3QJHB

The crystal structure of the 5c.c7 tcr
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
243
structure length
243
Chain Sequence
MKVIQTPRYLVKGQGQKAKMRCIPEKGHPVVFWYQQNKNNEFKFLINFQNQEVLQQIDMTEKRFSAECPSNSPCSLEIQSSEAGDSALYLCASSLNNANSDYTFGSGTRLLVIEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords 5c.c7 alpha chain
total genus 51
structure length 243
sequence length 243
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qjhB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qjhB01
3K4DA 5H2BB 2Z4QB 3O2WL 1S9WB 1CD1B 1FDLL 3DECA 2FH8A 5KAQG 3BN3B 4X9BA 2W0PA 1BEYH 4DK3A 3CXHK 5F9WB 1ZGLA 5KSAC 2NY2C 2CH8A 4Y8DC 4H1LB 4JFEB 5IFAL 1FLRH 4HMEA 4UOW1 1F4YH 1T89C 1W0WB 1LP9F 4IIQB 3MNVB 5DLMH 4H5SB 3AC0A 5KG9B 4HV8B 2F53E 1AGCB 4R7DB 4F37K 1WTLA 4N0FB 5I66B 2F19H 5H35A 4QRUB 5A43C 4QEGA 3DXAE 1SY6H 4KHTH 2DKSA 3TBTB 2E7BA 1S7TB 1CIUA 5TPWH 3U36B 5GGQL 4YHNB 2VR9A 4K7PH 3V2AR 2CRZA 4HLZH 4XTRD 5CP7B 3U48A 1A14H 1FFRA 1KEML 2ATPB 2FZ3B 4MJ2A 1V8HA 5E2VH 5HHMD 2EXYC 3P77A 2XNAA 2YPKB 1F11A 3RWHB 4ERSL 2VDRL 2BNQE 5L0QB 1MCWM 2FCBA 5I8OH 1MLBA 2FATH 5C2UB 5INCB 1QEWA 1WBXA 4K7PY 3E8UL 3O45B 3L5XL 1BZ9B 3PIQB 3V5HB 5FKPB 4L8CB 5JOPE 5E08L 4LSUL 25C8L 1NFDF 2DQEL 3GSUB 1X4ZA 2ESVA 2ICWA 3HS0B 1S7UB 3MRDA 1TPXC 2O5XL 3HPJB 1K2DA 3CFJA 5HYEA 4ODXA 1CR9L 1J87A 3P30L 2RR3A 2XXMB 3U4EB 1ZA6A 3FB5B 4KGJA 1U8NA 2AJZA 4LIQE 4HMCA 1UEYA 4NKDA 4ZPTB 5I1LA 1RU9L 2ZG2A 3RTQB 3RY4A 3RAJL 1IT9H 1TJHL 3OX8B 4NO3A 2APFA 3O81A 1I8LA 5CJQL 1RZJH 3ZDYE 5JOFA 2DL9A 2CGRL 5DJDA 1CDGA 2W9EL 3BFOA 3FT2B 3ARDC 1NMAH 4I3GA 1M4KA 2ZUXA 3BRDA 4DTGL 2DMBA 4CJ1A 1S9VA 2P42B 4HUUB 5SV3A 2R8SL 1WWCA 4ODSL 2IFFH 4G8GA 4Z7VA 2VKXA 1A6AA 4PTUB 3QQ3A 3W0WE 2B39A 1M7DB 1YY8B 2DDQH 5GS1C 1V7NH 4BSWB 1CF8L 3F65A 2ENYA 5C0RH 4QRPE 4GAFB 1RUMH 1DQMH 4DN4H 4D9LH 2IANB 1D5XA 2P5EA 1UYWH 1EH9A 3LQAL 1SY6A 3WXWL 4F2MB 3T4YA 3CDYA 2AJXH 1KIRA 1CK0H 1KJ2B 1VDGA 5TDNB 2C4FT 1YPZB 3CMOL 3MLZH 3ESVF 1A3RL 4QRRB 4KTDH 2CO6B 1LK3L 1DDHB 1EFXA 3NCFB 2DICA 4NQDB 3WFZA 4FRWA 5E2UH 4YQXL 1JF5A 2WUCH 4PS4H 4KRPB 4OJFH 4HS8L 5MEQA 5EOTB 4H8WH 4HIIA 3UDWC 1OSPH 1U8KA 3LDBB 2PXYA 4YDKH 4XI5C 4ODVL 1IL1B 4PJBB 5K93A 4PG9B 1RPQA 1KB5B 4Z95L 1UQSA 3ZO0A 3HCVA 1S7SA 2A6DB 4E41A 2ZUSA 5GSVA 4MNQA 5C9JA 3GMRB 2EDJA 2CR3A 2OQJA 3RVTD 5GZOD 4ZMAT 4R7DA 3QEQE 2VISB 3GI8H 4U1NA 1A7QL 4GKSB 3O3AA 4OCYH 4QRPA 3DV4B 4ZUWB 3DYMA 5FV2A 3WFDH 1VFBB 4LSQL 4BK4A 2XQBL 3KR3H 4S1QL 5BO1H 5L9DH 4ODVH 2E9BA 4AEIH 2PYEB 3S9DB 2DQCH 4X8XA 4R8WH 1A9EB 5F9OH 2FBJL 4G6FB 2UUDH 2FWOA 4XP9L 4OF3A 1AGEA 4MX7A 4X6DE 1U3YA 2YBRA 4BZ1H 2DTML 3QHFH 5AZ2H 4LRIA 3WL9B 2FGWH 4O2FB 1Q0XH 4CRPA 1ITBB 4WI9A 4F7CB 1T2JA 2VZSA 4Y4FB 1Q94A 2C1PA 2AJSL 4UB0L 2BSSB 4ELME 1WBXB 3FAXA 3VWJC 2W9DL 4WCYH 4YBQD 4LCWA 3ZHDA 1Y6NR 5I8EA 1HH6A 2HVJA 3VXPA 4OCRH 5GGRA 5AYUH 2G5RA 4LP5A 4L9DA 3KJ6L 4WWKD 4X5WA 4MJID 3PGDB 5CIPA 5CEYB 1BZQK 4DK6A 4AZ8A 5I18L 5DFVD 2QTEA 3KYKH 4PJIE 2DKUA 5KVGH 2OR7A 4ZSOA 3T8XA 1D9KA 1JPSL 3P2TA 1SJXA 1URLA 2RCSH 1I9RL 2VN4A 5C0BD 3UO1H 3EOBA 3V4VH 3WSQL 1A4JA 4Y2DD 3MRGB 4XPBL 2NY5L 5GJTL 1SMOA 5ERWA 4I0PD 2VZTA 3IXTA 1IAOB 3V6FB 5EU6A 4HAGA 2YKLH 1OAUL 3FB7A 3JXAA 1GL4B 2IGFL 3LN4A 2EKJA 4FTVE 3IDGA 2FECL 4AMKL 1EBPA 4GAJH 5IBTH 2H2SC 3LH2L 5EFIB 1H9VA 2KKQA 4DVBA 1R24A 4GS7C 5K9KA 1XR8B 2ZNXA 2V7NA 1RJLB 3LZFH 4GJTB 4R3SA 3BEVA 3P9LB 2BCKA 1Y18A 4JFPA 4Y16A 5J1TC 1OOAA 4E5XB 5I1AB 1U92A 3MV7B 1AHWB 4JB9H 4JHWL 2FSEA 3IKCA 3V6ZA 3PABB 1XF3A 1JNLH 3BQUD 2DF3A 4LL9A 2NY4D 1ZS8B 2EDXA 5EOCL 4QRRA 3ARXA 3MUGB 3MV9D 3O3BB 4NKQB 5EUKA 4DOHB 4N8CH 3QUYA 3CUPB 2Y06H 4U6HA 1MFEL 3R1GH 2D7PA 1FG2A 5CJ5A 1FFPA 4X9GA 4P57B 3WCYA 4EOWH 1CGTA 3M17A 4M7ZB 4NQVA 1J1OL 2R29H 5CWSB 1YPZE 3CK0L 4YPGA 2CR6A 1CXHA 2J8OA 4JB9L 4WW1B 1YC7A 4HC1H 4MNGE 3H8NA 4WY7H 5SX4H 4MMZC 3FT4B 4RBPK 3IFNL 4IHOB 3LKOA 2GCYA 3KPRB 4I18C 2Z91B 5CSGA 5GGQH 5GSRA 3HR6A 3B8YA 2R56H 5DC9B 1E6OH 4LHUB 4MNGA 3MA9L 4JGJA 5TQ2H 5ESAB 1OT2A 1EUUA 3GO1H 4WEBL 1ZVYA 3EKCA 3WMSA 4Z7VF 4KJPC 4XT1C 5D96B 2KPNA 2XWBA 3TO4A 4P2CG 4QRTA 3VWKC 5KSVA 3EW3B 4G8GD 1NDGB 5HBBA 1N3NB 5FUZH 4OLWH 3T0WA 4P59H 4M5YL 5KS9E 1E28A 2FX7H 2VDKL 2WQRA 2YBRB 3REWA 2AV7A 4UIKH 1HXMA 1KIQA 3ECBA 1MWAH 3MV01 4Y0GA 3VWJB 2VQ1B 4D9RE 3MA9H 2DM4A 2VLJD 4L3EE 1WSST 4O9HH 5IMLB 5CJQH 4F9PA 1QNZH 1EJOH 3RZCC 2MJWA 4YHLH 3IDNA 2X09A 4KVCH 1NSNH 4PGCA 2ED8A 1FCGA 1FL5A 1S7RB 3MX0A 1KIPB 5DT1L 3RWDA 3O6KL 4H88H 1V05A 3MBXL 3O4OB 4QTIH 2QV2A 4E9LA 1RIHH 1TIUA 4LLDB 3TJHD 3LKRA 3N1PC 2HH0L 4TTDC 4G9DA 3TBVA 4WDIB 2HG5B 4HQQL 1OTTC 3SCMB 4PD4J 5F7LB 5LQBH 4ZAKB 1QBBA 3W2DH 3EOBB 5DGRA 2HMIC 4P5TD 4LNVA 4NUGH 1UKQA 2VO5A 2RAMA 5D7IF 4YO0A 1TCRA 5ITBH 1WK0A 3FB6B 2OJEA 3ILPA 3B43A 4WU7A 4HSQA 2L4OA 2Z92B 4FQHA 5DVNA 3SDXE 3QDHA 3SDAC 3ZE1F 3W0WA 2P8MA 3QULA 4ZTOL 1I3RB 2NXYD 1Q0YH 3BPOC 3U0TA 3MRCA 1N2RB 1TQCC 2C1OB 3BH9A 2HWZH 4DUXA 3EO9L 4OF6A 4A2MA 1GPOH 1J5OH 4CUCA 1OAXH 4EUPH 3FOLA 1YEJH 3AFLA 2RGSA 2G5BA 4K23L 4LLMB 1J8HB 1ORQA 1HHGB 3MNZA 4JCMA 3V5KA 5SWQB 1JV5A 1TETH 