3QJLA

One ramp protein binding different rna substrates
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
b'HMRIEVKLLPLKDNPILPFNYNYEVYSQILEKVNSIEPTIAKLLSSPHGFWTFSRIIVRKRKILPDKGIEILSDDVSLYISSSNEDIIRAIAEAVEKSPEFKIGELSFLVGDIKAIKVKELGKENVFSTLSPIVVRTVKFEGNKLRHWDLYPHDELFMDRLRKVMILRYSEVMGETPKDRDFTIEVLKFKPTRLMVGSSYIRGSLMVFRYAGSEEIARFGYENGFGEKTGLGFGMVKLIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PH0350
molecule tags Immune system/rna
source organism Pyrococcus horikoshii
publication title Cooperative and Specific Binding of a RAMP Protein to Single-stranded CRISPR Repeat RNA
rcsb
total genus 63
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01881 Cas_Cas6 CRISPR associated protein Cas6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qjlA01
3.30.70.1900 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qjlA02
4ILRA 3ZFVA 3PKMA 3QJJA 4C8YA 4C97A 4C8ZA 4C9DA 3UFCX 4C98A 3QJLA 3QJPA 4ILMA 4ILLA 3I4HX
chains in the Genus database with same CATH superfamily
2OO4A 1QY7A 3RAMA 3MMAB 4FF4A 4K4VA 1RA6A 2I5JB 4NXMF 3D3BJ 3N28A 1S9EA 3M6UA 3KNAA 2AZ1A 5HJYA 2BKNA 4Q45A 3DHXA 1XMBA 4RUCA 2DHSA 1XMOF 2YKQA 3C6TB 4I2PB 4B3OB 4ALZA 4QPXA 3MD3A 1K47A 3G8QA 4ED5A 4DR7J 4M5DA 3MECB 1U25A 3IGNA 2OPSA 1HQEB 3J7AN 1XK8A 2NYIA 1H0HB 4M8LA 1GXTA 4NRUA 4DDFA 1JNRB 4USJC 2CQDA 2F3JA 2EFVA 1V9OA 1X4DA 5IT0A 5DM7Q 3PRVA 1ZS6A 3KKFA 5F8LA 3Q8QB 4JV1A 1RHUB 1JJ4A 2VPYB 3MF5A 3CXCR 1QVFR 5EGYA 1IWGA 1Q79A 1SJQA 5HLFA 2CAJA 4NRTA 4DL4A 3EGZA 2XO6A 1FKOB 3VGSA 1H2VZ 4TU8A 1R31A 2MZQA 2WSCC 1KONA 3HHDA 5I3QA 3VAGA 2JL9A 3DRRB 1UA1A 2JLFA 4CO1A 4H4MA 1VLOA 2RJZA 2BE9B 2KT3A 1UJ4A 2VFRA 4WP8A 2UU9J 2FHMA 1QUVA 1ULRA 2OPQA 4Y00A 4LFCJ 1RAEB 4KGZB 1J5EF 3LGHA 2UUCF 5IT4A 3ILLA 3QZ8A 4M95A 4P72A 3BKFA 2FHJA 4O3RA 2DD8S 3DU5A 2VD3A 4HDGA 3FUYA 