3QJFB

Crystal structure of the 2b4 tcr
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
242
structure length
240
Chain Sequence
SKVIQTPRYLVKGQGQKAKMRCIPEKGHPVVFWYQQNKNNEFKFLINFQNQEVLQQIDMTEKRFSAECPSNSPCSLEIQSSEAGDSALYLCASSLSQDTQYFGPGTRLLVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords 2B4 alpha chain
total genus 55
structure length 240
sequence length 242
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qjfB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qjfB01
4JG0L 1ETZB 3ET9F 3REVB 2WUBH 4YHPB 1N2RB 1BJMA 4EI5A 1BEYL 1TMCB 1X4YA 3UAJD 1CDBA 5MHSD 1FGVL 4K2UH 5T3ZH 3V5KA 1Q9LA 4NQXA 2NY0B 1CTNA 2BVTA 4JVUA 1AGFA 1RUKH 4L9LB 2KDGA 3LB6C 5DJAA 3T0BA 1A3RH 2H41A 5J6GA 1Q9KB 4HKJA 5CWSA 4G9FE 4MJ4A 3U7WH 1MJUH 1X5LA 5DEGB 1N2RA 4XMPH 5BVJA 4LSTL 5DUBB 2MHAB 1CK0H 4LRIC 2G75B 1YC7A 2C4XA 1QFWH 4TPRH 5F8QC 4XXDB 1AGCB 4LARH 5HI5D 3W9EB 3X13A 1T7VA 3K2MC 4YZFE 3EJZD 5I19L 1UB5A 4WV1C 2YMXH 4YIQB 4JKPH 4ZUWB 4E9LA 1IC4L 2W9DH 4LRNH 2A9NL 4NC0B 5DD0L 3C5SA 5ALBH 5INDB 3ZT7A 4BSVB 3RGHA 5JDJA 1BZ9A 3QUXC 1F97A 3U1SL 1B9ZA 1T3FB 3U83A 3A6CL 1B88A 4N1HB 5CBEA 4O2EB 2NY3B 3OF6A 1JHTA 2PTUA 2PW2A 1S8DB 2H32H 4JFDD 3TPKA 1QVOA 2R0WH 1HOCB 1DLHB 1EGJA 4JFDA 2E3VA 1OAUL 3P73A 3OF6D 3NPZB 4Z7WA 1OD7A 4LU5L 1S7TB 2DQHL 2V2WA 4PRBB 3UTSB 1PDKA 5I1GH 2GI7A 3HI5L 3CSYA 1TXKA 2AABH 4YDJA 2N56A 3V95A 4G5ZL 4CMHB 2X9WA 2VUOA 1EEZB 5GRUL 2GTZA 4ELMB 5INDA 4JZOB 5MP6H 4Q2ZA 3MRHA 3RKDC 1DE4A 5CUSL 4NKOA 4RZCB 3BSZL 1UC6A 1VSCA 1DN0B 4FG6D 4FFWC 4FQ2L 4HS3A 2Z91A 2X1OA 4MQXC 5CKGA 5F6HJ 1JTPA 1JYNA 2D7NA 4LLVB 4PJ8D 1WUNT 3QIUB 5EOTA 4I13B 1DP0A 3BJLA 1INEH 3QH3B 3Q0HA 3OJDB 2GTWA 5DMIH 5L2KE 1OP9A 1HQRB 5ANMA 3KJ6L 1NL0H 1SVZA 4NQCA 4OZIA 4F7PA 1T04A 4F7MA 5FDWA 4MB5A 4R3SB 3FB8A 4X6DA 1GIGH 2AXFA 1RAMA 1MCCA 4KHXH 3SGJA 5C2UB 5AZ2H 1CXHA 4ORGB 4Y4HA 2E6QA 1H3PL 2QV2A 2B8OT 4K7PH 1JI1A 2VXTH 3EUUA 4GG6B 3TZVC 4OCWH 1MFAL 2FSEB 3G6DL 1KIQB 4K8RD 5F9OH 3MFFA 5EWIH 2YKLL 4CU8A 2EH8H 2ZWLT 2ZNWA 5JOPE 1WBZB 3LOWA 4JY5L 4F7TA 3NFPA 3JV6B 3QDAA 3S35L 3QNYA 8FABB 5J7CC 4NGHH 4PJIF 3JTTB 4FQ1L 3MRIB 3HNVL 4WHYH 3CFDA 5JQ6H 2D03L 1Q72L 4F7PB 2ITDB 1T22A 1C5CL 4LASL 2XQYG 3FT4A 5FUZL 4X0KB 3RWJA 4ZS6D 4ZUTA 3MX0A 3WS3A 4BKLB 5LWYH 2ARWA 3MUJA 3PP3H 1KGCE 2DOCA 5BOZG 1XGQB 3W9DB 5DFVD 1GOGA 1QSEA 3VH8B 3W39B 4I48A 2AK4B 5H94A 5LVEA 4PRHA 4K3DL 2IFFH 4NQEB 5F7UA 4I18C 2VITB 2VZTA 3JV6A 3ARGB 1G6VK 3T0EC 1R0AH 1I3GH 3CZFB 4PTTB 4X6EA 1F4XH 1GPOH 1NAMB 1MF2H 3O2WH 4KMTH 2Q6WB 1XIWA 4HK0B 3MACH 1OTUD 3RVXC 2PF6A 1ZA6A 2UZIL 3GFUA 4R4BB 3TIEB 2EH7H 4PRIA 3RVWD 3ZYIA 2XOTA 1FVCB 3OR7B 4XCNB 1LILA 5DDHA 1KLGA 3WIHL 3MV9D 5GRYA 3I75A 1J0HA 1NAML 1ZLUK 3NBNA 2BVYA 4X4MA 3RVWC 3SKJL 2VH5L 2DMKA 4QXUH 1JPTL 4OIIH 5FO8B 1PAMA 3F12B 1VEOA 4ALAL 4FTVE 2WIIB 4DEPC 1YN7A 4MJIE 5A2FA 3L3HB 3CU1A 1DQTA 1KCUH 1R24B 1U92B 4B7LA 4XC3L 4LLAA 2X6MA 2ZOLB 3Q5TA 1KCVL 4KAQH 3MRPA 2CXGA 4BUGA 1A21A 1QSZA 2O5ZH 1TJHH 1UJ3C 3QCVH 4XCNA 1OWWA 3V0VB 1NMCB 3FFCD 3DX9B 1VPOL 2F54A 4I2XB 3HFMH 1Q9OA 2Q7NA 4J4PA 5MI0C 2DQIL 1XIWC 4DK6A 1HH6A 4IMLB 4MJ6B 5C0JB 2XA8H 5D1ZD 3MRMA 2ARJA 2PO6A 4YHIA 5C71A 1T0NB 2CIIA 2P5EE 3IAGC 1C5DA 2VLMD 1NCUA 3QCTH 3QUXB 1MRCH 2PXYD 2VC2L 1A6VL 4QOKD 3SJVD 2IBZX 3TBYB 4BQ9A 1WBYA 4H1LG 4KQ4L 4PJXB 4X6DF 1WJ3A 1XF5B 4G8IA 3ARUA 3MLRH 2BDNL 3L5WA 3E1F1 4O2FB 2ADFH 2EECA 4Y4KA 3CK0H 4NSKA 5EBMB 3QRGL 2Y36H 4LSSH 2IQAB 3WEXA 5EC1B 3GO1H 5IKCA 5A2JH 5TDNA 3IU4H 4I9WD 1SJVA 5L2JA 3VXSA 4FQQB 3B9VA 4JDTH 1T66C 1U95B 1Q0XL 1RIHL 1J8HD 2H26B 3TVMD 3C8DA 4Y19B 1AR1D 1FVDB 1KELH 3KYOA 5C0CD 4YFEA 1NDGB 5HVFB 5BS0D 1RZ8A 1TDQA 2PTVA 1XF3A 2WW8A 4P4KC 3HG1B 1H3WM 5IW3A 4LLMA 2Y07L 4NRYB 4FFYH 4YDIL 4FG6C 4TUKL 4YUEH 1TNNA 5KOVC 4PJ8C 3C60B 4NKIH 1B4JH 1WFOA 5D7IE 1U8MA 4HKZB 1V3KA 4NHUA 4JPWH 4ODHL 5JLZA 1OM3L 4HUNB 4MD4B 5GGQL 2CK0L 4HUXA 5ACMA 4HWNA 1AXTL 1A7RH 3SY0A 2EIZA 4ZFFA 3DYOA 4R90H 4NQXB 3KPSD 3T0VA 1CU4H 1OARL 3HPJA 1XR8B 1CVSC 2JJWA 4JRYE 3OKKB 1SEQH 3KR3L 4OM1H 4Z0XA 3RBSA 3UTTD 4RFNB 1INDL 4WI9A 2VZOA 2HJFB 4H0IA 3P9MB 2AS5M 1K6QH 2R15A 5IROA 2DQUH 4NO5A 4XWOC 5FM4A 1YEHH 4NYLB 4H20H 4Y5YA 3KJ4B 2X4PA 3ZKSD 3QUYC 3VFNA 3G04B 4HPOL 2ZCHH 1WISA 5MHSE 5DMGD 1C16A 1RK0A 4XI5C 3GSWA 5D6DC 3IRPX 3ES6A 4LSQL 1MCHA 3EOAA 4NCC1 1SEBA 1T83C 2OTUA 2QTEA 3DVGA 4NNPL 4QTHB 4QRUB 1RMFH 3VFVB 4JZNA 3X3GH 3W5NA 3MNVB 1HSAA 4NO5B 1IT9L 1RJZA 2HFTA 1Z3GH 4Y2DC 1MLCA 4Z5RB 1JGLL 3VGEA 4R97B 2GYSA 3RY5A 1TJGH 1WV7T 1DVFB 3RZCC 4MS8C 4JCLA 3KYMA 4DKEH 1D6EB 4H1LA 4XPTL 5EULV 5BZWA 3FRPG 2DKMA 4YHNA 3BZEA 4X4XB 1AR1C 1ACYH 4MHHG 4WUKH 3HZMB 4GAJL 2JJUA 2YA1A 5DVMA 4CDGC 1OGAB 3DVGB 3QQ4B 4RGOL 3T77B 3TH4T 4QRUA 2OJZL 2I27N 1MNUL 5C0DA 2D9CA 2HTKC 1NCDH 4F9LA 2JK5B 3BXNB 1KN4L 3W0WD 4OB5L 1T03H 4JY6A 3QP3A 5EN2A 4L4VE 3RZCB 5KVEH 3RX7A 3TVMC 3HG1D 5ETUB 4ZSOA 4F80A 1FO0A 1XT5A 2J5LB 5C0CE 5EBWB 4PJHB 3BKJH 5A43C 1NC4D 1QACA 4WV1A 3U0PA 4KH2A 4TSAL 5F7NC 4FOMA 3T3PE 3MO1B 1IM9D 2WBJA 1NSNH 4G6FB 1RUAL 3BP7B 3U36B 1ITBB 3ARFB 3BDYH 2AEIT 1RZKL 3KYKL 