3QJLA

One ramp protein binding different rna substrates
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
b'HMRIEVKLLPLKDNPILPFNYNYEVYSQILEKVNSIEPTIAKLLSSPHGFWTFSRIIVRKRKILPDKGIEILSDDVSLYISSSNEDIIRAIAEAVEKSPEFKIGELSFLVGDIKAIKVKELGKENVFSTLSPIVVRTVKFEGNKLRHWDLYPHDELFMDRLRKVMILRYSEVMGETPKDRDFTIEVLKFKPTRLMVGSSYIRGSLMVFRYAGSEEIARFGYENGFGEKTGLGFGMVKLIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PH0350
publication title Cooperative and Specific Binding of a RAMP Protein to Single-stranded CRISPR Repeat RNA
rcsb
source organism Pyrococcus horikoshii
molecule tags Immune system/rna
total genus 63
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01881 Cas_Cas6 CRISPR associated protein Cas6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qjlA01
3.30.70.1900 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qjlA02
4C98A 4ILMA 4C9DA 4ILRA 3QJPA 3ZFVA 3QJJA 4ILLA 4C8ZA 3I4HX 3PKMA 3UFCX 4C97A 4C8YA 3QJLA
chains in the Genus database with same CATH superfamily
4DL6A 3HM9A 4FS1A 5B08A 2PMHA 3MMJA 2K7KA 1HNZF 2BJEA 4PUOB 2DRBA 1U1LA 3GMGA 1HBUB 4WTOB 1U1KA 3R7BB 5IT0A 1KTVA 3M8RA 2MKIA 2NUUG 2JFDA 3HVTA 4DR5J 1RB0A 3VGSA 4KYZA 4LSNB 3DRRA 2HSEB 1I1GA 3QWPA 2D1CA 3NOGA 4RW6B 1RKIA 1B7YB 1NDPA 2ZITA 1S1XA 2ASLA 3QGIA 4A8KA 2VBWA 3AOBA 3FMWA 4LRAA 3M8YA 3PYEA 1T02A 4YUDA 3QT5A 1NZ8A 3OFGA 4K4ZA 3FJ2A 2QE5A 1G2EA 3A8KA 5ETPA 4N8NA 5HK4A 1FTCA 4YR3A 1HMVB 4QR0A 3DLKA 3NAHA 5E0OA 4ZN1A 2YNGB 1SKSA 2WSEC 4ANDA 4P2MA 2R2RA 3RBXA 3J7YI 3GIIA 2QLFB 1WSRA 5J1NA 4DCJB 2BM0A 2HHQA 5GAGU 5HSPA 1FJEB 2YWGA 1VHIA 3KXDA 3T1HJ 4AUKA 2XM3A 1UAWA 2LA6A 3G87A 4X64F 4Q0BA 2R7UA 4WP9A 3F56A 3ZTPA 4K4TA 3LA0A 2FZCB 3ZZYA 2WCXA 1F2GA 1VQ4S 5SZTA 5ADZA 2R8IA 3OXGA 1B3TA 4LFAF 2LU2A 4IOCQ 2GCFA 5C2CA 4ECSA 1FE0A 1ZZNA 2DR9A 2BM1A 1SC6A 2EFQA 3GFHA 1DLOB 3CDWA 3PM9A 4WWSA 5F8NA 3SMZA 4M5LA 3LP0B 3VZHA 2PI5A 2K3IA 4A4JA 2NZ4A 1LKZA 2CJKA 1YJ9S 3CCMS 4A47A 3OLAA 2KFNA 2MGZB 4IG3A 3CCRS 4B3MJ 2LDIA 4WFXA 1SV5B 1I3OB 3M8ZA 1R8AA 3PJWA 1FA0A 2CQ3A 3EVWA 1TFWA 1SUQB 1IJFB 4LF2A 3W5YA 4JV5J 2Y8WA 1SL0A 4BWJA 4FYYB 4J5OA 3M6UA 3QT7A 1GX6A 3D2WA 1D3WA 1BMQB 2MQOA 2EWHA 4NCGA 3MPDA 2CQBA 4DV1J 4OYXA 1HI1A 3J7A1 1YIJS 3EJMA 2OPRA 2QV6A 2LVWA 1KOHA 4DR2J 3H98A 2FVQA 2MLYA 4FNHA 4WPAA 2VBYA 3MM9B 1U0SA 4UY85 2GHPA 3MM7B 1AW0A 2AF6A 3S1TA 1S6OA 1JLAA 4I6YA 4RNOA 4ZVTB 1I6JA 3N5BA 2YQ0A 3CCQS 1FE4A 1VR6A 2QSWA 3PO5A 2AKWB 1VQMS 1J5EJ 4ZPAA 4QIVA 3P6YC 3I96A 3MM5A 3E8OA 5D3GB 3FRYA 4OI0A 3GR0A 1NPKA 4V19J 2P9GA 2B6AA 3K5MA 5BJRA 2HNZB 2FJWA 4DWIA 4F0HA 1FKOA 2Z0GA 4U9RA 3M1VB 2HVZA 2RS8A 1IWAA 3CJRA 2E66A 2HHXA 4RW4B 4EFAC 1S6QA 4CTAA 4ELUA 2VG7B 3ELHA 3HI9A 2KZMA 2W9AA 4TU8A 3RRKA 1SQEA 2RQKA 4NL5A 1C4AA 2C2DA 2LDYA 4P2XA 2UP1A 3J7Z5 1LXJA 4OX9J 3M2UB 3RBDA 2ATCB 2DCUB 2D3UA 4OJ3A 1Q1KA 1PG5B 2ZBIA 1DHMA 4ER8A 1S9GB 3KJNB 2IRYA 1RTDA 1S9EA 5AE2A 4C3MA 4ZS6A 3BO4A 1JLQA 4CH1A 4LF6F 4UOCA 2AYMA 2QA4G 1VYAA 1UMJA 1XNQF 2V94A 1BQMA 1HNXJ 1XEZA 1DFDA 4ECZA 5B0AA 3D7SB 4C8NA 4IRDA 3SCJE 3BREA 1X0PA 4USIA 2QGFB 3Q8VA 3P3DA 5JVGQ 4Z7CA 4AT1B 1AZSB 2HK3A 4DZDA 3QT8A 1YRTA 3D68A 4KHRA 1KDNA 2XWXA 1LWXA 2QYCA 4I2PA 3VGTA 3AT1B 2QIFA 4K0KJ 4M5KA 3MWBA 3T1YJ 2QC3A 4HHHA 5I42A 1S76D 1XQIA 1S1WA 2X1FA 2IAJA 3BO2A 2QYGA 3N6LA 1WEYA 4A8SA 4Q8FA 2B8QA 4LF8F 2DNMA 2IMOA 1NCLA 3KNGA 3EPIA 2F4VJ 4RUAA 2HNDB 1ZM3A 5LSLA 1F0XA 4UZBA 5LM7E 1FK9A 5HP1A 1VQYA 1H72C 4H4MA 1NDLA 2KRBA 2QTWA 4CT9A 3TA0A 4K7QA 2RRAA 1DBDA 2CJ9A 4ZDNA 1OQ3A 3KLHA 1LOUA 4ZIVA 4K2JA 2HW3A 5ETMA 3WBZA 1S72S 2CJBA 3M8SA 1CEZA 3E2EA 2LEAA 3VAKA 4ZCIA 3A8JA 1VOMA 2ACMA 1JLBB 2ZE2A 4PXBA 5IC4B 2MQQA 2HYIB 3NGSA 1NMEB 4DX8H 3KWMA 3DFEA 3MUVP 2VFVA 5HAOA 4DHVA 2XO6A 1Q8IA 2V2KA 4QBUA 4FVCA 3R5CA 2V68A 4OJHA 5F8HA 1W7WA 3I0RA 4IDKA 1X4HA 5IWAF 2DH9A 1RWPB 2FHKA 4CLKA 1HW9A 3C66A 4F8RA 4QW8A 4ZVPB 5AT1B 3VF0B 1SJ1A 4F4ZA 1EKSA 1HWJA 5D8HB 2IVFB 3KHRA 3Q89A 3BGRA 1PBAA 5KFRA 2W2NP 4WIQA 3MPWA 4Y2AA 2AEMA 1UVJA 2YNHA 2CZVC 4B17A 4R5PB 3OW2R 1FFWB 3CJ2A 2XB2D 1L3VA 4ID8A 1YRXA 1UVMA 1R43A 3NS6A 2BYCA 3QBCA 3W1YC 2UVUA 4D3HA 1QVGR 4B3OB 3M30A 3OHBA 3MMAA 4OYPA 4WYWA 1NUEA 2HGLA 3UW1A 1WEXA 5F9LA 1RAAB 1LV5A 2HMIB 3C3LA 4K5RA 3CCZA 3P5TL 4JI5J 2VKZG 4MH8A 5T41A 2XLJA 1ZBTA 1UWAA 4CLLA 2Y1LB 5L9NA 3JAMU 2OHDA 3R6GB 2HQGA 2Q1LA 3CC2S 3MGJA 2R2SA 1L5UA 1JXEA 4DV4F 1MG7A 3KHHA 3TUZC 4FDFA 3UN5A 4TU9A 4NI2A 1VRUA 6FD1A 4YQWA 3Q86A 1CPZA 5IM0A 1UFLA 2YNFB 2ZH5A 5KFQA 1LFPA 3VAIA 3NXZA 2CQDA 1N36J 2WTFA 2CNOB 3U7JA 2XYHB 2LECA 3HSGA 1RHRB 3SBMA 2Y0SD 4PAAA 1FNXH 1VC5A 1TFYA 1PBUA 2CJYB 4WBFA 1WHWA 4M5IA 1Q5VA 2XMTA 4X65J 4CO1A 2BQRA 3D6MB 1C0TB 2WVEA 4ATNA 3CO9A 2GFFA 5KTQA 1I51B 4ZIWA 4B9SA 4ZPTR 4JI6F 4P73A 5C7PA 3CTRA 1OWXA 4NZ7A 2ASYA 3MR6A 1RAIB 4TU7A 3H59A 2UXBJ 3ZZOA 3UO0A 3VWSA 3OR1A 2HK2A 1YDLA 2LXUA 3P45B 1S59A 3VQSA 2R7XA 2DHXA 3V4IA 1OY9A 4DR1J 3AA8A 4JI8J 4ZKAA 5EHHA 2N3LA 3I0SA 1HWIA 4ILMA 2RU9A 2L9WA 5FLXU 4KHPJ 2O1PA 5KT3A 1VRTB 3I4HX 4HI2A 1YRUA 2QL5B 3F73A 3POTB 5KT2A 1RTIB 5L38A 1NZAA 3DOMA 1O0PA 2MTLA 1JLCB 4ZLNA 1P27B 4I67A 2KO1A 5KG7A 3FFIA 3E01B 4I0WA 