD 4P59L 5GQBA 1DJSA 3MRJA 1HOCB 2CUHA 3ZKNC 2YA0A 4MD4A 1Q1JH 3BX7C 3VW3L 3VXQB 2GJZB 4LQFH 5EO9B 3PHOB 4XC3L 1C16A 3DJ9A 2AXGA 1EFXB 3RVXC 1WC7B 1TQCC 1MREH 5CD5D 5CZVL 5AZ2L 4JFQB 4C59B 4KI1A 2LTQC 1FVEB 3FMGL 4NWUH 4YO0B 5IHUH 5LWYH 1KC5L 4JFPB 1IAKB 1S7XB 4OCRL 1KENH 1DEEA 4RSVA 5AD0B 4MNQE 5DD1H 3HKFA 5EIVA 1Y0LB 2VR5A 2A0LC 3RNQA 1CWVA 5KOMC 4JFYB 5E8PA 1ZANL 2A6DA 4GBXC 4YIQA 3VI4F 3CLEH 3KWWB 4Z76B 4XVJH 1MCJA 3TIEA 4B5EA 4OF7A 1J0ZA 2XIDA 3FT4B 3MUHL 5DC4B 3GSNA 15C8L 1F45A 1EPFA 4OCSL 5D5MF 4XAWH 5EBMB 5FV2A 2EH8H 3CK0H 1YEGH 4D8PA 1YQ2A 3LS5H 3C6LB 2EDKA 3PG2A 1AE6L 2R9HC 5B22A 1KELH 3HZYA 4K3DH 4M6ML 1RJYB 1V5JA 5HPOA 4BUGA 3Q6FA 1ONQB 4HUUA 4G6KH 4NWUL 4ZUVA 5AWNH 1UKTA 5EZLB 1P4LB 3LY6A 5HYFA 4HC1L 3SCMC 3CH8A 3WIIH 4P46B 1QR1A 1KG0B 2OSLB 5HHXL 4O2CB 1DFBH 4F58L 1F90H 4XPBL 1ZLVH 1H15A 3UYOD 4XCCL 4BQCA 3QDGD 5J89A 2VQTA 3JXAA 4ZUVB 5GS2D 4AY0A 5C09E 5FGRA 4G6FB 1ZLUH 1J0KA 1BAFL 3F58L 2I60L 5EBLB 4OTXH 1C7TA 1RZGA 3C6LA 1T2XA 4D8PB 4PY8J 5CBEB 4YEEA 5EBMA 1EHLH 2QBWA 2JJTC 4NQCE 3EGSA 3FT4A 1UCTA 5I76A 3TIEB 5B4MD 2ICCA 1JTPA 1GGYA 2AV1B 3JWDL 1N5YH 2DBJA 4NRXA 3LN4A 3ZKQD 5IWLC 3SDXE 4YIQB 2A6DB 3MCLH 5JW3H 2W9LA 3HNSH 3H42H 1MPAL 3QRFM 3RNQB 4Z7UE 4PB9H 3ME0A 1Y0LA 3ZKMD 1DN0A 3TN0C 1MCFA 4QWWD 5FK9B 5AD0A 2WIIB 3WSQL 1EV2E 3A6BH 4MAYA 5EU5A 3KHQA 3NTCL 4AG4L 2Z4QA 2ZWLT 3HHRB 4X83A 1FVEA 4JFQA 4UOW0 3DYMA 5EC1B 2LVEA 2Z93A 3DNKA 3O8XD 5DJ6B 2R69L 1WC7A 1EFXA 2ICES 4GQ9L 1KULA 1C16B 5EO9A 1KTKE 2GJZA 3VXQA 1N7ML 3KPSA 4L4TD 1T83C 4Y5YC 4PGDA 4U6VH 3I02A 3QCVH 5MEOA 1HOCA 2NY6B 5E8OB 4ORGB 5GJSL 5ANMA 4OSUH 3O81A 2FZ3B 3O3AB 4Z0BL 5JW4R 3U1SL 3QQ4B 1BHGA 4PGEA 5E0QA 5ICXA 5C9KA 3S88H 1QQDA 2G75B 2DKMA 1FRGH 1K3ZA 5GJTL 3SE3C 3S5LA 1H5BB 2W60A 4HT1L 1IC7L 1KF9B 4XNXH 15C8H 1NCWL 1A2YA 3P0GB 3X13A 4KVNL 2V6HA 3EOBA 3OG6B 3U0WH 1FO0B 4OCXH 4RZCA 1IGYA 3FQTB 2UYLA 4JQVC 3UC0L 5IJVB 3BYYA 3FB5B 4OM1L 2ERJB 5CGMA 2IBZY 4LGSB 4PJFE 4UTBH 4M6OH 3QQ9C 4DN4H 5DD1L 3LDBB 3ROLB 1ND0A 3UTPD 5IW6A 3BWUC 2FSEA 4EUPH 3K1DA 5D7JB 1VGKA 2LU7A 3AROA 4TVPL 4LLMA 3RHWF 3SKOA 3CU7A 2EH7L 3BIKA 3U4EB 3OR7A 1T1YA 4KZDH 2UWEB 2A77L 4NKOB 1DBKH 3IDIB 3VWJA 3AS2A 3VMPA 1X9QA 4P59H 3VFSB 5T1LD 1BX2B 3PWPE 4S10A 4UV7L 4E5XB 3T0ED 2DQDL 4OZFH 1B0RA 3KLHC 4ZXBC 1G7IA 1JF1A 4GW4B 1OP9A 3VH8G 4M43H 43CAB 1QSEE 1I7ZA 2W0PA 1RUKH 2EDQA 3PV6A 1DQQB 5ITBH 3RIAF 1F6AB 1HEZA 3FO0L 4PGBB 3ZKMC 4LLYB 4EUPB 1A6PA 3OB0K 2P7TA 4QCIA 4OZ4B 1O7SA 4QTIH 2AP2A 3PWLA 1L7TL 2YPLA 2DYPD 1YYLL 3MRQA 3S37X 1S5HB 1WBZA 4Q9QH 1KBGH 4JFOA 5F7MC 4UI2A 1AKJD 2D0HA 1BFOA 2GI7A 3OBAA 4H8WC 3WDIA 3RI5F 1FL3A 3TYFB 1TVBB 4FTVE 3VXUE 3VXSA 5FO9B 1FSKC 3NFPA 4ZO7A 3S97C 4JFXA 3K80A 3S36H 5C09D 3IFLH 4ELMF 1NSNL 4HUKB 5FOBA 3TT3L 3S35L 4ZSOA 3RBSA 3C5ZD 3ZT7A 2EDOA 3F7VA 2PNDA 3IXAB 1MFAL 1Y18B 1SYSB 2ADGA 4HMEA 3MUGB 3MLPA 4KTEH 3QUZA 2ID5A 3Q3GB 1XR9B 3WO4C 1XGPB 3IXTA 1K8DB 4HEPG 4GAJL 5DD5L 3RWHA 3L7FA 2VL5B 4HWUA 2G60H 2XTLA 4J8RB 4JG1H 4ZG1A 2X4PB 2NMSA 3BP7B 2ZSWB 5AUMB 2W07A 2E6JA 1QKZL 3G6JA 5DJYB 1MSPA 1DDHA 4U4BA 3DGGB 2A9NH 1ETZA 4J3WA 1H3VA 2NW2B 3T3MF 2MKWA 4UZGA 1BD2A 1U6AL 2XZZA 1AXTL 4L9LB 1KJ2L 3FQUB 4PJGA 2VE6A 1GC1L 3FN0H 4I9WD 4GG8B 1MFDH 2D3VA 5GS1B 4TSCL 1TCRB 5D70H 1VFAA 3SOBH 1DVFD 3AFLA 4EJ1C 5EOCH 5KSUA 1SJVA 2NY5L 3WXWL 4YUEL 4PYGA 2P48B 1IJ9A 4TRPL 1KEML 1CZ8H 2OXGA 4M61A 