4DKFH 3TCLB 2R2HB 4YPGB 5BV7L 1HI6A 3L5JA 4HAGA 2WQRA 1A7QH 3X11A 3WYRA 1F8TH 1Q0YH 5SWSB 3BVNB 5IVNA 1N7ML 3MGOA 4R3SA 1L7TL 2VDKL 4LSRL 4G8GE 2DJSA 5CEXB 3UTTE 4DVRH 3AFLA 4M4RA 3LKNB 5J12C 5ENWB 1EFXB 3KPQA 4NNYA 4UNTA 5JW4N 5FECA 4U33A 4TUOA 1F4WH 3E0GA 4XBEL 1OL0A 4YDLB 4ODWB 4LKCA 4Z7OF 1FVEA 3BAEH 4NUGH 3RUGA 4DTGH 4FABL 1S7RB 4L8DA 1NUDA 1CLYH 2HLAB 5D7SL 4HMDA 3SO5A 3VFSB 5CEYA 3QDHA 3H3PL 5IG7B 2EC9T 4S2SA 5CGYC 4OGYL 4CKVX 1KJMB 3AUVA 5FYKU 4JM4H 3AMLA 3FO1B 3VXRE 4K3JH 2EIBA 2H2PC 3H0TA 1A4KA 3VG9C 5ENWA 5EOCJ 2MOVA 2R23A 1MLBB 5B8CB 3KPQB 3AS2A 1RZGB 2WWMC 4I0PD 2SEBB 1CGVA 3QDJD 3TT1H 4BA8A 5ISZA 5BVPL 1AGEB 3PABA 3E6HA 3O6MH 1ZHNA 2DI7A 3JXAA 4GKZB 2DQFA 5GS1C 3C60C 3SKNB 2VE6A 4XBPB 1I8LA 3GB7A 3GKZA 3RL2B 1X3DA 4JDVA 3KPRE 4NZTL 4LNVA 2ZG1A 5FEBA 2H2SD 2ERJC 4EIZC 3NCFB 1HHGA 4LLDA 4M5ZH 3VH8G 1Y0LA 2XXMB 4KTEH 4M3JA 3OAZK 5T1MA 1S9WA 3DSFH 1JF6A 1P69B 3V5HB 2BJMH 4PUBH 5TDOA 1VKXA 5GHWL 4FFZH 2A9ML 2FZ3B 4HX1A 5JW3H 4C57C 3H7BA 4YXKL 5ISZD 4DGIL 2Q8BH 4NC1E 4PRPD 3QRFM 1CIDA 3F7RA 4PPTA 5MEQB 5JOFA 3TA3C 2GJ6B 3SE9H 3RL2A 2VABB 1KULA 3D3VB 4PJCE 5FM8A 3MLTA 4MA3B 2Z4QB 5I8CA 5EZOH 3BHBB 2QQLH 2ATPB 2VLJD 4PJAF 3RA7L 4UIMA 4OIBA 5DRZB 4YAQA 3CFEB 2X4SA 1TTGA 5FOJA 3MFGB 5IB4A 4KTDL 3C2AL 4M93C 4GRMB 4LBEB 5EIIA 4DW2H 4XMKH 5I1JL 5BZDB 4UUJB 4MJID 4F2MA 1S5HA 2C3GA 1WZ1H 2A2QT 1WZKA 5TQ0H 5JZ7C 1CXEA 3X14A 1ADQA 2JKXA 1RULH 4OZ4A 4R4FH 3GSOA 3DURB 5EG6C 2GJ6A 4GSDL 3O2VL 2WZPD 3VXOB 1LO5A 1XH3A 1MCQA 3QIUD 4XC1H 4RFOH 4DVBA 1JGVH 1ZA3B 1ZHBB 1K4CA 3P4MA 3T1WA 3TH2T 1EEQA 3O4LD 1HDMB 3KPLB 4E41E 4A2MA 1KTLB 4G8IB 4ZUSA 5IK3A 1KJ2A 3EKCA 3HRZA 4L3CA 2I5YH 1DBKH 3EYSH 4MNQE 5FK9B 5SWZE 5B4MD 2GCYB 5E1AB 5JMRA 3D25A 4WTZG 5LGJA 4BFBD 1LNUA 1WFUA 4J6RL 1RU9H 3AM8A 3TBSA 4A6YB 3BP4A 3UYRH 4JHWL 4XCEB 4CNIB 1EUTA 3VU2A 1YJDH 4ODTL 4P49A 3TVMB 1VERA 1IQWH 1CCZA 3QI9D 4U1IA 1IGMH 1EJOH 4TUJA 2EKSB 3WIFA 1ZANL 4Y4FB 3S5LG 4KI1A 4N90D 4NNXB 4NHCH 2DM7A 4FQLL 1RZ8B 3QZWB 1XZ0A 4PY7B 4EBQH 3O8XB 4LIQE 2VLLA 5EA0L 2H8PA 1D6VL 3MA9H 1QFOA 2FGZA 5FO9B 5HYIA 1YMHB 1P7QB 3FQXB 4OCLC 1IAMA 1PBYA 5JLZB 5I8EB 3I6LD 3NAAL 2K7PA 3DYPA 4LLQB 1BLNA 2IANB 4HJJL 5JOPD 1I8MA 3LCYA 3PE9A 3MYZA 3JWOL 4ODXB 3OTTA 4UOW1 4TUJB 4IS6B 2BSSB 4HH8A 2OQJA 3S6CA 3NFSL 4J23A 1ZLVH 3UTZA 1E6JH 2ADGA 3GSQB 3VRIB 2VAJA 3JV5A 5D6CA 1P2CB 2GHWB 2WM0A 5DQ9B 3DUSA 2NY4B 4MA8H 4X9HA 3HNTL 3ILQD 1I7UB 1X6LA 1E28B 1ZSDB 1WIOA 4PRHE 4R97C 4K9EC 4XCFL 1QLEH 2PO6D 1IAIL 4XPBH 1FN4B 3WJJC 5IT2L 1NGXB 5HSFA 1B6UA 3KGRA 1R3LA 4OLUH 4L4JA 4YXHL 1FJ1B 4ZFZA 4DUWA 3FOLB 3QPXL 5EUKB 4MMZC 4NQEE 2NY1C 2BNQE 3HC0A 1RK1B 4Z7NF 5GGUB 4P2RB 1UQSB 3DIFA 3GBNH 2UYLB 3TNMB 3QG7H 1DANU 5DQ9A 2YXFA 2VAAB 1WIUA 2P24B 2P45B 4HXAL 4LOUC 4IRJD 4JGJA 4HCRL 1E28A 4H0GA 1ZSDA 1DL7H 1S9VA 2KL6A 1DUZA 5E6ID 4N0UB 5I2IA 4JVWA 4I5BA 2YBRB 3LPWA 2IH3A 2ZPKH 3WFCH 4OM0L 1G9NL 5TFSL 1PKOA 2J4WL 1FZMA 3N85L 3V6OC 2VR4A 2DQGL 3H9SD 4OZHA 2NXZB 3ZDZF 4KK6C 1FO0H 3HCVA 4P2RA 3B2VL 3BZ4B 1G6RL 2AK1H 4ZXBD 2XWBB 3AB0C 5EU4A 1M1SA 4S1DD 4D9QD 3ULVF 4XPHL 2B5IB 3LRSB 4QTIH 3SGEH 4B50A 1IFHL 2Q8AH 1ZLSL 4IIQB 2GQHA 5K9JH 5ISZE 2PCPA 4KRNA 1QR1A 4P2YA 3K3QA 4U7MA 5IQ9A 1T1XB 4LLYB 3FQRB 3LS5L 3WUWB 5EFIA 4IDJL 5B39A 5CEZL 1LEIA 3VXSD 1NCTA 5IB2A 4JQIH 4PJEE 2YPLA 5E4EC 3NZHH 3MLVL 5D4QA 3IDIA 5J3HD 5IHLB 2APFA 3JWNC 3BKMH 4Q6IA 4UILL 1MCJA 4K9EL 4LVNC 7FABH 4PRNA 3EO9H 1CLCA 1MCOH 4JZJC 4ACPA 3U0TA 1UM6L 2R9HD 1PYWA 1YN6B 3DXAE 3EO1B 1X5ZA 4TSCH 2C1PA 4J3WA 4YGVB 1FSKB 1NKOA 3NIDF 5D5ME 2R1WA 3ARGA 3LN5A 1UA6L 2QSTA 2GW5A 1DVFC 1BFSA 4NJAH 1J0IA 5B39B 5B8CC 1LEIB 2A38A 5L88H 2ZUWA 5I0DA 4TTDD 4PTTA 2D7TL 3MSPA 1UZ8B 2APBA 5L0QB 5JHDE 5DVNA 5MERB 4CMMA 2ZG3A 4DAGH 1NCWH 4JRXB 1N6QL 4Z7VA 1IGCH 2FBJL 1RUPL 1WEJL 3MRLA 1T89C 5HY9A 2XN9A 2OL3A 1EBPA 2XKSA 3DV4B 4J1UA 2B1AH 4EKXA 4K07A 1RUQL 3KPPB 3PWNB 3I75B 4YC2B 5ID1B 1K8DA 5K33A 1JF1A 5JA9A 2H3NB 2PKDA 1G7IA 4XZUA 3DROA 2J8UF 3GSXB 4KK5D 2P8MA 3RVVD 1ZGLM 2C26A 2OXGA 5FM5M 1U92A 3I6GB 4LP4A 1CG9B 2R29H 1ZE3C 1BIHA 1NFDA 4GKNB 3MLSH 3LQAH 2QKIB 4S1DC 3NCJH 4MB3A 4I3RL 4U1LA 1JNJA 1VGKA 4NJ9L 2XN9B 2ZUUA 3ETBF 3IF1B 3JWDL 1X5FA 3LHPH 2EE9A 4WU5B 4NOBA 3RWGA 4BZ2L 3IYLW 4BELD 3KLSA 5F8RC 1NGPH 4LSPH 3EW3B 4K71B 2O61A 4Z6AT 5IHUL 2L0DA 3GSXA 4RISH 1W8OA 3FB7B 2E9IA 1T0NA 1FORH 4TOYH 1IEAA 4MXVE 1KJ2H 3V5HA 1FL3A 4L5FL 3JWDC 1EFQA 2IADB 4P9HL 5EB9A 5F7EL 3CVHH 3PWPA 1CL7L 2BVOA 3MRKB 3TO4C 5IQ7L 5GZNC 2HTLD 4EDWH 1DQQB 5DC9B 3ARDB 5DD5L 3ZO0A 4O2FA 1BFOB 5D93B 5EO1A 4YO0B 3ZL4L 2X1XR 4LGPB 5EBMA 5EU5A 5TH2B 5MENB 3MREB 4WHTB 2ATPA 4JFFE 2GJZA 4JFYB 1DSFH 1Z5LB 3MMEB 2Z31C 4HF5L 3VD9A 5CINL 5D71H 3IFPB 5BV7B 1NUFA 5BS0A 1WTGT 4XTRC 3I3EA 2W9EL 1WBXA 2QQNH 1AD9B 3AXLA 3QJHB 4UUJA 1YYLH 1ZEAH 1A1NA 2G60H 2Z31D 4WI7A 3BEVB 5C09D 3V6ZA 5H37H 4PGDB 1GXEA 2IEPA 5D7JC 1Q9KA 5EUOF 1U3HB 1UKTA 1I1AA 4WGVB 4YO0A 1OSZB 3N1PC 4PD4J 1C7TA 3MRQA 4F7CB 4YX2H 1K4CB 1GGTA 3HC4H 1V8HA 5DUML 3RRQA 5EU3B 5I75B 4LSUL 3DBXA 2DKSA 1G9EA 1WBXB 1FFNA 3T3MF 2DI9A 1RY7B 5HYQA 