2OIHA 1S10A 4WKYA 2AGPA 2Y1RI 3OXFA 4QJVA 1WWHA 1FKPA 4B9TA 4KFBA 4FKYA 1VCTA 2HBRB 4ZP8A 3J7AN 3CD6S 3A13A 1YJWS 2UUAF 3P49B 1GFWB 1RT6B 4PWUA 5DRKA 2EK6A 3DLLQ 2CZ4A 3HT0A 1XERA 2MLXA 3ZTQA 4M5JA 3CDAA 3MM6B 2C2KB 5E3RA 4LVNP 4J7CA 1GH8A 1U1RA 3HSJA 4AXJA 3UPFA 3GIKA 1RT7B 1B0PA 3PW7A 4NASA 2V4JA 5C42B 5LMNJ 1S5ZA 1H73A 3N5FA 5IOLA 3JSBA 4IFVA 1RZMA 2V2VA 4DUTA 1JNRB 2ZZNA 1NK5A 2YWEA 3MEEA 2DXDA 1V6HA 1BWVA 2B7CB 2HHHJ 5DDRC 5F3TA 1LWEB 5C5JA 3CIMA 4YY3F 4YS2A 2MKCA 5F8LA 2O67A 3BGOP 4J9KA 4DMZA 3KG4A 4QYZJ 4QR2A 3O8WA 3A3PB 1F5BA 4DV2J 1VIXA 1KQGB 1H2TZ 3HHLA 3GV8B 5GAEI 4J9NA 1EARA 2KDOA 5KG3A 1XWLA 3LP1B 3RGIA 5DLGA 2D69A 5KFOA 1HBMB 1FRJA 3RYLA 1Q7LB 2GNKA 2AU0A 1KVIA 3P4UB 2E1AA 3TARA 4NLSA 3I55S 3NGDA 1HL6A 1RHKB 2QX0A 4IRKA 1YTYA 1YITS 2LP4A 3LGNA 4UTGA 3IFEA 2L9NA 2RILA 3THVA 1T0TV 3MEDA 1WELA 2YTCA 3UVJA 4RNFA 3QQCD 3EE3A 2QSFA 4YMEA 1JMTA 2J0WA 1QD1A 3UNGC 5ETLA 2IM2A 2ZH8A 2EFGA 1ITPA 4CLUA 2J9DE 5DG9A 3PRBA 1R7IA 3R5AA 2BDPA 4LBIA 1N88A 4DI6A 5J2MA 5AXNA 2AJ1A 3P96A 1XMOF 1T9WA 2XGPA 1NM2A 4Y2CA 2UUBF 4OYWA 1C0UB 3ZXWA 5L1KA 1FDBA 4O44A 3M9MB 2LLZA 4LF9J 2GX8A 2HVDA 3DRPA 2DR8A 4JI2F 4Q44A 4L74A 1UVNA 9RUBA 5E2QA 3DDKA 1KLNA 1CBKA 3DLGB 3OUYA 1F9FA 1U6BA 4F3QA 2N82B 4B3MF 1VQPS 2IVMA 2M8DB 1REVA 3QLHA 3E51A 3JQMA 2N4DA 2H65B 2VD3A 2HQDA 3RR7A 2ZC3A 3ZZRA 2NSBA 4JV1A 2XLKA 2M88A 1QTNB 4QWCA 3G6XA 2OUGA 4WFYA 1HI0P 2DBBA 3IS9A 4I64A 2DO0A 3EVMA 1TUVA 2FJEB 1QM9A 4JUZA 2VG6A 3CCVS 4OI1A 3QZ7A 3AFGA 4XTTA 3RR8A 2WK4A 1HD0A 3W8PA 4DV1F 1U45A 2J6UA 1S0OA 2MSTA 3GFXA 1ZA1B 3IR5B 1B0VA 2PMZD 4DR2F 4ED5A 4DS4A 3UD5A 4HT7A 1S1TB 1U24A 4Y6IA 4JI7J 4QIEA 4U95A 2W8KA 2EEYA 1CQNA 4AL7A 2OEJA 2YH0A 4PQUB 2YQ1A 3PKYA 2VJUA 5E3QA 1NBEB 1BQNB 1H98A 4C98A 5CYMA 1FDNA 5E7OB 3PRVA 2DHAA 4LFCJ 2DGTA 3L7UA 1TTHB 2DXFA 3UFCX 3NBPA 3LP2B 4RW8A 1J5OA 2J9CA 2VU5A 3CD7A 1T05B 1GMVA 4O3SA 3KK1B 1VRQC 4RR5A 4C3LA 5GAHU 2JLGA 3ZZ0A 1NK4A 2HNYB 4B9VA 5F8IA 4JI3J 3I5CA 3X3UA 4CIOA 2FJAB 2VC1A 4KHMA 2CWXA 4OYOA 2UUCF 5HVHA 2OMLA 4URQU 3OFFA 4OYIA 4B3RF 4OX9F 1CJUA 4E8UA 2M2BA 2V67A 4EZ6A 5J2NA 2BE9B 4F0MA 1LWCB 3Q8RB 2HFOA 1OY8A 2IPOB 2PEBA 4G6VB 4J9SA 2CPXA 5LXYA 5GAGI 3K5OA 3H40A 1UVKA 3BGLA 1IKWB 2RUGA 1U25A 4O3OA 2BOAA 1MU2B 4B3SF 1QJHA 2DIUA 5KFPA 4OZ5A 3AOCA 1U26A 2ZDPA 2E5IA 2HS0A 1HR0F 5KFHA 4BS2A 4LF7F 4ZVOB 4C97A 1EQ0A 2IDEA 2WBMA 3OV7A 2IIHA 4RL1A 3SCIE 3R9LA 2UVRA 4DL3A 4DU8A 4DUZJ 5K8MA 2FVRA 1YJTA 4C8KA 4M95A 4DR4J 5AJ3F 4PXCA 2EI5A 4X62J 2RU3A 5MAOA 4JV0A 2MQMA 1RT3B 3NLCA 2BEFA 5CZXA 1TL7A 2JEFA 3N0VA 2B4UA 2UV8G 4C0OC 3UR0A 4FP9A 2F4VF 1DTTA 1WHXA 4M8LA 3HXMA 1ZTTA 3H8YA 3QAUA 2CQ1A 2AZ1A 4BC9A 2FQQB 3OLBA 1U4BA 2XHWA 3H0PA 4KKOB 3OBIA 4MKYA 2OP5A 5CCMA 1TVRA 3SDEA 4RLEA 3VVUA 1NHUA 3M7VA 2E44A 1T95A 3WIUA 3KLEA 3CJ4A 3C16B 1QE1A 4IQXA 2YKOA 3DDIA 2V2QA 4P10A 3PEJA 2AEJA 1S6UA 4JYAF 1SQGA 1N34F 2HPUA 5DLFA 2BR0A 1H74A 1KLMA 4DPXA 3OL8A 1U6ZA 5H1SV 2P6SA 1RJJA 3HK2A 3H7HB 3BJYA 1U47A 1NJWA 3ITHA 4GKJF 2BX6A 2NYHA 2HAIA 5IC6B 2XLIA 2ASDA 1VQ6S 4WZQA 2EKYA 3DM2B 2ASJA 7FD1A 1Y9OA 2YX4A 3KJVB 3T41A 2IC3B 4DG1A 4AFFA 1VBZA 1XJWB 3D54A 4IFYB 1NSAA 3MAAB 4CYUB 3O1LA 2B5JA 4C8MA 1HBNB 5H9EK 2DGXA 1A9NB 1Q5YA 2MKYA 2PA3A 4MKVA 2L08A 1T9YA 4O4RA 3TUJC 2FVPA 3VV2B 3QGHA 4NRUA 3D5MA 4TQSA 4ZVUB 2KU7A 1IKYB 4OI2A 4RW9A 2OD6A 5HLFB 3MFIA 4CO4A 1TKXB 3LAKA 4B3TJ 4K4XA 3QATA 3TZZA 5J2PA 2IMWP 2LEPA 2I5JB 3M8PA 2VONA 4I2QB 4GVLA 1U8SA 1JJ2R 2LYVA 2W7OA 3TJAA 4Q45A 2FLPA 4RBTA 3DNCA 5IZHA 5KAKA 1YBUA 4ED3A 4PABA 2YBVA 3Q8SB 1R3NA 3NCQA 4H4OB 4TXSA 8RUCA 2J0XA 2FD2A 1XMQJ 3L9ZA 5JMNA 3IR6B 1RWUA 3CUNA 2VODA 2HVHA 3HHDA 3AQOA 4U8YA 1M5PC 2BABA 3SSSA 1X4AA 2DH8A 4MJKA 1ZPWX 4AQYF 2FY8A 1HPZA 4GKKF 1LK5A 2FJXA 2QMUB 4R8UA 1F2HA 3NAIA 5KG1A 5JVHQ 3EMTA 4ZJLA 4HDHA 2VICA 3J7YU 3RB4A 1CULB 5C25A 1GT8A 1CS4A 1HQ2A 1U2FA 2YNIA 4LR7A 3M6WA 2VUGA 2UXCF 3V6JA 4X65F 3JAMY 2HQCA 1PCAA 2EFNA 1S1UA 1IQZA 9ATCB 4K2XA 1TKTB 3UCZP 5DG7A 1X4FA 5D0GA 4X2BA 4LR8A 4HKQA 4O4GA 4NLOA 3ISND 3WIVA 1KVKA 1VGYA 5H9FJ 1QSYA 3V6DA 3GYNA 3FZ2A 1N32F 3GWCA 5K14B 4PG5A 4XPEA 4J9RA 3CMES 2DCLA 3U1NA 3DMJA 4JI8F 4DV3J 2ATLA 3TZWA 3I9V9 3L95X 1WKLA 2L41A 2CPFA 1YWXA 1SKUB 1MLAA 4DV0J 3HJFA 1N0UA 4DV7J 1PJ7A 1ZS6A 3AAWB 3TOQA 2KG1A 2IJFA 3LPYA 1LNQA 3WZ0A 1TL5A 3EDRB 3L4BC 2RQCA 5C24A 5GVQA 1VFJA 4DOZA 4KV8B 5LJ3Y 2KVIA 3OTEA 2XMWA 1RT4A 2NXJA 3HSDA 3MR2A 2ILZA 4UT4A 2MZJA 2NXNA 4RZRA 1LW2A 3ILJA 4OI4A 5D6GA 4ED8A 2HHTA 2Y9HA 5FLXY 3T9NA 3UD4P 4WE1A 4K4YA 2V4RA 2R2TA 4DL5A 4DV5J 1HFEL 4JB8B 1YK9A 2YPYA 4KGKA 1RHUB 2MJNA 3FQKA 4X4QA 3DC2A 2IA6A 2OSRA 4ETZA 3OFHA 4EU0A 1MWQA 3C2PA 4KC5A 2W1BA 4PEOA 2BJ3A 4Z7YA 3LF0A 2KHDA 1F5CA 3CCUS 4JBCA 3ZNUA 4CM2A 1VQLS 1F9EB 3PR5B 4ES3A 5E3PA 1HW8A 1LW0A 3NEKA 1U49A 3D66A 3DLEA 3QSYB 4TY8B 2GIFA 2J7UA 2ALZA 2HHWA 5HBMB 1IKXA 2AJ0A 2BQUA 4W4MA 1JLEA 5AXLA 3CT9A 3FCHA 1TR0A 3DDNA 1LFWA 1DURA 2JVOA 2EBGA 3RU0A 3AD9C 4NA1A 1SH0A 3H2UB 1PAEX 2DK2A 1S48A 1L3SA 1IBMF 4ELVA 3I4PA 4LQ9A 1ZM2A 1EAYC 3C15A 3QIPB 1C1BB 2CJQA 4LVOP 4UOFA 1RP5A 5GMDA 2O66A 1FWPA 2Q6BA 1IUJA 4EK2A 3PW5A 1VC6A 3LTOA 1RWWB 