4CL7A 2AABL 4GXUN 4HFWB 3X3FL 4L8CB 4HFUH 3IGAA 2VDQH 4H88H 3DETC 3L3DB 4E0RA 2IGFL 3QUYD 5JHDB 2XXCB 2BSRA 1NBVL 4LQFL 1FNGB 5AG9A 4YUEH 4PRIB 3E0GA 4M62L 4NM8H 5IP4A 4KAQH 1ZA3A 4M5ZH 4ERSL 4ZAKB 1UACL 3CC5A 4LSSL 4HZLB 5HHQB 3L5IA 1CS6A 3VFWB 2K7QA 2OI9C 3EOYG 4UQ2A 5HTSA 1QSEA 5HHNB 3P4NA 4KUZH 1IKNA 2A74A 1HHGB 4K23H 4PJBB 3WDHA 1A1NA 1G7LB 4YHMH 2C4FU 4R90L 5D1QC 4WO4A 3ZT6A 1WZLA 2DQGH 5I1JL 4Y5XA 4IIQA 4Y8AA 1OD9A 1AO7E 3G5ZB 5TH2B 1MJ8H 3BH8B 1V3MA 2Q20A 3AY4A 1QTYT 2DQTH 4TULL 4P2QB 2D7MA 5I1CH 4Q6IC 2X4QB 4LHUG 3SDYL 3VH8A 5D2NE 3WE6A 2I9LB 1UJTA 3QH3B 3UTSB 4BFIB 4AMKL 3GK8H 4YHNA 1KPVB 3GSXA 3U2SB 1JWSA 1GGIL 1OAKL 5MEQA 3LN5B 4NFCA 1U93A 2Y5TA 2BCKA 3PUCA 2ZSVA 3Q1SH 4WHTA 5D93B 3WV0A 4ZNEE 3RGVB 2CR3A 4I18C 3HNTL 3DTXA 4NOFA 5ITFB 4UIKL 4WO4C 4KXZI 5JDJA 2I07B 2IPUK 2XKNB 3VRLF 3W0WD 1MJ8L 3WNNA 1WV7T 1KIQB 4MHHG 4Q9QL 4M93B 3IDJA 4POZC 2JJSC 2VLME 5SWZD 1OP3K 4OQTA 3WN5B 4EZMA 3QNXA 1NDGB 3FONA 2UY6A 1CXIA 3RTQD 4K07A 3FT2A 5I0ZA 5T3XD 4P23C 3P0YL 3MRRB 1JYXA 1DQLL 1MWAL 1SMAA 4X6DF 2XZAH 2AJZA 3U82B 3DUUB 4N5ED 1HHIA 1U3HA 4R4BB 4WUUB 2R56H 3NMEA 1XR8B 4XCYB 2VXTH 4K3JH 5T1MA 5ANME 1TZHB 4Y1AD 1FGNL 4TSBL 1CDCA 3DX8A 3KLAB 4PJ7B 5DEFA 5HDQL 2X1OA 2DJUA 1QRNA 3BJ91 3BKYH 5EOQL 3O11B 5I1GL 1C5CH 4C56B 3TO2A 1RURL 8CGTA 1IGCL 5DMKA 3EYVA 5B21A 5C0CB 4J3OC 2IALA 3BRFA 1XEDA 5C70A 1E4XI 2J8OA 3FCTB 2EDEA 3QIWB 5BXFB 1EAPA 4IDJL 3SGKA 2E7MA 4OM1H 4HWBA 4XNQA 1IGJA 5JNYA 2Y6SD 4KMQA 1FNHA 4KI5C 3VA6A 3C09C 5KVFL 4YXKH 1U6AH 3D3VE 1HIMH 1FFNB 4FQXD 2QADB 4PYHA 5FGCB 3LKSA 3MRNA 3MUY1 1I9IL 1L6XA 2L7JA 2XPGA 4NNPH 1YEIH 4QRPD 3BP4B 4FQQA 3X11A 3KPPB 1P2CA 4JY4B 1F4XL 1FBIL 2P8LA 3S3JA 3RL2A 4PBVC 4PJAF 4F7TB 4Z18A 4DZBB 1YNLH 2X42A 3QCTL 3R8BB 5FUCC 2DTMH 3B9KA 2Q8BH 3VA2C 4PJ9D 3UPRB 2VN4A 1CFVH 1G9MH 4YWGH 5C0RH 4IRSC 6CGTA 3B83A 3OZ9L 4I3RH 4I5BA 3RHWK 3TT3H 1T5XA 1F13A 4ZTOH 4QOKB 4HDIB 1INDL 2BMKB 3TT1H 2EO1A 3QZWA 2WBJC 3CZFB 4XNZB 5IIEA 1BQHG 3MMEA 3VFUA 4R4NC 1B90A 5FA4A 1F3DH 2FNBA 3QDMD 4PJ5D 4QLRA 1DBAL 1F6LL 2CMRL 1INEL 5F6HJ 1U8OA 1MIML 2PW1B 3HMWL 2EDYA 3BD3A 4MNQB 1TVHA 3ZO0A 1QLRB 3SDAB 1OSPL 3QJFA 3C9NA 1Q0YH 3MLVH 3UZEA 3VE0B 1I1CA 3TCXA 3LKPB 1YYLH 3S5LG 4XXCC 1FIGL 4DZ8B 3N1PC 5C2BL 1L7TH 4XMPL 1DBAH 5LGHH 3L6FB 1UVQA 4HXBL 3IS0X 2HTKC 5L6YL 5I8OL 4JFDA 5I1LA 1BZ9A 2EDJA 5D7KD 1JNLH 4R2GC 2D7PA 3CVHA 4M43L 2A1WL 4XT1C 2X4SB 4F8TA 5FOJA 3QUKB 4FFVC 1KJVB 3BRDA 3MGAA 5E6IC 5EFIB 2GTZB 3IVKB 3MBED 5GGTL 2CQVA 5DHVA 1KCKA 1OL0A 2IAMC 5EORH 4CADB 5JQ6H 3JV5A 5JZ7D 1E4KC 1QHPA 1IM3B 2YSSA 1ZS8B 3IDNB 4Y4FA 4QRSB 4LLVA 4GRLC 4LDEB 1OT1A 3DO3A 1FE8H 2BSTA 5HDBE 2FD6H 5ISZA 4AEIL 4F37K 4DN4L 4RIRB 1I8KB 1T7XA 2V5YA 5C9JA 3ES6A 4YHIA 2R29H 4CDGC 5C0AE 4YAQA 3RGVD 2FO4A 1L9NA 4FQJL 4P5TA 1NQBA 4WI9A 1WIOA 5E70A 5D4QA 5ISZD 3HZKB 2X6MA 4P0DA 4N0UE 1DSFL 4U1NB 1XGUA 2AJXH 2VXQH 1NDMA 4Z7QF 3IFOA 5DJZB 1MIEL 1OD7A 3QCUH 4JG0L 2MSPA 5BV7B 1AGEB 2Q8AH 3RWEB 3UYPA 4PJHA 3ARBC 4A6YA 1Z2KA 4P49A 3QDJD 1G9NL 2VLKA 4M6NH 1FLRL 1LDPH 3MRMA 1QPPA 4L3EE 3KPSE 5ETUA 4BK4A 3IYLW 4O02H 2AEQL 4ODHH 5DJXA 4X7TA 3ZTJH 2JCCE 3ZE2E 3KNBA 2BNUB 3TBYA 5LGHL 1Y6NR 1FP5A 4NO0B 1NLBH 5I9QB 1KT2B 2IAMA 4MD0A 4Q0XL 3V4VL 2R23B 1LO4H 1LMKA 4DOHB 3H9SA 5B8CC 1NAKL 3H8NA 2LVCA 2GAZB 3PWVA 1NGPH 5HYJE 5F9JB 1S3KH 1J8HA 1J1XL 2HKFL 2DQFA 3BT2L 4I77L 4OZFB 2WWMC 1G7QA 1NC4B 