4QJVA 2YY3A 4ED0A 1J5EJ 3FSXA 3JSMA 3AXMA 3NGDA 2QA1A 3HSGA 4RW9B 2UU9F 4ED6A 1NK0A 2PDAA 2NXCA 3R97A 1TV6B 2HIQA 4OHZA 3RRKA 5AE2A 1C0UA 3DLEB 2KH9A 2F8EX 1SKSA 2W8LA 4DV6J 4ID5A 2RE1A 4PQAA 1SCJB 1YJWS 1Y7PA 4RJVA 2R8KA 3R5DA 5CHCB 1DJ0A 3DYAA 2VG5A 4PPZA 3RAXA 1EQMA 1OPIA 3GR1A 3MCNA 2K8GA 4RKUC 5K9FA 5CYQA 4FYVB 2LQJA 3W5YA 1QSLA 4ZN3A 4QU6A 2IAJB 3D6HB 5EWFA 5FD1A 1SH2A 2HBRB 2VQFJ 4ECZA 2PA8D 2AHOB 2ZVSA 3SQGA 3VAKA 4GKJF 2JSXA 4ELTA 4K5SA 5HJXA 4LF6J 4LF8J 1AUDA 3SIPB 4NMXA 3S01A 1SJ4P 4RW6B 2GFFA 3VVTA 3EVOA 4DR1F 2W9CB 3OW2R 1HBUB 2OTJS 3CCQS 3ITHB 2BJ7A 2BRLA 5KFGA 4DCOB 1RU2A 1V3RA 2PIIA 1NSQA 3EXCX 4P2MA 2N7YA 1D0EA 1RT1B 5D4PA 2A18A 1WC3A 2CDQA 1LWEA 3MPUB 3K8VA 1VQYA 5THWA 5A2QU 4HKQA 1TKZB 5E3AA 4WFBQ 4WTYA 3L4BC 3OR2B 4DX6A 1WF1A 2EEYA 1SC1B 2XWYA 3MM5B 1NJWA 4ZMMA 1VC0A 1X9WA 1QSSA 1YJVA 4X84A 2L3MA 4BWJA 3VTIA 2XMWA 1S6QB 2ZM6J 3TUPA 4IR9A 2LCWA 4I64A 2HW3A 3D2WA 5H9EK 1RT6A 2BANB 4L73A 3WHIA 2CADA 1TTHB 2LKZA 3H0PA 1NZ8A 4ZLJA 2GHWA 2IVMA 4ZJLA 1A6LA 2YWFA 4QQBA 5IV4A 2OUGA 3H5UA 1VRTB 4LFBJ 2OTLS 4ZPWR 1FESA 5IM0A 2GIQA 3H59A 4DV0J 4KY3A 1GX6A 1VFJA 2DITA 2C3PA 4P73A 3OVBA 2FGCA 2PSZA 2XHCA 4WFXA 1NHVA 1XMQF 1I94J 4HR2A 2R7UA 2V9KA 1U1NA 4E0DA 5MAOA 4DPOA 1SL0A 2J0WA 5D3GB 1KVIA 2RUSA 1N34J 1ZA1B 3U7JA 2ZOFA 1RTJA 2V68A 4KPCA 5CZXA 1Q8BA 3Q8RB 5JVHQ 1T02A 4Y2AA 3A13A 4USVA 4DQSA 4ED4A 1Q7YT 1GMWD 1U24A 3P4UB 5KFUA 2EFOA 3BR9A 1N52B 3RBEA 1WF2A 1NDKA 2K7KA 2YTCA 5KFPA 4YOEA 5HATA 4NYOA 3IRWP 3DGPA 3UWTA 2DO4A 3UCUP 3QIPB 2QV6A 3GV7B 3NCPA 4QZVB 1VK3A 4N8NA 5DJBA 5AXMA 4M5GA 4CO2A 1IBCB 5M2PA 4FYDA 1AB8A 2Z0GA 3CT9A 3OXFA 4I2QA 1S99A 2YNIB 1YZ7A 3U1NA 5KOXA 2MKSA 5F9NA 4RU9A 4DV3J 1G4CA 1U1LA 2DNMA 3I0SA 2DNZA 2NXJA 4DR7F 1K0VA 2P9EA 2HS4A 4BC7A 5BR8F 1F9EB 1OSDA 4CH1A 1HIYA 1HI8A 5B0EA 2VODA 4WFYA 2GVDA 2AEMA 