3CD5A 4X64J 1GTHA 1QVFR 4J9MA 5KFUA 3JSMA 3B4DA 4URSA 2E9RX 2M4MA 3QYYA 1U1MA 3KK2A 4LFAJ 4ZLPA 4NMXA 5HATA 1K0TA 1WG1A 3LANA 4XK8C 5EDWA 1Y11A 4W90B 4DR3F 2D41A 4V19X 3CWJA 2JRSA 2DD8S 2ILYA 2VDHA 4QCLA 3JYTB 2IVYA 2DVIA 4IG3B 1N56A 3ENVA 2CXEA 2QL7B 4ZVQB 2LCWA 1U1NA 4LSLA 2PD1A 4FXDA 3CJTA 1HKAA 1X9MA 4DFPA 4U7CA 2KT5A 1JNZB 4ID5B 1FVSA 1H3DA 2PE8A 3GSDA 2OAUA 5KFIA 4DSEA 5A0YB 3QFHA 3UD3P 5B0GA 2RQMA 3D28A 1WSVA 4NCGB 4Z37A 3KJFB 3W2VB 3ENWA 1YBTA 2DPJA 1FNOA 2K1RB 3B82A 2GHWA 4RUHA 2A6MA 2CQHA 2VFSA 1D09B 4ANCA 5GMKa 1LK7A 2AD9A 4OZJA 4ENOA 3AJ1A 1XIQA 1JLAB 3BBBA 6AT1B 3THPA 3KDNA 1X9SA 5DZ6A 3N28A 4DQPA 4ECWA 1R8HA 2F8HA 2HHPA 2DKOB 2OSQA 5J1PA 1RU1A 2BE7D 4KQZA 3MCMA 1XR5A 2CQ4A 1WF2A 2B6AB 5G4DA 5B7WA 4FKXA 2F9DA 2UXDF 5LL6d 2WVBA 3DYAB 1QAJA 1HMVA 2MB0B 1F6TA 4OLPA 2YNGA 3MFHA 3PW2A 2DGUA 2AX0A 5DDQC 5B0EA 4FNIA 5L1IA 1OS5A 5LJ5Y 1VLOA 2YKAA 1IBLF 4TY9A 2J7KA 1X4EA 4LFCF 2DNZA 4UQGA 4ECYA 1JJHA 4MAKA 3F44A 2DGVA 3SQOP 3V2UC 4ZCLA 1RTDB 5L1LA 4NLYA 5DM6Q 4G65A 4NYPA 4I1TA 1RBAA 5ETSA 1BXNA 2MKKA 1BQMB 2ZFHA 4N77A 1YBAA 2B9EA 4ICLA 5DO2A 1HBOA 5CQGA 2JWNA 4DJBA 5GMEA 4DSLA 1AUSL 5A6WA 3LP0A 1XNQJ 4KGVB 4LRDA 1K47A 4DSFA 3MEKA 1FDAA 2CJAA 2MGZA 2LQJA 1SV5A 1Q78A 3SQGA 5I42B 2QLJB 1S1WB 2XI2A 4P7VA 5HROB 1S77D 4NLXA 2IAJB 3IBWA 4C3KA 1SUQA 1L3UA 3CDEA 3T19A 1GMWA 3N9UC 3MDFA 3I9ZA 3TAQA 2OO4A 4KGMA 2AP6A 2MZQA 3K57A 2DPIA 4C11B 4LF8J 4CLFA 1M90T 4L3NA 2CPZA 3MMBB 4H4MB 5ETTA 5HVGA 2DNLA 1O6XA 3JS9A 2CDRB 4EI2A 1FD2A 4ZP7A 4AL5A 3TWZA 3V6HA 5E33A 2YY3A 2MYFA 3MM9A 4F3OA 4DR4F 4RNNA 3MM7A 2WB1D 1VQ7S 3SZ2A 4NPOA 2Z30B 4I68A 3VAMA 2GV1A 4J91A 1UVIA 3KLHB 1ROFA 4AXIA 4MFBA 2B9YA 1F5AA 1Z4UA 4GRSA 3R5GA 2IY5B 3OR2A 1KVJA 3R7SB 5L9XA 2J5AA 1RWOB 3EVOA 2QRRA 2DHGA 3Q83A 1QUPA 4CLWA 2EC0A 2V8PA 3DOLB 4V1Ak 2H48B 3OD2A 3M1VA 1Q8BA 1N5TA 2Q79A 1T03B 4RW4A 1M5KC 4IH6A 5A8RB 2ZJPQ 1SJ4P 2R7VA 4WP3A 3D3CJ 2KI2A 4IDKB 1HI8A 4YDDB 2B9WA 4TQRA 4E2FB 4ED0A 1QY7A 4C2MA 3P5BP 2Z2ZA 5K9FA 1HQEB 2VG5B 3PG9A 3QZ8A 4M1KA 1TUGB 2RF2B 4L73A 3MPUB 1S9GA 2GJFA 4OYMA 4BBYA 3T6JA 2XMKA 3PNIA 2GMJA 3BPSP 3PCOB 3MXHP 2H9ZA 4Y28C 3OTOJ 1TL1A 3LOUA 1GXLA 2RMLA 5HMXA 3MEGA 2A10A 1D8ZA 4JI4J 1R0CB 4YB6A 2F3JA 2X3GA 3UR3C 2Y8YA 1U2CA 4MT1A 3FVYA 2XS5A 5GAHI 2HRUA 1VQSA 4L75A 2NLWA 4USWA 1AZSA 3EGWB 1RYRA 2DNRA 3M30B 1FJ7A 4EZ9A 2YVSA 4KO0B 3ADAC 3JTNA 2M3DA 2HQFA 5BYSA 2CPHA 5KFMA 1J2VA 1CJKB 4YHHJ 3C6UA 2OD4A 4B3TF 5J2QA 4DQRA 1UA1A 4X66F 4P6QA 3EX7B 1EHWA 4X4UA 4P75A 3BR9A 1RXOB 2RT3A 2V8VA 4ZMMA 3VGUA 2HNDA 4MYUA 4ECTA 1HYSA 1H2VZ 2D74B 3MMCA 3H90A 4OV1A 2MZTA 3R97A 1ZETA 4XO0A 3ETMA 5IM0B 5KFAA 3ET6B 2ZBPA 1KBRA 3S8SA 1DQ8A 4USTA 3R6LB 2R8JA 4M5DB 4DV4J 5D4OA 2JC1A 5AE3A 5GAEU 3H2LA 3PO4A 2XO7A 1XMQF 5I4MA 3HX9A 3THTA 5I3UB 5A8KA 2FC9A 3D1OA 3U1LA 2BKNA 3EZUA 2Y3YA 4WF9Q 4O3PA 2KTQA 2HKEA 2H51B 3GE9A 3NNHA 3FRZA 2KT2A 3OFEA 2CPIA 3R2DJ 4OZ3A 3TEGA 1ZM4A 3H42A 4I69A 2ZZMA 1ZOTA 2A3JA 3LGMA 1E6YB 1RTHA 2RB7A 2GA7A 1JLBA 3IM9A 2U2FA 4ZLJA 3CCJS 3K8WA 1YZ6A 3CJ8A 4RBUA 4B08A 3Q8PB 5K20B 2V9WA 4DZ6A 3PFOA 2N3OA 4OX8A 3V4IB 3V81A 5KT7A 2W8LA 1Y7PA 2IRXA 3MR3A 2RSQA 3DOKA 2H4WB 4U8VA 1IVZA 1FVQA 2VPXB 2RKIA 1RWVB 3W66A 4UW2A 5H9FK 3IWXA 3DU6A 2QMWA 3SI8A 2XMMA 2XY7A 1UKUA 1UEVA 3BH7B 1BGXT 3IM8A 1SVDA 1AROP 1ZM9A 2GQQA 2HWHA 4XDDA 1B4SA 1JLFA 2D9OA 2J9EA 4J90A 3DI6A 2EW9A 4OHVA 4NWBA 3G9CA 4OYBA 2WOMB 4ES2A 1S1VA 1FHTA 1UL3A 1BHNA 4TVAB 4R5PA 1Z2ZA 4KFBB 3RZAA 3W9JA 1WC1A 4P2SA 4I7FA 2CG8A 4PPZA 4DV0F 4K5SA 4B9UA 3IA0A 2P9EA 2BW2A 1VISA 2FTRA 3BZQA 1T8EA 3H20A 4K50A 1JXVA 4B3OA 2I38A 2UUAJ 2XI3A 4WYLA 4C9DA 4CH7A 1K73T 1NB2A 2V4JB 1NK8A 1Q4RA 2HMIA 1GXTA 2HQIA 3KG1A 4KB7A 1HWKA 1V9OA 3TQEA 2R2UA 2HRTA 5CA5A 2KKHA 2W2MP 3A8IA 2ZH2A 3GZ7A 2CQPA 4FBTA 3D6TB 3GCWP 1N33J 4DV5F 2OH2A 1K9MT 4FF2A 1EETB 2YNFA 1VHFA 1N8RT 4NZ6A 2QT7A 3UDVA 3TUIC 3J7ZT 5D4LA 4MIWA 4EBCA 4RW7B 2QZ8A 1U1OA 3M2VA 4YY3J 2XY5A 5F0UA 4YDXA 4P2FA 2LXIA 1N0VC 4NYZA 1C0TA 3BN4A 1T3NA 3AH6A 2JEGA 3AODA 2CRLA 3RB6A 3FNNA 3VZIA 2HZVA 4N56A 1WORA 2LFVA 2ZKTA 4USJC 4NYOA 2VC0A 5KFFA 5ETKA 4KBIA 5KFBA 2O5DA 4UOGA 4NE9C 3HD1A 1IR1A 3FDSA 1YJNS 3UVJB 3UWTA 1EIYB 1C1CA 2UUTA 1NPPA 1VRTA 3M32B 4O3QA 3TEHB 4BDPA 1Q95G 3OVSA 1RTIA 1RADB 1R6YA 1RAJA 2PT0A 1NXIA 2JX2A 4N41A 2BANB 5J2MB 4A8YA 3PJ9A 3QRPA 2CJXB 3K5NA 3EXCX 3AJDA 1JLCA 2HWTA 3FQLA 4QOTA 4HVZA 4ZVSB 1CC7A 3QFWA 1QDUB 4QQBA 2VQFF 1F1BB 3PW0A 4GC7A 3FEYB 1XMOJ 5T14A 1DQ9A 3DRPB 4CLPA 2UUBJ 2RE1A 3R27A 1TZ0A 4NLQA 3OUYB 2MHEA 4RBVA 1RT6A 3OPKA 4OYAA 2FHMA 1MMNA 1Q81T 1F3FA 2X3DA 5ETRA 4JI2J 2CA9A 3U1MA 1FXDA 4A46A 3MM6A 2YKNA 1IR0A 3JTPA 2ZDOA 1SIWB 1FEHA 2LQBA 1VLYA 3SV3A 4QU6A 5C42A 4HI1A 1WKJA 3IS9B 4IG0B 4IO9Q 3W7BA 2VJVA 3BDPA 3HJVA 2HLUA 4ALZA 2HEKA 2IA0A 2I6WA 1DTQB 2W9BB 3KLGB 2ZWOA 1EP4B 2NXCA 2M7SA 1LWEA 1RTJA 1UWBB 2KRRA 1S97A 3IGNA 2V9KA 5D77A 4ANEA 2ACYA 1RYSA 3C14A 3RJMB 3MM8A 4NLVA 3WC2A 1U8WA 4DX6A 1NJIT 4OHYA 2PFFB 2G9OA 4NZ0A 2CAJA 2Z2YB 5CYMB 3IG1B 2HFVA 2YPZA 3G82B 3I5AA 1OJ4A 3VVTA 2PDAA 3MTJA 1RBOB 1J5OB 2COLA 3TA1A 2HBZB 3UE2A 1I94F 4QIWD 1B70B 3BM7A 1KWMA 1RLDA 1S6PB 