1IAIH 4HIJA 3VD7A 4PPTA 1SEQL 4G8GE 2YA1A 4RMWA 2DWEB 2ICWI 2NR6C 2APTA 3FOLA 4NPYB 4ORZC 5E2UL 4ALAL 4GKOA 4F2MB 4LHUB 5JO5A 4MMXC 1KTLB 1LO3L 1INDH 4KRNA 4KTDH 2PO6D 3K81A 3VXNA 2OR9H 4M7JH 2ZUQB 4RA3A 1GH7A 4R2GD 5IMKB 3MV8E 1A4KA 2VZ3A 2JE8A 3LPFA 4WTWA 3VXRD 2V17L 2H9GB 5TDPB 1I9RL 1A6TB 1I9JH 2I27N 3O0RH 1FNSL 1MEXH 2KKQA 3HZMB 4U1JB 4D0BB 5DMYA 5SX4I 1I3GH 5DFVC 2PO6B 1WT5C 4H1LA 3LPGA 2D7QA 1JWMA 5E1HB 4B41A 4FZEL 4WY7H 5BO1L 1X6LA 3SGKC 5F96H 3UAJC 4OV5B 3K1KC 3V6ZB 2JCCB 2EIZB 2VDKL 5GPRA 1TPXC 1JZ2A 5T33L 5ISZE 4LHQB 4ZDHA 1NC2D 1K2DB 4CMHB 4EI6A 5A16A 4LPTA 3SO5A 4O5LH 1QFWL 1X5AA 3O45B 4XP6L 3SKJH 5DR5L 1JTOA 4LCYA 4KMTL 2GJ6A 2XTJD 3IS1X 2WBJD 1EUTA 5IQ9A 4LCCA 1BJ1J 1AY1L 3SDDC 3O41B 4ETYA 2EE6A 4TSAL 3U6RB 1CLOL 1UYWH 1MCQA 4NQXA 1OARL 2HG5B 2VDNH 1X5FA 3EJYC 4UB0H 2X4TA 2FJGB 1FZOA 5MENA 2YPVL 1NAMH 2GEEA 4ONGH 3LKQA 1LK2A 2RFXB 5DO2C 5D7IB 1P5VA 3LEXB 1D6VH 3MLWL 4JO3H 3CVHH 3DSFL 3B43A 5KS9E 1CVSC 5D7LA 1D6EA 3UP1A 4ZO9A 2B0SH 3B9AA 2AK4A 4MNGA 3PWPB 1T2QL 1F2XK 2BNQD 2R4SH 3CUPA 1FC1A 2JJSA 5F3HB 5I16B 1QEWA 5D1XA 1X4YA 5CBAB 5HVHB 2JK5A 4WI2A 4A6YL 1LHZA 3FTGA 3ARDC 3OKNB 3NAAL 4M3JA 3BO8B 4O51B 2DDQL 5HYSA 1KCRH 1SY6H 5C0BA 1AD0B 4DTGL 4I18A 2X2YA 3T0EB 3S36X 3WFHA 1LQSR 1N5AA 1WJ3A 1UB6B 4PV8A 4I48B 3VDAA 5DD5H 2VWEE 4TOYL 4KROC 3NIGE 5L2KD 5T3XL 3HR6A 4GS7B 2FR4A 4GLRH 1T22B 5D7IF 2H26B 4UILH 3RWIB 2QQKL 4PFEA 3BKML 1SJEB 4MJIB 3FB8B 5FHAH 4D0CA 4NKDA 3ZL4L 2F19H 2IQ9L 4D2NA 2HTLD 3EJZC 4HS8H 4X99B 4X0KB 1PYWA 3UYRH 3RU8L 2ZPKH 4LSUL 3X17A 4ETQB 5C6WH 1WUNT 2WW8A 4L1DA 2G2RA 3SDYH 5EUOB 1KPUA 1P4IH 4ZTPL 4LNVA 5KG9B 3G6JF 3EOTH 1CG9A 1DUZA 2J6EA 1QLFB 4PRIE 4Z7NE 3DO7A 5D7LE 3V7AG 1OW0C 3O6KL 2KQMA 5GRZA 4RX4D 3I9GL 4P57B 1RHHA 1JK8B 5KTEH 4I4WB 1YMME 1TQBB 1KJ2B 5C1MB 1ZVSB 2FATH 5GRVK 3Q48A 2Q3AA 5FKPB 5IVXF 1YMHA 1Q9LA 1JGEB 3UBXA 3THML 5IBUG 3I6GA 1T1XB 4K23L 4PV9A 3GZKA 1P7KA 4U33A 4MAUL 1ORQB 3UMTA 2RGSA 3ZE0F 2NY6D 2XWJB 1I7RA 1R5IB 4I0KA 2P8MB 3HG1D 3PHQA 2G9HB 4OBSA 2VDML 2Z91A 5EIIA 4C56E 5L0QC 1Q9WA 5JXAL 3O8XB 4JO2L 2DQJH 3BEWA 3CFCH 3M8OH 1UWXK 2XY1A 2A83B 3EJJX 4MNQD 2W92A 5E95B 3DRTA 2D03H 5HI4D 3U4BL 4N1HB 2QR0B 5F1KC 2HLAA 4H26B 2X4NB 3O6MH 5SV4A 3TBWA 2AXJA 3QULA 5F3BA 4NRZA 4WI3A 3WO4B 3CMGA 1WWAX 4Z77A 1D5ZB 3CSYB 3DX7B 2MPAL 5CP3A 4M7ZC 4PRDB 4D0DB 3TFKC 3RVWD 2D7OA 1UWXH 1CE1H 4NP4L 2P43B 1EVTC 4KGLA 1RUMH 3TF7C 2VDNL 4UT6L 3F12B 3L5XH 3RX8A 2XN9A 4O9HH 1UYWL 4FP8L 4EIGB 2XQBH 3W0WE 2GSIA 2PETA 1MJUL 3BPNC 4M6OL 2CDFA 3MXWL 5DMIL 4QY8A 3NOIA 4Z8FH 5IG7A 3L3KB 1QFWI 3QFDB 3D69A 1KLUA 4MA1C 2IMMA 4XWOD 3VMNA 1T0MA 5J6GA 1RJZB 2CXGA 1IAII 3PNWA 4J3VA 4NDMA 4JPIB 2H2SC 5GS0H 2W0KA 3TVMD 3GEWB 1R5WA 2QSCL 3MA9H 5E6ZA 4MMZC 1JTTA 2R1WB 2Z9TA 5EORL 1MCWM 1GCFA 5IB1B 2FCBA 5JOEA 3SDDA 1DQTA 5GJSH 1P5UA 4NCC1 4X5WA 3DRQB 1LE5B 1ZGLB 4M1GL 2FYYB 3GSUA 1GYAA 2IFFL 4ZS6C 1JNJA 2E9BA 3C6LD 4N8VG 2NNAA 5FKAA 1NSNH 3O3BA 2AXFA 4OCMC 5GS2H 1SYVA 1JP5A 3LQMA 2VMFA 1EEUA 4Z7VA 3LSOA 1OPGL 4JRYD 1OSZA 5H2BB 5DUPH 2EICA 5HGGS 1HCFX 1OAQH 4M4RA 4HPYH 4NYLB 1FNAA 1IC4L 2CK0L 1ZLVK 4KK6D 2Q6WA 3VFOB 3ZHDA 2VUOA 5JW3L 5ALBL 2X1WL 4HJ0D 4TTDC 3PL6B 1QR4A 5KS9F 4V2BA 1F4YH 1J8HE 5KANI 4KHXH 4WFGE 1E6JL 1U92A 2H3NB 4PJ7F 2LU3A 3ECBB 5IFJA 5DA0B 4JRXB 3DWTA 3RTQB 3MV8D 2A6JB 2HFGH 2IQAB 2NTFB 3P9LA 3RZWA 3FQRA 4UT9L 4XX1E 3HUJA 5A1AA 