4I5BA 4R0LB 4MJ6A 2IPKB 2Z9TA 4YBLB 3MRMB 4J4PA 1CG9A 4G8EB 3UTSB 4OZHF 2I26N 4XNYL 3LEYL 3SQOH 4FFYH 4NNYA 3L1OH 1YEDA 3QIWD 3GMQB 3GNML 4OM1H 3O9WD 2EKSB 4HIHA 3RDTD 1LO0H 2YPVL 2IAND 1K3ZA 1JZ3A 4M4PA 4J3WA 1OPGL 1YEKL 1JL8A 5FO9B 5EC2B 3PWPE 1D6EA 1NH6A 3VXME 4L3ED 4UI2A 3VMNA 2HRPL 5E9DB 3LKOB 3U1SH 4PJHE 3WFDL 1RY7B 2BRRL 4ZDHA 4PRDA 4C56A 3BN9D 3W9DB 4JM2A 1E4KA 4JM2D 3VWKB 3ULVE 2ZUVA 3BUYA 5BXFA 5GGVL 1LE5A 3VFGL 5J9PB 4EIGB 2FYYA 1BJ1H 2X4QB 5EUOE 5EWIH 1MFAH 4BZ1L 4YE4H 5IW3A 4HKBA 4O2CA 1T4KB 2L0DA 5KANI 3JV0A 3OKMA 5B39B 4JRXB 3NIDE 2IADA 2X4SB 5CLTA 2CIKA 3KXFD 4TOYH 5D2NC 4MA1C 3DJ9A 1BBJB 4BH7A 1EAPB 3Q6FB 2O5ZH 1U8PB 3X11A 2FGZA 2HFTA 5C0EB 4KH2A 1DBKH 1D9KD 4W70A 1R5WB 2Z35B 4M6NL 3NN8B 4PJEF 5IW6A 1I7UA 1ROWA 4WUUD 2VXQH 4JFDE 3SDXB 4M8QA 1C16B 1TVHA 5IMLA 5TE6H 3V4PH 3KHQA 4P23C 1I1CA 2ESVE 5IGXL 5J3HD 1QD0A 5DUPH 1NBYB 5C86A 2DQGH 2W38A 3BIKB 4P9HC 3JV6A 1FORL 4IMLB 2YA2A 5FGBC 4N0CD 3TZVA 5B4MC 3ARSA 4FNLL 4OLUH 4RMVA 4YHZH 4LDEB 3MJ9L 4DKDC 4M7ZC 3I50L 4UT7L 2NW2A 4XPBH 2FD6H 3QDGB 5E1AB 1PZUB 2BNQA 1Q8MA 4UDUB 3GI9H 3K8KA 2AABH 2P47B 1IAIH 4DUVA 3RKDC 3TA3C 3SDAA 4ACPA 5HVHB 2X7LA 3MRNA 4U4BA 2EECA 2GYSA 1G7MB 2J8UF 4B53A 3I3EA 3S4SB 4BQ8A 1J05B 1YEFL 3M8OL 4F57L 4LLYB 3L3JA 3V79C 4Y4HB 5EG6C 1XGYH 4OZFH 5EIVA 2XWTA 4NFCA 1WIPA 3TN0B 1QBAA 1DZBA 3TBWB 4YK4C 5AZEL 3D25A 2DQIH 3NFNA 1J0IA 1RVFL 2P24A 4NZJA 3H3KA 3RNQB 5F7FA 4QRSB 2Y72A 5KS9B 1BVKB 4Y1AA 3VFNB 4UU9A 4BZ2H 5DRXB 4N8VG 3IFNH 3P0GB 1NBVL 4DWHA 3MRQA 3BOVA 1FL3A 1RZGA 5HHPA 4EUPG 2DLFL 2BSED 4W68A 4WRLA 1DN2A 1R5IB 3DVGB 1Q9WB 2X1OA 4HCRA 4CN1A 1UJ3B 4ZYKA 1A1OA 1INQA 1YEFH 3M8OH 1T83A 1JGEA 1H5BC 4CVXA 4P9HH 3JWOL 1FHGA 5DRZA 3ZMRA 5C08E 4OZFB 2JJSA 5JW4M 5JPNB 1H5BA 3BQUA 3B83A 1JZ8A 4P23B 5LAXA 4Y4KD 3PV6B 5IMKB 4OUUA 2GFBA 1SYSA 2VDPH 3P4MA 1C5BH 3QJHA 1A6WL 5DMGD 5TE4H 5KSBF 5KOMC 1WZ1H 2FL5A 1GC1C 4U6YB 5E2WH 1HN1A 4OZGE 1AFVL 1GRWA 1CGUA 1OARH 4P5TB 3KPOB 5C6PB 5IEHB 3S8WA 1OQOA 5DXWA 1MH5B 4KFZC 4Z5RB 2VQUA 1F6LL 4RDQF 1QR4A 2MWCA 3FHQA 1PLGL 2XZQL 1C5CL 2WBJB 1ZHKA 5CAYB 5IFJA 3H9SE 5F7DA 4X98B 1AQKH 3WJJC 3O6FA 1U8IB 2VSCA 4LSTL 4NQEA 3PWLB 4X9HA 2ITCB 4M5YH 4PRPB 5J57B 4QNPF 1JPGA 4I48B 2RFXB 5DD3H 4QXWA 1BD2E 1IM9B 1VERA 1T83C 2J3SA 5CJBA 4HIEB 3X17A 1A64A 1R3IL 1MRCH 4G3YL 4M7LT 5BW7C 1NGXA 2R1XA 5D7LD 3E0GA 1QSEE 2CIKB 3VGAB 4M93C 5ADOH 5CP3H 3KVQA 2GJJA 1NCUA 4U1KA 5MEOA 3KXFE 4KVCL 1VADB 1CD0A 4G8FB 4P2RD 3BZFA 5C0NC 3D85A 3E6HB 4QHUB 1BVZA 3UTPE 4JO2H 4QHMA 4EBQH 5IW6B 2V2TA 3Q5YA 1Q72L 1REIA 3SDXA 3RPKA 5GIRA 1E4XI 4P5MA 5DI8A 1CXKA 2E7HA 3V0WH 4Z8FH 3BP7B 1FAIL 3C08L 2IG2L 3O4LD 5D6DC 2X4TA 1JWUB 1P53A 1KEGL 1AD9B 1QRNB 4NNPH 4Y5XA 3SJVA 1G7IA 4PJGA 1S7XB 3DRTB 4GUPB 1Q9KB 2CLRA 3HI1B 2P44B 1GZPA 4HWZA 4PJAA 3LDBC 5I1JH 2BXZA 3H42L 2NY5C 4OQ1A 4L29B 4PJ8B 1S7WB 1H3WM 1PKQB 4UDUA 4OCWH 1M05A 35C8L 1A21A 1DUYB 3WJLA 1QFWL 2FNBA 4LGPB 1KUMA 2BMKB 3BPOB 1SVZA 3THMH 1P2CB 3TC9A 2R9HD 3RWEA 5IIEA 3BN9C 4XBEH 5C0RL 2ADIA 3RDTA 3HE6A 1G1YA 2IBGA 2VLJE 2H8PB 4QGTA 3OF6D 4KJYB 3RWFA 4Z77A 1KG0A 1PAMA 3S97C 2NZ9C 1IC4H 3GSVB 4U1GC 1HQRB 3CFDA 2WUCL 5KS9A 1P6FA 3AVEA 2PXYD 1WZLA 2CMRH 5HYJA 4XRCA 3ZE1E 1UWXK 3WHXA 1NMBH 4H26B 4MXWL 1SJHB 2FJGA 3H9HA 5KTEH 2P1YA 1OM3L 2OX5A 4QHLB 4YH6A 4J3UA 4KMTL 4LCWD 4GOSA 1EFQA 3G08B 3LSOA 2OTWB 2W60B 1GGCL 5D1QA 4DAGL 2AEPL 5DVOA 3NGBC 5E8NA 2E27L 3QR2A 4JAMB 5F3HB 5AAMA 4MLIA 3RVUD 2NY3C 4XMLL 3DXAD 4TPRH 4QT5A 1YN7A 2R0KL 4KK9D 4OB5H 4Z76A 4X5LA 4N9GB 1L7TH 4PJ7A 3HKFA 2I9LA 4LDOB 3KPPA 1T0PB 4DFHA 5FGCE 3RGHA 3IB4A 5FA4A 3STLA 3FONA 3T0EE 5HYSB 5EWIL 1MH5A 3FTGB 2GTWB 1MCKA 2JJSC 3MCG1 1MHCA 3ARGC 1KLFA 4EUPA 2HKHL 3X3GL 3IDYB 1K2DB 1X5ZA 4NNXB 3CNKA 4DZBA 2B1HL 4H0HB 3PF2A 3MMEA 3FT3B 4V1DA 1E27A 2UYLB 4U1JA 2EIZA 4E41D 4HGKC 4K7FB 5JPMA 1S9KC 2QADB 5JTWA 3SPVB 3DX6A 4X99B 4PRIA 2DLEA 4S1SH 3EJJX 5CHNB 3WUWA 3ARED 5C0FA 4EDWL 4IRSB 2BVQA 4PJBF 3KJ4C 1YY9C 4UIMA 1HEZB 5JW4R 3PP3H 4DEPB 1CFTA 5IGXH 2Q3ZA 1SQ2N 1T7XA 3C8HA 4X80L 2IPTH 1FO0A 4K8RC 4HKXB 4J1UB 4XPAL 3MLSL 2PO6D 4LPCA 3EUUA 5GGVY 1K6QL 1B0RB 5EORL 4FQQB 2E7MA 3CFEA 4KC3B 4BYHA 3IETB 2D7TL 5FGCB 4XB8A 1C12A 1YEGH 1YY8A 4NFDA 3QA3B 2LFGA 4I9WD 3MODH 4TNVF 5E99L 4S1SL 2VITA 1SEBB 2X4TB 1CDBA 2E7LC 1W0VB 2GY5A 4G6JH 5KVFH 4KJWC 2W0FA 1DJSA 1Q9LA 4Q6IC 1BFOA 1IBGL 3WIHA 3KR3L 2XQBH 3UPAA 4MQXD 2CLRB 1YNLL 3FZUD 1ZTXH 2A73B 2YC1A 3AREA 4PJGF 4GRLA 3PWNA 2J8UA 3F5WB 5L8JB 1CVSC 1JZ4A 1T22A 4BUGA 1F4AA 2DLTA 4L8DB 5IF0B 5EZJA 4X6CE 3MYJA 4FQ1H 5E94A 1LO2L 4PJFF 3ARBD 4TSAL 2XPGA 2F53D 4JY5L 5C0IB 1MJ7L 1W72L 3UJIL 5D7LA 5IHZB 4OGYL 4JFXA 2XFXA 1FZJA 1YC8A 1YECL 2DQJL 2CKBB 2QHRH 3D0VA 4MD4A 3IDYC 1JNLL 2HLAA 5FHBH 3BWUC 2OI9C 4Y89A 4NRYA 1UH3A 1UXSB 2HFGL 2BHUA 4QXUH 3TBYB 1P84J 2R1WA 1JNNL 1VFOA 3IFPB 6CGTA 1UB6A 2AV1A 3WN5C 2A77H 1EV2E 2DRUA 4YGVA 1U58B 4D0CA 3EO1B 1HILB 1TTGA 1MI5A 1EK3A 1GGYA 1J1PH 1T7ZA 3ZE2E 4CDHA 1OAYH 4IRZH 2NY3B 1JWSA 4P5TC 3QNZB 1E4KC 4HFWB 5KW9L 2E6PA 5BS0B 5I16B 4V1DE 4Z7WF 3BMWA 2OSLA 5FDYA 3EYVB 3WSQH 3ZYJA 