2V6HA 4V1DB 3SCMD 3LD8B 4O2CA 1I9IH 1QBMH 5FFLA 2RCSL 2WWKT 4MVBC 1D5IL 2P5WD 4WWKC 3FT2A 3VXRA 1IEBA 4JN2A 3LKOB 2W0LA 4D8PA 1UACL 1CLZL 1WZLA 4JPIB 3GNMH 1XZ0B 4PY7A 5CBEB 3I2CH 1P4IL 1WCQA 4XRCA 4HKBA 1BQHB 4N8CL 2NY3C 3GMLA 1RD6A 3CC5A 5J06A 1IVLA 3VXSE 4ZS7H 1VFUA 2A6KB 5KAQF 4F3FA 4ZFGH 4HD9A 3MYJA 5J1AB 1CDIA 3C5ZA 1OAQL 1P4BL 5F71A 2WP3O 1P7QD 3KPMB 4GMSH 4GKOA 1I9JH 4NQUA 4I3GA 5J11C 3X3FH 5C6WH 3H9HB 3MA7B 5KN5B 4XP6L 3GUTA 4D0BB 1LDPH 4U7KA 3IFNH 4ODSH 5DEGA 3E2HC 1KXQE 1RZFL 4PJ7E 3QUKB 1N8ZB 1J8HE 1BOYA 2G75A 2DJUA 4NZJA 5T5FH 5L6YH 3QUXA 1HNFA 3TBWA 3BZFB 3CMOL 1KN2L 4M43H 1U8PB 1PG7L 1CGWA 4ODBD 1FH5H 3THML 1MCSA 3KPMA 3SN6N 3R1GH 1EFXD 5KTEL 4JFXA 3CU7A 3RGVA 4MSWB 1YEGH 4LCCC 2RFXA 3GM8A 4UTBL 3QWQB 1ERNA 5TF1H 2W92A 1B0RA 5FDWB 4F7MB 4XHJD 1SMOA 3GMPB 4HWBH 5CILH 3RNKB 3VW3L 4HUKB 2VLME 3VI3E 3VXPA 3S34L 1KPRA 4Q9RH 5E99H 1J05B 1TTFA 3BP7A 5DI8B 4ZTPH 3TZVB 3DHMA 3LMJH 5IW1B 4PJGB 4MJ5A 1F6AB 4TTGA 4U1NA 1BAFH 3WXVL 8FABA 1VACA 4OT1L 1MSPA 1OTSD 2H45A 5C3TA 3RGVB 4WFFD 2NY5H 1N6VA 3RTQB 4NM8L 4S1QH 3BPOC 5EBLA 1IGJA 1DQMH 4XP5H 5SWZA 1B2WL 5A1AA 2G9HB 4M4PA 3TA3A 4FQJL 4E5XA 3HUJE 1H8SA 1EEUA 2G5BA 3A6BH 1JVKA 3VXTA 1X5GA 3CX5K 4ZYKA 2MKLC 2EEAA 4Y4HC 5HYJD 2HT3C 1IC7H 3TN0C 1P5UA 2OZ4H 3QHFH 1FRGH 4G8GA 4U1MB 3MV9E 4HK3J 1XMWA 4Y0GA 2HMIC 5FHAH 5C0AB 2HLAA 4OTXL 4FQCL 5GISL 4I8DA 4LVOC 5FYLL 1ORQB 3FAWA 2PXYC 3EOBB 5C0FA 1OVZA 5KJRL 3STZA 4M1CD 1LK3L 5SV3A 4PJAB 5L8KB 4HIIA 3KXFA 4M8VA 3OR7A 3HS0B 3A6OA 4WENB 1IL1A 1X5XA 4XWGL 3S4SG 1I9RL 12E8L 2EDBA 4U49A 5DMYA 1JHLL 4OSUH 3VXQA 1BBDL 1QYGH 5IB5A 5ILTL 2OK0H 4NRZA 4KK9C 1OOAA 4HZAA 1OW0A 5SWZD 2IMMA 1NANI 1K2DA 4NC2B 1IAOB 3S4SA 5GRJL 1HHGB 1AXIB 5ICXB 2B0SL 3RBGA 1ZS8B 2YUVA 4NP4H 5FCSH 1ORSA 3QDME 4XMLH 4IRJA 1UEMA 1MPAH 1S78D 5JHLL 4LF3B 4PFEA 4YBQC 5LCVH 5C8JB 4DN4L 5JOFB 1QNZL 3DMMC 3NIGF 1L0XA 4OJFH 4P99A 3EJYD 4OD3L 3TZVD 4KGLA 4XX1E 3TV3H 4JY6B 4NM4L 4MA3A 3FMGL 4X6EB 3CSBA 3CXHK 4HGWA 1VFBA 1AGBA 4M6NL 1BVLB 4M6OH 3D18A 1EEYB 4PGBB 2B2XL 1NBYB 3TIEA 4U1LB 1ZS8A 1G9MC 3C87A 5ESVA 5LQBH 4WIQA 4KRPC 3B4NA 4QRPD 4ERSL 5JPNA 2IQ9L 3LPFA 5H35B 2XN9D 3AMKA 3OQ3B 5LJYH 5IWLA 3OJ2C 3RY6C 3GSRB 2P49B 4FP8H 4QXTA 3AY4C 3H6JA 3HC3H 5D1QA 3MLXL 2XQYK 2HJLA 1AHWA 4KUCF 1SVCP 5HGAB 4DGYH 5GPRA 1OQOA 3BT2L 4HT1L 4HAFA 2A0LD 4ZPVB 4L8CB 2R4SL 4G6ML 3ZDYF 4LLMB 4LDOB 4M61B 4QYOA 5M94B 2KZ1B 4LCCA 2V2XB 3IU3A 1MVUA 5EO1B 1IM9B 5BRZB 4L8BA 3CDYA 4PS4H 3O6LH 3EGSB 2GK0B 5TH2A 1U9KA 4R0LC 5IIEA 2L4OA 5MENA 5F89B 1KENH 4G7VL 5LKNA 1Z5LA 2DDQL 5KVGL 1P4LA 2CLVA 2XG4A 4ZMAT 5JO5B 1EX0A 4U1IB 1ZVYA 3H2WA 4Q74A 4UV4H 3S3SA 5AD0B 2EIZB 4ZFFB 1BIIA 2BRRL 4D3CL 2PUQT 1E4WL 1T4KB 5J9PA 4OZGF 4L8CA 1E4JA 2PXYB 3VXMB 5GGVY 5EORH 3QUMH 1DFBH 2AV1B 1UJTA 3UCRA 5C0GA 1GOHA 3OG6B 4N0YH 2YXMA 1JJUA 3ZMRA 4GBXC 4YHPA 4NO0D 4HS6A 4AH2B 3RWDA 1T0MB 1AGDA 3HI6L 2KH2B 4TN9A 1VGEL 1BF8A 2DQDL 2Z92A 3HKFA 4QY8A 35C8H 3DLQR 2D0FA 1F3DH 3FTGA 2G2RB 3PWPE 2YK1H 1YUHB 4X6BA 4P3CL 4QTHA 2XFXB 3VRIA 3MJGX 4WI3A 2HKFL 3JZ7A 2NY6D 5HD8C 2X4UB 3ALXA 3LZFL 3K2UH 3VFRB 3LN9A 5DEZA 5GRVK 4WJ5B 1IGTB 1I1YB 4MQTB 4XPAL 5DMGC 3MV7D 4HFUL 1WWWX 1X4ZA 4ZOCA 1HINL 4L4TA 4LEOB 5DJ2A 4OZFG 2EDQA 4X5XB 3QIBC 3BMVA 4NQDA 3MRRB 2XQBH 4KKAC 4PLJD 3RIFF 1NDMB 3NN8A 4J3OC 4PJAE 1AQKL 4ZTOL 1N59B 2D7MA 1N5YL 4G80A 1ZGLA 1OGAE 1U58B 5EUKA 1O7SA 2Z4QA 1TQCC 4GW4A 4O4YL 3BHBA 3HC0B 2Q76A 1LQSR 4Z0XB 5LBSL 2C3HA 1MJJA 5KSVB 5DEFA 5C0DB 4NWUH 1A4JB 5C2BH 1HILB 2XZCH 4YDVA 2QQKH 3WNKA 3L1OL 2PR4H 2VISA 2WINA 3M1BA 4OCRL 4V2BA 3GMMB 2BNQA 3EBAA 1OAYL 1NPUA 5GRXG 4EQ3A 1R5IB 4PJBA 5FGSA 4M7LT 4P23B 4W6YB 5C6TH 4O2EA 1MRDH 4GG6E 4RA0C 4RQQB 4U1HA 5KZCB 2FX8L 1N59A 4IMKA 4WV1B 1FZMB 5FA4B 3NA4A 1I7RA 3EOAB 4LLWB 3PWUA 4BYHA 5IR1B 1CGXA 3MLPA 1PSKH 3WDHA 5LGHH 2NY4D 3UO1L 3D2UA 4LDLB 3WNPA 3UPRA 2HWZH 2DYPB 5HHVH 2R2BB 5LAXB 3BMWA 4L3EA 1T1WB 4MX7A 4OAWB 3B5GA 2IALA 2VUYA 1JRHL 3FN0H 4ZXBC 5D7IA 3U46B 3GIZL 2IBBA 4TRPL 3U7YL 1AXSB 4CVZB 1DE4B 5KVDL 3C6LC 1ULVA 3ARBD 3HE6D 5AAMA 3EZJB 5F44A 4YIQA 1J1XL 4U1HB 3WUWA 5ID0B 3GK8H 3K4ZA 4YHLL 2RQ8A 3DGGB 1EUUA 3C5SB 4R7NA 3QIBA 2HP4A 3O8XC 4G6AC 2Q87A 4DZ8A 3FAXA 3SO3B 3WJJA 3VRLE 1SBSH 2DQCL 2PW1B 4XVSH 2CDEB 1RSFA 1MCNA 4P4KA 1VADB 3Q2CA 4PJ5D 3LKQB 1RHHB 4RFEA 4HXBH 3MGTA 1QVOB 3U46A 4Z9KB 2DQEL 1TENA 2BNRE 1B0GB 1P7QA 3P73B 3DRQB 2XRAL 1AIFB 1A3LH 3Q3GA 2AKRA 1NAKL 3IFOB 2V7HB 4WEBH 4YNYA 2I26N 5E9DB 5DF0A 2LU3A 4M7LL 4HHAB 3MLZH 2SEBA 1IC4H 2B4CC 4G8GB 2Z31A 2EE2A 5CKAA 4GQ9L 3TCLA 2UWEE 4KVCH 2UUDH 3LKQA 1T21A 3SGEI 2APXA 1XGRB 2ZSWA 3BKCL 3JTSA 5MI0B 1I7UA 3FO9B 3SE3C 1YEKL 3OSKA 4R4NC 4P5TA 2Q3AA 1WLHA 1UZ6E 4ZD3L 3V6FB 4XZUB 2FO1A 4GRLD 3Q3GB 4PJFA 4QEGA 4JO2L 4HIIB 4TSBH 5EZJB 2F53D 3SDXE 2LVCA 5TPWH 2X09A 2XTJD 5GS2D 5D96B 2EDRA 3H7LA 3ULVE 4KJQD 1UQSA 3MUZ1 2P5EB 1FNEB 4M1GL 2BOCA 2VLJB 4QHNB 4ZUVB 5MP6L 3P77A 2JCCF 3IF1A 1F6FB 5I30L 3NIFE 3ZE2F 4L4VB 3BPCB 5FYLD 3CSGA 1QBBA 4FQ2H 4JRXD 1JYVA 5F6IC 1UWEL 1VENA 1IAOA 5JA8B 1A02N 5I1IH 1H3VA 4RWHA 4K3GA 4YBLC 1U6AH 