4LQ1A 4BSWB 3IDMB 3NZ8A 4QYOB 4FXLA 2E9WA 2VXUH 4WIQA 4O02L 2ED9A 4PJFB 5I71C 3ISWA 5KZCD 2ORBH 1R5VB 1QYGH 4N0CD 5EOTB 2IFFH 3RY4A 3W0WB 5J12B 4PRAB 4EI5D 2FIKB 4G42B 4M5YH 3WIIL 2DTML 1I3RA 2FWOB 5MEPA 1J0IA 2OTPA 2V7NA 1JGLH 2YPLE 2ZKHL 3KPMA 1SJHB 4WV1C 2GUOB 4Y4HD 1I1AB 1CFQB 1I1YB 2VLJA 5KS9B 1MIEH 1TCMA 1XGYL 2QSTA 4R8WL 1WBXA 5E5UB 5J06A 4NN5B 2HAZA 1PD6A 4YZFE 5EU3A 4PJAB 5MENE 3P11H 5AZEL 3LD8C 2CIKB 3VXTA 3VRJA 3G5VA 4P23B 4U0RC 4ZXBA 4OF6A 4A2LA 4K7FA 5IB4B 2OP4H 1R24B 1AQKL 2VSCA 4IDJH 4JDZA 4PR5B 4QNPE 1CN4A 2O5YH 3MJ8A 3WNOA 1J10A 3GKWL 3MNVA 1N6QH 1I8LC 4DVBB 2BNRE 2EEDA 4OKVA 3JV6B 4XVTL 5E6IA 2OL3L 2DKSA 1ZVYA 1EH9A 3BD5A 3NPSB 5K9KA 2SEBB 5I1GH 1E4XH 1N64H 4X6CA 1HH6B 3IRZA 1PY4A 1L0QA 5T1KD 3WYRA 2BC4B 3E6FB 1X4ZA 5TDOB 5F97E 4QF1A 3SKMA 3EYFA 4P2RD 4N0CC 3WFEH 4O2EA 5FM5O 3NACL 5BZWA 3BQUB 1FL5B 4TNWF 2R56L 2WSKA 1G6RL 3ILPA 2P47B 1NMAL 5F8QC 5KSAB 4PJXB 3TBTA 4XXCA 1D5MA 3B3IA 3KG5A 3BP6B 2IMNA 5DJ8A 3OTTA 3GJEB 3K4DA 1EO5A 3WD5L 4JPKL 4P9ML 2DI8A 3KJ6H 4F7PA 2AXHA 1AP2B 3TZVB 3C60D 3HA0A 1BZ7A 5IBTH 4R7DB 2P44B 2BNQB 1U58A 2VKWA 1FO0L 3N50A 4QXUH 3RZCA 3PWPD 5IB2A 1EO8H 5KVGH 3MLVL 1Q0YL 1MCOH 4RMQA 2IH1A 3RA7L 4QT5B 1WBYA 3HMWH 5I1DB 3WLWD 5CKGA 1CICC 2VH5L 2OJEB 2R2EA 2FEEI 4WTZG 1IC4H 5KSBA 3B2VH 4S0SD 1K5NA 3S35X 5C7XH 4J4PD 4I0PC 4V1DA 4L4VD 1XIWD 1MH5B 2YD5A 1NUFA 3IDYC 3MSPA 4L8SB 2V7HB 3VXRA 5ID1A 2WBJB 5DJ0B 3QEUA 1EJOL 1JHLL 1NCTA 1WFTA 1IGMH 4X6CE 4J4PA 5T5FL 3CJJA 3GMRA 5C0RL 3EO1B 1YEFL 2P1YA 35C8H 5EWIL 3B6SA 2PTTB 4P2OC 1C12A 3N85L 5J6HA 4X4YB 4PGJA 3RGHA 2OX5A 4LOUD 3TJEH 4L4TE 4CU7A 1H3PL 2P8PB 3GB7A 4S1DC 4MQSB 2OL3A 5CSGA 1MFNA 5ACMA 2DQGL 4LEXL 4F7EB 2OK0L 1UFUA 4JDTH 1WISA 1QO3A 2ADFL 2DJSA 5FUCE 5IKCB 1Q9KA 4MQ7A 3B2UD 1A1MA 4U3HA 3H3KA 4XVJL 4JEGB 3LQAC 4YBHA 4RNRB 2HFFB 2HRLA 1S7SA 3HE6C 4H25B 1JYVA 4IRSA 3MUZ1 4JM4L 2H1PH 3FZUC 2X7LA 2YUZA 1DL7H 1NKRA 4ODBD 1YQVH 2X89A 4WI8A 4N0UB 1AGDA 1BVLB 2MWCA 4HLJA 2R2HA 3WFDH 1IBGH 4ZMAT 3QDJE 5IESH 1AIFA 2VLLA 2I9TA 2XFXA 2VXSH 4EDWL 2CDGA 1MI5D 4Y19B 1VKXB 4ONGL 1U3HC 2AGJL 2UZXB 1NMCB 3F62A 4PRBB 4WGVB 2NY1B 2PYFA 1JNNL 4QXWA 4GRWB 1ZHLB 2HN7A 4GRLB 5CHNB 4PB0L 1QSED 2VL4A 3MTRA 3T2NH 1QA9B 1IGTA 4KMTH 5HJ3B 5I0DA 5EZIL 1MAJA 4FZ8H 3W9DB 1IAOB 3ET9F 1A6AA 4LARL 2YWZA 3MOBH 3HI6H 5EUOF 4RFNC 4JHBA 1P9MA 4R3SB 4TUJB 4EXKA 5JOPD 4GG6B 2GW5A 2XRAL 4Z78A 1E28B 5KTEL 2ZJSL 5E5MA 5C0ND 4DEPB 2Q76B 2DYPB 2PR4H 3K7UA 2ITCB 4MZ3A 1RULL 3KS0J 3DYOA 1K8IA 1QSVA 4NQVB 4XBEH 4HKZB 5CWSB 1S8DA 5JDSA 3UBXG 4PJAE 3I3BA 5CUSH 3B5TA 4W6XB 5IEKA 5GHWH 5KJRH 3QIBD 1RSFA 1U9KA 3T1WA 1BGXH 4J6RL 2A73B 4XRCA 4M7JL 3Q1SL 2YUVA 3GBNL 1MUJB 4DKEL 1EMTH 5D96C 2J5LC 3VWKC 4AM0B 1Q94B 2CD0A 2HTLC 3EJZD 3LVEA 1ZSDA 5I8CA 4WWKA 3KPLA 2GFBB 4XPHL 3GBNH 2AJSH 4N8VB 32C2A 1LEKB 4AMKH 4UILL 3RJDA 4GKSA 2COQA 4ENED 2MCPL 4YGVB 4HUXB 5TF0A 5JIKA 4DN3H 3RAJL 5FF6A 3HI5H 1H3UA 1JUFA 3WFCH 1ZT4B 1CGWA 4XXDB 4FQHB 3IAPA 5DYOB 1DQDL 5DD6A 3QNYA 3TH4T 2R1XA 2F58L 5EZOL 3TM6A 3HI1B 3CLFH 4U1LB 1I7TB 5EDXA 5IBTL 4YHML 2V2TA 4LVHC 5IHLB 2EDDA 4Y5VB 1LWRA 3G08B 3AREA 4GAGL 4JRXD 2ZG3A 5CLTA 1A6ZA 1M7IA 3I75B 3S37H 2VLRE 3VXPB 1Z9OA 3HFMH 5CS7A 4WHYH 3QXTA 2E27H 5MI0C 1T1WA 3FO1B 2ESVB 3TA3C 5B39G 3BSZL 3BH9A 4PB0H 1ZHKA 3S4SG 1UA6L 4CVZB 2AK1H 5DK0B 1FZJA 3WS3A 3NIDE 1YN6A 3UPCA 5DDHA 1IM9D 1UQSB 2NZIA 4OF3A 