5I19H 4DJMA 4PJIF 3AY4A 1DEEB 4GMTL 4F7MA 3KS0J 1K8IB 3WNOA 2O26U 4HQQH 1FFQA 3G5VA 3LKQA 5CJOL 3S88L 3U9PH 4NJ9L 8CGTA 3T0EA 1LO5A 4PR5B 5D2NA 3SQBA 3GHEL 3NMEA 3QQ9D 1ZT4A 1A3QA 1MCPH 1CDJA 2NYYC 1S8DA 3QDJE 5T3ZH 5DJ8B 5HHOB 5L2KB 4JRWA 3KPQA 4X5WB 3FN0L 1XGRA 5E6IC 4UV4H 3O11A 1S7VB 5F93C 1IGTA 2WIMA 1KN4L 4DZBB 2F74B 2MCPL 1L9NA 5ICXA 4FFVD 3QI9A 1UCTA 3DVNA 4DGYH 1RMFH 2FEDC 2JELH 3QXUA 3CZFA 3HC3H 5E7FA 1JJUA 3TIEB 3HNSL 3KWWB 4TTGA 3KS0H 2C26A 1M7IB 2F54D 5E6ID 5HXMA 3DYOA 2HRLA 4K3HA 1RQ5A 3P0YH 3ZL4H 3CVIL 4LPXA 5F21B 4UIMB 2V5MA 1DQDH 4QNPE 1JNHB 3JTTB 3U82B 4G8GE 1EMTH 1BX2B 2R69L 3IAPA 3QIUB 4PJFB 3LMJL 5DUML 3P9MB 3QG6B 3OZ9H 4CVZB 4PRNA 4D2NA 5IT2L 1J10A 4IRJD 1VESA 3VGEA 2HAZA 2VAJA 4DQOH 3VXSB 5F96L 4RSVA 3IU3A 3Q5OA 4Z95H 1MLCA 3NCJH 1XGTB 1CL7L 1RJZA 4IRJB 1A5FL 5C08A 5K9QI 5BJTA 1D5MA 4L3CA 4ZXBA 2EXWD 3QFDA 4K3DL 5GXBB 3RX7A 3CVIH 1I8IB 1Q9OA 3QI9D 3MRKA 2J6EA 4A6YB 1IFHH 1A1MA 3L3IA 1GZQB 5CJXC 1AC6A 2GK0B 2X4OA 3CH1B 1VFAA 1OD7A 5BRZE 1XF2B 4KUZL 1TJIH 2E7CA 1JGVH 2Z31C 3CAFA 3DUUB 4C83A 4XB7A 4YE4L 4WFFE 3MYJB 2IPUK 1FN4B 1T7VA 3NIGE 1CI5A 2AXGB 4OSUL 1Z5LA 4M8VA 2XFXB 5E8DL 3LKNA 4HUVA 1RIUH 4KKCD 15C8H 2VLLA 1QFWM 3SEPA 3BP6A 4NO5A 3HMWH 4NKMA 2FIRT 3VRJB 3Q48A 1RZ7L 4N5UA 4I77H 1ACYH 4PJHA 4QYOB 2CXGA 4JZJC 2X4PA 1KT2B 1MQKH 1U41A 3VXMA 4OKDA 3TBTA 4X6EA 4MAYD 3RWIA 3QO1A 1QHPA 4MAYA 3I9GL 2IANE 1CXIA 1IEBA 3NZHH 4L5FL 5L7XH 3NAAL 5L0QC 1A7PL 1CS6A 4LCYB 2YPKA 2ZCHL 1MRDL 4WW2F 3X14A 5DS8B 1DFBH 2CKBH 5HHQB 3VFVB 4RIRA 2W65A 1MCNA 4X4XB 4S1DD 2VE6B 2BSTB 4YHIA 3AXLB 1DEEA 3R06B 3J8F7 4MSWB 4FQIH 2C7UA 3IDMB 1E4JA 1BZ9A 3PIQA 1MUJA 2GT9A 4WV1B 2AJ3B 2A74A 4JJ5A 3G9VA 1JF1A 5KSBB 2YS4A 3NIDF 1YEHH 2I9TB 4H5SA 4YK4B 1AO7B 4M00A 4N0UB 5IJVA 4OZHA 3CFCL 5H35B 1VCAA 1PG7H 2Y6SD 3LIZL 3C60B 3ZKQD 4K23H 3K80A 2DWDA 1S7VA 2X89A 1A22B 3K2UL 2B1AL 2OMBA 3V6OA 5EUOA 4HS3B 3N1FC 1B6UA 4NUJB 3I02A 5JIKA 1R0AL 2R23A 2ADFL 2CIIB 1I1YB 4X80H 1TDQA 5IVZB 2R4SL 5EB9A 5EU6D 1F02I 3TJEL 3U0WH 5GGRY 4I0PA 2QQQA 3L6FA 4FFYL 4HUWA 4P2OA 5C0JA 1LO3L 4WGVB 2AK4B 4ZUTA 3LZFL 3L3DA 1CFSA 1K5NA 4NM4L 1YNTA 2VXUL 4YBHA 1NUGA 3KPTA 2XKNA 4HBCL 4Y19D 2P8PA 3LIZH 1YNKH 2KQMA 1HSBB 2V2WA 3ETBF 4OIAA 4J3TA 4LSRL 5CEZL 1SYVB 8FABA 2XWJA 1H3PL 1M6OB 3SE9L 3KNBA 5DYOB 2NY1D 2D7MA 3IXAB 3MGOB 1HCFX 1JMZA 4GKZB 3R1GL 3MFFB 3TWCL 2X41A 1H8NA 5CINH 2GUOB 3UEZA 3PGFL 3C5ZD 1EO5A 2EDTA 4XTRC 4D3CL 2XRAH 1AE6L 3QB7C 1SM3L 3E6FB 4EKXA 1DVFB 3RL1B 1FSKB 1NEUA 4Z9KB 3TO2B 1G0YR 4M3KB 4H1LH 2BSRB 4UDTA 1X5AA 4NQDE 1K85A 5F7EH 4CJ0A 1JWMA 1QRNE 3BZDA 2EIDA 2YXFA 5TFSH 3LD8C 5AG9A 4NPYA 4Z7UE 1NGYA 3U7WL 1KCLA 1BQLH 1T89A 3TH4T 2CUHA 3OKEB 1QBLL 4IS6B 1K4CB 4KQ4H 3GDBA 1S3KH 5GRJL 2COQA 4LPYA 3VCLB 4G43B 5CBAB 2XY2A 4YXLL 4R4BA 5KSAD 3ARRA 5DVLA 3HFML 1FZMB 5D6DA 2J8HA 1KC5L 2UZYB 4EN3A 2Z93B 2E5EA 1JUFB 5A3IC 43CAB 3W39B 2FYYB 2X4QA 5D8JH 5E5MB 3V0WL 3TYFB 3VXRE 1XCTB 3MJ9H 3MXWL 3O6LL 3N06B 4QCIB 4N0RA 3DHMA 1NEZB 3L3KB 5JXEA 1KFAH 5IROA 4LEXL 5TF1L 4B41A 3WLWD 2C3VA 2H32A 1MCOL 3CVHH 4OM0L 3ULUF 2MCPH 1J1XH 5HTSA 5JUEH 4ODUA 3CPLA 4HIIB 3DRQA 2WLZA 4OZIB 1HNGA 1OCWH 4YHIB 4TN9A 5I1JL 2D31B 1KB5A 2CQVA 3FMGH 3UTSD 2FO4B 1T7WA 4P2QE 1SBSL 4P3CH 1PYWB 2PN5A 3GSRB 4XCNB 4JHZA 4POUB 2XTJD 1S7SB 4H88L 3LKPB 1DQDL 5DD3L 4KZEH 1NEZG 4Y5VB 2RB8A 1LNUB 2X44D 4KRPC 1KPVA 4UILL 1G7HB 3MXWH 1RIVH 3O6LH 2MKLC 1Y0LB 5SWZE 4PJ9B 5FF6B 5DD0H 2P5ED 5L88L 2A9NL 2NTFB 4OZHB 2VMFA 2PCPB 1NUDA 4DGYL 3S96B 4HH9B 3L3OA 5HI3C 4MAUL 4JG1H 3HRZB 2UY6A 1VFBA 1J5OL 1EFXD 4OFYA 2JCCB 3GK8L 3JTSB 3FQTB 5FYLL 4DKAA 5IB5A 1A9EA 4HS3A 3H0TB 3LQZB 1OWWA 3ORJA 3T0BA 2QR0B 2HT2C 2NXZC 2P7TA 1BVLB 5FO7A 5IQ7L 4Q6IA 5A16A 4MJ5B 2HFEB 3OG6B 1R5VA 3FO1A 4M7LL 3WHE1 4JDZA 3LN4B 4UNTA 3I75B 2DIAA 4M62L 3U4BH 2KZWA 1PVHA 1WZKA 1BP3B 5ITFA 2XY1A 1QFWI 2B4CH 2V7NB 1U3HC 1LO0L 2YPVH 4R90L 2BOBB 2AAVA 5DQ9A 4YHYC 5D93C 1OQXA 3VFOA 1IKFH 4M02A 1JHTA 2RJMA 4OCMC 3G6JE 4KK6D 4MJIA 5F6HI 2J6EH 12E8H 3QQ4A 4GRMA 5CGMA 4L4TE 4I4WA 3OAYK 3GUTB 4K71C 4AYFA 1U6AH 4HH8A 5BW7A 1FFNB 4M6ML 4UQ3A 3VFSB 1G6VK 2OL3B 3PG2A 5ESQA 2PW2A 4FABH 1UGNA 4HX1A 5T1DL 2A6JB 4LSVL 3T0AA 1FG2B 1RURH 3EBAA 1FFPB 4M9PA 4XVUD 4JQIH 5ETUA 3EOTH 1CDHA 1AH1A 1DBMH 1NCDH 4NQVB 4B7IA 3P73B 4BSVA 5ESVA 1YZZA 5D2LF 1DN0B 1N8ZA 3BZ4A 3BAEL 3VD9A 3HAEA 2AJYH 4MA7H 1U93A 2EYSA 5EBWB 4F37F 2DD8L 3AMKA 3MCKA 3QIBC 4R0LC 1R3LA 5DRNB 1I8KA 4JHAH 4JPIA 2BXYA 4QY8A 3S35X 1FNSH 4XVSL 4U1SB 3BEVB 4PGBB 4Y16B 3OB0H 3CSBA 1RUML 2JLLA 3V5DA 4FQXD 2GITA 3MGTA 2QLVB 3RKDD 3TA3D 5GS0L 3WS6C 1G7LB 3CMOH 3MLZL 3QCUL 5H37G 3LY6A 1XIWD 3QEHB 4OCSH 4IOFC 5EDXA 1EGJH 3VFMA 3WO4B 5I1EH 3F12A 1I7TA 2Y7QB 2BNRA 4ZAKD 4JPKL 1A4KB 4ISVA 1FPTL 2DI8A 4YHOL 1RUAH 3V95A 1OGAB 1AGBB 1MCRA 3K7UA 1YEIL 2DQGL 5T1MA 5IB1A 4P49A 1G9EA 2G9HB 1QYGL 3GMPB 4RX4D 4U05A 4QHUA 3PNWB 4ZUUA 3BSZH 3MJ6A 5T3XD 5IVOA 4LARH 5I8CA 1X5FA 3PWPB 2WBKA 4LEOA 1INDL 3D18A 3DGGA 3QDME 3V0VA 5HYQB 3DO3A 1IM3A 2X4UA 3JWNC 3O41A 2KDGA 3EYQD 4Z7UA 1CLOH 3SGDI 3O2WH 2LVCA 1NBZB 3IFOB 