3SPVA 3WLWD 4LVHB 1FGNL 1YNLH 3HB3D 2M26A 2MJWA 4ZSOE 1PKQE 15C8L 5K9QI 4G6KL 5FUCE 3CX2A 4Y5VC 5GQBA 4X98B 2VDOL 4GRWF 5I16B 4OIAA 4AT6A 2ITDA 5F9JA 4JFEB 1FL6A 2AV7B 3I85A 4OZ4B 3V7AG 3HB3C 2DQFB 2YUXA 4M02A 1YEFL 4HIJB 5DMJB 2RBLA 3HR5B 1EHAA 1FQ9C 1P7HL 5IB3A 4WDIB 1S7VB 2EE3A 5BOPA 2VXTL 3MLYL 4J3SA 4OKVA 5GGVH 1JV5B 5GJTL 2FBOJ 1F4AA 1YEEL 1IQDA 1U93B 1IZKA 1W0WA 4NGHL 1MELA 1IE5A 1HWHB 4OF3A 3SHSA 4EN3C 1ZA6B 4YEFA 4BUHA 2XY1A 3OR6A 2R2EA 4X8JB 5EC2B 3DO7B 4PRNB 1XGYH 1KB5L 5DJCB 4WI5A 4ENEC 3WLBA 5E6IC 1MHHB 5DYOB 2BVUA 2ZSVA 3D85A 1IGYA 1L7IL 3FQNB 2R0LL 5CD3B 5IBUB 3RVVC 3NFNA 4KK9D 5CS7A 3REWA 4S1RL 3PL6D 1QHPA 1J10A 3KPSB 4U6VH 2QR0A 4PGZA 4PB9L 4HG4K 5IF0A 1IGFL 1R3KA 5EIIB 2O5YL 4KJWC 1G7MA 1FP5A 1Z9SA 2KKQA 1T0PB 2NW2A 3LSOB 4K3DH 4KRLB 4RSVA 4Z95H 3OAYH 5JR1H 4PJXE 1MHPH 1UZ8A 4P2QE 4HG4J 2IQAA 2QBWA 4KJYA 1FLRL 5DJ6B 1BLNB 4OQTA 2BCKB 3ARFC 3KS0J 3IJSB 4KZDH 4FQQA 5HYJB 3MACL 5GXBB 5I1EH 2B4CH 4HH9B 3DX9A 2DQJL 1CN4A 2X4RB 5J9PB 2I9LA 1I85A 4C4KO 3GJFB 1MAKA 3W2DH 4AEHL 1ND0A 2YRZA 1YMMD 3V4UL 3DUSB 4L8SB 4HKBB 1ZTXL 4GW5A 5E2UH 4X7SL 1VA9A 5E94B 2NY2C 3VGAB 4L29B 4G6JL 4NO0B 4UT7H 3O8XD 1P84J 1PFCA 4KJYB 4MD4A 4YHKH 4XCEA 1LP9A 4CNIA 4X5LA 4PJ9B 1HIMH 3RWDB 5JXEC 4OLYL 3T2NL 5K9KB 3SDYL 5FV1L 3Q6GL 3BW9B 5IW6B 3NCYP 5I15L 5T1LD 2E5EA 2AK4E 2IAND 5IBTL 2QJDA 4UIKH 4F7EB 5GGUA 1TJHL 4LCWE 5CMAA 1CYGA 1MCPL 3QHTC 1JGUH 4NQDE 3DI3B 1FZOB 3O8XA 1J0YA 2FIKB 2GJJA 4MXVF 2XI9A 3QNXB 4AQOA 3VMPA 3WN5C 1UM4H 4WJ5A 2XA8L 2H1PH 5DK0A 3UZQA 4WUUD 4E0RA 1O0VA 5FGBA 1ZLWH 1IAKB 1J86A 2A83B 3WO4B 5I8OL 3DARA 3KHOA 5GGSA 1DEDA 1CZ8H 1DQQA 1JUFA 3INUH 1T5XA 1JFQH 4QRRE 2OQJB 2XT1B 4PREB 2CDGB 3L3JB 3CZJA 3G6JB 3PQYA 1X7QB 4M5YL 4QNPE 3TIDA 4NHUB 1TTUA 3ELAT 4OCMC 1C08B 4AL8H 3IT8D 3BJ91 3M8OH 3QNZA 5KW9H 1KPRB 3FCTA 1CGSL 1WITA 5EZIL 1AFVL 3OB0H 1BBJB 4M93B 3VI4E 3DUUA 5D7JB 4GLRI 5I1HL 4YDLC 1Z6JT 3FONA 5ECJE 5EUOE 3OJDA 1KTDB 4K7PX 1QR1B 4XXCA 4RMRA 2WBKA 3MR9A 1NEZA 4XB7A 5C70A 4PG9B 2XKNB 3CLFH 4IRZH 4ZFZB 2CJUH 5F96L 1WWBX 4MA1B 5CSZB 3PQYE 1F4HA 2I07A 1ZT7A 4KI5C 2J2ZA 4FFYL 2NW3B 4XCCL 4WNQB 4FXKB 5BW7A 3ARZA 3SO3C 5F1IA 4LQFH 2G9HA 2LV4A 4YUEL 1QFUL 1INQB 4PD4K 2LU4A 2PNDA 4NZUH 4N9GB 4OFVA 2ATKA 4RAUB 3VD4A 1EZVY 3ES6B 5CSBA 5GGQH 2BY2A 2VLKE 1GYAA 5BMFL 2ZJSH 1JTTA 2HKHL 1UCBL 4KUCD 4X6FB 5GGTL 2X89A 3AVEA 5HHOB 5AG8A 4HGMA 4M9PA 2R56H 1BGXH 4UTAL 2P8PA 4R90L 3GBMH 4OLVH 1CU4L 3D87B 3MUY1 2LU7A 1GGIH 4OCSH 1J0KA 4Z5RA 5IP4A 1AHWC 1WIPA 5F3HA 2Y1VA 3ME0A 4UDTA 4WNQA 1K6QL 4OGXL 5CJBA 3EOBA 1KBGH 1R5WA 2JIXB 5C0FB 3GSVB 1K3IA 5D72H 5FUOL 4AG4H 3NGBC 4XNXL 2XXCB 1QTYT 2AK4D 3GHEL 3PGCB 1HI6B 1NLDL 1RZKC 1OSPH 4O5LH 5K59F 1GL4B 1CDCA 2J5LC 2QSQA 2UY7A 4MLIA 3MGTB 3AC0A 3L3KA 3IXTB 4PRDB 2BHZA 4JKLA 1DQDL 5IVXE 4KU1A 3FO2A 2HVJB 1HXMB 2QSCL 4NQEA 1OCWH 1OPGH 1S9XB 4MA7L 2FB4L 2AJVL 3GKWL 4IOIA 4NN7B 5E2VL 1J8KA 3IVKA 4JFEE 3ZE2E 2V7HA 4JANA 1GZQB 3H42H 3VFTB 3SDCB 1MI5E 1ED3A 3K0WA 4J12A 3BD3A 3DNKA 3F62A 2FX9H 4NIKB 3EYUH 5CZXC 3S5LA 1Q8MA 5CEYB 3BYTA 2VXVL 3ZKNC 5SWQB 3U9PH 4GRWE 4YXLL 1OTSC 4OFYA 4CVUA 3RWFA 3BN9C 5D5MA 1U3ZA 2DLFL 3R0NA 3FO1A 1P6AB 4GAJH 4EEEA 2APTA 1CFVL 2RIKA 3B9KA 2R2HA 2CDFB 4OZHE 3VWKD 4Z78B 1HHKA 4WTZA 3IKKA 3ORJA 4ONGH 2GTZB 2AQ1A 1FNFA 4DQOH 4JFHE 1NC2D 4EDXA 5JTWA 4Q2ZB 4JHAH 5DFTA 2BVOB 3KPNA 4KKCC 3ZDZE 4DFHA 5HPMB 4Z7VB 1QO3A 2AJUH 4Q0XH 1Q9WB 5F7YC 5C86A 1FFQA 1BVKA 3E3QE 5DZLA 4PJDB 3FB6A 3PG2A 4MAUL 1PEZA 5E95B 3STLB 4EUPB 1FPTH 1PY9A 3SE3A 1RUMH 4KK6D 4G8FB 4IJ3B 3ZTNL 5A2LH 5E0QA 1RUAH 4FTVA 2XZAH 1E4XH 2GY5A 3MV8A 5GZND 3WFHA 1G6RB 5T5NF 4OV5A 1CLOL 5D2LA 2F5BH 3WFEH 5MEQA 2CRZA 1XF5A 3N1MC 1WTLA 2VLKA 1A2YA 4E5XB 2ZCKH 3VI3F 5GJSL 4F15B 5AYUL 3I9GL 4GG6A 3CUPA 3NACL 4LSRH 1TCRA 2GAZB 4LCIH 5FCUH 3UDWC 5I8CB 2OXHA 2JLLA 5IIEB 2VZ1A 2H9GB 3ARBA 1A6TA 4LLUB 1KC5H 1U8IB 2CPCA 3BEWA 5HDQH 5HGHB 2B39A 4XBEH 2PYEE 2R4RL 1NKRA 1CGUA 1HHHB 4UBDD 5FB8B 1U93A 3MRGA 1NDGA 4OBSA 3BN9D 4UQ2B 3EFDH 1CFTA 2FO4B 4JRXE 4MB4A 3T0EE 4OQTL 3MXVL 3FT4B 3S7GA 2CKBL 3AREC 4I3SL 1A14L 1MIEH 1VFOA 4TTDC 2IH1B 4YHZH 1PJ9A 3GI9H 4MDJA 5ITBL 5C08E 5CJQL 3CGTA 3HMXH 3FQUB 3SQOH 2ARJQ 3O6ML 4WWKD 1FYTE 5FKAA 3S97C 3ULSB 4RGMC 5T3ZD 3MRGB 4F37F 3QUYD 5F7FA 5IFHL 3BP4B 4FHBD 3BEVA 1A6AA 2AVGA 4FNLH 4P59L 5D1XB 1IKFH 3UTTB 1F6LL 1DJSA 1UEYA 3LEVL 2DD8H 3QT2A 4JEGB 4PJGF 1J0JA 2JJVA 3AGVA 3IDYC 4NQCE 1BOGB 3QDGB 4R26L 3DOSA 3VFNB 5DJ2B 4J4PC 3OKOB 4PJ7A 3QUKA 2P8LA 4D9RE 4HIXH 2PW2B 5E2TL 1BFVL 3FQUA 1G7QA 3BWAB 1RJLB 2H8PB 4PJHE 4X99B 1A6WH 1AJ7H 2YA2A 3U7AA 2VDPH 4P46C 2YWZA 2C3XA 4UV7L 1E6OL 6FABH 3DMMA 4FZ8H 4XTRD 1NBYA 2OMBA 1KTLA 1KJ2B 3HRZB 4L3CB 1EAPB 4XVUD 3O4OC 2JB5L 4LAQL 3U30B 4N0CC 1QFWM 3P11L 5HHNB 1W72L 4UQ3A 1U2CA 2NY6B 5DJDA 1BEYH 1G7HA 2E7LC 1I4FB 1PX4A 4CU6A 2VSDA 1JWMB 1DLFH 1MCKA 1H5BB 4OLEA 3OXRA 5A16B 4DW2L 4K2UL 5T3ZL 1FZOA 1QBAA 3EYQC 2FEDD 1CTOA 4JM2D 1T83A 3EOYG 1WZ1L 5ICZB 4GG8A 2EKSA 1CQYA 2IGFL 3GM0A 2X05A 5IW1A 3PNWA 2W60B 2DYPA 2FLRT 4POZD 2RB8A 5IVZB 3C5ZB 2AJXH 4Y19D 4FN0A 