2HFUA 2FHJA 5KFCA 3ICLA 3DRYA 3GFZA 4OV6A 1R89A 2L3MA 3NWGA 5HI7A 1EKRA 2IJNA 1PJ6A 3CMQA 1M5OC 1JIHA 3M8QA 4DN9A 5FDLB 4DL2A 2Q43A 2DHSA 4ECVA 3WX4A 1B0TA 3HPOA 1NH7A 3GYXB 2UUCJ 4B3RJ 4CRJA 3CJKA 3HMJG 2RHSB 1Q86T 2E1MC 3QO9B 1MMLA 1JJCB 2MY8A 1C0UA 2N7YA 3BPDA 2MQLA 3RB0A 3WHIA 2R3VA 3CW2C 1N48A 3Q8UA 4ED4A 3NWRA 3QJPA 5DQIA 3B78A 4FBUA 4B3SJ 2GAGC 3DLGA 3GV5B 4F25A 1EJ7L 1SIZA 2HIYA 3KUGA 3KUHA 1Q16B 3MZIA 3HHKA 1WJ9A 2RAQA 2DRDA 1HR0J 3OJSA 2C3OA 2GZOA 2BJ8A 3GTYX 3UN3A 3H25A 5KFKA 4QPTA 4LF7J 4A8OA 1VDHA 3C8YA 2ZH7A 3NNAA 4ITSA 4O23A 3GIRA 2R8HA 4A8MP 4C0HA 3EUNA 3OVAA 4WXOA 3QAEA 3DGPA 4U7UD 2V0NA 2RHQB 3G71S 5AJ3J 1KFDA 2ABYA 3RRGA 4KH0B 2JH3A 3FGVA 4WXWA 3PV8A 3GONA 4PWWA 2M52A 3K7RA 4FVMA 4PXDA 1T11A 1U0HB 3BQ0A 3CGIA 1HHQA 1R6VA 5DZ7A 2NS1B 2G2ZA 2VF3A 1S1TA 1TVRB 2ZUAA 1BQXA 3BS9A 2V34A 2PIIA 3HHLD 3OTCA 4WIIA 1QE1B 3DXSX 4KE5A 2ZC4A 3TVYA 3HKZD 3BB5A 2QA1A 5KFLA 1BQNA 4E98A 3BBFA 5KG0A 1KHVA 2KYZA 1KLMB 1SH2A 1WD6A 2AGQA 4CQ1A 2HFSA 3VTIA 1OPIA 7FDRA 2BV3A 3FBCA 4JYAJ 1V5VA 1N34J 3RBEA 1T05A 1HARA 2CNKB 2DNGA 3KK1A 4HACA 4XDCA 4QW9A 4DN0A 3PYFA 2AT1B 2HLTA 4ECUA 4DEZA 2DH7A 2XSJB 3GU0A 2BJDA 4GKJJ 3OJUA 2ZD1B 4DG1B 3OSPA 4M94A 2RDIA 2FHOB 1YZ7A 3FZBA 5K8OA 4PG6A 2EKNA 3QSIA 4CO2A 1SCJB 2IYIA 4MK7A 1RQ0A 4RUCA 2UVWA 1S4FA 2GVDB 3KJQB 3K59A 3AOAA 3EPGA 4YB1P 4FXWA 3KG0A 1NHKL 2FGOA 3B4MA 1IKWA 2MKHA 3IBFB 4ELTA 1OY6A 1KRPA 3OTOF 1CSJA 2NQPA 2WVFA 3NGTA 4CDIA 4JI4F 4DV6F 1J27A 5F0WA 1NDKA 5AXKA 1SC4B 2YXLA 3M8PB 2AMCB 1DY3A 4PRFA 2GIRA 5J1EB 2OPSA 1EB0A 2DIVA 2IYGA 1H6KX 1TKDA 4PG7A 4K8RA 5I3PA 1WUUA 1VQ9S 2OFHX 4ZP9A 2X1BA 2VFRA 4YHHF 2OELA 2G0CA 3G8TA 3CVKA 1KS2A 4PWDB 3PEHA 1JX4A 3S7RA 5IQ6A 5D0RA 2QN6B 2BW7A 3A3NB 5U47A 3SEOA 3SCKE 1RI7A 3N01A 1NRKA 4MK8A 4RU9A 2XWYA 3IBCB 1TL3A 4ZPWR 2QO3A 5T7LB 2R7TA 4KKOA 1PO6A 1WOPA 4AQYJ 5FD1A 3VALA 2R7WA 1FJGJ 4GKKJ 3LO3A 2IHR1 2YNIB 3ZTOA 4FPRA 3RRHA 1IKVB 3OTDA 3IR7B 3C19A 1WHVA 3C6TB 3MPYA 3DGVA 3FCWA 4DPWA 1RT1B 1S1UB 4WK1A 1BE4A 3CC4S 5EWEA 2UXCJ 2APOA 2VDIA 1NK7A 4ED1A 2HHSA 4O4GB 2YKMB 1KEKA 1MWZA 2NPFA 3AD8C 4IOBA 1NU4A 2VZ9A 2JL9A 2PMWA 3T5HA 3DMJB 3DM2A 4RX6A 4RPFA 1UZHA 3KJVA 3J81j 2HFZA 2IC3A 3HULA 2HG4A 1N32J 4IFYA 2WVDA 1CJVB 4LQ3A 2QA2A 3PACA 5G0RB 5E41A 3PX6A 3MAAA 4CYUA 2PEHA 2VBZA 1ZYQA 2KJVA 3D4JA 1HBNA 2E1CA 2CQ0A 1C4CA 2CIMA 1RAEB 3G4SS 3G96A 2HFNA 2DNKA 5E3CA 3OXLA 1H7XA 3FK4A 4KPYA 2RUSA 2OEKA 2ZOFA 4CI0B 5LMUF 1UVLA 2DJWA 2K06A 4OZ1A 2ZOMA 3TZXA 4ZLLA 2A6OA 1IKYA 4K4WA 5C2GA 2U1AA 2XZDB 5D0HA 3ZZTA 2HWIA 3BYRA 1VBKA 5EX0A 1LW2B 5F8MA 5E3AA 4G1IA 4Y0FA 3NMAA 2I5JA 4NLUA 4WE1B 1JQGA 2FGCA 2G13A 1M5HA 4DQSA 2KH9A 4C8LA 1SJ3P 4KH1B 3KTQA 4OHXA 4DPOA 1OMSA 2X7IA 4HTIA 1V3ZA 3FMBA 1M5VC 1WI8A 2V2ZA 4LF1A 1HLWA 2GVZB 3FKBA 3N6NA 4AD6A 1FJCA 4L76A 2KG0A 3BBCA 2MKJA 2RJZA 3NKYA 4NA3A 3M2RA 4ED2A 4H4KC 4KSEB 2YWKA 3R1LA 2J0QD 4DLGA 3DLEB 3FSIA 2LQ9A 1N33F 2DB1A 2B4OA 3US5A 3OHAA 1IKXB 2RD5C 2ZWPA 2OI2A 4PYAA 4NXMJ 1NB7A 3CDUA 1FX4A 5CABA 4WFNQ 1MMDA 4ZJOA 1RWXB 4EMDA 1WG4A 4TN2A 5KG2A 1WF1A 4NA2A 4KPCA 1Q8LA 5B0BA 1R0AB 3FSXA 4PG4A 1H7WA 3W5ZA 1MWYA 2G4BA 3IAM9 1VQKS 3TR5A 3L3CA 4HLBA 2WSFC 2NXEA 5HO4A 2RS2A 4FYDA 1REGX 2HGMA 1IBMJ 2HRYA 3GQCA 1Y4ZB 5A8WA 3GIJA 1UP1A 2C3PA 1RUSA 1O5JA 3GJRB 3JSMB 1Q8KA 3UN2A 3MR5A 1V3SA 3FUYA 5K14A 4LF5F 4GO7X 1KD1T 3CJ3A 4N5SA 2FB0A 1YX2A 2F4FA 2E7WA 3K17A 3K58A 3GSIA 2JZ5A 3AQPA 3TAPA 4CO3A 2XEXA 2L48A 5B09A 3ILLA 3HZGA 1VQ5S 4BHQA 3KYLA 4LF4F 4DCOB 1X9WA 2MZ1A 2C22A 4DLEA 3IWNC 1MN7A 3HDSA 3UI3A 4ZVEA 2W9CA 2MSSA 1Z2LA 2XBPA 2ZH1A 3DLJA 2HURA 3BH6B 4KV8A 4DR3J 2W7AA 4B9MA 4ETXA 2CG4A 1MNEA 4LSLB 1TV6B 4F7VA 2PSZA 5KFSA 1RT5A 4P52A 2I1RA 5BYRA 1PYOB 1WC4A 1NKBA 1HQUA 3CMAS 2CUYA 1V5IB 4CNZA 3BKFA 2CYYA 2GMHA 3SXLA 2DR5A 3LPEA 3LUYA 2G1HA 3BQ2A 2I9SA 2V6AA 3CXCR 3E3XA 1Y5IB 3KHLA 2JDJA 1JKHA 2XNRA 4DXLA 4JV2A 5BR8J 4NCBA 1MROA 4L6V3 3GG1A 3QGGA 1N5YB 4F67A 4CLTA 3A12A 3RAXA 5HJYA 2XTJP 4TY8A 4ERDA 1IBKF 1BD6A 4FF3A 2HAFA 4K4SA 5HBMA 2BXJA 3K5LA 3N79A 3FBBA 2VPYB 3KLVA 4PG8A 3IP0A 4ZPCA 3NP5A 4UUXA 5L1JA 2WW4A 3P8BB 2AX1A 5K5MA 4K59A 3RAQA 3AB4B 4WJBA 3HP6A 3NGUA 2I8EA 2WONB 4NLWA 4Q2LA 3MPVA 4DR7F 2UXDJ 3IXQA 4F04B 2ERRA 3TX8A 3GR1A 3QIPA 2EFPA 3WX8A 1C1BA 4FZVA 2MEWA 2C3UA 2PA8D 2JHEA 3UCGA 4DUYJ 1IBLJ 2RDJA 4FYXB 1FRMA 2F63A 3D3BJ 1YGYA 4ZHRB 3HVRA 4DBQA 1TK8A 4LRBA 3MECB 4ZN3A 2VPWB 1N4LA 4ICLB 2BUNA 1HBOB 1TK5A 2UUWA 4Y2IA 1X5SA 1IQTA 3M8WA 1DRZA 4TLQA 3HO1A 2E5LF 4PYDA 3O3LA 2F9JA 3JYTA 3DRSB 2NUHA 3K5PA 4DX5A 3ILOA 1TL4A 2CFXA 1FCAA 3SQGB 2YH1A 4HHUA 5AE1A 1S0MA 5F3ZA 1QTMA 2VPZB 1HNWF 1HNVA 1RA6A 4WCEQ 1FKAF 1PIEA 3HKWA 4UUWA 4H54A 4ZVGA 3TA2A 3MCSA 1YI2S 4ID5A 2W25A 2AZ3A 5A0YA 1HHSA 2JVRA 3MCNA 3VAGA 2FLNA 3ZTSA 3OSNA 3BR8A 3W61A 3W2VA 3CCSS 2K1RA 2HZAA 4YP3A 5D0EA 3IWLA 3DKDA 1KOOA 5IXUA 1S0NA 1NKCA 4W92B 1NSPA 2CDQA 3TQ1A 3TNVA 3BDEA 1N52B 2FYXA 2LU1A 1UETA 2LEBA 4ZPVR 1FFGB 1NSKL 4MIAA 3T3FA 3AHPA 2ZM6F 1SH3A 2VA3A 1X4GA 3KLFB 2XCPA 1K1QA 2VIHA 4OMFG 4MFBB 2FC8A 5A2QU 4LR9A 1KQSR 5D4NA 1FXLA 3JQKA 3OR2B 1E6VB 1ICEB 2A18A 3GP9A 4P9SA 2UU9F 4LSZB 1TAUA 4KY3A 