1NJ9B 1MHEA 2EYTA 4IOIB 5HI4C 3DUHA 3MLRL 3MUHL 1A7RL 3NFPA 4AEIL 1CD9B 3KLAA 4L29A 2BY0A 3FOMA 3O2VL 4AMKH 4U6VH 4MNQE 3FB6A 3B6SB 2P5WB 4NZUL 2VLRA 3M1BA 5GRUH 5I6XB 2VLRD 2AV7B 2VXTL 2H1PL 3O4LB 4XWGH 4BFBD 4FFWC 2APXA 5I1IH 3RGVB 1BM3L 1TZGH 4YC2B 1EZVX 4PV9A 2Q8AH 4UB0H 1ZSDA 1VPOH 5MEPA 3SDDC 4WWKA 1A3LL 3P11L 3QFJD 4PJGE 2MOVA 5J12B 3KLHD 1CFQB 4KKAD 5EO9A 1I9IL 4EQ3A 1BHGA 1S7RA 1MFEH 4HW6A 4XXDB 2DMCA 5GRJH 2V7HB 2ED9A 3MNZB 3GSWB 5C0AA 4RGNB 3DROA 1SJHA 5C3LD 1YQ2A 3S5LB 3RU8L 4HGWA 5T3ZD 2PKDA 3ROLA 5DJYB 1S9YA 4LSTH 3V7AE 1K9TA 3WFCH 2GJ6B 4M1GH 2EH8H 2DQHL 3HNTL 4YNYA 2DQJH 5MI0B 3SCMA 4HDIB 2Z31B 3OXRA 4UUJA 3L5IA 4HIXH 3LN9A 5ALCL 3OGCB 3LB6D 1LE9A 2OJEB 2NLJA 5EIIB 3Q2CA 3GIZH 3VRLF 4BSVB 4G6ML 4PBWD 4Y2DA 1UA6L 1NCBH 4H20H 4D8PB 1OAZH 3IGAB 3MV7D 3VXUD 3U0TB 5BS0D 5HGAB 5HGBB 5CGYD 4R4NC 5CBEB 3FONB 2YD8A 4PP1D 5DD6A 4NQEE 4XXCC 2F53A 1G7JA 4L4JA 1WBYA 3N85H 1FL6A 1FIGL 1JGLH 3I85A 4PRHE 1NC2A 1AP2B 1R3JA 2C3WA 3D48R 3EDFA 3QXTA 3EJYD 4MZ2A 5FA3B 3TVMB 1BGXH 4PY8J 3MJ9A 1U36A 3NA4A 5D1XD 1GGTA 1EEUA 1HYSC 1PSKL 4X6DA 1WEJL 5JXAH 2X4NB 4KKBC 1XF4A 5DD0L 3GMNB 3QIWB 1V3MA 1RZIA 1MFDL 3DUSA 3V5KB 4LAQL 1DE4B 1OCWL 3WXWH 4OKVA 3SDCA 4HULB 1KJ3L 3RWGA 3ULVF 2DKMA 4GRWB 1AGDA 5E00A 3HI6L 5EZLA 1X7QB 4Y88A 4ELMB 2CDEB 1I7ZA 5JHLL 1ETZA 4CBPA 5HY9B 1NC4B 1L0YA 4CADB 4RFNC 3BUTA 2JE8A 2J88L 1MEXH 1F42A 4H8WL 3PGCA 1NCCL 4YR6A 4X9FA 1KENL 4XP1H 1UH2A 4NSKA 5EU5A 1A6ZB 1NCTA 3B9KC 1N6VA 5H94A 3HE7C 4NQCA 4ONHA 3MV8A 5GS0C 4HK3N 3ZKSD 3TZVB 4GBXA 3BP5A 5HSFA 2WP3O 2UWEE 3H42H 3LPFA 1T1WA 2APBA 1INEL 1BOGB 1HWHB 1AD0B 2E6JA 3IJSB 3C9NB 3U83A 3OG4B 4HKBB 4PG2C 5LGHL 1JBJA 1QFUH 4PY7A 4OCYL 2IH1A 2HN7B 1ADQH 2Z0BA 4KTEH 3NFPB 3PWNB 4GRLB 4KUCD 2VKWA 2OBGA 4N5EC 4CU7A 1IAKB 4X6BA 3CC5A 4XNXH 1KF9B 4DQOL 4BH7B 1T0NA 3DSFL 2ICEA 4WVRA 4YZFF 2LTQC 3X12A 4UINL 1JK8A 2EEDA 3EYOB 1A7PH 2MNUA 1T5XA 1MPAH 3U7AA 1W0WA 1IILE 4OZIF 4KK8C 5HYFA 1LILA 4FXGB 2CJUH 4XZUB 5ABDE 1LGVA 4YAQB 2BY3A 2FJHB 2KBGA 1CFQA 4OZGB 3QEGH 5HHVL 1NGZA 1WCBB 4R96B 3SQOL 1GGBL 3T65A 4LKXA 2F8VA 4BM7A 1HILA 1Q9WA 4P4KB 3HC0A 1MF2H 4NRZA 1QVOA 2IFGA 4ODHH 3QRFM 4FHBD 5EC1B 3SGKA 5KJRH 3S5LA 4MJIE 4FQXB 4OSUH 1AXSB 1FNEB 3RAJH 2X10A 5I1CH 4QRPD 2Z31A 4HDIA 3OXRB 3PHQA 3F7VA 4JY4A 3EAKA 4OUUB 5HYSG 4NN7C 4ZFZA 3Q6GH 4PJAF 3S4SA 4D9RD 5LVEA 1LO4L 3PHOB 2NY6B 3VGBA 2AABL 2R2HA 4HJJH 2ERJC 5FYJH 4GQ9H 3OHXB 3TT1L 3ZTNL 4ODSH 2C9AA 4TULH 4H25A 5DEGA 1AC0A 1LP9B 4YHOH 1C08B 3ZT6A 3SGDH 4MDJB 3G5XB 1CICB 3I6GB 3KJ4B 2IEPA 4MA3B 3DX8A 4PJ5A 4XCEB 1OL0A 3IU4L 4WEUD 5HI5D 3A6CH 5H8DA 3WV0A 1BQSA 3VG9C 2BP3A 5D72L 3OWEA 4GW1A 3QUXC 3D69B 4X6DB 4ZAKC 3VXQB 2RHEA 1UM4H 1PX3A 4KXZH 1G9NL 4JFQA 3GMNA 2YZ1A 2IPUG 5I66A 3C6LC 4LBEB 2IPTL 4BK5A 1MREH 5FM5M 3FL7A 1YEEH 4KUZH 4I3RH 3W0WD 1Z3GH 4FQXC 3QIBB 2WAHA 1QSZA 4YDLB 5FO8A 4D0DA 4X8JB 2IALB 4OLXH 3T77B 1DUZA 3SKMA 3NCMA 3MRLA 3B5GA 4TSCH 3P9MA 2XZAL 1NFDE 4PRNB 4JY5H 1FVCA 1HXYB 2H1PH 1MRFH 3LOWA 5JMRA 2ESVB 5L6YH 1UM4L 1KCSL 4P4RB 1RZKL 5EOCH 1IAIL 5FUOH 4L4TA 3ARDB 1YPZF 1ZVSA 3HPJA 4OBRA 1ZTXL 1A7RH 3LV3A 5J1SC 1KJ2A 4PJGB 1BOGA 4OI8A 1GAFH 4P99A 5C2BL 4K71B 3MRKB 4XGZA 4Y19A 4YEFA 3OAUH 4HIEA 2Q76A 2AJVL 3CXHJ 1DUYA 3UJJL 1P4IL 1EGJA 4XHJD 2D9QB 3HMXL 4RMWA 4DGVH 3NH7H 2IQAB 2UWEB 3T2OA 5DWUL 3U4EA 4RAUB 1JRHH 3MLVL 4WHTB 1JMXA 4ETQA 5E70A 5DR5L 4FA8A 4HKJB 1GH7A 3MUY1 3X12B 3LHPL 5HD8D 1I9IH 4YIQA 1T3FB 3WE6B 3OX8A 4C56D 4E41B 2P48B 5ISZA 3QQ3B 4OD3H 3D1MC 4OD1H 2FJHA 2P8LA 1M7XA 2OL3L 1NLDH 4G80B 2XA8L 4QHNB 1CWVA 4CU6A 4MXQC 4HXAL 2H6PA 4MNQD 3QXAB 3W5NA 5T33H 4LQFH 1H8SA 1IC5L 1KJVA 5DWUH 3SY0A 1HHKB 2HT4D 1A6WH 3B4NA 1RIVL 1I8LC 3ES6B 1W72B 2LU3A 2W0LA 4LPVA 4QF1A 1D5XB 4NIKB 4FG6D 3F7YA 4JFOB 1FDLH 1KIRB 1FZOA 1MCPL 3GSOB 1T6WA 1QA9B 4KK5D 1IL1A 3CVHB 3QHTC 2XT1B 3DMMB 4JJHA 4N9GA 4MCZA 4IRSC 1W2KT 4Z0XB 1FRGH 1D5ZA 3VFPB 4APQD 5GRVK 3GJFA 3ZL4L 1KBGL 1JPFA 5DDHB 4XVJH 4XBPB 3I3BA 4WW2B 4XNUH 4I1NB 5F88B 3FTGA 4JJ5B 2XG5A 3S34H 1JGDB 5SX5K 4RGND 4PJBA 4Q74A 4WI6A 3H3PL 3LQMA 1QPXA 1KFAL 2NX5A 3O8XD 3GSVA 3SCMC 3MO1A 3SOBL 3DI3B 2LU7A 4XCYA 2X6MA 3P9WB 3B3IA 3HCVB 4GG6F 1A47A 4NWUH 2VIRA 4CGTA 5E8EB 1FGNL 3OJ2C 3C60A 1T6VN 5IM7B 1DQQA 2UZIL 1MJ8L 3S37H 1ITCA 2ICWI 5HDBE 3T0DA 3HMXA 4I18A 4M61B 4PBXA 5C0FB 3OKNA 3MXVL 4HK3J 1P1ZA 1Z9MA 2CKNA 1NCCH 5ERWB 2VXSH 4LVEA 4TQEL 2EDOA 2F9BT 3EGSB 3Q3GA 4QGYA 4GW4B 4F7PB 4AM0B 1QR1B 2VDPL 2QKIB 2C1PB 4J1UA 2ZOLB 5L88H 4LOUD 1HINH 1K5NB 1YNTB 4OM1L 1EX0A 4DKEL 4PRHA 5K9KB 3EOAA 3P4OA 4O5LH 2D9CA 1RJLA 3TA3A 2CUIA 4MLSA 4P0DA 2R0LH 3OMZA 4RNRB 4WU5B 5I1AA 1IGJB 3RIFF 3S37L 4ZXBD 3NPSB 4OCWL 3PGDA 5CIPB 5CEYA 4NQXB 2YSSB 2IH3A 1WT5A 2W59A 3MXVH 3KYMB 1JYXA 2IQ9H 3BWAB 1JYWA 3PQYA 5FYJE 5KN5A 3K4ZA 5T1KD 4V1DB 3QUML 4YX2H 5DMIH 3V52H 5HPMB 3FO9A 2M2DA 3U2SA 4JRYE 4L8DA 5IF0A 3VH8G 1OTSC 3ULSB 3BIAX 1AR1D 2EYRB 5E8DH 3B2VH 3TF7C 2DI9A 3MRHA 2VZ1A 3ISWA 2XTLA 5ALBH 5F7KC 3VRIA 5LJYH 3RWCA 3ZE0E 2J5LB 5HHNB 2J6EL 4QO1A 4Y8AA 3UP1A 3WD5L 2PW1B 2P4AB 2GCYB 2EDEA 3WHE0 4IJ3B 