4C83A 3SPVA 2H6PB 4FFWC 1O0VA 5JR1L 4AQOA 2FGZA 3WFDL 4MD5B 4MXVF 3GO1L 1BEYH 4Y1AA 1CFNB 4WVRA 3PIQA 5DJ2B 1FDLH 1U8PB 2H8PB 1IBGL 2EDFA 7CGTA 3MV9D 1ORSB 2EDXA 5FV1L 2EEAA 1JHKL 3WHXB 3I3EA 2H1PL 1GPOH 2CDEA 4OQ1A 5EZJB 4RWYL 3IJHA 3AC0A 4PRHB 3RWFB 4XP6H 3DIFB 1FG9C 3MACL 4ODSL 3DGCR 3QDGA 3QDMB 3JWOL 4UNUA 4X9IA 5IVZB 2VDKH 1NCUA 4Q97A 4XHQA 3CVIH 5LBSL 4PJGE 3TVMB 3DVGA 1MWAB 2IG2H 1AO7A 4KU1A 3RDTB 1NCDH 4OLZH 3T4YA 2CJUL 4BQ6A 2G60L 3SEPA 4FG6C 3MCG1 4JDVA 2J6EL 3DUHA 1PKQE 4YQXH 3N85H 1MQ8A 5DJDA 1A8JH 4G43A 4FQPA 4OZIF 4ESKA 1XAUA 1AO7D 3IETA 3NABL 1C5BH 1IC5L 1QLEL 1YDPA 4R4FL 5TGBA 1GIGL 5C8JB 4XNYH 4XI5C 1OWRM 3RJQB 4GRMA 5FYKH 4ZUUA 3EBAA 4DCQB 1MHHA 1SM3H 1Y6KR 3V0AC 1IILE 4Q9CA 1AXIB 4JKPH 1M7DB 5EG6C 4R0LB 3QI9D 3T4AA 2WWMD 1NBYB 1YEDA 3V6FA 3MA7B 1J1XH 1NANH 4NIKB 2WUBL 4YHZL 3QEGH 1RD6A 5AYUL 1S78C 3IFNH 1I1RA 1Z5LA 3RPKA 3GRWH 2BY1A 2HVKB 4PP2B 1OTTD 4FXGB 4Q0XH 2VOTA 2E8ZA 1BIIA 1N4XH 1F6FB 8FABA 5HYJA 4K3GA 4UQ3B 3SKNB 3G9AB 3RFZC 3WJJC 1P4BH 3QBTB 1J1PL 3OB0H 5JUEL 3ARGA 4GAFB 5CEYA 4IMLB 3MRCA 5F89B 4QRTB 4JHAH 2MMXA 4XPFH 1G7PA 5KVEH 4R26L 5TFSH 5FA3A 4X6EA 1CICA 5HGAB 4OZHF 3PQYE 4Y4HA 4APQA 1DBKL 3KYMB 1CGYA 3T0BA 5ICZB 3WFBH 4DGYH 3P0VH 2X5PA 2GSGB 5IFAH 5E8NB 4HCRH 2B5IC 3ROOB 1HSAB 4JQVA 4U6YB 3CSGA 3N06B 3U36A 3VCLB 4YXHH 5ALCL 2W65B 5D6DA 4AL8L 1ZT1B 4LEOB 1S7WB 3C8KB 4XAWL 4WJ5A 4CVWA 4NBZB 2EDBA 5I1AA 3H9ZA 4FQ1H 1ES0B 4JY5H 1W0VA 2BSSB 4QRUA 5F1IB 1MVFA 4E41E 1KB5L 1W2KT 3T0EE 4HKJA 5FM4A 4ISVB 4NQDD 4YXHL 2I25N 2BVQB 1KB5A 4XVSL 4YHPA 1AGFB 3CPLB 4Z7WB 2F54E 3TP4A 5ALCH 2ZKHH 4YDVA 1CIUA 4Z7OF 5CJXA 2OCFD 1V3KA 3LQAH 1VFBA 2AV7B 4M7ZB 1X5GA 4QHUB 3A6CL 2NX5B 1JWUB 4XC1L 5E6ID 4U6VL 3ARVA 2GCYA 4QKXB 1MCPH 3RY6A 4OLXL 4FFVD 4I2XA 2P4AB 2Y06L 4L29B 2CRZA 4JO2H 1JZ3A 2CLRA 2UWEF 5IROC 4QHNA 3BMWA 4P9HL 3GSQA 1QRKA 1Y6MR 1S7UB 2CO7B 4L4JA 4QXTA 4X4XA 2KPNA 1N8ZB 5FECB 3EYSH 5CILL 3HCVB 4ZUWB 2ICEA 5BS0E 3F7YB 5E9DD 1JN6B 4X4MA 1QFUH 2DLFH 1IKFL 4OD2B 4TUOA 5C07E 5FUZH 4OD1H 4Y5YA 1TLKA 4JM2D 3QHFH 4WW1A 5C09A 4JLRA 3RIFK 4NC1E 1O5DT 3QPXH 3QT2A 1HXYA 3V8CA 1UM4H 1DQJB 5CP7A 2ATPA 3FN9A 4MNHA 4G7VL 5CJ5A 3PJSB 3BDYL 1G7HA 2FX9L 4MSWA 3MXVL 5IB5B 5TE7H 3DYPA 2Y7QB 1N3NA 2F19L 3MOAH 1FN4B 12E8L 3MNZB 3BP5A 4FFWD 4TPRL 2DN7A 3WHE1 1XIWA 2VZOA 4ELMB 4MA7L 4O4YL 3WIHH 5CD3A 1AHWC 3T8XB 2CJUH 1I9EA 4HAGA 43C9A 1M05A 4M7KH 3ULSA 3I50H 1JZ4A 5GS0L 3UZVB 3H9HA 1LEGB 1UXWB 4RAUA 1OTTC 2XA8L 4UBDD 1HNFA 4OAWA 3ZHKA 1U8MA 3ARQA 1JBJA 1BWMA 4LRIA 4NSKB 1OF2A 3H0TB 5I1HH 3O9WD 4A6YH 4FQ2L 2Y9RT 3MC0A 1NBZB 4LLUB 4DGIH 1KIUA 2WLZA 4KQ3L 1FFQA 1BQSA 3V5HB 2X9YA 3QI9C 4OZGA 3UTTA 4YFDB 5MEND 4ERSH 4XZUB 1MJUH 1NMBL 5DT1L 5IK3A 1PG7H 5MERB 4N90E 1OAXL 4XI5D 4J3SA 2VXVH 4XH2A 1DE4B 2FEEL 3T08A 1TZIA 1EEQA 1PQZA 3PQYB 3SQOH 4RQQA 4GG6F 3WHE0 3B9EA 4ONOA 5DD0L 4ZFOL 2HJLA 1JPFA 4ZPTB 4PGCA 3S96B 3DROA 3MYJB 4MXWH 5FYJE 1OARH 5GGTA 3E3QE 5DK2B 3TCLA 1H5BC 4Y2DB 5CEXB 2GTWA 5T5NF 2J8HA 3WO3B 1UENA 1LILA 4LSVH 4WTZA 4KJWD 5DJAB 2NX5D 5HYIA 3KYKH 5HPMA 3C60B 2BVTA 3ARSA 3TN0B 3QJHA 3SE8H 1UH4A 4P5KA 1I7UA 2DM2A 3GNML 4G7YH 4CNIB 5E8EA 3SJVE 4E41A 3DV4B 2YBRB 1IGFL 1U0QA 1YNTA 1WEJL 5DVMA 4KKCD 4NQDB 2ZZUT 4L3EA 4JO4H 4PJBF 3QXAB 1QFOA 5BQ7A 5EO0A 3FB6A 3QO0A 3QA3A 5B38A 3EYUL 4NJ9H 4BUHA 2V2XA 4WDIB 2BOCB 1A22B 3CMOH 3SDXB 3S6CA 3DVNA 3FQNB 1EMTL 2D9QB 