3TI0A 1IR2A 3FCVA 3MAQA 1P9YA 2QJ3A 4WFBQ 2IBKA 2E1RA 2ZVIA 4NEZA 3T5JA 3DYAA 1FXRA 2H5IB 3SFGA 3W2WB 1T9TA 2YX7A 3VAFA 4WZMA 3UDEA 3NY0A 1UW9A 3HHLC 4J9PA 3EGZA 1RCOB 3KMQA 1NAQA 1LXNA 3LAMA 3IAS9 3A8EA 2L9DA 3Q2SC 2HHUA 4G1QB 2DITA 1UJ5A 3FEXB 3JXOA 1IBCB 3B54A 1TUWA 2YKQA 2WB4A 2POKA 3QNWB 4NLGA 4I6WA 4ZVFA 2BE2B 2IM0A 1TL1B 4P72A 5F41A 4OQJA 4EBDA 1X5OA 4USHA 3MEGB 3Q0AA 1CQMA 4ZOSA 1VBYA 4DR6J 5HMYA 1RAGB 3C46A 3WC0A 4ECQA 4URGA 6FDRA 3SCLE 3PHTA 1CG2A 1CJTB 2D7SA 1SQFA 1R31A 1WF0A 1QSSA 5F8GA 1KN6A 3K0JA 5DETA 5F8JA 3GCXP 4WK3A 4YOEA 4P7TA 1M1KT 4Y3CA 4R0EA 3NMRA 2C1EB 5HROA 1SKRA 4H4KA 2V63A 4WFZA 3C6UB 2KN4A 5KOWA 5DQGA 5J2QB 3DLBA 2NXUA 5ETQA 3IRXA 2ZHBA 1N6QB 2XS2A 2QL9B 3CB4A 3G8QA 5B0DA 4LRFA 2NCKL 2MQNA 2C3MA 2X1AA 4X84A 1RGVA 1KP6A 2CQCA 4U96A 3CDBA 1HYSB 3MMCB 3FEZA 4X66J 4GVBA 2A0FB 4C11A 1L3TA 2B8PA 2AW0A 4USVA 3H4BA 1HWLA 3QWUA 2R8GA 1JLGB 3MMBA 2ZH4A 3GPAA 5IV3A 2CPYA 4YFUA 3OTBA 2LQ5A 1QAIA 1OPZA 3AD7C 2MMYA 2BACA 5A8KB 4DX7A 2VFTA 2J7WA 2A1BA 2F1FA 3F0NA 3DHXA 5LOQA 3KK3A 1FWKA 1D0EA 1IN0A 3UNYA 2MXYA 2DR7A 2GGPA 2KXFA 1BUXA 2D3ZA 2Q3PA 1NLKL 4GMKA 2Z8QA 1PYSB 4J9LA 1U6FA 2NYIA 1RTHB 4YEAA 1LWFA 3NOCA 3JTOA 1D8YA 3DOLA 4B02A 2C2ZB 2XMAA 1M1GA 1X60A 3CJQA 3KOAA 1T03A 1FJGF 2OPQB 2EK1A 4DS5A 1T94A 3V81B 2AJFE 5A8RA 2D3O1 5CYQB 2K3KA 3DOKB 2V8HA 3EICA 4ES1A 4DFJA 4G1PA 4EBEA 2RKIB 4RJVA 1MN9A 5DG8A 1HQEA 2R7SA 2VG5A 1TQLA 1SXLA 4L72B 2RF2A 2H54B 2K7JA 2FUG9 5H9EJ 1JLFB 3Q23A 3ZFVA 3DI6B 1RAHB 2B56A 2ZEJA 1U09A 3W65A 1FRHA 1Y5NB 4Q43A 2XS7A 2AJ2A 2ZUGA 1S1VB 3R2CJ 1ELOA 4MIBA 5HQLA 4X4RA 4AE5A 2M8HA 4M63A 4WU3A 3EM1A 2DHHA 1GTEA 2FZKB 2E5HA 2GMLA 2P9CA 4ZPBA 4I7FB 4CO5A 4F26A 4JI0F 2MHNA 1FFSB 1FTRA 1PC5A 5MLCV 1RT2B 5HN0A 3W3SA 4UQTA 4F4AA 3T9ZA 3IRWP 3M9NB 3LGHA 4KO0A 5HMZA 2R4FA 2W2QP 2E29A 1Y00A 4P71A 5THWA 3PX4A 4O3RA 5FIIA 5M2RA 2CPEA 2N7CA 1CJKA 4I4BA 2P5VA 3NG8A 2OMOA 3SV4A 3VAJA 2CVEA 1IM6A 2QEXS 1G1XA 1GMWD 3TAMA 2ZHOA 4WU2A 4NXNJ 1WC3A 3AXKA 3CF5Q 1U1QA 2KM8B 1P6TA 1URNA 1U02A 3O2IA 3BSAA 3PKMA 1VQNS 4NLRA 1VJWA 4NEYA 1UFKA 2UV8A 3ET6A 3T5LA 1XTZA 2M5YA 2Q6CA 2KVQE 3TO8A 3D1QA 4M5DA 4A8XA 2DNHA 2VFUA 3ISZA 2AHOB 1KQFB 3AA9A 1TAQA 2MJUA 2XHCA 3M2VB 5I3UA 3Q8QB 2K2PA 3HVTB 3CO0P 1TKZA 2GIQA 1VC0A 2M9KA 2P6TA 3TX0A 2F65A 3DRRB 4FYVB 1Y0HA 4ZK7M 1UFWA 4OZNA 3W63A 4RUBA 1U1PA 3EZ5A 2OPPA 2GQ2A 2WVCA 2DO4A 4HH0A 5B0CA 1S1XB 4TNOA 1XR6A 1E6YA 4NXMF 3AXMA 3KHGA 1WEZA 3PXGa 1UJ4A 2XG8A 2FZGB 3O6QA 3G8SA 1N5QA 1OIAA 4QWDA 3G6VA 4QYZK 3NCRA 2Y1IA 2MLZA 2DRAA 1VQOS 1C1CB 4WTYA 4TYBA 2HQ3A 4JI1J 4IKAA 1NHVA 2KJWA 3MAHA 4I6AA 1IM4A 3K89A 4LFBF 5EWFA 1S9FA 2J8AA 3DLKB 1HA1A 2BRKA 4XAKA 3KLIA 2MQPA 5HANA 3W5XA 3H4DA 1KR4A 3BSNA 2VOOA 3KNAA 1OSDA 4ZP6A 1LEOA 1RE1B 3DXBA 4Q0BB 3SFUA 4C4WA 5LSRA 1PYTA 1ZZFA 1X4CA 2WOMA 1KC8T 2EC2A 2MZRA 1PGZA 1VQ8S 1D9AA 4QIGA 1U7LA 1XNRF 3DRXA 1A7GE 1XMBA 1RU2A 2DYAA 1UJ6A 2VQFJ 4USKA 4OJ1A 2XYGB 1HNIA 2PFDA 4Y2KA 1NK6A 2XZWA 4IUFA 2CKWA 4N8OA 2YKNB 3OL9A 2R7OA 1W2IA 4HEA9 1RTZA 5IT4A 3GFYA 2B3TB 3G6YA 4MTPA 1SJQA 3PDNA 1GX5A 4ZCKA 2LMIA 3CCWA 5DM7Q 2V69A 3FBFA 1RWMB 4PPDA 2VA2A 3G6ES 4LUBA 2ZH9A 8ATCB 2ZJRQ 1KONA 3SSRA 5E5NA 1Y3JA 2BMBA 2LKZA 5DGAA 2HS4A 2RH3A 4LT6A 2YWHA 3BSCA 1EX8A 1Y10A 4N76A 1EETA 1AA1B 1RTJB 4IOAQ 1KNZA 4KAIA 3NGKA 4PUOA 4DR5F 4IRCA 1HBUA 2C2EA 2W4PA 1K0VA 3JSYA 3C14B 4K4VA 2R9LA 4RW7A 3MM8B 3MR7A 2OPRB 4HDGA 2BBEA 3PJXA 5BR8F 2X1GA 4JP8A 5GADI 4DPYA 1Q79A 2UZAA 1K1SA 2MQ8A 5SUHA 4J9VA 3RBZA 4LSNA 1VS3A 2W4DA 3KKFA 2NPIA 4RW6A 1S0VA 2AYBA 3HVWA 4EYHB 2P8IA 3W60A 3HFKA 4ZCMA 1WACA 1QLNA 1GMUA 3HHEA 3MM5B 3L7PA 2ADBA 5F9NA 4USUA 4F4XA 4BC7A 2Z4PA 4DSKA 1I94J 1FT8A 5IFMA 1FEEA 1FKOB 2IM1A 4IYQA 2G2YA 2WSCC 2XY6A 2DY9A 3M8QB 1APSA 2JFKA 3M32A 1S6QB 3T1HF 4CTAB 2YKPA 2WRMA 2EXUA 1KTQA 4DSIA 1RK8A 4ECRA 1WNEA 5EWGA 2BANA 3CJKB 3CCES 4DUYF 2GQCA 4RO0A 2VL1A 3A4TA 1DZ5A 5CH7B 2DGQA 3D0HE 2EFOA 2M0GB 4CT8A 2B0GA 3QT6A 1I5OB 2PO4A 3IMQJ 1S9EB 1R8BA 1S99A 1H2UX 3AB2B 2LA4A 1JLQB 4USMA 1WDTA 1R0BG 3W64A 4DF8A 3H5YA 1UCNA 3TZYA 4UF4A 2JEJA 2RRBA 1PJ5A 2BOPA 1RACB 1DLOA 2QLXA 1GK8A 1JJ4A 2VQEJ 4RNMA 2C2OB 2X51A 3NGRA 5LSOA 3H2VE 1TMJA 3M6XA 1CC8A 3MHYA 2J6SA 2DNNA 2KZZA 4I2PB 4PKDB 1R27B 1EZZB 4IG0A 3M9OB 3B8HA 3DGPB 4JV5F 1JXLA 2C3YA 2CNLB 1GXUA 1DTQA 1R8CA 2W9BA 2DY1A 3KLGA 1KFSA 5KFWA 1PILA 2WZ1A 1EP4A 3ONQA 3PYGA 5LXRA 2F8MA 1UWBA 3CCTA 1TELA 3V4MA 4AL6A 5KOXA 1WTBA 1WHYA 1XN9A 2VH7A 1X5TA 1FK9B 5HP1B 4F0KA 4A48A 5EUHA 4CLZA 3SIPB 2IM3A 2ZH6A 2EVZA 3IO1A 1NJZA 3QJJA 2QG9B 3CC7S 4C8YA 2XSFA 4ZJQA 1J5EF 3IG1A 1RCXB 1WC5A 3G82A 4LRCA 4N47A 2RQ4A 3R5BA 2VHGA 2Q66A 1N54B 4U6PA 1S6PA 1G7CB 4HACB 5D3GA 3H5XA 3OL6A 4HH1A 1W26A 3I56S 2ZE2B 2HNZA 4XIUA 4YB5A 2AQ4A 5ETNA 5A2QY 3GJSB 4OI3A 1Z1ZA 3TVZA 2Z56B 2VG7A 2H3EB 5FDLA 3BGFA 1HIYA 3PR4A 4FS2A 3TANA 3J80U 3I0RB 5CCLA 2OTLS 1K44A 2FLOA 1YJVA 3BSOA 3M2UA 3MUMP 2GHVC 3ZZUA 1LQ9A 3QO9A 2ZNZA 3IGVA 5K8PA 2O01C 4ZVRB 2V8DA 1F60B 2ZZTA 3O44A 5IV4A 2J6TA 2N4CA 2QLBB 1HNXF 4LMZA 3BGRB 4DL7A 5IS2A 4DR6F 2V4QA 4FXVA 3SSQA 4J9OA 5ETOA 4PZVA 4TKTA 1YSJA 1WC6A 2B4VA 1YKWA 1R8PA 1WC0A 