5IMOA 3MOAL 5F3BA 1BFSA 3OKYA 4NO0D 3GM8A 3P3YA 1VACA 3L95A 3DWTA 4N1EA 3RFZC 3QCTH 4FABL 5TE7L 3TT1H 3ZTNH 2HKFL 3CLEH 4CL7A 2VWEC 4IIQC 2E9IA 5DURD 1QRKA 3TH2T 4PP1C 1RUPL 5L2KE 4HWBL 2ZP0T 5DHXB 2IAMD 4MD0B 5EN2B 1LK3H 5FDWA 3S36X 4KDWA 3T0ED 2E9JA 3O3BA 1U8HA 3CDGB 4NO2A 2LAGB 5I8KL 5FYLH 1UENA 5BZWB 3SGJA 5AWNL 1LEGB 3ULUC 1J86A 5EZJB 1CU4H 3RVTC 3FFDA 4FZEH 5CZVL 3GBMH 3GJEA 3OSKA 2XTJB 2VH5H 2HKHH 2G75A 4ZTOH 1L6ZA 3LEXA 2GEEA 3PDOB 3GMOB 3S5LG 1DLHB 3K74B 5DK2B 1TLKA 4WHYH 4PJXA 1XMWA 1T04A 2V9TA 3MBEB 4QRQA 2FLRT 3HNVL 2XQYK 4Y5VA 5EO1A 3K2UH 3KPQB 1FLRL 1B4RA 1L9MA 5A40E 3MRJA 3EO0B 1ES0B 1V3LA 4NWTH 5I74B 4BFIB 3SKNA 4YHPA 1OB1A 1NMBL 1YEEL 2H45A 5FUOL 4PLKD 4PJCE 1RZ8B 5TDPA 3VXNA 2Z91A 2HTLD 3UXFA 3BXNB 3VDBA 2ZCKH 3OJMB 3UJTL 1V7ML 4LMQE 4MQXC 4L8BB 4DAGH 4M1CD 5ACMA 1MIEL 3DARA 1HXMB 1KIQB 3ECBB 5BQ7B 5DHVB 2OJZH 2ED7A 4DN3L 4U1IA 4ERSH 1GHFH 2QQNH 2DMKA 1MJUL 3PQYE 3G5VB 2MQ0A 3AS0A 4P59L 1LP9E 2FO1A 1JGUH 3LCYA 3NBNA 3FKUS 1N3NA 2YUWA 3QDGD 4KQ3H 2DI7A 5DZNA 5BRZA 3VA6A 1JZ2A 3HG1B 4OGXL 1OAKH 4M7KH 2ICWB 3HS0A 1Z6JT 2YN5A 4R7NB 3C09C 4KKCC 5E2WL 5IR1A 5F7YC 1U3HB 4L3CB 3T2QA 3BHBB 3Q5TA 5K9QG 3U0PA 4CMHB 4XMKH 2GAZB 3C5ZB 4YUEH 2DWEB 4RFEB 3D9AH 3UBXI 3AREC 4W81A 2VC2H 3QI9C 4W6XB 5ANME 3LKSA 5FECB 2J1KA 1JGUL 1F4XL 4TOYL 4U33A 4XC3L 3QQNA 1RV6X 5C0BE 5E6ZA 3GMQA 4PY8I 3MRBB 1E4XH 5DD5H 1YUHB 4Y5YA 1NDMA 4X4MA 5DD1H 5EU7C 5IJKA 3QDMD 1IGYB 3S36H 1OHQA 4HG4K 4G9FB 2BNRD 3WEXB 5D7LE 1YMMA 4KWUA 5FKAB 3HTLX 3TVMC 4V1DD 2HP4A 3TV3L 1BIIB 1IGFH 4MS8D 3HZMB 2VQTA 4JM2B 1TQCB 1EEYB 4F2MA 1S7QA 2J8UE 1DBJH 1UCBL 3H7LA 3KYOB 4U1HA 2JB6B 4ZXBB 4ZFFA 3STZA 2BNUA 4XPFH 5B21A 2VDLL 4QOKB 2NY3D 3K8MA 4FP8H 3LPWA 1CLOL 2XXCB 4NQDA 5DK0A 1ZK9A 1PQZA 2F5BH 5GRVL 2WV3A 3GSQA 1GZQA 3PDDA 1U8LB 2DJ4A 2IADB 4MD0A 2EDQA 4J6RL 1X4XA 3VXUA 1CK0L 1IGCL 3ZDYF 1EAJA 4NQED 3E3QE 5IVXA 2W65B 3BO8A 4TRPH 3PL6D 1LEGA 1RK0A 1FNGA 3OAYH 1ZXQA 4JPWH 1P4BL 5DJXA 1KNOB 1IGFL 4PS4L 4XAWH 1QSFE 1PGRB 3FQRB 1AGBA 3EYSL 5HVGB 2FX8L 1S9VB 4HUUA 3CK0H 5LBSL 1VHPA 4RGOH 5A1AA 1A6AB 3GNMH 4XNZB 1P7KB 2ZUYA 4OV5A 4Q2ZB 3T4AA 2OTUA 3PWUA 3QQ9C 5GQBA 2ZCLL 3HE7A 1XGQA 2XN9B 1YEKH 1T21A 2YHGA 4HKZA 3B9AA 3ILQC 4UAOC 2ENSA 5D1ZB 2DYPB 1OB1B 3GI8L 4XAWL 1EVTC 3OKDA 3OF6A 1UVQB 5CS7A 4J4PD 4U3HA 4WEMB 1F6AB 1U8OB 4XPGL 1IQDB 4M7LH 1XIWA 2DM3A 3S37X 2G60L 3V7MA 4WUKL 1QUNA 3DMMD 5DS8A 2IAMA 5D5MB 5FYKE 2DJSA 4JN1L 5JZ7D 2KQNA 3VXTA 3MACH 5C09B 1U8QB 2JF1A 2YD1A 3CJJA 2BOCA 2YWYA 1TZIA 1QFPA 4NQSA 3ARVA 5C0JB 4OZ4B 3HG1E 1JHKL 4F3FB 5TE4L 4R90H 1HDMA 4U1GB 2D03H 4HJGB 3D39D 3GIZL 3NN8A 1IC4L 4X7SH 3U6RA 4ENED 2H26A 1HH6B 2HVJB 1IAMA 4G9FE 1QQDA 1B3JA 4XVTH 1MELA 2EO1A 2A74B 2P24B 3REVA 3T09A 5DRWA 1U8PA 3L5HA 5T3ZL 4XPTH 1I1AC 2OR9L 5GS3A 4C58B 5C0EA 5B8CB 2BVUA 5A2LH 5MHSE 3RVXC 5I76A 4YX2L 4P2RB 4NZTL 3QPXH 2CO7B 1BGXL 1PZ5A 2V7HA 2I5YL 5IBLD 3WFHB 5ECJE 2ID5A 4KU1A 4PG2A 4L8SC 2Q7YB 3VFUB 4HHAB 2XTJC 2BNQB 2F58H 4B50A 1NAMB 2R0KH 1KN2H 5I1KH 4C55A 3TT3L 4KJWD 4PJIB 1EO7A 3GMLA 4PUBL 1CGSH 3D3VD 1FC2D 2EDDA 2HVKA 2VDML 4JKLA 4Y5YB 4WV1C 4LMQI 5D6CA 5H2BA 2PO6C 2GQHA 2IFFL 5SWSB 3UTZB 4HG4J 3WFBL 4GBXC 2VLMD 5D71L 1Q1JL 4HIJA 4UTBH 4D8PA 2V2WB 1KLGB 3VXPB 4R4BB 5D9SA 4F57H 3AU1B 1U92B 3HG1D 4M9OA 2QSTA 4MXVE 1TCMA 4CKVX 2NW3B 3MLUH 4HZAA 1CTOA 3MFGB 4AG4H 2X4RA 4ELKA 4PRPA 4YXHL 4PJAE 4ZSOB 1ZLWK 4OGAC 5DUBB 5IEKB 5TJWK 2FX9H 4X5XA 3SE9H 1KCSH 4WO4C 3RNQA 4JGMA 3U4AA 3RZCB 3DV6B 1QFUL 1NGXB 2R1XB 3ABZA 1HOCB 3ARYA 4M1DL 4LCIL 4ZD3H 4RGMB 2UWEF 5A2FA 1XZ0B 4PJ7E 1B2WH 3MRGA 2R2BB 3HC4H 5I9QC 2CDEA 4U49A 3T2NL 4LLWA 1N6QH 1PKOA 2GKIA 1G0XA 2W92A 3VA2C 2DL2A 2ZSWA 4LASL 2NX5D 3RPIA 4ZFOB 3ARFA 1PFCA 4JKPL 3D5OF 2R0ZH 1C1EL 2FX9L 4NHUA 3PV6A 1I8MB 4CMMA 5HGDA 3GKWL 4NQDD 3T3MF 2A6IA 4Q2ZA 2DQDH 3T4AB 3TZVC 2OTUB 4PLJC 5E4EC 5BZDA 4KRLB 1FZMA 2A38A 4WFEE 3RX5A 1T1ZB 2CSPA 4LSSH 2I25N 2H3NA 3QZWA 1CICD 1A7NH 5JDSA 4DFIA 2Y36H 1KTKE 3C9NA 3TYFA 1G7PB 2ICES 4JANA 5FV1L 3MUGA 2XV6B 3R0NA 3H0TA 3LQZA 5EUKB 4Z6AT 3BKYL 2HN7A 1CR9H 2HJLA 2QSCH 3CFJB 2C3VB 1BVLA 4Q6IB 4OFYD 1MJJB 1MY5A 1ZA3B 2XACC 1T5WB 1NL0L 3ROOB 4K3EL 5DJZA 4PGEA 2PUQT 5EOQH 1UWGL 3HE6C 4XCNA 1Z9LA 3C6LB 4ONFL 5JA8B 1JVKA 4P5MB 5DI8B 4WJ5B 4FMFA 5CSZA 2Y6SC 3CFBB 4M48L 2EC8A 4Y4HC 4M5ZH 1Y0LA 4HEME 1CXEA 5GS2D 1S5IL 4EI6A 4W4OA 2ZUWA 4WFHE 2FRGP 4HZLA 5LGJA 3D39B 1F4XH 4JN2B 5J6GA 5DQJA 2R9HC 3BKJL 4Q97A 1XR9B 5FYJU 3CDCA 3TIDA 2YD4A 2IG2H 4KDVA 4PJCA 1WUNT 3HB3D 1MCJA 4AIZA 4WUUA 3FO2B 1OGAE 1X5JA 3IRZA 1KTLA 3VH8B 4AEHH 1LDPL 2Y07H 2F5BL 5D7IA 3UYPA 1ZT7A 2BX5A 2DYPD 2EH7L 4YDJA 3EYQC 5IIEB 3O3DB 1GZPB 4PJAB 4ZSOE 2VL5A 1EFXB 2WNGA 4X4YA 5L2JA 1NLDL 4F80A 5F9DC 5FA4B 5IWLC 4TNWF 4GH7B 3PP4L 1R3LB 2DQUH 3QISA 5MEQB 4L3EB 3BPLC 5B3NA 1LP9A 3L5JA 1C08A 1JIBA 5JHDE 3EYSH 1YMME 1KG0B 2APWA 4NBZB 2H9GB 1R3IH 4M03A 2HLFD 2EZ0C 3FJTA 2EE3A 3L9RB 1ORQB 5E8PA 2AK1H 3WHXB 5F7HA 3NIGF 1G9NC 1QKZL 4MWFB 2JJVA 1CL7H 3TBSA 5F9AC 5IB4A 4YEEA 4X5XB 1A0QH 3PL6B 4HPOH 1CXFA 4NQTA 5J6HA 3WN5B 2WBJC 5EBLB 3MLTB 2ZWLT 