2RNEA 1RT4B 1JMTA 2D1CA 3DLKB 2JC0A 3DLGA 5JXSA 3PIPQ 4NWBA 1Z1ZA 2X51A 3TAMA 2BYCA 5LJ5Y 5FDLB 4Q5VA 3H5YA 1QUPA 5L1KA 1U47A 4M94A 3M6WA 2C42A 1JKHB 4MFBA 3NY0A 2CQGA 2KO1A 4DR6J 2IFXA 3GSDA 2GMLA 1RTHA 2NPIA 2YKMB 5DG7A 2KT2A 3H5XA 2ZZTA 3AQPA 1QLNA 3CCRS 2IC3B 3L9ZA 5ETSA 1ZOTA 3W9JA 4HDHA 4NLSA 1DTTB 4YS2A 4QWCA 3KLIB 2XGQA 3CJ0A 1L5UA 1DY3A 1GAOA 5D0RA 1Y5LB 3MAQA 1JQGA 3CD7A 2RF2A 4QYRA 4HH1A 2VFTA 3ZC4A 4ED7A 4BDPA 2Q6BA 3O1LA 2FJWA 1K9MT 2EK6A 4QIEA 3UPFA 5EWGA 2P9GA 4ZP8A 2UXDF 4CH7A 4Q8FA 1RWPB 1Q1KA 2O67A 4L6V3 2UP1A 1MMDA 3C66A 2OMLA 3MEGA 2C1EB 4OFZA 3TUIC 4J9QA 4WFNQ 1FJGJ 1YZ6A 4G65A 2FVSA 2ACYA 2GGPA 3DOLB 1W2BR 3A8KA 4C8YA 2DGUA 4RL1A 1ZYQA 4RU2A 1HYSA 3QT6A 1OPZA 1VRQC 3W61A 2R7XA 4WP3A 2YPZA 4DPXA 1KOOA 1IQTA 1FRIA 3IWXA 2GNKA 2W4CA 3I5AA 5A2QY 4JI2J 3I0RA 3CJ4A 4RNOA 4FF1A 3AJ2A 1X5OA 2RHQB 4X4NA 2ZFHA 3D4JA 3R1HA 1I6JA 2VKZG 3PW7A 2IA0A 1B7FA 3OLBA 1UAWA 1N0UA 2ACMA 2G0JA 2YNFB 4QIVA 5D0GA 3VGUA 4L3NA 4A46A 4B3SF 2F9DA 4F0KA 1D8ZA 1SC4B 3GILA 3BKUA 2KJVA 1JLEB 2Z30B 3ILJA 5J1PA 3SYZA 3DOLA 1P27B 2QSFA 2KRRA 4DUTA 2MQPA 1U1OA 4B3SJ 1UWAA 1JLGB 1SQFA 3LPYA 3U1LA 1YJTA 3MFHA 3M2VB 1FEHA 1M5SA 1RTZA 2GJ2A 2HPUA 3HZGA 2IVYA 4F4AA 4LSNA 2ZH8A 4JI1F 3R6LB 2WZ1A 3T1HF 1HWLA 4B3MJ 2IIHA 3EPGA 2WVEA 2D7SA 3C6UA 3UD5A 4DG1B 2R2RA 4PQUA 1TL7A 3BN7A 4DCPB 2HWHA 4FN5A 1KOHA 1KTVA 3E51A 4J90A 2XYHB 3D67A 3CCJS 1NCLA 1PC5A 3NWRA 4JI0J 3K5PA 2HHPA 2PEBA 2QL7B 4C3LA 4OZ2A 1UPPA 2VBZA 1FT8A 2AW0A 3Q86A 4ZLLA 2Z57B 1DQ9A 1GEHA 1RSCA 1S1VB 3C15A 5B08A 5KFMA 1UW4A 2CG4A 2DY9A 5DGAA 1EIYB 1J2VA 1U7LA 3B4MA 4P52A 3MUVP 1EZZB 2NQPA 1P6TA 4CLPA 3IAM9 2CNOB 1WELA 4ZCMA 3I9ZA 4C0OC 2E29A 3OTBA 2E9ZA 2OFGX 1U6ZA 1WI6A 1BLUA 2CJKA 2YVSA 5GAHI 4DR6F 1TL3A 3PFOA 5KTQA 3Q23A 1FRKA 4DL2A 4A8FA 4WF9Q 2ZE2A 3R8YA 5RUBA 2FJBB 3CMES 2VFSA 3M30A 