4TULH 3IU3B 5KSAB 1V7NH 1CDHA 1MAMH 3ZSSA 3EGSA 1I3RA 2GK0A 2Y72A 3EYSL 3S96A 2L7UA 2JJTA 4Q9QH 4DKAA 5EBWA 4GG6F 4M7ZC 2AXFB 1BFTA 4XNZC 1CBVL 2QL1A 5I74B 4ORGA 2G5BB 2DM3A 3QHZL 1UB6B 3C09B 5E9DE 4X9GA 3UYRL 1G7JB 2YMXL 1X4XA 1YJDL 3GMNB 1IAIM 1IGML 2ADGB 5CP7B 4HLJA 2FNBA 4K94L 4QHUB 4JJHA 5IEKA 2B1HL 1S7UB 1VADA 2CXKA 2EYTB 4XPGL 1DBMH 4S0SD 4LPCA 5IVXF 1FAKT 4MNQB 4XBGB 4JQVA 4DOHB 4ZO7A 5F1IB 2WK2A 3L3IB 1ZWIA 4JAMA 2VR5A 5FA3A 3LEYH 5TE6H 3ZTJH 1I7ZA 1H15B 4XNQB 4URTB 4HBCH 3HI5H 5E8EB 2HN7B 5JIHA 2YSSA 2I25N 2DL9A 5GRUH 2A77L 2V9RA 2AXJA 4IMKC 3D48R 5FYJU 1SJHA 2VAAA 1S7UA 2P43B 3NFSH 5C0EB 4KVNH 2GK2A 4K23L 1H3UA 4JE4B 5CUSH 5HJ3B 1FCCA 5IB2B 4WWKA 3EDFA 3ZKXC 3T0ED 1ADQH 1MIMH 4XBGA 4LVEA 1K8IB 1JZ3A 2IBZY 3RPKA 1A4KB 4RWYL 4D9LL 1NDMA 4JREB 2EDTA 5DDHB 3L3KB 4Y88A 1W72A 3IKCB 4XPBL 2C1PB 5DT1L 5SX4H 5DJYA 4KZEL 5IT2H 5E8EA 2QEJA 3DVIA 4N0UE 5I9QC 1T20B 2Y6SD 3BZ4A 3PABB 4UDUA 4OLUL 3O0RH 4YHYB 3VD3A 3LIZH 2E9WA 1CT8B 1YJDC 3KS0H 5D93C 4YDVB 2WQ8A 3OPZH 4H8WL 3MRPB 3JV4A 1MJ8L 4OCWL 1CD1B 3EOTL 1JZ8A 3KXFB 3V5DA 3TJEL 2AJYH 5IFJA 3VA6A 1U8NA 4OUUA 5D8JH 3WFCL 5IR1A 5SWQA 3S35H 4IOSD 25C8L 2EZ0C 5HBBA 1KG0A 3EYOA 5JPMB 3VFUB 2OLDA 3N85H 4MWFB 4YHIB 2C3VB 3NCEB 3O3AB 2IJ0C 3HE7A 5JQ6L 1HHKB 1FO0L 2HJLB 3MRCA 1PG7X 3IXAB 2ADIB 2A6JB 5IJVB 2VDLH 1EJ6A 3U4EA 2BOBB 1GGBH 4ZSOB 4GKNA 3B9KD 4KKBD 4QGTA 2HG5A 1K2DB 3JV4B 5IESH 2E9JA 1QRNB 5HHME 3UMTA 4GAGL 2GITA 4GUPB 5I66B 1A7PH 2V2XA 2Q8AL 4Y4KB 1FNSL 5I73B 3VG0L 1F13A 1JHKH 5C07D 3CFCL 5C0RH 2OTPA 3MUGA 3RVUC 4KI5E 2CLVB 5F88B 3MLVH 1FNGB 2J8OA 2WIMA 3ULVL 2FATH 3WN5A 3WFHB 2F8OA 3L5IA 5SWSA 3V7AE 2IADA 1UT9A 5E7FA 2EH7L 3BIAX 4S10A 3P4OA 5MEOB 3U4AA 4M1DL 1EO8H 1MI5D 3ARWA 3KPLA 1X5JA 4HLZG 4U3XA 5A3IC 3MRFB 3ZE0F 3RWJB 4U2YA 2W65B 1R3IL 4YHMH 1ZHKB 2IPTL 3AREB 4P57A 5DSCA 2XWTB 4HWEL 4QLRA 4WW1A 1NMAH 2Q86B 3I84A 1UA6H 3B3IB 3MREA 1F11B 4ALAH 4BSJA 4PRPA 3MUGB 5DHYB 4TUOB 3QEHA 3MQIA 4ETQA 4NJAL 3LEXA 4Y1AB 4UU9B 1P53A 2XNAB 3OKDA 1CXFA 1A6ZA 4YK4C 2HLFD 3EIFA 5L9DL 5BRZE 4KHTH 4JRWA 4Y8AA 4NN6C 4PRAA 2I9LB 1KJMA 3BE1L 4FZEL 4H0HB 4JLRB 3RI5K 4YGAB 2D4FA 2X2YA 3ARGC 4M61A 4QYOB 5EOCH 5HHOE 4BH7B 3HAEA 1S78C 5DURB 3MBEC 5CZVH 2DTMH 1MLBA 3MV9B 1FE8L 1I1AB 3P0YH 4LEXH 5B8CA 1OAKH 1JGEB 4UB0L 4ZFOL 1A7BA 1YMHA 4OZGB 1TETL 1KEML 5CHNA 1L6ZA 1KPUA 3D0LA 4P4RB 3OKNA 1NCCL 4Z7UA 3C6SB 1HH9B 2R29L 4C56A 4LSDA 2HH0L 1OF2B 4GH7B 2H6PB 3OWEA 1SQ2N 3V52L 4U31A 1T4KA 1G0YR 4Z76B 4MLSA 4HJGA 4I0KA 2QADC 2OP4L 3TT3L 3I6KA 4P46B 2GFBB 3UYPA 3MLRL 5TGBB 3IGAA 5F7HA 5CD5D 3PQYD 1URLA 1A4JA 3QNXA 1VHPA 4JPKH 3F8UB 3OAUH 2LVEA 5DD3H 4FMKA 4HUUA 3QQ9D 3FHAA 3O6FD 4Q9BA 3A67L 5T1DL 1GH7A 1HH6B 1KJ2L 2UWEB 1M7XA 5GSRB 2V9QA 4L4TD 3T2OA 1JUFB 4YE4L 1ZV5A 3M17B 1NMBL 1AY1H 1NCAH 4N9OB 4LLWA 3HR5A 2MPAL 3VFWA 2XICA 2A6KA 5TQ2H 5DD5H 3C08H 4UIMB 4YAQB 5DRZA 1T2QH 4NWTL 1WCBA 3REVA 2IPUK 4WW2B 2CLZB 1BBJA 1S5IH 4KKLC 1UKQA 5HDOA 1S5HB 1IQDB 3WMSA 1F4YL 3BWUC 4WUUE 4RGNC 2YBRA 2NY4C 1MFBL 3QUZA 3MR9B 4HJ0D 3N9GH 1KJVB 3DURA 3S36H 5ID0A 2FRGP 2HT2C 1PLGH 1K5NA 2HTKD 3QQ3B 5H8DA 2R69L 3BISA 3DGGA 3KYAA 4YWGH 1CF8H 1GVIA 3QEQB 1JZ4A 2FEEL 4U6TA 2DQUL 1N5AA 4JFQB 1PW3A 4UINL 5CJOL 2J88L 3HG1A 4H25B 5MENE 5GIRA 2J12B 4MNHB 4LIQL 5C0CB 1F2XK 2F53A 3TFKD 1FNHA 4JG0H 3C60D 1F42A 3QXUA 2QADD 2VZUA 3HC4L 5LGJB 3PWJB 3VCLA 4FQXA 1SM3L 1DUYA 3IJYB 3O2DA 4LSUH 1B0GA 1B0RB 3WXWL 5F9DC 3VJ6A 2UZYB 3GMPA 1V05A 2H2SC 5J1AA 1TVBA 4LSQH 2AW2A 1MFEL 1TPXC 4LCWA 5TF0A 1LK2B 1J1OL 1UB6A 1A3RL 1PKQA 1I9IL 1QBML 3WIFB 1JYXA 1JGDB 2YD9A 3FQWA 5F3HB 4YQXH 4CL7A 4XB8A 3S88H 4QCIB 5T1KB 3IDMA 4LKCB 1BX2A 1KV3A 4H25A 1DEEB 4WRLA 1I1FB 2OTWB 3P9MA 3PUCA 3G5XB 4Y2OA 3BH9A 4CW1A 2DBLL 3QDGE 2PYEB 3MRDA 4FQXB 4P2OD 4ZNEA 4JFDB 3RTQA 2NXYC 3BOVA 1FC1A 3ROOB 3HE7C 5FO7B 2R9HC 4N8CH 3BZFA 2BRQA 3F58L 1S7TA 2V2WB 2R1WB 5CZKA 4IOIB 3Q5OA 3IVKB 4LARL 1YPZA 5D70L 5E1HB 2LAAA 3Q1SH 4JANB 4JFPA 5AUMA 4D9RD 4ZFGL 5IOPA 3LDBC 1Q94A 2JCCA 1JWSA 4BQCA 1NCDL 2A73A 4ZS6C 3OKLB 2OMNA 4RZCA 4U1MA 2YPVH 3OX8B 4QRSA 4JVPA 5KVEL 5AZEH 1HK6A 3F7PC 3QFJB 5IBLD 4UBDC 2V5SA 3NOIA 3U1SH 3RU8L 3ALWA 4ZFOA 5JIIA 2IAMB 1YQVH 1JF1B 4P5KA 3GSNA 2BY3A 3BUTA 1NGQH 3RHWF 3QULB 2HT2D 4FRWA 3O4LB 1MI5B 3VXNA 5JUEL 2EXWD 3DUHA 4K3EH 4M43L 1CICB 4LU5H 1PG7W 2AJSL 3HZMA 4P5MA 4M7ZB 3FN9A 4NKQB 3SDCC 1U8KA 4XNZB 5SX5H 4OZGE 4NQCB 5T3XD 3MROA 4B5EA 1X7QA 3ZE0E 4QRSB 3MRNB 2R0KH 1YEGL 1IKNC 3QNZB 2LAGB 3SDCD 1KEGL 3D3VA 3WNOA 1W0VA 3BSZH 4ZFOB 2NX5A 4L1HA 2FSEA 4D0CB 1A8JH 1L9NA 4OKVB 3NFPB 4EOWL 3IDNA 3RWHA 2AXHA 1RFDH 4Y1AE 1CR9H 4OCYL 4BQ6A 4HUMB 1F58H 3LKPA 2XPGB 3KXFD 4M6AA 1BPVA 1NL0L 2AAVA 4PRIE 4DK3A 2JE8A 3U48A 5E2JA 3GSOB 2FD6L 4PB0H 5IROC 4OGYH 2FJHB 3L3OB 3Q48A 4G7YH 2VZ3A 4J7RA 4RCAA 4PGCB 4DGVL 4NM8H 3ULUH 2BVQB 5I8KH 1UWGH 4YPJA 3UJJL 1J8HA 1AQDA 2F5AH 4NBZB 3PHOA 4RAUA 3U4EB 4FQJH 1MQKH 3D9AH 1QRND 3WSQH 3MNWB 1KLFA 3QBTB 2FJGA 3ALPA 5FK9A 5IF0B 1UH2A 3QHFL 4LKXA 2YPKA 1G9ML 4JY5H 1A1NB 4KUZL 2AEQL 1FZKA 2NXYD 2D0HA 5HDBE 4M7KL 3V4VH 3WBDA 1FL6B 2AV7A 