4R4FL 2QQLH 1NC4D 4W6YB 1UB5A 4PD4K 1MFNA 3TPUB 4I8DA 4F8TA 2HTKD 4FTVD 1NGPH 5BVJA 1VKXB 4JG0H 4LHUG 2WW8A 3UC0L 4KRPD 5IB1B 3UTTA 5SX5H 1JRHL 3MLVH 2Y25A 4LK4A 4LSVH 4X4ZA 2V5RA 1ND0B 3FQNB 1KPRB 2IBZX 5D96C 1O7SA 3OL2A 5DQDL 1QSFB 4GRWF 3SKUD 5E9DA 3F58H 4G42B 4K9EL 1RHHB 2B2XH 5DRNA 2NY0D 3BD5A 1NUFA 1YYML 1I8MA 2VUYA 3QEUA 4X7SL 3RX8A 3C8KA 3DNKA 3TNMA 4RFNB 3P4NA 3IS0X 3C2AL 5C07B 1T1ZA 1J11A 3OXSA 5F1NB 4OTXL 4KI5D 3MGTB 2ITDB 1FG9C 1F3JB 1WC7A 2YPLB 3ULVC 5I18H 3V8OA 3QPXL 2JIXD 3JV5A 3EDEA 4UOJA 5ID0B 2Q76B 3ZTJG 4NC1E 4GQPH 4PLOB 5BOPA 1NGQH 1F3RB 4KI5C 4IRSA 5C0IA 1K8DA 2H2PC 3MSPA 2GJZB 5JORB 2DJUA 4M6OH 1OGAA 1FZJB 2O61B 4IBLT 5JPMB 3WYRA 5FYKL 4X99A 4HC1A 3N9GH 2ADGB 5JW5B 5AWNH 1MFCH 1A4JB 3PP3K 1UXSA 2NY5H 4KUCF 1EEZB 3SDCC 4UT6L 1CYGA 1ACZA 3MRIA 2EDWA 3KPLA 4CDGC 3AAZA 4U7SA 2DAVA 2WIIB 4KMTH 4Y16C 3OAZH 2AXJA 3BZEB 2X1PA 3CFBA 1F5WA 3W9DA 5DEZA 4LCCB 5JHDD 1T03L 4O02L 5F6IB 1UYWL 1IGIH 3CCHB 4MS8C 4PJ8D 5C0AB 2HTKC 4KKLD 3NVQA 3NACH 1WWAX 5DTFB 2QBWA 4P48A 4NT6B 3WS3B 5GHWH 1KACB 3ME0A 4MQ7B 5LQBL 5E2UL 5F7WC 3EYVA 3VWKD 1HHJA 2YK1L 4MMXC 2VRAA 4GXUM 1GGIH 2X1XR 1GSMA 2DBLL 2W0FB 5MP6L 3DXAB 1TITA 4GW5A 5BV7B 4M1DH 1FNFA 2CXKA 3LMJH 4H8WC 5GRZA 5INDB 2PR4H 4Z0XA 4PV9B 6FABH 2Y5EA 5DDHA 5JMOC 2GW5A 1M71B 4P57A 3ZKXB 3R4DA 4QRSA 1CQKA 1FJ1B 2B4CC 3M17B 1OGTB 3FHAA 4MA1B 3UO1L 4QRRE 4RRPA 1N0XH 1VFUA 3VFTB 1XGRB 3FFCD 1ULVA 2H9GA 1RFDL 1B4JL 4MD4B 3CXDH 3DX7A 3PWPD 1JGEB 5F70A 3RUGA 1F4HA 4RQQB 5CCKH 3V6BR 1F11B 3RWHA 2IGFH 1FAKT 2GJ6A 2OTPA 3KWWA 4KJQC 3MV9B 4MD5B 2EDNA 4P23A 4PJXF 2AEPH 2NY4C 3FB8B 5C9KA 3IDJB 5HY9A 4P9HL 2DBJA 2XWBB 5DEFA 4GXUN 2GHWB 1JFQL 4LLYA 1K8IA 1NGWB 3BJ91 1HSAB 4JZOB 1IGMH 3JWDH 2NXYB 3QUYD 5L8LB 1KCRH 4PRBB 4DOHE 3FQNA 1G7QB 4KROD 3X13A 5CILH 5KVFL 4IIQA 4G42A 4PRPE 3UCRA 4IRJA 2Y36L 4LFHG 5F7DB 1KYOK 1WZMA 4BQCA 4M7JL 4ODXB 1RZFH 2LV4A 3WIFB 4PREB 3VFGH 1EPFA 3AM8C 1UKSA 4OD3L 4YFLI 3HZKB 5J13B 1WAAF 3KYMA 1U3JA 3Q1SH 2BY1A 4TSBL 2IH1B 1YN6B 1HHHA 1EXUA 1UM6L 5FHBL 1NL0H 5T5FH 3BKJH 3LEVL 3RVVC 1B0WA 1NCAH 4P2QD 2CDFA 4Y4KA 1I9JH 2FJFB 1I1AD 2GJZA 5JORA 5D2LB 5JQ6H 3QI9B 4M48H 2FZ3A 4HLJA 4ZAKA 2WZPD 4RA0C 1X5KA 3V5HA 4OLYH 3WJLC 3ZDZF 1NMAL 5T3ZE 4NSKB 5EU5B 1I1AB 3QFJA 3UMTA 4MCYA 1TJGH 5IBTL 3BSZL 4O00A 2ORBH 5F3BB 3FAWA 4JM4H 1ODAA 4M93B 2UZXB 1XGTA 2JKXA 4RAVB 3CFCH 1AD9A 1WVZA 1N5AA 4Z7VB 4LKXB 3DRTA 1S7XA 5T5FL 3QO0A 5MERB 3GZKA 4MA8L 1IEBB 3HI1A 3CCHA 5K9OB 2CGRH 4DN4L 4TUKL 3K4AA 1G0DA 1EHLH 3KHOA 1JN6A 3S3SA 3IRPX 5JQ6L 1R3KA 1KEGH 3IVKA 5DJAA 2F5AL 4G8IB 5BJTB 5FYLE 2Q87A 4NO3B 1F90H 3GKZA 4BELD 4EZMA 3EIFA 4MHHG 1KTRL 4LHUD 1KJ2L 3IJHB 3NTCH 4FXKB 5F1IB 3FB5A 4K8RL 5JW3L 4TSAH 2DDQL 1UFUA 1XH3B 1ED3B 3OKOB 3EJZC 3D85B 3E6HA 4FS0A 4FQJL 5C0CD 1EHNA 3P30H 2YRPA 2ATKA 5GS2H 3RIAK 4JPVH 3T0VA 2VLLB 3PDOA 1PSKH 1FCCA 5ID1B 5D70H 3PHSA 1FGNH 3QBTB 1WJ3A 1RJCA 4TUKH 3KPSB 1BFVH 3PXJA 3GMMA 5L2KD 4PJ5B 1RMFL 4XCEA 1JRHI 3KXFB 2PXYC 4BZ2L 1WBZA 1AR1C 5F8RC 2I24N 3KPNB 1MFBH 4K7PL 3BW9B 4QHLA 4HLZG 4WO4B 5IK3B 1JE6A 1LD9B 5EZOL 3VJ6A 4BJLA 2OR9H 4ZOAA 3DVFA 4BSWA 4PLNC 1AGEB 4MX7B 4PRDB 2AGJH 1FGVL 1TQBB 4GKSA 4LOUC 4TNVK 1JP5A 1M05B 4LCYA 2WWKO 3VDCA 4KZDH 4XPHL 3RKPA 5T1LA 4Y19E 4ALAH 3FFCB 1GGBH 4QRRD 5CUSL 4F7TB 5J8OA 3LRHA 1ZHLA 4G6KH 4ZUSB 4F33A 4JDTH 3HI5H 3CX5K 3NCJL 4JFHE 3NAAH 4KJPD 5HYIA 1MCHA 2IWGA 2FWOB 3NFSH 4PRAB 4S0TD 4R26H 1P5UA 4X7TA 4PJ9C 1MHHB 3DETD 2AJXL 3HUJA 4LLUB 4TPRL 3UYOD 2GSIB 2ADJB 4JFEE 5HHQA 4WTZG 1I85A 1BZ7B 3O9WB 2ZUQB 3VGFA 5AG8A 5FYKH 3R06A 4P2YA 3DGCR 4R7NA 2BJMH 3ARDA 3G6AA 1P5VA 3VXOB 3LN5A 4ZO7A 4HCRH 1GOFA 3GSXB 5C6TH 2NCMA 4MQTB 2NY2B 3HZVB 1QSED 1B88A 5C0AD 3GM0A 3QUKA 3RTQD 1L7IH 1MFDH 2CIIA 2W60A 5D1QB 5HDQH 2MQCA 4L9LA 1NQBA 5DO2C 2A0LD 1IAOA 3O8XC 4GLRH 5IW1A 1BFTA 5FM5O 3ALPA 1JF6A 1NGYB 1NCWL 4JFYB 5JHLH 4ETYA 4D0DB 5EUOF 5C0CB 4MYWB 4S2SB 2VABB 1TENA 3T77A 1FYTA 3MCLL 4QHKI 4APQC 3VXUE 4OZHE 2AVGA 4FOMA 2BFVH 2I5YH 5I15L 1MCLA 1FAIH 1UXWB 4MZ3A 1F4WL 3DPBA 3QA3A 4Q58C 4RZCB 4OFIA 5DJ0B 4QHNA 2R15A 3GGWA 3ZKMC 3ZTJH 2FR4A 3L5WA 3EZ8A 4G6AC 3HHRB 2DTMH 2XWTB 5IP4A 1UZ8B 4EN3C 2FEEI 1X5XA 4EVNA 4Y2DC 3HLAB 1DBKL 1FH5H 2HFFA 2K1MA 3RVWD 4N0YL 2Y5TB 4W4NA 5C09E 3D2UA 5FFLA 3VG0L 4HUNB 3GIVA 4JZJB 4U6XA 3UX9B 4CU8A 5E94B 1IBGH 4HWEL 4YDKL 4OCRL 1KTDB 5EIQA 2UWEA 3N50A 5LWYH 1A1NB 3L1OL 2Y23A 4R2GC 4D9QD 1IC7H 4NN5B 5TH2B 5I74C 4EIZC 3JWOH 2GSGB 1KLUB 4WI7A 1QOKA 1X3DA 1ZLVK 1BJ1J 1CGXA 1PG7L 4P3DB 3ZKND 4LSPL 5DRZB 4XBPA 1CFNB 3VWJD 5ANMA 4OCNC 1LNUA 3WS6A 1GHFL 5IMKA 1JWMB 3K2MC 4JO3L 5ILTL 3WIHH 4FTVB 1HNFA 4R3SB 1P7KA 3R8BB 3V6FA 2EE9A 2ZJSL 4L1HA 4ZQKB 4DZ8A 2ZZUT 1ACYL 4KI1A 4D0CB 1FVDA 3IDGB 4LDLB 3BJLA 2G2RA 5EZIH 3OKLB 5KTEL 4DVBB 5GGUA 1ORSA 4HMDA 1XR8A 3BIBX 5E5UB 4MNGB 1NDGA 3SY0B 1C5CH 2DYPA 4L9LC 1LK2A 2A73A 3WDIA 4NFBA 3PJSB 1EHAA 1F6AA 1U8OA 4HXAH 1UG9A 4CNIA 3PUCA 1CBVL 2NXZB 2ITCA 1NCDL 1MCFA 1V3KA 1KULA 5E5MA 1IM9A 1N6UA 4ONGL 4MDIB 4OB5L 1CGSL 3T0EB 4J23A 1BBDH 4WTXA 4S1RH 5TQ2L 1NBVH 3VXRB 4UIKL 1OW0A 4LRIC 