4MCYA 3UYRL 5C0FA 1KJ3H 4WEBH 5F1NA 5INCA 1GGIH 5DURB 2OTWB 2QQKH 5D71H 4U1SB 3IU3B 1Q72L 3OGCA 4LKCA 4BH8B 2BOBA 2P24B 1F5WA 1YMMA 2Z8RA 1EVUA 1JPGB 2DD8L 5ID0B 2GK2A 4BKLB 2Y07H 4HIHA 1ZMYA 4XBEL 2FB4H 2VTFA 1SJXA 3MV9E 4MDIA 5F44A 3FHAA 5IMOB 3LAFA 2XRAH 2IH3B 1KBGL 3D39A 4ZFOA 5ICYA 4HS6B 4U1GC 5KSVB 4QXGL 3GNMH 4G7YL 2HFTA 5GGRB 4X9FA 5HGBB 1FYTB 2X4UB 3QG6A 4XNMB 1Q0XH 4ZD3L 3B4NA 3HI6L 4RX4A 3V4PH 1D9KA 3W9EA 2HT3C 3MRKA 3WD5H 4K7PH 4PTUA 3I2CH 4GRWF 2LAGB 1ZXQA 3LKOB 3ZYZA 4L8SC 4DKAA 4G6MH 4FZ8L 2B0SL 3K46A 3JV4A 4LVNB 3X12A 5EU7C 3U7AA 5DQ9A 1CDUA 1BM3H 3ZTJG 3FFCA 1S7VB 1G9NH 3GO1H 4X6DB 3DSFH 3AY4C 3HRZA 5IV2A 3K2UH 3QUYC 2DMKA 25C8L 4G5ZH 4P2OD 3E2HB 3MLRH 4C58B 4ZUTA 2NXZB 5DUBA 3S4SB 4UB0L 4NKMA 2YPVH 3L3HB 4OLUL 5IESL 5C86A 3SJVA 4N0YH 1QNZL 4ZOAA 3CH1B 4G8EB 5GXBB 5D72L 5HHVL 3ARDA 4EDXB 4QOKD 3RP1A 4JFZH 2GKIA 1OB1A 3JZ7A 1DVFC 4ZUSB 1S7RB 4I0PD 5D7SL 4CU8A 1IZJA 1H0DA 4U1MA 4JZNB 3RVTC 2Y1VA 5FDWA 4HK3J 2CRYA 5GZND 1UWEH 3JVGA 2NTSP 1N59B 1MVUB 3IJYA 4NO5A 1GC1H 4Z0XA 3AS1A 3BUTA 4KQ3H 2EKSA 4LHJB 2R1YB 4BSVB 3BAEH 4AYFA 4DGIL 2DIJA 3MOQA 2DAVA 4LKXA 4L8BA 3GSOA 5EPMB 5IMMB 2XA8H 4WFFD 1L0XA 2HJKB 5D8JH 3ZDZE 4OQTL 5D9SB 3QHZH 4HQQH 2ZCLH 5EU4A 1L0YA 4IOIB 3TJEL 4XP4L 4YGAB 5EUKB 1P7HL 1P6FA 1NFIA 3VD3A 4L5FH 4CVXB 4YHLL 3MODL 3OKEB 1JCKA 4FQCL 3O2VH 3SY0A 4KJPC 4NCDA 3NN8B 4GAYB 4NHUB 3BWAA 1U91A 4YE4L 3CNKA 5D2NA 2EYSB 1RIHL 3QYCA 1K85A 4I13B 5I75B 1V7MH 12E8H 5HY9B 4XNUH 4P5MB 4MAYD 2A1WH 2AJ3A 3KPRA 1BOGB 3NTCH 5IJKC 1OAYL 1MFEL 3DX9A 4PJCA 1MELA 3HE6D 4LU5H 4M7LL 3LEVL 4OZHB 5TDNB 1F97A 4JFHD 1QFUL 3LOWA 4KGJA 1K4DB 1E6JH 1EERB 5D1ZB 3WUWA 5ENWB 1X5YA 2XNAA 1YEKL 3TBSB 5GGSB 3JWDH 4JFDD 5SWSD 1MLCB 4OIIH 4CAGA 4POYA 3P4OB 4HPOL 4LCWE 3S7GA 4CW1A 2IF7A 4LARH 3LQZA 1S9KC 2AEQH 1RY7B 3PWUA 1EFXD 1NCCH 4ONHB 4F7MA 2EECA 1HK6A 5I1KH 4P9HH 1V8HA 3WDJA 1HI6A 3QSKB 4JCLA 1LE9B 1F90L 3DUSB 1T5WB 4ZAKC 5C3LD 5D93C 4YWGL 2LQRA 4M4PA 2ADJA 5FGBC 5T3XE 5GRUH 4Z7WF 4NQEA 4YR6A 2GIYA 2VXSL 5AWNL 1G6RA 3JWNC 4QRRD 2V2WA 4K3DL 1OP5K 2VLMD 4WI5A 4EVNB 1PZUB 1FJ1B 2DLGA 3L1OL 3MA9L 3ZLQC 3PDOA 1RIVH 3D18B 2X44D 3O2DA 4NOBA 1Z6JT 4NFDA 4CMMA 2PUQT 2ZOLA 4IRJB 4PJIE 1B0WA 3QUXB 3RWGA 1BZQK 3BPOC 5IOPA 3SDCA 1MCRA 1U3JA 5GGVL 2YC1A 1U8NA 3HC0B 3O4LE 4Q6IB 4FQ1L 3O4LB 3QFJB 4YDJB 2IPUG 2C7UA 3MRIB 5IW1B 3VJ6A 2ITDB 1CT8A 4NNXB 5I66A 3T3PF 2F53E 3BZ4B 3RNKB 4JFFB 1W8OA 4P2RA 4GXVH 1CXFA 4ZSOE 1UXSA 3T77A 4YNYA 3H9SD 1NFDF 1NLDH 3QXDB 3R4DA 1C5DB 3OF6A 3EOAB 1NGWA 2VDPH 5DSCB 4M5YL 5CMAB 1R3HA 1JHLH 4ZAKD 2X4OA 3NA9H 4FQLH 3DSNA 4LLAA 4JGJA 3QIWC 4M93C 5FYLE 1NKOA 4KH2A 3U4AA 1CLZH 1J1PH 4JHAL 5ERWB 3ARYA 5HYQB 3O6FB 1NGZA 2BVPA 2GQHA 3L5WB 3O3DA 1MI5B 5K9OA 1U8JA 3S9DB 5C2BH 2OTUB 5A2FA 1A0QH 5D2NC 4R97C 1CE6B 3ARWA 1CFTB 3TBVB 1A9EB 5CZXD 2CIIB 3CIQA 3QO1B 3SHSA 4NQCA 4NRYB 2JB5L 3RDTC 4Y4KA 1N0XH 1EHNA 1FG2B 2UY7A 4X7FC 3GSWB 3VI3F 5I1IH 1T7ZA 1UZ8B 1XT5A 2CK0H 2W91A 2YEZA 1UZ6E 4HPYL 1FFOA 1C7SA 3MRLA 3ZE2F 2JJUA 4WCYL 4AIZB 1JNHB 3PGCA 4BZ2L 1CXLA 4N90D 1NC2A 4HG4J 1IT9L 4MAYC 4QO1A 1AQDA 1SM3L 1FL6B 1KIRA 3LRSA 1MCKA 4KVCL 4WU7B 4BELD 4YE4H 2AK4E 4V1DD 1DVFA 5J11B 3KPNA 5GIRA 3LHPL 1KUMA 2ED8A 1E6OH 4FTVD 5FYJL 3D25A 3RBGA 5JW4Q 4URTB 3KYNB 4IJ3C 2AKRB 5LXGH 4Q2ZB 5HI4C 3SDAC 3W39A 5JIIA 5DRNB 3VFVA 1XGTA 2BVOA 1ERNA 4XP1L 3IDGB 4GUPA 4Q6YA 2XWTA 