4HDIA 3K1KC 5C08D 3T3PF 3RUGB 3L3OA 2YC1B 4IDLA 4S1SL 2D03H 1BD2A 3ROLA 3VXUA 1OSZA 1C5CH 4KPHL 5KJRH 2W59A 2X4RA 5FUZH 4UNUA 1QSFB 4JDZA 3DSFL 1KJ3L 2COQA 3NCCB 5I18L 2FJGB 3D39E 2C5DC 2A9MH 4LHUG 4HUVA 3AREA 2IFFL 4XP4L 2EDJA 1VFBB 3T65B 5KVMC 4S11A 2OK0L 5I71B 4CGTA 3MV7B 2VL4A 4GKZA 3VE0B 3O11A 3RA7H 1WK0A 4U2ZA 4TQEH 2UZIH 2NY5C 1X5KA 4JDZB 1RJYA 3GSQA 4P3DA 1OP5H 4G8EA 3WIHH 5I1AA 2OJEA 3L7FA 1UWXK 2P8LB 4D94A 2FJFB 1ACZA 2GY7B 4GMTL 4KROB 4PJHF 1GGCH 3MV9A 3WS6C 5LCVL 2VDNL 3SKJH 1QHOA 1QEWA 5TQ0L 2VIRB 3K80A 1NFDB 1NH6A 4OJFL 4A6YH 2V17L 3AB0B 4GKSB 2DWEA 1Z9LA 5L7XL 5HPMA 3C6SA 4XC1L 1NGXA 1KCVH 2VQ1B 4K8RC 3ZKQD 1T5XB 1R3JA 3CPLA 2J7LA 3BP6A 3MLTB 4HWUA 3LQMA 3STLA 3PQYB 1FFPA 4IIQC 1JNLH 2N7BA 2X89D 3CFEA 3QXAB 3NH7H 2IBGA 4CN4A 3TNNA 2CK2A 2DQIH 3UZEA 3DETC 1HYRC 1EMTH 3F7QA 1Q9LB 1JCKA 4Y5XC 1KCSH 1OHQA 5D2LB 1EJOL 1RURL 3MRKA 3BYYA 5DRNA 1M7DA 4FQLH 4XVTH 5DD1H 1QSVA 4JFXB 3Q6FB 4LHJB 3ECBB 2R4SH 4G6MH 2HFGH 4MSWA 1BQLL 3K4AA 3ILPA 4OCNC 2CSPA 4F7EA 1ROWA 4NBYB 3RY6A 5I76A 1FG9C 5FIEA 4NO2A 4HUXB 3ARBB 4PS4L 3ULUC 5IK3B 1TJIH 2Y36L 4JM2F 3PV7A 1KENL 3LRSA 3OXSB 4WY7H 4QT5B 3SOBH 2XZZA 1T6VN 4IIQA 2GSGA 4P23A 4UOW0 5FYJD 4DCQB 5HVGB 3RDTC 3FQRA 1KJVA 3T1FB 1VACB 2V2TA 4Y4FD 4ZUWA 1K5NB 4QRTA 5H2BB 3STBA 4NYLA 1I7RB 2EXYD 4MNQA 5C0BA 3UBXA 3D39A 3QDMD 4E41A 2X4PB 2JIXA 2BXZA 3QZWA 1KACB 2VN7A 1JE6A 1DFBL 4NQED 1NFIB 4OBRA 5I74C 3NABL 2V9TA 4QRPB 1QLEL 1ZT1B 3FL7A 3BDXA 1YECH 1PYWB 5FHBL 1OM3H 1IAIH 1UYWH 4B41A 1U58A 1AXTH 5F6HI 5LXGL 2OTUB 3GJFK 1DCLA 1YDPA 1GOFA 3LN5B 2AI0L 4JR9H 4RDQG 1U8QA 4OLXL 4P3CH 1A9BB 2C1OB 1V7MH 2HKFH 3BGFC 4GW1B 1JGDA 1EHLL 1MUJA 4DZ8B 1UVQA 2D31B 4J8RA 4Z7WF 1BX2B 4LFHD 5T33L 4ZQKB 3D2UD 4LVOB 3G5XA 5L2KB 4J1UB 4GLRH 3GMLB 1HSBB 1A6UL 5DJYB 4P23D 3KHQA 2ZOKB 1U41A 4O4YH 3PP4H 3BUYB 3B2VH 5LBSH 3RP1A 5DR5H 5AUMB 3EAKA 1XR9A 5GSVA 1WFTA 5C0ND 3WKML 1MCEA 1EVUA 1RIVL 2LABA 1RK1A 2XZCL 6CGTA 2EKJA 3L1OH 4M8QA 2CLRA 4AMKH 1IMHC 3HN3A 4X5WB 5AWNL 3GMOB 5FV2A 4JRYA 2G5RA 2A1WH 2XZQH 3EDKA 2D7QA 2WBJB 3FRUA 5CGTA 4XPTH 2EE6A 1B90A 3LS5H 1A1OA 2FX8H 1ACYL 1HQ4B 5E00A 1L0YA 5C07E 4EN3B 2EICA 4JQIL 4M7JL 2IH3B 2CDEA 3PDGA 3CVHA 3ARYA 3WO3B 5GRVL 2OJZH 1RHHA 4JY4B 3BRDA 3VFTA 5HHMD 2Q7YA 3MRHB 4OI9A 5ESQB 4HQQH 3HCVB 5HI3D 1WFNA 4KK5C 3MGOB 3O3UN 5JORB 1MCOL 4WVRA 4NDMA 4KQ3L 4I18A 3MRNA 1AIFA 4TRPH 2CLRB 1MY5A 5CEXA 3QR2A 4TSCL 3P77B 3U7YH 3OHXB 3MJ9L 1JZ2A 1NLBH 4HWBA 3MBXH 1QA9B 3QH3A 1J1XH 3QXWA 3LKSB 3GMNA 3GK8L 4JFYA 1HZHH 4MJ5B 1XF1A 1F90H 5DO2C 4AEIL 3PHSA 1NFKA 5C1MB 5F7KC 4XI5D 1UG9A 5JW5A 1E0OB 2DWDA 3BDYL 3LPGA 5HGAA 4JY4A 4DAGL 1SBSL 4NCC2 2P47B 3MCLL 2XPGA 2ZCLH 3P4OB 2Q6WA 4W70A 4PR5A 4NZRH 5TJWK 1ZWIB 5I1KL 3L5XL 1YYMH 4RMQA 1U3HA 4JHBA 1IM9A 1AI1H 2WBJD 5FA3B 3ZT6A 1IGIL 4NKDA 3WDIA 4XNMB 1CFNB 5IV2A 1O5DT 4H26A 1NAKH 4HWZA 4RNRB 3UTQA 4KDTC 5IMOA 5F3BB 1FBIH 4U1KB 1OTUC 2BOCB 5DTFA 4HC1H 3U2SA 4P2QD 4ORZC 3QCUH 4XBPA 1BIIB 2P5WA 4UZGA 3BI9X 3NCJL 1NCBH 4V1DA 3TPUB 1BZ7A 4KY1L 4R4ND 5J13C 4FFVD 3STZB 2VLKB 1FDLH 5I71C 3FB5B 3NA9H 1WGOA 4BZ2H 1T1ZA 1S9WB 4Z7VE 5E03A 3CUPB 2HAZA 4OF5A 5C0GB 4XNMA 3H7BB 3IDYB 5I16A 5FKPB 4APQA 1JWUA 3SGKC 3LKRA 4LFHG 5TPWL 2E7BA 1DZBA 1HHJA 4U1KA 3RWCA 1F5WA 1QPPA 2C4FT 1QSFD 3CFJB 4PJ5A 2Z92B 5AAWA 3CFKB 4JB9H 3RWIA 2YOCA 2H32A 1D5XB 4M1GH 3TO2B 5IQ7H 2BNRB 3WUWG 1U91A 2DLEA 3TPUA 3MYJB 5EU7C 3ZHLA 2A6DB 4AENA 2LFGA 3IJSA 1FVCA 3QUYB 4F57H 5EOQH 2QHRH 1ZT4A 1GGUA 1I1YA 1JPGB 1U8NB 1SJEB 1CD0A 1BM3L 3UXFA 1BHGA 1I4FA 4Z0BL 1IEHA 4X5XA 3L7FB 3MJ8A 3DI2B 1BECA 1ZEAL 3OR6B 4GAYB 5EC2A 3DO7A 3OKEA 5E94A 1XCQB 2AXGA 4MNGB 1GAFL 1R24A 4XVUC 1YEJL 2ZNXA 5GS0D 4PJIE 3FQNA 5D1ZC 1AGBB 1YNKH 3OBAA 5IVZA 5D1XA 1LO0L 2PTTB 2OL3L 2DF3A 1HILA 4OD2B 2VQ1A 4P46D 4WW2A 4BJLA 5CJ5A 5EDXA 3MLYH 3IDXL 5D1XD 5E2WL 2EDOA 4RA3A 5H35A 3NCBB 3OZ9L 3ZT5A 4GRLB 1I8KA 2VR9A 1LWRA 3MMEA 3CVIL 3OKOA 1LO3H 2ARJB 3RIAF 3RQ3A 5CEZD 5BS0B 1HXYA 1G9NC 5K9OA 3HNSL 1FNGA 1OAXL 1AHWB 3NIGE 3RGVD 1J05A 5CZXD 3PWUB 4K8RH 5DI8A 1M6OB 5DRWA 1GC1H 1XGYL 1N64H 4O51B 3D69A 4RFOL 5D7LE 5IEKB 3QXTA 1UACH 1NUGA 1MREL 2WBWB 2NY7H 4PJIB 3UTOA 1YEDB 1OAZH 3FQTB 2EZ0D 1LE9A 5LG1A 4NSKB 4RIRB 3RL1B 5JHDB 5JW4R 5KVFL 1CK0L 3N50A 5IKCB 4TPRL 1UXWB 4ZS7L 5JR1L 4EI6A 3MOQA 4JHWH 3GSWB 1YEIL 3ARED 3X17A 2D9QB 4QXWA 1FVDA 3KYOB 1K9TA 5IFAL 5C08A 1P4BH 2W60A 3SE4C 4GMSL 5IBUG 3TA3D 2E8YA 2PW1A 1NQBA 4NQCD 5D6CB 3O6KH 4JFOA 1I1RA 1LDPL 3OJVC 3VXMA 1ES0A 3FT2B 2NMSA 4NO3B 5FF6A 3FQTA 4JN2B 4WEUD 4AEHH 3VXUD 3L3GA 1HCFX 1ORQA 4E41B 1C5BH 1DVFA 1ZTXH 3B8SA 3F65A 5T5FL 1S7QB 2R0WL 3MA9L 1FN4A 4Z7UB 1OGAD 1KF9B 1EO7A 1BQSA 3LS4H 1YY9C 2NZIA 4RMVA 2H6PA 3RKPA 5DURD 2W38A 4X80H 2DQHH 1RZIB 5I1GL 1T89A 4QO1A 2AABL 3T2NH 1MY7A 3W9EA 1OGAA 3X13B 1U8HA 3OKLA 1T80A 2EIDA 2OI9C 3G08A 3OKKA 4OZFH 4TNWK 3IGAB 4ETYA 4BK4A 4HPYL 4JFOB 1EERB 1DVFD 3VXME 4UTBH 5TF1L 4ELMF 1JYWA 1ES0B 1G0DA 4NO3A 2JK5A 5FF6B 2D0GA 1CE6B 3UC0L 2P42B 1WT5C 4CVXB 1I3VA 4HWBL 4PY8J 3C5JB 3RZCA 4FXLA 1FO0B 5E99L 5ICXA 4EJ1C 5ADPH 2LQRA 3RX5A 