2YNHB 2AV5A 3R7NB 3OT9A 1WOSA 2HIQA 4DV6J 2SXLA 4TYAA 3PIPQ 2OPSB 3MI7X 3QIDA 4K0KF 3T1YF 1M5SA 3Q8YA 4Y2MA 1T9XA 3D6HB 4F50A 5KFVA 1S49A 3MOZA 4BWMA 1KHWA 5KFNA 5DGBA 3MMAB 2MDAA 2RIJA 1GEHA 4PXEA 4F4KA 2EBEA 4OHWA 5CYJA 3J81U 4EO6A 4QU7A 1WI6A 5M2UA 3BQ1A 1Y5LB 2HBYB 3PZPA 4O0NA 2ZHAA 2FJBB 2GAHC 1X5PA 1TL3B 2C42A 4G3IA 2AYEA 5K8NA 4WKRA 3KDOA 1U0HA 1U48A 1DARA 4F2SA 3TP2A 3GIMA 4NI2B 1VRUB 3ENAA 4PCQA 4F36A 2JJ4D 4F2RA 3LW5C 4DFKA 1NKEA 2XMUA 3I6PA 4JOUA 5JJBA 4KGZB 1RHQB 5FJ4A 2H5JB 3W62A 4EGLA 4GO5X 4C7QA 2H1YA 4ZITA 5HMWA 3GYGA 4BCAA 3I5BA 3VCDA 1ZAVA 3LWMA 4NRTA 1XR7A 4EO8A 2DTJA 4YR0A 3AJ2A 2NZCA 1ZH5A 2FHJD 5EX3A 1FERA 3MCOA 2ZVSA 2DGSA 3PYDA 1WDDA 2QLWA 1F3VA 1SC3B 3KFWX 2XSJA 3D9BA 2YQ3A 4HT5A 2ZD1A 3OR1B 1XBWA 4CWBA 5KFTA 1AFJA 2MPUA 3R8YA 4DQQA 5KFEA 1B64A 3WQPA 8AT1B 3PVXA 4B9NA 2R7QA 3I0SB 5BYQA 1URRA 3CJSA 1WOOA 2W01A 3DHWC 2GVDA 5A76A 3GG0A 3CULA 2DISA 3DOMB 4HHJA 3T6BA 1SJRA 2VKRA 1VMBA 2V50A 2P2CB 4F3MA 1D9DA 1S12A 2AIRB 5LMUJ 1WTFA 1P8GA 4NLDA 3ISNC 3G86A 1RSCA 3FFIB 4X4TA 1G6BA 1SKWA 2MY7A 4IQMA 2E7XA 5B0FA 5D15A 4M5GA 3SYZA 1FKPB 1JK9B 2H4YB 3JQJA 4Q5VA 4LIWA 3W8GA 4U7UK 1X0FA 1Q82T 1HWUA 2ZBRA 5J1EA 2O3DA 1B7FA 1FRLA 3D1HA 1AYEA 1X7VA 4FN5A 4UY8T 3NRBA 2I2YA 1YHQS 2KXHA 4RWXA 5AXMA 4JI5F 1GAOA 1FI4A 2OKQA 5BXIA 2E5GA 4PWDA 3EGVA 3M2RB 1VK3A 1C2PA 1UA0A 4NXNF 4QR1A 3EZOA 1P1TA 1UTAA 5KT5A 3ULHA 4IFVB 5HVFA 5DDOC 1FRXA 3HLUA 4FYWB 2LXFA 4CZCA 1GQEA 3MEEB 2FJDB 2W4CA 2XNQA 2R7RA 1YG0A 5T7LA 4OZLA 3ETOA 3HZEA 4QWBA 1N36F 3HT3A 2A2DA 1Y3KA 2CWKA 2OFGX 3MF5A 3RW7A 5KG6A 1DQAA 2GJ2A 2PGCA 1IKVA 3EYZA 2OTJS 3C6TA 3GLJA 5IT9U 3M05A 3HHLB 1RT1A 3PHEA 2BA9A 4O0IA 5L8RC 1JB0C 1RHJB 2VASA 3QGPA 1NSQA 3T1AA 4DDFA 3WDOA 4OFZA 3ZNJ1 4CH0S 4NCAA 2XYPB 2YKMA 5D78A 4OYZA 5A8WB 1ZPVA 2BRLA 2UXBF 2EG2A 3VHQA 3CSKA 4KRWA 1YQHA 2EFVA 3HD2A 4ECXA 4ZVHA 4C8OA 4DR1F 4IO1A 4JI1F 3MEDB 1BLUA 3A1YG 1X31C 2GO8A 3BO3A 4KHPF 1CJVA 2XGQA 5G0RA 4LF5J 3PFEA 1D1UA 1WG5A 3K2YA 1IWGA 4X4OA 4A8WA 5HQ8A 1Q7YT 2W9CB 5LT5A 2D3OR 4Y34A 4MKAA 4D3GA 3LALA 2HS3A 2XCAA 1PC4A 3POTA 4FF1A 4LF4J 1SB6A 4KIAA 1RKJA 3HCXA 2PN6A 4U67Q 3UCUP 4M5MA 2BZ2A 3R3TA 2JLFA 3RAMA 3RG6A 1RT5B 1NK0A 5KT4A 2NR0A 2RRNA 1VJQA 3TJ9A 1HQUB 2G1DA 1AUDA 4E0DA 3NNCA 1F9HA 5DQHA 5KG5A 5KFGA 4O44B 1OQ6A 3E01A 3TW0A 4P74A 3RUBL 5CXTA 4HYKA 2C2RA 5D4PA 4F4WA 2KFYA 1HNZJ 2DEJA 4EYIB 3CPWR 2KYXA 1HHTP 4K4UA 2GVZA 1JKHB 2DR6A 5LMNF 3QRRA 2W2PP 5M2PA 5CZVA 1REVB 3QLHB 2QFIA 1MROB 1RABB 2HZCA 4DCPB 1RT7A 4YN3B 3VR1A 4IH7A 2XQCA 1V3RA 3CJ5A 3NCPA 2XMVA 3G2XA 3MD1A 2GC8A 2HHHF 4KR0B 2W24A 3TYTA 3DN9A 1B99A 2FDNA 4OL8A 4C0BA 3UQSA 3JSRA 2VG6B 2J0SD 1W25A 4OI6A 1QAXA 1VIOA 2V5HG 2QFJA 1N5VA 3U27A 1IBKJ 4DV2F 1Q53A 2ZJQQ 1FNMA 1ULRA 1S7IA 4KTQA 1MSWD 1FF2A 1BWEA 2JLEA 2XULA 1OO0B 1UEKA 1VI7A 1R0AA 2IFXA 3NL0A 2DNQA 3LP1A 4UZCA 4EWTA 3S01A 4OLOA 2ROGA 3LWLA 4DR7J 1HBMA 4NLTA 2CVIA 3K8VA 2RNEA 5KG4A 3I82A 3ZC4A 2WHOA 5HL7Q 3Q24A 3BV8A 3VAHA 1O8BA 2VBXA 3GV7B 2KXNB 2XMJA 3NBPB 4RW8B 2ZH3A 5CD4A 4YB7A 1K8AT 4CNYA 4QZVB 1A0OB 1TU0B 3CNQP 2Z2MA 2G0IA 4YR2A 2W2OP 5EGYA 2GS8A 2BJ7A 1U2RA 4LIRA 4ILRA 3D6FB 4CLSA 1A6LA 3FBEA 2B51A 4A8FA 2AWZA 1CJUB 4WFAQ 3RTVA 3QJLA 2UVVA 5J2NB 2E5LJ 2OLWA 2HVEA 3HF5A 2OJ3A 3TRGA 4LF9F 1HNVB 1TV6A 1AT1B 2ADCA 4MYTA 1NJXA 3PW4A 2J8SA 4PQAA 1HNWJ 5KFXA 3X1LB 4M5NA 3MTKA 3PX0A 5DJBA 2ZBQA 4OX7A 2YWWA 2VQEF 3S6EA 3DU5A 2M70A 1SPBP 4NOHA 1T9VA 4IR1A 3T5KA 3VQTA 1VBXA 2B9XA 2EG1A 1YJUA 3ZTRA 1H38A 1AFIA 2HHVA 4L3KA 3OL7A 1N5YA 3TJ8A 2A2CA 2Z2LA 2ZM6J 3CCLS 1TL7B 3CIZA 2VV5A 3LH2S 4BLGA 3EXYA 3BYPA 1DTTB 1X8DA 2KM8C 4Q7AA 1ZAWA 5KT6A 1NEEA 1RAFB 1FD8A 4RNHA 1W2BR 4JI7F 2NREA 2Z58B 2UU9J 2XC9A 1GNKA 4QIFA 2WONA 5CHCB 2F40A 3BEGB 4Q8EA 7AT1B 3VGVA 3SDEB 5KFYA 1UEUA 2FLLA 3KLEB 4PQUA 3N6MA 1D9FA 1G4CA 2AEFA 3UDLA 2C2NA 1XC9A 3O5TB 4FPIA 3PY8A 4IR9A 2BVZA 1OYDA 4HR2A 1G3OA 5KFJA 4DQIA 4J37A 1IJEB 3RW6A 2C2MB 3GB0A 3MOJB 2E7VA 4ZHRA 4DF4A 2RVJA 3MECA 4DU7A 3LP2A 4JI3F 3ITHB 1N5SA 1QUVA 3V5RA 2ZKUA 4LF6J 4J9UE 3HHNB 1SJFA 3IC1A 1P1LA 2NSCA 1XK8A 2HNYA 1FDDA 1S7HA 4DPUA 2CADA 3N4WA 2KB2A 2I0XA 1M0SA 4DSJA 4QPXA 2BKOA 3BF4A 3DRSA 2V8GA 3KUEA 2KL8A 3HSZA 2B5JB 1OYEA 1RAOA 1SBRA 1HD1A 4RU2A 3M6VA 4RKUC 1LWCA 4ED6A 2E9ZA 1JWWA 1YJRA 3MUTP 3OQ2A 1FESA 3IRXB 1S4EA 3D67A 2DNPA 1YJ7A 1L3KA 2EPIA 3U02A 2PC6A 2D9PA 1MU2A 4RW9B 2CQ2A 3TVKA 1FX2A 4NLPA 3H5UA 4R25A 3ILIA 4S0MA 3J80Y 4GVBB 4X4PA 4LBPA 2YX1A 2CQIA 5J2PB 1BY9A 2KT3A 5HJXA 2DGOA 2GJIA 2AYGA 2CPDA 2KHCA 2CNNB 4FF4A 3L7OA 3PIOQ 3I31A 4DUZF 4MKBA 2XZTB 4N7TA 2ALYB 3CE8A 4PR6A 4CO0A 1UPPA 4F02A 2CPJA 4OJGA 4NMLA 4X62F 4Q2MA 2OGUA 2ROPA 3A3OB 4ZPDA 2GO9A 4OX6A 4HL9A 2R42A 3KK3B 3QPIA 3KLFA 3CJ0A 2RDDA 3CEDA 4TLRA 2GGPB 1RWKB 2G2OA 5CD4H 5I3QA 1ZAXA 2PI4A 3W9IA 4HTJA 1RT3A 1E6VA 4QWEA 3FC9A 5JXSA 1LWFB 5L39A 1RISA 1M1HA 1NH8A 4OIXA 3L09A 1VK8A 5JUMA 5IQQA 1HPZB 1NPRA 2BJ9A 1RLCL 3EDQB 3NS7B 4R8UB 4OZ0A 3BN7A 1X4BA 1DJ0A 2F5GA 1TK0A 2FPHX 4MMOA 3W2WA 1SL2A 1T3OA 4LBHA 3J81Y 3I87A 2QA4S 3KMSA 2E1PA 4XPCA 1YVFA 2IRUA 1H0HB 4LJMA 2ROEA 5DS7A 1UPMB 2FVCA 5C25B 1CS4B 2AJQA 3C16A 2J76E 