5DSCB 4KDTC 2AW2A 3PGFH 2VAAA 4YHML 2YMXH 1BZ7A 4DTGH 5J11B 3MC0A 4JZNA 4N8CL 2Y1VA 2X89D 1SM3H 3JV4B 1EERB 4A6YH 5KSUA 3OB8A 5I17B 1FNAA 4AY0A 3JWOC 1BEYL 4P2RA 3QDJD 1J0JA 4Z7QE 1HKFA 5GIRB 3LEVH 1J1OH 2R29L 3DVNB 4MHHI 3MV9E 2JCCA 3TCXA 5FF6A 2K7QA 2PYEE 3RNKB 1IKNC 2Z4QA 5EOQL 3OAZK 1TVDA 4U31A 1RJYA 3AROA 2PCPA 4CN6A 4OQTH 5FGSA 1T20A 5IHUH 1EZVY 4KTDL 5KVEH 5A16B 1S78C 4FN0A 5IOPB 1S9XB 4U0RC 1R3HB 1TJGL 3JUYA 3CU1A 5FKPA 1J9CT 3IFLL 5HHXL 1LO5B 2BHZA 4PR5A 5D2NB 5IMOB 5SWSA 2CUMA 1OAQH 4G5ZL 3DVIA 1AI1L 3CLFL 3NABL 4YXKH 5ACLA 4FQCH 1H3PH 4E42B 4X6CF 4QRUA 3QDJA 2PETA 4F7EA 5HHMB 4LCUA 4YDIL 3QQ4B 1SEQL 1G9ML 3PQYB 2GK0A 1UZ8A 2BDNH 1A2YA 2DIJA 3NTCL 4EVNB 3NPZB 5DQ9B 1WTGT 3H9SD 3MRMA 1AE6H 3RWDB 2AJUL 3RZCA 1T7YA 5E2VL 4U7KA 4MJIB 2X70A 4OFKA 3PV7A 2F8XC 3JZ7A 4LLVA 1NSNL 5D2LE 5D7JC 4RGMC 1JV5B 4I5BB 3MBEC 1W72H 4J3SA 5FK9B 3UJIH 4RCAA 5C6WH 5KBNC 1FBIL 5D1XB 5TFSL 5IQ9B 1C7SA 1U0QA 1IEAA 2OTWA 3LSOB 3LPGA 2P8MB 4NM8L 5TQ0L 5I8CB 1Q0XL 2DLGA 3MCKB 1I4FA 4HWNA 2FHFA 1CFNA 1OLZA 2C1OA 4OBSA 3B9KB 1E6OL 4C4KT 3BAEH 1CE6A 3BP4B 1G6RH 2JIXB 4YDVB 5FYKU 1ZWIA 3MRFA 3UTTD 5TDNA 2I9LB 1I3RA 4N90E 5JXED 4XPHH 4OLZL 4UNVA 1Q9OB 1RZ8A 2H3NB 5IVXE 5JO5A 4I2XE 1IE5A 2MHAB 4JRXA 3D87B 5C0GB 1LQSR 1FFOA 3FOLB 2Z8SA 4FFVC 4ZNEA 4NM8H 3GRWA 4OAWB 3MLXH 4NNXA 4AL8H 2GJ6D 2Y7QA 4QOKD 3F58L 2Q86A 4K9EH 4RRPG 4O2CB 4Y16D 1HH9A 4DGIL 2IBBA 5EU4B 5GS0D 2WWMD 2VZUA 5I1CL 2HMID 3L7FB 5FO9A 3UTOA 4EDWH 1PEWA 4O4YL 5AYQA 3RHWK 4Z0BH 1A6VL 4MNQB 5EO9B 2SEBA 3GB7A 5F9OL 3QWRA 4HCRL 4G9FD 4OFDA 4F8QA 2D7OA 1QYGH 3CSYA 3T4YB 1OP3H 2QQKH 2RQ8A 4WFGE 5I1KL 3D39A 3BGMB 5E8OA 3ARBA 3ARUA 1LEKA 4BQ9A 5C0BA 1ZT1B 3OPZL 4ZS7H 3GEWB 1DANT 4KKBD 3VXNB 1ADQA 3D18B 4YGAB 3TCLA 4NJAL 5IVZA 5IV2B 3JUZA 4J3OC 4O2FA 5FYLD 3QAZC 1LE5B 3RL2B 2I60L 1U8KB 1EAPA 2OMNA 3L6FB 5DA4A 1NFIA 3FN3A 4UZGA 5EBMB 4LPWA 5L8KB 4R9HA 5DMKA 1E4WH 1NJ9A 1ZT7B 5CP3A 3CH8A 2Q6WA 3QIUD 2C7UB 1KCVL 3QXWA 1KENH 4LVOC 3KLDA 3VE0B 3VFWA 1G7MA 4GRLD 4NZUH 2XWJB 1UT9A 3QNXA 4O2EA 2EDHA 4KK8D 3GMRA 1F4YL 4Y1AB 3VFNA 2OQJB 5MENE 4AT6A 1CGYA 5D93B 5FA3A 1YNKL 3TVMA 1NMCC 4U7MA 3VXSE 3MFFA 3QHZH 5GJTH 1FPTH 1CU4L 3RWJA 2IQ9L 3QIWA 3G04A 2F54A 4N5ED 5E6IA 5MP6H 4OKVB 2F54E 7FABH 3BKCL 4NQCE 3HUJF 4EJ1C 1H3TA 3DLQR 1PBYA 4LASH 1ZLVH 4APQA 1U58A 3MLTA 1FNGB 1MI5B 3QEQB 2V6HA 1G84A 1NKOA 4N0CC 1QSEB 4AH2A 3I6KA 5BVJB 1VKXA 1MRFL 1QLRB 2R2EA 4GG8B 3WFEL 1MPAL 5GGTA 2ZJSH 3NH7L 5JPNA 4L8SA 1CBVH 1K4CA 2XTJE 1IEAB 2XKNB 4HJ0D 4HF5L 5I8EB 4N8VB 1KCUL 1I4FB 3F7RA 4JFFA 4GBXB 3A6BL 2JB5H 3B9KA 3O6FD 5E9DD 4U6YA 4LVHC 4NQEB 5I75B 4UU9B 1EEYA 4HJ0C 3RP1A 1NAMH 1T66D 2FIKB 2B7DT 3TN0A 5F6IC 1BQHB 3FN9A 3P0VL 3PXHA 3ULVL 3EHBC 4FQLH 5KVDH 4WFED 4JM4L 2EDBA 1ZHKB 2FATL 2AKRB 4S10A 2VXVH 3O6FB 5ISZD 1DBAH 1UWEH 2I07B 3U7WH 1BPVA 2P5WE 5JNYA 4KY1H 1S7TA 1ZA6B 1AIFB 2ICEB 1N0LA 3LS4L 2GFBB 5SWSE 1UJ3A 4ZYKB 5IESL 4PLKC 1X5YA 4OD1L 1T5XB 1RZIB 4QTHA 3MV11 3X3FL 4CVUA 3E2HC 3QJFA 3CZFB 3ARGB 2CLZA 5TE6L 1AQDB 5SWZA 5B8CC 1N4XL 3QEQD 3C5ZC 5CINL 4YAQA 3BD4A 2WUBH 1DQLH 2EEBA 2WSKA 5T33L 4U1MA 3RDTC 3B9DA 1ZLSH 2VXVL 5IB2B 4KI5E 2D2OA 5E99H 1I7RA 1JZ5A 4P46A 5LXGL 3PWLA 1QP1A 1CDCA 2YZ8A 2DQTL 3MJ8B 3BP7A 5FM8A 3SDDB 1ZS8A 1KXTB 4P2RE 1R0AH 1FNEA 1ZT1A 1BWWA 3C6LD 2EEAA 1U91B 1U3ZA 5CMAB 4ORZC 1ZOXA 5CFHA 5FCSH 3ULUL 4HUXA 3OJDB 2HVKB 1S7WA 4OZ4A 3DXAA 2D31A 4LKCB 2HYMA 4Q6YA 5C8JA 3J7HA 2VXSL 4U0RB 1ZLUK 1FV1B 3LEYH 3U6RB 3EHBD 3H9SA 5AZEH 5IMMA 3LKPA 4FXGA 1IAIM 5DJDB 3CC5B 3WNNA 2NR6D 4N9OB 3FT2A 2A9MH 1NANH 3QNXB 5F89B 4N8PA 1I3GH 4LGSB 5CEZD 2QJDA 3KDMA 4WI5A 4HPYL 3RZWA 2W91A 4OIIH 4OT1L 3SJVB 5GGSY 1CN4A 5E24E 1I1RA 4P3CL 4RAHA 4Y5YC 1VGEL 4DKFL 1KT2A 1FP5A 2QR0A 3SO3B 4MD5A 3ILPB 5ENWA 2Z8RA 3RWIB 5MEND 4L4VB 4XC3H 1P69B 5ESVB 1EDQA 4E41E 4P4KA 5ALCH 1C5DB 1NCAL 4ZFZB 3HAEB 5CD5C 5DD5L 2L7UA 3MBXH 5CGYC 1CLZL 3QUMA 4FQXA 3QUZD 1IKFL 2W0KA 4GG8A 1N2RA 4L8SB 5I75C 5GGTH 4NQCD 25C8H 1NCBL 1S3KL 5CEXB 5FCUL 5KSAB 1BF8A 2GTWA 3FCTB 4Y4FA 1KB9K 4HS6A 1W0YT 4I13B 3PDGA 1FVEB 4ZPVA 2K7PA 5BZDB 1KIPA 2G5BB 3HE6B 3RVXD 4LCWB 2AERT 4MVBC 3W11C 2NW3A 3S4SG 5BVPL 2WBJD 1JGVL 4Z77B 5HYSA 1BJ8A 1XFPA 5TE7H 5D7JA 1IQWH 4HT1L 4DW2L 4JANB 4O58L 3BGFC 4JCLA 4EI5B 4OCLC 2OR8A 3O8XA 2N56A 4HWBH 3T8XB 3BDYH 1A4KA 2IQAA 2RCSL 3S6CA 4JDVA 1AY1H 2UYLA 4L4VD 4PGDB 4RAUA 1WWBX 4Z7WA 5ITBL 5DHYB 3VI3F 3O4OC 1RZ7H 4QT5B 2HJFB 3D69A 3SKJH 5LGKA 4K8RH 1NKRA 5CHNA 4XC1L 3AB0C 2R23B 4XX1E 5D4QA 3DO7B 2ZSWB 1MHPL 1X5IA 2BVPA 4LRNL 3C2SA 1RUAL 3FRUB 2FH6A 4WJ5A 1OP3K 5EA0H 1YA5A 2PTVA 5I30H 1YMMD 4NHUB 3GBLA 1KCVH 3NCBB 1UJTA 4NM4H 1J0KA 4I0CC 1JNJA 4J4PC 3MJ8A 1TPXB 1GXEA 3U9UA 3DBXA 3OKMB 5B39A 3ES6A 4JHWH 4PJHF 4NO0A 1S78D 4LFHD 1T22B 1XF3B 2ARJA 1BBJA 3IDIB 1MSPA 4WHDA 2VLRB 4YLQT 4V2CB 1CT8B 4TQEH 1MJJA 1A6PA 1ZA3A 3BKCH 3HR5A 1OSZA 2BNRE 2EIZB 2GUOA 3HZYA 4E0RB 5IHZA 4CW1B 4OD2B 1YMHB 5T1MB 3BKYH 1QO3A 2FEDD 3NFSL 2PO6A 4EOWL 1UADC 5EC2A 4GAGH 3FRPG 4TVPL 4X6FB 1KOAA 4IDLA 3PNWA 1W8NA 2M26A 2DB8A 4ZS6D 5ACZA 2QQNL 1CLYL 5D7LB 