1INEL 2PYED 1Y18B 4ZTPL 4ONHB 4BZ1L 4ZAKC 5DLMH 5J13B 5IJKA 3SKMB 5I8OH 4YJZL 1RZIA 5HHXH 1QFHA 2Z8VC 3SGKA 2YSSB 3NPSC 3LQZB 3INUL 1JFQL 4PYGA 4UT6L 4J3VA 5DEFB 3AS0A 4PRBA 3UTSA 4JO4L 3QPXH 2NY5L 5KSBE 2DLHA 3O3AA 4HUWB 3ARXA 3MNVA 1EEZA 3UBXG 2VISB 2WINB 3V6BR 2ZP0T 5D7LD 1QBLH 3C5JA 3O4OB 2B5IC 5IWLC 4HXAH 3TWCL 5E08H 2GSIB 1H3PH 5I1LB 3PJSB 1SY6H 3GHBL 4K7PL 1CGSH 4HCRH 1YZZA 5I6XC 1MFDL 1MFAH 5F9OL 1AFVH 3RNKA 2VXQL 3J8F7 5EWIL 2W0FB 3O81A 1EBAA 4OFDA 3RWEB 5C9KA 4HIEA 5D7IF 3SKOB 1FAIH 3SKMA 3ZTJG 4ZO6A 4IRSA 4KV5F 2Z35A 4PJDF 1EGJL 1I3UA 3ZDXF 3T4AB 1HHIB 3R06A 4U6XB 2APWA 4M62H 1Q72H 4Z7VF 3BXNA 2GEEA 3NTCH 4JG1H 1G6RH 4WFHD 2CGRL 3B9EA 1J11A 3IXTA 4XVJH 2WAHA 3KAAA 3W11D 1JMXA 3ESVF 5I1LA 4YGVA 3KPNB 1T04B 4JPVL 3RPIA 4OZFB 5JXAH 4M9OA 5I1CL 4QKXB 1KYOK 1IFHH 3O9WA 3KJ4C 2BNQD 3UJTH 5KS9A 1S7SA 1BBDH 2Z35B 1F11A 4M48H 2VOTA 5L0QC 1O7VA 4IDJH 1GGIL 3P9WB 1WBZA 4F7TB 5I1DA 4WI8A 4K3HA 3NZHL 3QNYB 3VMNA 3HE7B 3FFCE 4AZ8A 4A2LA 4OGXH 4LMQI 4RFEB 3GB7B 4KK8D 5DUPL 2CUMA 4AG4L 2ZSVB 3QG6B 4MS8D 2VDQL 3PHQA 3CFDB 43C9A 5TE7L 3IS0X 3BPLC 4NP4L 2EDEA 4GBXA 3WFZA 2BVPB 4NQDD 1N0XH 5IBLC 3LN4A 1R3HB 4PJAA 4WFEE 1G7MB 3DPBA 5HYEA 2I24N 4QXUL 1VKXB 2NX5E 3BIKB 4ODVL 4HX1B 3D3VE 4PJCB 1G7PB 3LH2L 3K4DA 1Z0NA 5A2KH 5L88L 2OR9H 4WUUA 4DOHE 1OF2A 4Y16A 3TO4A 4M6NH 2P44B 3C8HA 5C0IB 3SBWC 3VFSA 4KMLB 3QG6A 4S2SB 2O5ZL 3ULVC 1IGCL 4TNVK 3PIQB 2BVPA 2O61B 3QDMA 4UOJA 3MRFA 4Y4FC 4U3HA 2BSED 3EFFA 3QQNA 5J57B 1IEAB 3MRJA 5E5MA 4G6FD 1T5WB 3UYOD 4Q58C 4BSWA 1KXTB 4RAHA 1EDQA 3OB8A 3HC3L 4MDJB 3FO0L 4GKSA 2GUOB 4WCYH 2FGWH 5ITFB 1HHJB 1OQXA 2EC9U 3F12A 3TO4B 1FNLA 3BT2H 4YHYC 5C0IA 4NFBA 4FQXD 5AG9A 3FRPA 4RAVB 1RV6X 5HGBB 3BP5B 5EU5B 4X4YA 4E41D 4KRPD 4AENB 5SWSD 3TNNB 1RUML 3RWHB 1PQZB 4N1EA 5DQDL 5E56A 1MWAB 3M1BB 2CLZA 4HIHB 1NGWB 3HTLX 4ZNEE 4WHYG 3DO3A 2DI8A 3MNZA 1BOGA 2O5XL 3QDGA 4TOYL 4U0QB 3ABZA 1M05A 3DETD 2CMRH 3EYVB 4UQ2A 4UV4L 4AY0A 1TLKA 3SCMA 4L5FH 1IC5H 5HHPB 3OMZA 5DHVH 4QXTB 2ESVB 1FHGA 3MCKA 2FX7H 3C8KA 1CL7H 4PREA 3KPTA 1Y6KR 2VWEC 3BGAA 5F97E 1KIUA 3G6JF 1AE6L 4POZC 4U1GB 4EN3D 2YS4A 3T8XB 1JMZA 2ORBH 4KMQA 3SE8L 3ZL4H 2I60L 1U8OA 5D7KE 2EDLA 2VXSH 4EI5B 4NKIL 2X4QA 4AEFA 5KANI 5KBNC 2VLLB 2EYSA 4JPWL 1IC1A 3ARTA 5HHNA 2Z8SA 4I77L 5L2KD 2CK0H 5GGTA 5FKAB 3C9NB 3ULSA 2EEDA 5FO9A 1CE1H 4ODUA 2YD6A 3WE6A 2W9EH 2X4TA 2X40A 2QQNL 3GEWB 2VDMH 1WQVT 5HDQL 3JUYA 2W1NA 4PRPE 1NEZB 1QKZL 5FDYA 3ZHKA 5BJTB 2A74A 1BWWA 2EXWC 1INDH 1MHHA 5DYOA 1FYTB 1Y6NR 4KXZH 4OQTH 4YDKH 2X4OA 4WO4D 3VFMA 4FXKA 4LCWD 5HVHC 2YWYA 3LVEA 4MQXD 5T1KA 1YEHL 4NQVA 4CDHA 2IANE 1A14H 1TZGH 4WO4A 3CLEL 2Z0BA 4R2GB 4LAJH 1R3KB 4MJ2A 5EU6A 4CJ1A 5HI3C 3C60A 5BQ7A 5CLTA 2YRLA 5CJQH 4X7CC 2X4TB 1FC2D 1JNNH 1JPFA 1W0YT 3S96B 2CR3A 4C56D 4YFDB 4E42B 4IBLT 2VL5B 2Q3ZA 2DIAA 5FYKH 1RUKL 3D3VD 3D5OF 4HFWA 4XGZB 3O11B 1WSST 1RMFL 1FJ1A 2NTFA 3KG5A 4FNLL 1D5IH 4PJCF 1TVHA 2X1QA 1YUHA 3PGFL 1BWMA 4PIRF 5JXED 2WANA 4OCRH 2CR6A 1OAYH 5IMKB 4HS8H 1HOCA 4O02L 2L7JA 1DUYB 3IJYA 4G9FB 4DKEL 1P9MA 4OCXL 4OI7A 5E2TH 1U8PA 1BFVH 43CAB 2DWEB 3VXNB 1X5HA 5T3XH 2VDPL 2BP3A 3MRRA 5CP3H 5EO0A 4RGOH 3O3DB 1CICA 4OF6A 5HHVL 4XNQA 5E9DD 3RNQA 4XPFH 3QFJD 3RIAK 1JRHH 1B0WA 1IBGH 2A9NH 3FN0L 4OB5H 4S0TD 5C0BE 4JKMA 2DMCA 4HMCA 5ALBL 3V79C 4G8GD 1U2HA 3UTPE 3QI9C 4HS3B 3U6RA 5KVDH 4MXWH 5HJ3A 3VXPB 1BREA 5HI4D 3A6CH 4PJEF 4CVXA 1FL5A 3QIUC 5FYJE 1KIPB 2RR3A 2R0ZH 4I1NB 1I1CA 2A83A 4YC2C 4QHUA 3MJ9A 5KS9E 3CMOH 3C6LA 4MCZB 2EYTA 4PJFF 4KI5F 2DQCH 1UXSB 3FOMB 4K7FA 3U9UA 3G6JA 2F58H 4JM2B 2NNAA 4TULL 5JORA 1F8TL 3MOAH 4Y5YC 3EJYC 5C07B 2X1PA 4N5EC 3W81A 4GRWB 2W91A 3HI1A 1YN6A 3EO1A 3B9KC 4KKBC 5D1QC 3E6FB 3W82A 3DMMD 4JO1H 3S9DB 4I0PA 1OP3K 3PL6B 2N4IA 2CD0A 5H37G 3T0EA 3I02A 1GHFH 1CD9B 2A6IB 4FQIL 4U05A 1F4WL 3S3JA 4K7FB 4RMWA 3U9UB 2ICWJ 1W0WB 3WXVH 4OT1H 2NNAB 2ILLA 3H3PH 2J8UE 4X8JA 2EDWA 5FYLE 1EH9A 3WS3B 3MRLB 5HY9B 4JM4L 2A6JA 3ZKMD 3U0WH 2NX5B 4NKDB 1GIGL 1QSEB 3VH8A 3W39A 1KCRL 1K8DB 3BPLB 3DRQA 3UTQB 3CH1B 2V5YA 5F3BA 3G6DH 3IDNB 4LLUA 1PEWA 2UV3A 1TQBC 2AEWA 1FYHB 2EH8L 4NPYB 1DBBL 4P48A 5BVPH 3EDEA 3EO0A 4LHUB 4F33B 3VXRD 4P2OC 4BZYA 3IDIB 4J8RB 4UNVA 4R8WH 4B7IA 4FQCH 3QJFB 1BJ1H 5J12B 3VE0A 1H0DA 1V3MA 4LCYA 1UWEH 4HH9A 2XTJC 4ZAKD 1I8IA 2ITCB 1LK3H 4RWYH 4LPXA 4YBHA 4MD5A 3RIFK 1XF4B 4MD0A 3MNWA 3VFOA 2Y7QB 1GJIA 5JPMA 1E27A 4M00A 4QXGH 3FZUC 2BHYA 2BSTA 2W65A 4BFIB 4L3AA 2VDOH 3E8UL 1MWAH 1NFDE 2D7OA 4PP1D 4PJ8A 5GSVB 1U91B 3ARDD 1CDGA 3X12B 1R0AL 3SE9L 3TC9A 5K93A 2WLZA 2EDKA 1U36A 1ZHNB 2YC1A 1XCTB 4O9HH 3TH3T 2VLJA 4QHNA 2XTJB 5IW6A 2QQLL 3OPZL 4PJ5E 3K8KA 2K3TA 2Y06L 3V4PH 5TE4H 1UADC 5JPNB 4PRAB 2DQTL 1ZMYA 4KTDH 5FAAA 3TJEH 1S9YB 2MCPH 4XH2B 4XMLL 1LVEA 1MEXL 3SPVB 2R2CA 1MFNA 5ADOL 1RJLA 3OKEB 2ICEA 2Y5TA 5J1TC 5C7XL 5D2LE 1RULL 4R4FL 2X44D 1DBAH 3TV3L 2E7MA 1KCUL 4P2CG 4R2GC 3O2DH 1GGBL 4LDEB 1FG2B 3BO8B 1CXKA 2VABA 2CDGA 3L3JA 5T1LB 5B21A 3TO4D 3QCVL 1JZ5A 5IB3B 2MQCA 4JO3H 3TIDB 1KNOA 2KBGA 5I1AB 2CUIA 2FR4B 4Y1AA 2FJFA 5J11B 2F54D 3HFML 3VG0H 1RU9L 