1AXQA 3QMQA 5DDPC 2Y1JA 4G1QA 3D0GE 5IWAJ 3BKTA 1BC6A 1UW4A 3R5DA 3F41A 4I56A 1NNDA 1KQKA 4NX9A 5CAAA 3R5JB 2BE2A 1PSDA 1TP7A 3AY0A 3IN5A 4UOHA 3V6DB 4EEYA 4J9QA 1PAUB 2H5EA 2YWFA 3FSYA 2K8GA 1NK9A 1NDCA 2CQGA 3JB9k 5KFZA 4O3NA 2AJ4A 4AYBD 3BKUA 1WKKA 1UZDA 3R1HA 1CJTA 5ITHA 1IXKA 2DNYA 2E5JA 3Q2TC 2MKSA 3DCAA 2WBRA 4ZA1A 2WW8A 1QSLA 4X4VA 4JI0J 3I32A 2GW8A 4R0JA 4DPTA 1SI9A 2E9TA 3QRQA 4ILLA 5C24B 3PRDA 3DLHA 2ZBCA 1DAXA 2BKPA 2IDLA 2B4PA 4C48A 1FRKA 2QMXA 2FVSA 2HGNA 1KKHA 1MW7A 1AB8A 4GC6A 4CLYA 3TAMB 1EQMA 1N6QA 1RT4B 4LREA 4B9LA 4KJIA 5HLFA 2KFZA 1TKXA 4OHZA 4WP8A 3W9HA 1NJYA 2HBQB 2DXEA 5KFDA 5HQMA 1JLGA 1ACMB 2B43A 5RUBA 4I2QA 3MD3A 4KT0C 3HFZB 3ZZPA 3B6BA 3ZO7A 3GJTB 5GADU 2FY1A 1RDRA 4RWWA 2IJRA 4H4OA 4Z2XA 1TKZB 1S57A 2FIUA 3LQVA 3EGNA 1OSCA 1RHMB 1S79A 4OZ2A 3ZZZA 1SL1A 1T7PA 1O51A 4X4SA 4DFMA 2OPPB 2JSXA 2OEMA 2B7BB 2G0JA 3M4XA 1FRIA 1LW0B 3EWGA 1ZTWA 2HVIA 4CM0A 2VOPA 3V6KA 4IH5A 4JI6J 3GILA 3ENQA 3H5SA 2OPQA 3D0IE 1RA7A 4MK9A 4DL4A 2ZNYA 1JLEB 2J9DA 5CYQA 1X4DA 5EN1A 3TUPA 3CD0A 3OVBA 4A8QA 1QAYA 4C8ZA 2DGWA 1CULA 3KLIB 1CLFA 1RWNB 2FJVA 3NS5A 4LFBJ 4C6AA 5L46A 3RB3A 1FO1A 4QYRA 2AGOA 2JNJA 3C15B 2W7PA 1T9UA 1TKTA 1Q0NA 2JC0A 2DNOA 1RBLA 1NO8A 3MURP 1FWLA 2JEIA 1PKUA 3PTWA 2BQ3A 2F7VA 4DV3F 3HVAA 5IT9Y 2DT9A 2LQ8A 4X4NA 1HNIB 4DV7F 5A6PA 4EUVA 4KGXB 3KK2B 1RT2A 1XNRJ 2R8KA 2DEIA 2MZSA 2IBOA 2C28A 2BJ1A 3UDCA 1ZA2B 2Z57B 4DL0C 4Y00A 2ZOGA 3HFVA 1P9QC 1KSPA 1CVJA 3BGUA 2F8EX 1YLXA 4W98A 4CCHA 2VB6A 2CZ9A 4QWAA 1SC1B 3GJQB 1TMMA 2Y0BB 2JOQA 4ED7A 5ETVA 3Q22A 4M5HA 4Y65A 2WAQD 4CP5A 4F4YA
chains in the Genus database with same CATH topology
4XDCA 4QW9A 4DL6A 3HM9A 4GKKF 1LK5A 4FS1A 2FJXA 5B08A 2PMHA 3MMJA 4R8UA 4DF8A 2K7KA 4DN0A 3NAIA 3H5YA 1HNZF 2HLTA 2BJEA 5KG1A 4DEZA 4ECUA 2DH7A 2XSJB 5JVHQ 4PUOB 2BJDA 2JEJA 2RRBA 3OJUA 1U1LA 2ZD1B 4DG1B 2DRBA 3GMGA 3OSPA 1HBUB 2BOPA 4M94A 2RDIA 2FHOB 1DLOA 2QLXA 4HDHA 1U1KA 5IT0A 3FZBA 1KTVA 5K8OA 3M8RA 4PG6A 1JJ4A 3J7YU 3RB4A 5C25A 1GT8A 2MKIA 2NUUG 1U2FA 2YNIA 4CO2A 2JFDA 3HVTA 2IYIA 3M6WA 2VUGA 4RNMA 2UXCF 2X51A 5LSOA 3H2VE 4MK7A 1RQ0A 4RUCA 2UVWA 3M6XA 1CC8A 3V6JA 4X65F 1S4FA 3JAMY 3K59A 4LSNB 3DRRA 3MHYA 2J6SA 1I1GA 2DNNA 2KZZA 4I2PB 3QWPA 3EPGA 2EFNA 4PKDB 1R27B 1S1UA 4YB1P 4FXWA 2D1CA 3KG0A 4IG0A 1IQZA 1RKIA 4RW6B 3M9OB 2FGOA 3B8HA 2ZITA 1S1XA 4K2XA 2ASLA 3B4MA 1TKTB 3QGIA 4A8KA 1JXLA 3UCZP 1IKWA 2MKHA 5DG7A 4JV5F 4ELTA 1X4FA 2C3YA 1KRPA 4X2BA 3OTOF 2VBWA 1CSJA 2NQPA 3FMWA 4HKQA 4O4GA 4NLOA 3ISND 1VGYA 5H9FJ 1QSYA 3V6DA 1GXUA 1DTQA 3GYNA 1R8CA 2W9BA 1T02A 3KLGA 3FZ2A 4JI4F 4YUDA 1KFSA 4DV6F 5KFWA 1PILA 1N32F 3GWCA 1EP4A 3ONQA 5F0WA 5K14B 5AXKA 5LXRA 2F8MA 3M8PB 4PG5A 4XPEA 1UWBA 3OFGA 4J9RA 3CMES 4K4ZA 2DCLA 2QE5A 3FJ2A 3U1NA 3DMJA 3CCTA 4JI8F 1G2EA 3V4MA 2ATLA 4AL6A 5KOXA 3I9V9 4N8NA 1WTBA 1WHYA 1XN9A 1FTCA 3L95X 2VH7A 4PRFA 1X5TA 2GIRA 4YR3A 2L41A 2CPFA 1HMVB 1YWXA 4QR0A 3DLKA 1FK9B 2OPSA 5J1EB 5HP1B 3NAHA 2DIVA 2IYGA 1H6KX 1TKDA 5E0OA 2YNGB 4PG7A 3HJFA 1N0UA 4A48A 2WSEC 1SKSA 5EUHA 2R2RA 3AAWB 5I3PA 3TOQA 3J7YI 2KG1A 2IJFA 3LPYA 2IM3A 2ZH6A 1VQ9S 2OFHX 4ZP9A 3WZ0A 3GIIA 2EVZA 3IO1A 1TL5A 2X1BA 1NJZA 5J1NA 3QJJA 3CC7S 2RQCA 2VFRA 2BM0A 5C24A 4YHHF 4C8YA 2HHQA 5GAGU 2XSFA 1FJEB 2YWGA 5GVQA 1VFJA 2G0CA 1J5EF 3IG1A 4DOZA 3G8TA 4AUKA 4KV8B 3CVKA 1UAWA 2LA6A 1KS2A 4X64F 4PWDB 5LJ3Y 3PEHA 2KVIA 4Q0BA 2R7UA 3OTEA 2XMWA 1JX4A 3S7RA 5IQ6A 1RT4A 3F56A 4N47A 3MR2A 2ILZA 2RQ4A 4K4TA 3ZZYA 5U47A 3SEOA 3SCKE 2WCXA 1RI7A 3N01A 1NRKA 2MZJA 3R5BA 1F2GA 1VQ4S 4MK8A 2Q66A 1N54B 5SZTA 4RU9A 4U6PA 4RZRA 2XWYA 1LW2A 4OI4A 5ADZA 5D6GA 4ED8A 1S6PA 2HHTA 2R8IA 3OXGA 4LFAF 5FLXY 1G7CB 2LU2A 3T9NA 4IOCQ 5D3GA 2GCFA 3H5XA 4ECSA 1TL3A 1FE0A 3UD4P 4ZPWR 1ZZNA 2DR9A 2BM1A 2QO3A 3OL6A 4WE1A 4HH1A 5T7LB 1SC6A 2EFQA 3I56S 4K4YA 2ZE2B 2V4RA 2HNZA 4XIUA 4KKOA 1PO6A 2R7TA 2R2TA 4DL5A 4YB5A 3GFHA 1DLOB 1HFEL 2AQ4A 5FD1A 3VALA 4KGKA 5A2QY 2R7WA 3CDWA 4OI3A 1Z1ZA 2MJNA 3PM9A 3FQKA 3LO3A 5F8NA 3SMZA 3TVZA 4X4QA 3DC2A 2IA6A 2IHR1 3LP0B 2YNIB 2OSRA 4ETZA 2VG7A 4FPRA 5FDLA 3VZHA 2PI5A 3RRHA 3BGFA 2K3IA 4A4JA 2NZ4A 3PR4A 1IKVB 1LKZA 3OFHA 3OTDA 3IR7B 4EU0A 4FS2A 3C2PA 4KC5A 1WHVA 3TANA 3C6TB 3MPYA 3I0RB 5CCLA 2OTLS 2CJKA 1YJ9S 2FLOA 3CCMS 4A47A 3OLAA 2KFNA 3LF0A 2MGZB 1RT1B 4IG3A 3CCRS 2LDIA 4WFXA 1YJVA 3BSOA 1SV5B 2KHDA 3M2UA 1S1UB 4WK1A 3MUMP 1F5CA 3CCUS 4JBCA 2GHVC 3PJWA 1R8AA 3ZZUA 1LQ9A 3CC4S 5EWEA 3QO9A 2ZNZA 1VQLS 3IGVA 5K8PA 2O01C 3PR5B 2V8DA 1FA0A 4ES3A 1F60B 2APOA 5E3PA 2CQ3A 1HW8A 1NK7A 3O44A 1LW0A 2J6TA 2N4CA 4ED1A 2HHSA 4O4GB 1TFWA 2YKMB 1HNXF 1U49A 1SUQB 4LMZA 1IJFB 3BGRB 3DLEA 1KEKA 1MWZA 4TY8B 4DL7A 5IS2A 2J7UA 2NPFA 4DR6F 2ALZA 2V4QA 2HHWA 5HBMB 1IKXA 4IOBA 2AJ0A 4FXVA 1NU4A 3SSQA 2VZ9A 4J9OA 2BQUA 2JL9A 1SL0A 4TKTA 1YSJA 4BWJA 3T5HA 3DMJB 3DM2A 1JLEA 5AXLA 4J5OA 4RX6A 3CT9A 2B4VA 3FCHA 1TR0A 1R8PA 3DDNA 3M6UA 3KJVA 1GX6A 2HFZA 2IC3A 1LFWA 3D2WA 1D3WA 2AV5A 2YNHB 1DURA 2MQOA 2EWHA 4NCGA 1ZH5A 2HIQA 2HG4A 2CQBA 2JVOA 2SXLA 4IFYA 1HI1A 4TYAA 3J7A1 3PIPQ 1YIJS 2OPSB 2EBGA 4LQ3A 2QA2A 3PACA 3MI7X 5G0RB 5E41A 3PX6A 2OPRA 2QV6A 2PEHA 2VBZA 3QIDA 