1U8JB 3IFPA 4ZDHB 1UJ3C 2X1QA 3QNYA 1G9MC 3EFFB 2P8LB 5C0AE 3MO1B 2ADFH 4N0YH 5CJ8A 5FEBA 1X4YA 3BUYB 1T1YA 3NA9L 1MQKL 3KPNA 4HZLB 2N7BA 1W0VA 3TESA 2KH2B 4FQQA 5EFIA 5GSRB 4WO4A 1BECA 5J1AA 4JVWA 3G5YB 5T1DH 3NCEB 1S9WA 1CICC 3WO4C 5JXEC 1QHOA 3MV7A 4WUUB 4LSPH 4LNRB 2ZUQC 3QHFL 3HPLA 5AZ2L 2Z93A 2Q8AL 1UB5B 1KCRL 3RU8H 1LE9B 3BD3A 1AKJA 2MQ3A 2ZG1A 3M1BB 2VC2L 1JI2A 4M43H 4PJEE 3W9EA 3O6MH 3GKWH 3MODL 4XHQA 4JHBA 1CD1A 4U6HB 4NKIH 1SY6L 4KHTL 1DSFH 4XCCL 1C16A 1TVHB 3REWB 1FYTE 3QXVA 4RWYH 1CIDA 2D4FA 3IDUA 1H3GA 1MOEA 2FDBP 5E95B 2AQ2A 4P3WA 5D7JD 1QNZL 1H15B 1CFBA 1NFDB 4Q9BA 3P4NB 4Q9QH 2H32H 4LHQB 4WW1A 3C09B 2WUBL 3ZKNC 2VNCA 3OXSB 2XN9E 2VDKH 3MRRA 3W5MA 4YHKL 5D7JB 4H0IA 4HGWB 4HUMB 3VDAA 3ALWA 3PWVB 1A6TB 4F9LA 3QNZA 4D9LL 3BPNB 5IESH 5ESAA 3RY6C 2NX5B 4O51A 2ZNWA 4OFVA 4G6MH 1W8OA 4M61A 3QUZA 1TNMA 1SEQH 2AXFB 4WI3A 1JNHA 1SJEB 4NN6C 2PF6A 3TBVB 4KMQA 1MVUA 3QPQC 4X7CC 5DHYA 4U3XA 1YDPB 3WUWG 3QUXD 3QG6A 3UTTB 4JFYA 1L6XA 3C6SB 4DCQA 1XAUA 4ODTL 2X9XA 1E6JL 3DO7A 1DBBH 4POZD 2OSLB 1E28B 1K6QH 1ZV5A 1EEZA 1O7VA 4YHYB 4L4TD 3MRIB 3GSNB 3IF1A 5FM4A 2XZAH 1RIHL 4LPUA 5HGAA 5KG9A 4NBXB 2R0WH 4JLRB 4KHXL 3VXSD 3HNVH 1AJ7H 1AGCA 2VR5A 1GJIA 3OKKB 5JLZA 4LCCA 1Q0YL 1BVKA 5KSBE 3IJYA 3MLWL 4POZC 4J6RH 4J3VA 3MRCB 3GSUA 4NUGL 4JQVC 3DIFA 4PRHB 2WMPA 4GMTH 1KB9J 5DJ8A 1R5IA 3DVGA 1ZLUH 5FDWB 1IGJA 3UJTH 1SBSH 2CMRL 2WP3T 5GRWA 2A0LC 4OIIL 1KEMH 4OT1H 5DO2D 1N59A 3GHEH 2Y5TA 1KBGH 12E8L 3QSKB 5JOFB 3L3GA 2IH3B 5DVKA 1AGDB 3L3IB 4DGVL 5CZXD 1FN4A 3CU7A 4FFZL 5HJ3A 3ULUD 3KPMA 5I1LB 1FFNA 3SGKC 1VGEH 3BGAA 1JPTL 4WDIA 2A6KA 3FN0H 2ATPA 4OZGF 3TZVD 4XNYH 4Y7MA 2UVEA 4OCXH 2A6JA 5IKCA 1FNLA 1I1FA 1OAXL 3MV8E 4NNPL 1WV7T 4XZUA 4P5TA 5EPMA 3QUXB 1EHXA 1IJ9A 1M7DA 4MAUH 1QBLH 4QXUL 3VG9B 1N7ML 3AS1A 3QIBD 2JCCF 4J2XA 3VXSA 1GIGH 5HHOD 1U8JA 3HC3L 5BRZD 4P46D 3ARGD 1KPUB 4UTAH 4HS8H 3DMMC 4UNUA 4GUPA 4Q0XL 2ZKHH 4A6YL 2BRRH 4Z0BL 3T0EC 1HK6A 4XP6L 4QWWD 2B5IB 3K0WA 4PJ8A 3RUGB 1N5YL 4JPIB 3DSFH 4JR9H 5GGVH 1ZKAA 5HHVH 3MLYH 3MRDB 4U1SA 2EH8L 3EDJA 3RTQA 3ILQD 3I6LD 2FEEL 3QO1B 4B0MM 3PJSA 2B1HH 4R2GD 1FZKA 1J8HA 1C8PA 3VD5A 5HYJE 1OTSD 3DURA 4KKNA 2XKUA 2XOTA 4R0LA 4LLQB 4NJ9H 3QFJE 3OV6A 4JGUA 4KROB 3BYTA 3K3QA 4HUVB 4Q0XH 2R8SH 2A1WH 4MQSB 4PYHA 5KAQF 5C9JB 4Y5XC 4M6MH 1P6AB 4HJJL 5FYJL 4RISL 4Q9CA 1DL7L 3O2DA 5HYJB 1FE8H 5T3XH 4QRPB 3BRGC 4PREA 2IANA 3H3PH 2NZ9D 3B9KD 3THML 1LWRA 4LIQH 5DJ2A 4XNXL 4GW1B 1DBML 1HIMH 3WIIH 2DOCA 3SGJC 1H0DB 2VISA 5TDPB 1EXUB 2BC4B 5EO1B 5BMFL 3QT2A 1TVBB 1AXSA 1XGPB 3PWVA 3T2PA 3VWKA 3TEUA 3TO4C 4OJFL 4RIRB 4NHCL 4X4XA 1H3VA 4HUWB 4WI4A 1MWAA 5A2JH 1VEPA 1MAMH 4NUJA 5IOPA 5KZCD 5CCKL 4LCIH 3L3HA 5EU3A 1CGWA 2Q8BL 4HWEH 2CDGB 3GRWL 3KGRA 4U6VL 2QQKL 3HC4L 2GIYA 1QLFB 2YEZB 5KANG 5AD0A 5CEZE 2D7NA 3A6CL 4FQ1L 1HIML 1Q94B 4WTWA 5GSVB 1GPOL 4PG9A 2NY0C 5B3JE 3SCMD 2ZCHH 4HC1L 1HI6A 4OFPA 2R0ZL 2DLHA 2VLKB 5CKGA 2BNUB 3DV4A 1E27B 3U0PB 5D7SH 2R4SH 4PV8A 3HZKA 1PJ9A 5DK0B 2FJGB 1JF1B 3SGEI 5IVNA 2R56L 3F6IA 4Y19B 3SPVA 2LVEA 3DETC 4UT9H 1RD6A 3E6FA 3SDYH 4IRSD 3LB6C 2YD7A 3TWCH 2BSRA 4UDTB 1FL3B 1TJIL 3QDMB 1ZANH 1RURL 4BFGA 1JI1A 2DS4A 3I2CH 2RBLA 1NGQL 4LLVB 1OF2B 2PYEA 2ERJB 2VDRH 1CLYH 1YN7B 3H9ZA 1Y6MR 3I02B 2YR3A 1CFSB 2DTSA 4YIQB 5F7EL 2A6KB 5D5MF 4OLUL 3H7BA 3GJFH 3V6OE 1B4JH 3STLB 1HSBA 4G43A 5JIIA 1E4XL 3QUXA 1C12B 3RA7H 1PG7X 1GAFL 4KK5C 5AYUL 3AM8A 1I9EA 3ARBC 3FQXB 5C7XL 5E08H 3VGHA 5I2IA 4S11A 3RIAF 1KPUA 3KYKL 4Z5RA 1BFOB 3QO0B 3BH8A 3EYFB 4QCIA 4BZYA 4K7FA 3LVEA 2F8OA 3NACL 1UWXH 5TGBB 1G7JB 5IFAH 4ONGH 5T1LB 5DRXA 3O2DL 4KRMB 3V4VL 3VMPA 4CMHC 2PYFB 3HRPA 1LEIA 1A7OL 4OGXH 1RZJC 2I60H 3WLBA 3BEWB 1HWGB 3QUYB 3ZYIA 4NPYB 4BKLB 2VXQL 4XCFL 3GSRA 5HYJD 2VZOA 3NCCB 4TULL 5CGTA 4NDMB 1U9KA 5DUPL 1R24B 2MKWA 2R1WB 3C5JA 3FO0H 4GT7A 2LQRA 4PJ9A 4GXVH 4P46C 2NR6C 4YBQC 3TM6A 2R69H 4E5XA 3GB7B 3FB7B 1PYWA 4FZ8L 5C70A 1YY9D 5CIPH 5ICYB 1FYHB 4YR6B 4YXHH 2WWKT 5E8EA 43C9B 4GAYB 4NQUA 3RJDA 3TO4B 3NABH 4YXKL 1B0GB 3MRPB 5H94B 3HZVA 1BFVL 4JEGB 1VGKB 5BS0A 5I16A 1H0DA 1NAMA 4YC2C 4P9ML 1BQLL 1DQTA 4GMSH 4EN3B 3HE7B 4RMUA 4YHLL 5FO7B 4K55A 1Q9KA 5IFHH 1DQLL 5J06A 5LG1A 3FO1B 4XWOC 2JTDA 3LKQB 5IB5B 2VXTH 5B39G 5CD3B 4Z8FL 2AGJL 3ZHLA 4PY7B 2IJ0C 1OSPL 3IDNB 4X7TB 4JRYD 1JPFB 3MLWH 5DLML 1VPOL 5CEZH 5HVFB 4N0FA 1FBIH 1I85C 4B7LA 1JHLH 1IRAY 4WWID 3T3PF 1MNUL 1VADA 1KCUH 2D03L 1PW3A 1EBAA 5I76B 4HPOL 4YHNA 2V2TB 5I73C 3EO1A 3E2HB 4I4WB 4OLEA 4WUUE 5CP7A 3SDDD 5HDBF 3REVB 1OWRM 1NLBH 4QRTB 1KPVB 3FQTA 4KPHL 1AGFB 1NUNB 4OCXL 2OK0L 3SO5A 4R96A 4JQXC 1QEWB 1T1XB 5GS1A 5D70L 4G9DB 1PZ5B 3EGSA 3VRIB 1I3GL 4HWZB 2EDKA 5JHDA 4HK0B 3LQAH 1OTUD 3SBWC 3I75A 3NIFF 5FHAL 4HEPG 1S8DB 4S0SD 3U46B 2HJKB 1BQHG 2OM5A 5ALBL 1CDUA 3GBNL 5T1KB 2OLDA 1RJZB 1NCWH 2AI0L 4DUWA 2ORBL 3SDXF 3PHOA 2YPLD 5ADPL 3KPPB 5EBWA 3CFKA 1JGLL 2FHBA 1X6LA 1GGCH 1O0VA 2IC2A 4H25B 1OD9A 4ZNCD 3SHSA 5IWLA 1JHKH 3G5XA 5JA9A 4XMPH 4ZFGH 4R26L 2YWZA 1U8MB 1WWWX 2NY0B 1Y6KR 1UM5L 2F5AH 4AEHL 4JO4L 5JDJA 2VOTA 3WKNA 4U1JB 3T1FA 3RUGF 3I50H 4UT7H