4KPHH 5DRWB 4NUJA 2DDQH 2EH8L 3CK0L 3UTTD 5CCKL 4JB9H 3EO0A 4X7SL 4JKWA 4HD9A 1LGVA 4RWYH 5D2LF 3DMMC 3MACH 1G7MB 3T2QA 2R2BB 3BXNB 2GY5A 3P77A 3RVTD 2B4CL 1UACH 4LPWA 5DI8A 1AGBA 5BS0A 1CLYL 3L5XL 2CUMA 3QZWG 4YPGB 2EO9A 3FFDA 5FUOL 1JVKA 3NFNA 1MCHA 4D94A 5FCSH 1T4KA 3TZVD 4PRNB 3W2DH 3HE7A 3H3PH 1S7TA 2YD3A 4DK3A 3RVXD 3FQXA 2CSPA 2NY0B 4YJZL 3WL9B 5KSAD 4ODXA 1WWBX 1H3WM 3BISA 4PJ8C 3J7HA 5T1LB 4P3CL 3J8F7 5D70L 5E9DB 1BVKA 3LS4L 1XH3B 1KIPB 5JPNB 3MGOA 4YHYB 4PJIB 5C92A 4XCEA 2XA3A 5DUMH 1FV1B 2Y36H 5C0AB 3WLBB 3MROA 1NANI 4HPOH 5T33H 4GAGH 5EC2A 3QNZA 4OLYL 4YPJA 4K7PY 3KPQA 1K3IA 4OD3H 2A9NL 5ILTH 5L2KA 1XF1A 3ORJA 3O3UN 1XCQA 3SQBA 1SEBB 3P73B 2WUBH 4YHZH 5JW5B 5BOZG 1WK0A 1UJ3A 3I9GH 4X6FB 2MCPH 3GSRB 4HG4K 1YC8A 4LVOB 3HI5L 2YRZA 5FO7B 4HK0B 3MRFA 3BPLB 4HJGA 5B3JF 5SWZA 3H3BC 2VISA 1OQOA 3AVEA 5LGJB 2ZPKL 1ZHBA 5EBWA 5H37G 1R3JB 2VLRA 2MKLC 3VXMB 3CFKB 2AJSL 4XPAH 4G9DB 1GAFH 2VITB 2HRPH 5HHOE 4C4KO 3OX8A 1CDBA 3Q2CA 1KTDB 2FH8A 1A1OA 5DTFB 2BXYA 5T3XH 1T89A 2R4RH 3QIUA 4LMQE 2NW3A 4G8GB 4FN0A 3CFJB 1IQDA 2WQRA 4F33B 2YOCA 4KKCC 1GZPB 2EIBA 2QSCH 2ZCLL 4K8RH 4KKBC 1CGXA 1SVCP 1NGYB 3CVIL 4NC0B 3Q6GL 4JFEA 4U1HB 2M8XA 2X40A 1S7QA 2GHWB 4RGMB 4YDIL 3V8OA 1IEAB 2YPKA 4D9RE 4Y2OA 1IQWL 4U6XB 1SVZA 1AI1H 3ARBB 3QHTC 3ZTNL 1U8LA 3MV7E 3WNKA 5E7FA 5SWSB 3T65B 1T7VA 2NQCA 5BRZA 3CAFA 5AEAA 1T2QH 3L3IA 2I24N 5DFVD 3PL6D 5DQDL 3ZSSA 4Z7VE 1JPSL 3OKMB 5JR1H 4MA3B 4H88L 1RVFH 2CUIA 1AHWB 5TPWL 3H6JA 2J8UB 4JRYB 4RCAA 4PG2C 1HQ4B 2A6KA 2NYYC 3EYQD 4WHYG 4Z5RB 4OFKA 5D1QA 1R3LB 4HFUL 4JFDE 4KROD 3QXWA 5LAXA 1CDHA 3VG0H 3OHXB 3ABZA 5I9QC 4P2OA 1DL7L 2GJ6E 1EEZA 1A6VL 3C6SA 3O2DH 4L3CB 4LBEB 3FT3A 1CQKA 4G9FB 1MRCH 5B8CB 2E27L 4OCLC 1QVOA 1X7QB 1TPXB 3SGEI 3HLAB 1V05A 4TSCH 5BJTA 3D3VB 2FGWH 5HGDA 2F9BT 4O5LL 5FEBA 3PWNB 4KY1L 2LAAA 5DZLA 3QI9B 4YFLF 2Q7YB 4ZD3H 1CD0A 4K9EL 4M3KB 4RAVA 4KDWA 5BO1H 1JGUL 1K4CB 1VFUA 3DXAB 3M17A 5L7XH 3NA4A 4HUWB 2CKBA 5DRXA 5IBUB 1NEZA 3MO1A 2EEBA 3VGEA 3HC3L 3GJFA 2JJVA 4G80A 5GSRB 4GKNA 4PJEA 4G8FB 4HF5H 5FHBH 4D3CH 4IM8A 1NGXA 3IFPA 3VRLE 5J13B 4KJQC 2WINB 3WIHL 5HHPA 1E6OL 3QB7C 4K2UL 5C2UB 2EYRA 2Z8WC 4Q74A 3W11D 2CLZB 3B8YA 2NLJB 5DFTA 2Z31B 4X6BA 4Y2DC 3OXRA 2GT9A 3MV8A 3RWDA 5TE7L 4PJ5A 1HQRB 1AXSB 5DEGB 4QRPB 5GGRY 3LZFH 4ALAH 4H5SB 1VSCA 4MQXC 1GZQB 3UTZB 4WCYH 2ATKA 3ARBD 2QADD 3WS6A 4F3FB 1JI1A 3ULVF 2KDGA 3BGFC 1RFDH 5CUSL 2NXZD 2NZ9D 4HXAL 3UO1H 1PZ5B 3LKRB 3OAUH 5GGQH 4PB9L 1JMXA 3G5XB 1LP9B 3KPRD 2VH5H 1RK1A 4RISL 2AQ1A 3JUYA 2XZQL 3ARFD 2ZUYA 1EEYA 3I6KA 3RWCB 4AT6A 4PG9A 4QHMB 3L9RA 3MV9B 4CUCA 2BVEA 1NCBH 4JO1L 1T04A 1S9YA 3KDMB 1A0QL 2R0ZL 4JJHA 2GK0B 3MOBL 2RHEA 5GRWA 2ICWA 2NY7L 4HUVB 1E0OB 3CFEB 4XCFH 3MFFB 5KAQG 3BZEB 4K3HA 4R7NB 1FNFA 3NZHL 1TENA 4F7CA 4BZ1L 1BFVH 3VRIA 4IRZL 3LV3B 1NMAH 4LCUB 6FABH 1ZA6B 1BVZA 2VDPL 4S2SA 3KR3H 1LO5A 2F54A 1YECH 2Q86A 5DVNA 1FNEA 3CFDB 2NR6D 2H45A 2F74B 4LLQA 3MX0A 1YY8B 1S9VA 3BZFA 4Y4FD 4HIEB 3MLZL 5DD3L 2P46B 4YH6A 4LIQL 1ADQL 1BECA 2EE3A 5HVHC 5E1AA 1JPST 1XF2A 3TO4A 4PD4J 3I6LE 3FOMB 4JKMA 1QRNE 2BNRD 1KJMA 4PLNC 3VGFA 4ZPVA 4RFOH 1CLYH 1N6QL 5DS8B 4HV8A 5SWQA 4JM4H 3HR5B 3MNWA 2PXYB 2HTKD 3F5WB 1MCCA 3QEHB 1OOAA 2X70A 4LLDA 2WUCH 4JANB 1HXMB 4Z7UB 5DFWH 5D2LE 4FQJH 4WW2C 4BH7A 3LH2L 3TNMB 1NCWH 3FQWB 4JPVH 2HVJB 3GMMB 3FO9B 3VXUA 4J1UA 4R8WH 3WJJA 1AH1A 4OLEA 3IF1B 