5IGXH 2F19H 5AD0A 1QEWB 1MWAA 1RIUH 1OTTD 2H26A 2N1KA 4FXGA 1LEGA 2GKIA 5C9JB 4OD1L 4ODTH 5CCKH 1AGFB 4FA8A 5E8OB 4F58H 3ZYJA 4O51A 2A0LC 1MRCL 2VC2H 5ALCH 2PXYA 3S35X 1RQ5A 4QHKJ 4Y5XA 3FFDB 2J6EH 4N5UA 4ZAKA 2E7LA 2V2TB 3C8KB 3BP6B 1T2XA 3KLAA 3VXMD 3OGOE 1T7ZA 3RL1A 1CFNA 5IV2B 4JPIA 5C3LD 5EA0H 1TZIB 3PWVB 4QF1A 4QOKB 3IFPA 3SJVB 3KPSA 2AQ2A 3CK0L 4KC3B 3QRGH 4G6JH 1U8IA 3BEWB 4UT7L 3D0VA 3H9SA 1ZT1A 3QJHA 3AU1B 3GO1L 4U1SA 1G7LB 3OGCB 3D1MC 3QUZC 1G84A 4ODUB 3JWOH 3Q6GH 2VRAA 3RDTA 1Q0XH 1MHEB 4IRSC 3MV7E 1DQLH 2YD4A 2J8HA 1XF2A 5IBTH 5J6HB 5BJTA 3QQ3A 3O3BA 1GC1C 2Y5EA 4FZEH 5D9SA 1F00I 2M2DA 2HFEA 1M4KA 3VDCA 1JGUL 3H9HA 3MA7A 5EOCL 5ESAB 3F7YA 4MA8L 4TUKH 3QUML 3VGBA 5CZVL 1JIBA 1FE8H 4AJ0A 2IG2H 2X4NB 4RRPA 1DQJA 1FFNB 3W0WB 4ODHH 1NCCH 5DJXB 3PWJA 4U1SB 2YD3A 4GW4B 4W4OC 2OM5A 4LPWA 5DWUH 3MODH 3GI8L 3VJ6B 1VGEH 4DKDC 2GSGB 4DCQA 5JW4M 3V52H 3PDOB 4LLQA 2OBGA 1LP9B 4PJ7F 4F9LC 3UTTA 3QPQD 1CWVA 5EBGA 1J18A 5HI5C 3D39B 1BVZA 5CWSB 5CJXA 3QG7L 3LZFH 1QR4A 3P0VH 5FXCH 4NKOB 5EZIH 3ARVA 2NY0D 4NKMA 3GIVA 3SDDB 4M8QB 2EDFA 2E6PA 5I1HH 1U0QA 5B3JE 1DANT 5KZCD 3IKCA 1KSRA 2ZPKL 3CD4A 5BV7C 2OYPA 1QLFB 4FFVC 3LRGA 5HHQB 3RWFB 1HQ4A 1AQKH 5E00B 4ZTOH 4EN3A 4KKLD 2J4WH 1NMBH 3LAFA 1HQRA 1IAII 5ANMB 3O6FB 3UAJC 4NNPH 3FFCA 5C0CA 1A9BA 2C1OA 3WL9B 3C08L 5E6ZA 3UPCA 3KLHC 2AERT 2VXUL 4APQC 2ICWI 1QFUH 2ZUYA 4NN5B 3SBWA 4NFDA 5ABDE 1PY4A 5C2BL 2WUCH 2HJKB 4GXVH 5FOBA 1JWMA 3UTPD 4NDMB 2PR4L 4N90E 4LPUA 3WFDH 1ZLSH 5HYSB 1F4YH 5K9OB 2HKHH 5HPOA 5C6TL 5GRZA 1MRDL 5FYJH 1X5AA 5I75C 3GDBA 1WVZA 3GSNB 3RDTD 3V0WL 3ARFA 3IDMB 5L8LB 2FECL 2Z8RA 4O58L 3CSYB 3HE6C 3MLUL 4ZOAA 3O6FA 3UO1H 3WNNA 4MNQD 2VSCA 3LD8C 5KSAA 1Y6MR 3H3BC 3L7EA 5JQHC 4OV5B 3K7UA 5DJ8A 5IMMB 3WFBL 4O5LL 3RUGE 2HJKA 7CGTA 2O93L 2KPNA 4MZ2A 4PYHA 3RY4A 3MXWL 4XP1L 1W2KT 1CIUA 4DUVA 3QIUA 5EOTB 2ATKB 3TN0A 1OPGL 1L0QA 2AK4A 4N8VB 5E2VH 2BXYA 2A73B 1T7XA 3QWOB 5CP7A 5DVOA 4MXQD 5IMOB 5JXEA 1NSNL 4FQXC 5IQ9B 5DRXA 1I8LC 3HHRB 4XP9L 2EDNA 3KPRA 4Y16D 1EO5A 3L7EB 2HVKA 4W81A 4R6UA 2VZSA 5BV7H 2FBJH 1D9KB 3PDDA 3I50H 4MYWB 4UDTB 1A7QL 3V6FA 3FT3B 2B1AL 1SY6A 4YHOH 3TA3B 1QZ1A 3TBTA 2VXVH 2YD8A 3T4YA 4C54A 5F6IB 1AKJB 4JZJB 4ZYKB 1L7TH 4LP5A 4P57B 3PHOB 3B3IA 3U82B 2Q1EA 5CBAB 1YPZF 3CH1A 3OKYA 3GMRB 1JTOA 3MLZL 2XV6B 3KPRB 3MLSL 2YPKB 4L4VA 1BZQK 1UM5L 1D5ZA 4GQ9H 1MJ7L 1WF5A 4R7DB 4YK4B 1CLYL 5D7KD 1MFCH 3DGCR 5TDPA 3BKCH 4CVWA 1Y0LB 5T1MB 4AIXA 1HWGB 4CUCA 3ZTNH 3CFBB 4K3JL 1JNHA 2XYCA 4JO2H 1FORL 1LE5A 2VLRA 3NCYS 3IS1X 3QXVA 4K3EL 3KPOB 5D5MB 1TQCB 3GSRA 3LB6D 1EHNA 3ZDYE 4C56B 1QLRA 2OZ4A 5IB5B 5F7EH 4Z78A 4WFED 1LO4L 5E5RB 3SGDH 2AP2A 2R0KL 3BP5A 1T6WA 3WNMA 5SWSE 1MH5A 1KB9J 3NACH 3VFPA 4WFFE 4AEEA 2OSLB 4XNUL 4DN3H 1Q9WA 1ORSB 4LCCB 1TZHA 4WFGD 4F8TA 4Q7DA 1BVKB 2BC4A 2J6EA 5DJZA 3TN0D 4OUUB 4KROD 3QEGH 1FNAA 5D71L 4G3YL 1U6AL 1A7OL 1M05B 3EYVA 1FFOB 2DYPD 4XH2A 2UWEA 1I8KB 1MCFA 4Y89A 1CR9L 5GSRA 4TNWF 5CJ8A 5KSBF 4GXUM 1QLRB 2G60L 3VXSB 1WZMA 4YXKH 4NN7C 2P7TA 4KGJA 2ICEB 5DJCA 4DGIH 1BD2B 3ROLB 1U95A 2IPUG 3TO2A 5D2LF 1PZ5B 1DDHB 4XAWH 4LMQE 3HAEG 3JVGC 3DXAB 3ULUL 5I8KL 4I3SH 3UJIL 4PGBA 3HZYB 3UJJH 1EAJA 4M3KB 1C12A 1KFAH 1LMKA 2BMKA 1IM3A 3WSQL 5ESVB 1VESA 2UZXB 4YR6A 1OT2A 2WUBL 5DUMH 5T1LA 4ISVB 3S37H 1T1YA 5DS8B 5JHDA 4AIZA 3C2AH 3VGAC 1CXIA 2GJZB 2XACC 2ENSA 4JKWA 1FGVH 4XMKL 2FR4A 2PO6B 1RI8A 2CIIB 5HI4C 2R8SH 2AEQH 1ZXQA 4M7KH 5HGHA 4KFZC 3DX7A 3BQUA 1IKFL 5KG9A 2DM2A 3CDCA 3PHQB 4GSDH 5C08B 2JB6B 3RZWA 1ONQB 2NPLX 4BQ8A 1SYSB 2GT9A 3U7WL 2R0LH 4Z7WE 2BMKB 3FZUD 3GJEB 4ZG1A 4GW5B 4I0PC 4LSTH 4U6VL 2CQVA 2I5YL 1PGRB 3BESR 3KYNB 3QO0B 4W68A 4HIXL 3MV01 1ETZA 1WAAF 4EIGB 2O5YH 3LEXB 5F21B 1AJ7L 4ZPTA 3D0VB 4G80B 4BFEA 3OXSA 5I19H 3BQUB 1TVHB 1IQWL 3ULUF 4QRRA 2W9DL 3UTZB 3EJZC 4LRNL 2P1YA 1HYSC 1MJJB 5KSVA 3QDMB 1DEEA 1A5FH 3R0MA 2DQJH 1SJHB 3W5MA 3RAJH 4Z8FH 4P0DA 1T5WA 4EBQL 3MJ7B 4N1CA 1JGEA 3ROOA 2V5TA 3TYFB 1NFIA 1A1MB 4HS6B 4AH2A 1FIGH 1M7DB 3NMEA 3RUGF 5IOPB 3SY0B 1BQUA 1AO7B 3VGGA 3NAAH 1JI2A 5E7BA 5L7XH 3BRFA 1HIML 3SDYH 2ENYA 4G5ZH 4ZODA 3DMMB 5C92A 3VGFA 1MRFL 2JJSA 1LD9A 4LQ1A 4BM7A 1EPFA 1UZ6F 3CX5J 4LPYA 3FCTB 5DK3A 1A0QL 1J88A 1KTRL 3AY4A 1CBVH 3MNZB 2GSIA 3QHZH 3DHJA 1UM4L 3E3QC 1H5BA 1Z2KA 1CD1A 4FQPA 4POUB 4OFKA 3LMJL 4L3EE 3P3YA 1RK0B 2H2PD 4MCZA 4HV8A 4LOUD 1RURH 4OZHB 5D5MF 1CZ8L 1QFWI 4JM2A 2F8XC 5HHQA 1ODAA 3F7VA 4XVTL 5DD1L 4YXHH 2HFGL 3QEUB 3DYMA 4YDJB 3DVFA 3NGBB 3ULUD 3FFCB 4S1QL 1RJZB 5LGKA 2Y25A 4XP5L 2EYSB 5HXMA 1MLCB 5CFHA 3U79A 3PP3K 4KHXL 4YBLB 5J56B 2BNQB 4ZNCD 2HG5B 5KW9L 3LEYL 1NGYA 5TE6L 4NZDA 1EVTC 4OZFA 4NQSA 5KSUA 1Y18A 3LV3B 5KSBB 4WY7L 1U8QB 3ISWA 2JELL 3FRUB 2YPLB 4KKCD 4OM0H 4GW1A 3G5ZA 1J12A 4NRXB 1F6AA 2DQGH 4L3EB 2IC2A 2YR3A 5GISH 1CICC 3ESUF 1ADQL 3TLRA 1MIML 5D96C 3TYGH 3VCLB 2FH6A 2AGJH 3ZSTA 3TJHD 5IMMA 3FO2B 5JDSB 4KKAD 4WTXA 1JPFB 5DZNA 1X5IA 1TVBB 3VWJD 5A40E 4JAMB 5DT1H 2ZKHL 2YUWA 1OP3H 4NPYA 3QFJE 4RDQF 5GGTH 3MOBL 3VWKA 3P9LB 1I7ZB 4P9MH 3SDAC 3TN0B 3BIKA 4YZFF 3LKSA 4XT1C 3PXHA 2HN7A 5E8DL