3RU0A 4K0KF 2LVWA 1M5SA 3T1YF 1KOHA 2KJVA 1ZYQA 4NA1A 3H98A 1HBNA 4Y2MA 2FVQA 4F50A 1SH0A 3H2UB 4FNHA 5KFVA 1S49A 2E1CA 2DK2A 1S48A 2CQ0A 3MOZA 2VBYA 3MM9B 1C4CA 1L3SA 4BWMA 2CIMA 1KHWA 2GHPA 5KFNA 3G4SS 4UY85 3G96A 1IBMF 3MM7B 5DGBA 4ELVA 3I4PA 2MDAA 2HFNA 2DNKA 3MMAB 2AF6A 1AW0A 5E3CA 3S1TA 3OXLA 4LQ9A 2RIJA 1H7XA 1S6OA 4PXEA 1ZM2A 1JLAA 4I6YA 4RNOA 4F4KA 4KPYA 3QIPB 1I6JA 2EBEA 1C1BB 2CJQA 2ZOFA 4CI0B 5LMUF 4LVOP 1UVLA 2DJWA 3N5BA 4OHWA 5CYJA 3CCQS 4EO6A 4OZ1A 4QU7A 2ZOMA 1RP5A 1WI6A 5M2UA 1IKYA 3BQ1A 4K4WA 1FE4A 2QSWA 2U1AA 3PO5A 2O66A 1Y5LB 1VQMS 3ZZTA 2Q6BA 1IUJA 2HWIA 4ZPAA 4QIVA 3PZPA 3PW5A 5EX0A 1VC6A 1LW2B 3CD5A 3P6YC 1GTHA 3I96A 2ZHAA 1QVFR 4J9MA 5KFUA 3MM5A 3JSMA 2FJBB 3E8OA 5D3GB 1X5PA 3FRYA 1TL3B 2C42A 5E3AA 4G1IA 5F8MA 4Y0FA 4OI0A 2AYEA 3GR0A 4G3IA 5K8NA 2I5JA 3B4DA 4URSA 4WKRA 4NLUA 4WE1B 4V19J 2P9GA 2B6AA 1U48A 3K5MA 2E9RX 5BJRA 2HNZB 1DARA 2M4MA 2FJWA 4DWIA 3QYYA 2FGCA 2G13A 1FKOA 2Z0GA 1U1MA 4F2SA 3TP2A 3GIMA 4U9RA 3M1VB 2HVZA 2RS8A 3KK2A 1VRUB 1M5HA 4PCQA 4ZLPA 2E66A 4DQSA 2JJ4D 2HHXA 2KH9A 4C8LA 4RW4B 1K0TA 4F2RA 1SJ3P 1WG1A 3LW5C 3LANA 3KTQA 4EFAC 1S6QA 4XK8C 5EDWA 4OHXA 4DFKA 4CTAA 1NKEA 4W90B 4ELUA 4DPOA 2VG7B 3HI9A 2XMUA 2KZMA 4DR3F 3I6PA 4HTIA 1V3ZA 4JOUA 5JJBA 2D41A 3FMBA 1M5VC 2W9AA 4TU8A 3CWJA 4V19X 1WI8A 3RRKA 2JRSA 2DD8S 2ILYA 1SQEA 2RQKA 3JYTB 4NL5A 1C4AA 2C2DA 4QCLA 3N6NA 2LDYA 2UP1A 3J7Z5 2IVYA 2DVIA 4IG3B 4EGLA 4GO5X 1LXJA 1FJCA 4C7QA 3M2UB 2KG0A 3RBDA 2DCUB 2MKJA 5HMWA 2D3UA 4OJ3A 2RJZA 3NKYA 1N56A 3ENVA 4NA3A 4BCAA 3M2RA 4ED2A 4H4KC 4KSEB 2YWKA 2LCWA 3I5BA 3VCDA 3R1LA 1U1NA 4LSLA 2J0QD 1Q1KA 2PD1A 1ZAVA 3LWMA 4NRTA 2ZBIA 1XR7A 1DHMA 2DTJA 4EO8A 4DLGA 4FXDA 1S9GB 4YR0A 3AJ2A 3DLEB 2IRYA 1X9MA 1RTDA 1S9EA 5AE2A 2LQ9A 4C3MA 4ZS6A 3FSIA 4DFPA 4U7CA 1N33F 2KT5A 3BO4A 1JNZB 2DB1A 2B4OA 3US5A 4ID5B 3OHAA 1JLQA 2RD5C 1IKXB 1FVSA 1H3DA 2PE8A 2FHJD 3GSDA 4UOCA 2OAUA 4CH1A 5KFIA 5EX3A 4DSEA 2AYMA 1FERA 2QA4G 5A0YB 1NB7A 1UMJA 2ZVSA 2DGSA 3UD3P 1XNQF 2V94A 1BQMA 3CDUA 5B0GA 2RQMA 2QLWA 3KFWX 1XEZA 2XSJA 1DFDA 2YQ3A 4HT5A 3D28A 2ZD1A 4ECZA 4WFNQ 4Z37A 4NCGB 3OR1B 1XBWA 3W2VB 3ENWA 5B0AA 2DPJA 1FNOA 1MMDA 5KFTA 4C8NA 2K1RB 4IRDA 3SCJE 3BREA 1AFJA 2MPUA 1X0PA 4USIA 4DQQA 3B82A 5KFEA 2GHWA 4RUHA 1B64A 1WG4A 3PVXA 4TN2A 5KG2A 1WF1A 4NA2A 2CQHA 2VFSA 2R7QA 3I0SB 4B9NA 5BYQA 1URRA 1Q8LA 3DHWC 5GMKa 1LK7A 3P3DA 5JVGQ 5B0BA 1R0AB 2AD9A 4OZJA 3FSXA 1YRTA 4PG4A 3GG0A 1H7WA 3AJ1A 4KHRA 1MWYA 2XWXA 3CULA 2DISA 2QYCA 4I2PA 2QIFA 1JLAB 2G4BA 3MWBA 3IAM9 1VQKS 3THPA 5I42A 3TR5A 3L3CA 4HLBA 1S76D 3NMAA 1S1WA 4HHJA 2WSFC 3T6BA 1SJRA 2X1FA 2VKRA 5HO4A 2RS2A 4FYDA 1VMBA 2HGMA 2IAJA 1X9SA 2HRYA 3BO2A 3N28A 4F3MA 3N6LA 3GQCA 1D9DA 1Y4ZB 4DQPA 1WEYA 5A8WA 4ECWA 4A8SA 3GIJA 4Q8FA 1R8HA 1UP1A 2C3PA 2F8HA 1O5JA 2HHPA 4LF8F 3JSMB 2DNMA 1WTFA 1P8GA 2IMOA 2OSQA 4NLDA 5J1PA 1V3SA 3MR5A 3ISNC 3G86A 3KNGA 3FFIB 5K14A 3EPIA 4X4TA 4KQZA 4LF5F 1XR5A 2CQ4A 1WF2A 4GO7X 1G6BA 2B6AB 1KD1T 4RUAA 3CJ3A 1SKWA 5G4DA 2HNDB 1ZM3A 2MY7A 4N5SA 2FB0A 4IQMA 5B7WA 5LSLA 2E7XA 2E7WA 5B0FA 3SYZA 3K58A 1F0XA 1FKPB 1JK9B 2F9DA 5LL6d 2JZ5A 4Q5VA 4LIWA 2UXDF 4U7UK 3AQPA 1X0FA 1Q82T 3DYAB 1HWUA 1QAJA 3TAPA 1HMVA 5J1EA 1FK9A 4CO3A 5HP1A 2XEXA 2MB0B 4OLPA 2L48A 1VQYA 2YNGA 5B09A 4H4MA 2O3DA 3MFHA 1FRLA 3D1HA 1B7FA 3PW2A 2DGUA 3HZGA 1VQ5S 2KRBA 4BHQA 3KYLA 4LF4F 1X9WA 4CT9A 2AX0A 3TA0A 2MZ1A 2C22A 4DLEA 5DDQC 3IWNC 3HDSA 3UI3A 5B0EA 4FNIA 1X7VA 4FN5A 4ZVEA 2W9CA 4UY8T 3NRBA 2MSSA 5L1IA 1Z2LA 2I2YA 2XBPA 1YHQS 1OS5A 2KXHA 5LJ5Y 4RWXA 2ZH1A 3DLJA 5AXMA 2RRAA 4JI5F 1GAOA 1DBDA 2YKAA 2CJ9A 4ZDNA 2OKQA 1IBLF 4KV8A 2E5GA 4TY9A 2J7KA 1OQ3A 2W7AA 4PWDA 4B9MA 1X4EA 4LFCF 2DNZA 3M2RB 1VK3A 4UQGA 4ETXA 1C2PA 2CG4A 1MNEA 1UA0A 4ECYA 1JJHA 3KLHA 4LSLB 4MAKA 3F44A 1LOUA 4NXNF 4QR1A 2DGVA 2HW3A 3WBZA 1P1TA 3V2UC 4ZCLA 1TV6B 1RTDB 5KT5A 3ULHA 5L1LA 4NLYA 2PSZA 1S72S 5KFSA 2CJBA 1RT5A 5DM6Q 3M8SA 4IFVB 2I1RA 5BYRA 4NYPA 1CEZA 1NKBA 1HQUA 4I1TA 3CMAS 3E2EA 5DDOC 2LEAA 1FRXA 3VAKA 4ZCIA 3HLUA 2LXFA 4CNZA 4CZCA 1GQEA 2MKKA 3MEEB 2FJDB 1BQMB 1VOMA 2W4CA 2XNQA 2ZFHA 1YG0A 4N77A 2R7RA 1JLBB 5T7LA 4OZLA 3ETOA 2ZE2A 1YBAA 4PXBA 3HZEA 4QWBA 2MQQA 2HYIB 2CYYA 1N36F 4ICLA 3HT3A 5DO2A 1HBOA 2GMHA 3SXLA 4DX8H 2A2DA 2DR5A 5CQGA 1Y3KA 2JWNA 2OFGX 4DJBA 4DSLA 3KWMA 3DFEA 3LUYA 2VFVA 5A6WA 3MUVP 3MF5A 3RW7A 4DHVA 1Q8IA 3LP0A 5KG6A 2V2KA 3BQ2A 1DQAA 2GJ2A 2PGCA 4QBUA 4FVCA 2I9SA 3CXCR 1IKVA 3R5CA 4OJHA 4DSFA 3EYZA 5F8HA 3MEKA 3E3XA 2OTJS 1Y5IB 3C6TA 3I0RA 4IDKA 3KHLA 2JDJA 1X4HA 1JKHA 5IWAF 2DH9A 1FDAA 2FHKA 2CJAA 2XNRA 3M05A 3HHLB 2MGZA 1RT1A 1HW9A 2LQJA 3PHEA 3C66A 4F8RA 4QW8A 1SV5A 2BA9A 4JV2A 1Q78A 4O0IA 5L8RC 1JB0C 4NCBA 2VASA 3VF0B 3QGPA 1MROA 3SQGA 5I42B 1SJ1A 4L6V3 3T1AA 4DDFA 1S1WB 4F4ZA 2XI2A 3WDOA 3GG1A 1HWJA 3QGGA 4P7VA 1N5YB 5HROB 4F67A 4OFZA 1S77D 5D8HB 4NLXA 2IAJB 2IVFB 3IBWA 4CH0S 4NCAA 4C3KA 2YKMA 1SUQA 5D78A 1L3UA 3RAXA 3CDEA 3KHRA 3BGRA 5A8WB 1ZPVA 2BRLA 2UXBF 2EG2A 3CSKA 4KRWA 4TY8A 3T19A 4ERDA 1IBKF 1BD6A 4FF3A 4F4YA 1YQHA 4K4SA 5HBMA 2BXJA 3K5LA 3N9UC 3MDFA 5KFRA 3I9ZA 2EFVA 3N79A 3KLVA 2VPYB 3MPWA 4ECXA 3TAQA 4Y2AA