3X3GH 5F88B 3LIZH 1IVLA 5BW7A 1BJ8A 5L2JA 4HEME 3S88L 1MHCA 2JIXA 1PJ9A 1UM6H 2IADB 1H3PH 5FFLA 1HH9B 2I5YL 3VWJD 5JQ6L 1FQ9C 3QUMB 5LXGL 5J1AB 3O0RL 3FL7A 4JFHE 4S1QH 3QQ3B 4P2QD 3QUMH 1J05A 1FVDA 3BOVA 4MYWB 4PJDF 3GUTB 1XZ0A 4YC2B 1VEOA 2R69H 3QCVL 1O7VA 3D85D 3U9UA 3TO4C 2BJML 5E24E 4OUUA 4P4KA 4QTHA 3S34L 1JHTB 4PLKC 5DRZA 5CIPA 5I8OH 3NFSH 3KGRA 1BBJA 3P0YH 5IMLA 1DUYB 3OXSA 5CJQL 1MNUL 4Y4KD 1PAMA 1R3KA 4RGOH 2GJJA 4S1SH 4PJDA 4F80A 3L3JB 1FZMB 5F9WB 3KXFA 1CK0L 1A5FH 1MPAH 1IKFH 2X4RB 3ZDXF 3F8UB 4H0HB 1P84J 2YK1H 1LO4L 5ACLA 4LSDA 3HMXA 1S78D 5EU6A 2Y23A 1INEH 1QG3A 3MV11 5CILH 4MX7B 4DWHA 4TQEL 5F7FA 2HH0L 2HFEB 1OGAB 2IAMD 4PREB 2WMPA 1LNUB 1KXVC 1MRFH 3CDGA 3MBEC 4OJFL 3CX2A 3F58H 3D0LA 3FRUB 4LDOB 2MCG1 1BLNA 1DFBL 3UTQB 4F58H 1QLEH 4UUJB 3D2UD 3WFEL 1AGCA 4PD4K 2P5EA 3OV6A 3G6AA 2R0KH 3AXLB 4U6HA 4XWGH 4NNYA 3WS6C 1XGQB 1ZT7A 4MJ6A 1FORL 3BFOA 4FABH 5B39B 3O2VL 1MAML 1LD9B 4WI6A 3DPBA 1C08A 4L5FL 3D2UA 4JG0H 4ZFFB 3LQAL 1LP9E 1PG7W 3V4UH 4N5UA 2HWZL 3GMPA 1T6WA 1GSMA 2X9XA 3E6HB 2I5YH 3O9WA 1IEHA 2B7DT 4Q9RH 3T3PE 1HHKA 3GMNA 4N5EC 2VXQL 2W38A 3LS5L 3JTTA 4G6AC 5DQJB 1YNKL 2F53A 3RRQA 2O5YL 2IBZX 4PTTA 1R0AL 2VZ1A 5KVDH 1YJDH 1A47A 4E42A 1A64A 4U6TA 3U48A 3EYOB 3TA3A 4KJYB 5EO1A 2Z92B 5GGVH 1X5XA 5KVFH 4WU5B 5C08B 4FTVB 4GMSL 5K9JL 1JHKH 4K8RC 5INDA 4R4ND 3L3OB 3U0PB 1GGCH 4KKBD 2QKIA 1XF3B 3OR6A 2FJHA 1IGCH 3OJ2C 2DLHA 1QSFA 3SCMA 1KPRA 2AI0H 5DJCA 5FO8A 1C5CL 2AS5M 4HCRL 1OP3H 1XF4B 4NP4H 2XYCA 5C0EA 3HN3A 5E8DL 4HULB 5DGQA 1NFDA 4PJ9C 2WP3O 1YPZA 4HHAA 1YYML 3ZKXB 3L95A 4G5ZL 2FIRT 3MRHA 3VW3H 3MREB 4TVPD 1M71A 4WV1B 3U83A 1BQHA 1HILA 3MRDA 2VXTL 5F1SA 3GSNL 1AC0A 1P1ZB 4PG2A 2GY7B 3MLSH 2P42B 1RZ8A 2NY5H 4K3JL 4OGAD 4XBPB 4HS3A 5H94B 1W0WB 2WBKA 4GBXA 4HWZA 1MWAH 3X14B 1IL1A 3DBXA 3CFIC 4MWFA 4G3YH 5C0BD 1UT9A 4MAUH 4U0RB 4HXBH 4FQXC 2A6IB 3EFFA 4AH2A 2PW2A 4ODWA 3REVA 5C0DB 2G5BA 5GGUB 5EH1A 1A4JB 5C0IB 1S9WA 3O6FD 2MHAA 3GGWA 4PJDE 5C07D 4K8RL 4JN2A 3ARPA 5I71B 1NJ9B 3WFCL 4MJ5B 5ALBH 1U8HA 2F8OA 4UV4L 4HLZG 4E41D 5T1KB 1RZIB 1PEZA 3VD9A 3BKCL 2YD7A 2FECL 1ODAA 3MQIA 5EN2B 1DBML 3VFTB 4PJ5E 3V79C 5DVOA 2UZIL 3O3EA 4XPHH 1WIPA 4WEBL 3UTTE 3QIUC 1VDGA 4IHOB 5D1XC 1YUHA 1AR1C 5KSAC 2J12B 2BNRB 1A9BA 2R0LL 1KNOA 1VACB 4NN5C 3BUYB 3HPLA 1UKQA 4ODVH 3LD8B 1UCBH 5KW9H 2DQTL 2QEJA 1YNLL 4XCNA 1YZZA 3TZVC 3QEQB 1X44A 1D5BA 2D31A 4LCWB 3IKCB 4R97B 4U1IA 5IB3A 1HWGB 5HXMA 5E08H 3ZE1E 2B1HH 4U05A 4V1DE 5BZDA 1YN7A 4X5XA 2IANA 4JFFE 1I9IH 5ILTL 4QHKI 2GYSA 1FLTX 1MLBA 3HG1A 4PRPA 4L8DB 2X9WA 4P3DB 1FFPA 3NAAH 4KFZC 4QRRB 4XBGB 3G04A 4Z8FL 5HVFB 1EAJA 2XQYG 3K74B 4K55A 4GKZB 4XAKE 3OKDB 2MJWA 4YHOH 4BZYA 1IEBA 4UIMB 2IPKA 1PLGL 4NQUA 1IM9A 5C0JB 1HSBB 5KZCB 1T80A 3ARFB 2BFVL 4FQXA 4OGZA 3T0DA 1W72B 4JCMA 3NIFF 5FM5M 3MJ9A 3GSVA 2N56A 2LU4A 5E8DH 2PCPB 5KVMC 1WT5A 5F7DB 2BXZA 2CLVA 5M7QA 4UDTB 2P5WA 1X5HA 1ACYH 3H7BA 4HX1B 4JJ5B 5SWZE 1KV3A 1FGNH 4WUUE 4U2YA 3OAYH 1X5KA 3HUJE 1U8QB 4YX2L 3AAZB 3GMLB 3HZVA 3GMOB 3RL1A 2VABA 1CF8H 4XGZA 3PGDB 2DQIL 5I2IA 3OKKB 3L7EB 1WCBA 3VFMB 1DLHB 4L9DA 1GXEA 5B38G 1XCTB 5JLZB 4MCZA 3KPOA 5D1QD 4CRPA 2EE2A 3UROR 4IOFC 4F15B 5C08E 3HE6B 2ARJB 2OQJA 4KK5D 5C3TA 4KVNH 2JB6A 4I0PB 3RDTD 4LEXH 2DQHH 5IR1B 3STLA 1HHJB 4NO2B 4ELKB 3QP3A 3DMMA 3QRGH 3IDYB 3NIFE 1RZKH 1NAMA 5K93A 2ADIA 2QQNL 3BN9C 4M8QB 3DXAD 4GAJH 5LQBL <