1V3SA 2VBYA 3BBBA 1UETA 2AEJA 3BB5A 4EI2A 1VQKS 1PGZA 3BPSP 1BQXA 3IP0A 4OI2A 3BGRA 2AV5A 5EX0A 4IRKA 1SH0A 1SQEA 2KHCA 3TQEA 3CJ5A 5DDQC 3J81j 1IUJA 1N5VA 1HBOB 1REGX 2NXNA 1EQ0A 3FBFA 1CJUA 1Z2LA 4PRFA 2GJFA 4ECXA 2H5JB 3N0VA 3Q8VA 4DXLA 5T7LB 2BA9A 4DG1A 3Q8SB 3GG0A 2ZUGA 3N79A 1R0AB 4QWBA 1JLBA 4LF4F 4PEOA 4FXDA 3DRSA 1Y5NB 2FB0A 3BREA 1AZSA 4RO0A 1T94A 5C5JA 4UW2A 3GFZA 4LREA 4OZ0A 1PBUA 4X2BA 1VQPS 1MN7A 3T9NA 2MZRA 2YX1A 3NGRA 1Z2ZA 1M5PC 1TV6A 3QGGA 1RDRA 1Q8IA 3LAKA 1HPZA 3PX0A 2LFVA 1Y10A 2HNDA 4NCAA 1JLFA 4DFMA 3P6YC 4K0KJ 2GS8A 3GV8B 3CSKA 4EU0A 2XMJA 4ZIWA 1ZTTA 4YEAA 3VVUA 2UVRA 2LEPA 2OGUA 4RBVA 4TU7A 3PO4A 1HNVB 4FXVA 2BQRA 1CJVB 2Y0BB 4IG0B 1O51A 2ZBPA 3EM1A 4C11B 4C97A 1EX8A 2FZCB 3H42A 4K7QA 4TXSA 3TX0A 1HNIA 4IG3A 3RRHA 3IR7B 4URQU 2DRBA 4MKYA 5U47A 4C2MA 1S10A 4FBTA 1MLAA 3B8HA 4ITSA 3D66A 1WOSA 2HIYA 3BPDA 3G6XA 3LAMA 1HYSB 2EXUA 2LA4A 3AFGA 3U1MA 3UR0A 3KMSA 3I56S 3TZXA 5C7PA 1FO1A 3GSIA 3NGTA 1HBOA 1UFLA 3D3CJ 3N9UC 2QA4G 4WIQA 4LFBF 2CJ9A 4FNIA 1T3OA 2R7VA 3FEXB 4KC5A 2WVFA 5F8IA 5HP1B 2PE8A 1KWMA 2DYAA 4M5MA 2IM2A 3V6HA 1DLOA 2OMOA 4A8WA 4C48A 1HWUA 5ETKA 2F9JA 2XS5A 1CS4B 4U8YA 2MY7A 5HMYA 3IS9B 3PYGA 4ZK7M 1TVRA 1XNRJ 3CJ8A 1DTTA 1VJWA 3NGUA 4Y65A 4G1PA 4DJBA 2CQ4A 3K17A 2C2KB 2CNKB 2V50A 4H4OA 4KYZA 1WEYA 4F3QA 5CYJA 5L8RC 2DY1A 3TO8A 3G6YA 3Q24A 2HHXA 1NDPA 4WBFA 2OKQA 2V4JA 1HHQA 2X1FA 2FLPA 2CJBA 1Q7LB 2IJFA 5BYRA 4OI6A 2FPHX 1H38A 2Y8WA 1JKHA 1PC4A 4K4YA 3T6JA 3MI7X 3FZ2A 1T11A 4HHJA 2BJ3A 2XS7A 2QMWA 2XWXA 4HACB 2B56A 1DAXA 2A6MA 1S1VA 3C15B 3CDAA 3DOMA 4NX9A 2M4MA 2CPZA 4USUA 1S6UA 3SV4A 4G6VB 4CTAA 2C3YA 1SC3B 4GKKJ 4LSLA 3CD5A 3MCOA 4MFBB 5D78A 5HK4A 5M2UA 4NCBA 2AZ3A 2KN4A 4AXIA 2F4VF 4LMZA 4X62F 1NH8A 2QLXA 3ET6A 3X3UA 1MSWD 1BC6A 4ILRA 4GVBB 2KKHA 1Q0NA 4I68A 2B43A 4AE5A 4B3RJ 2BBEA 3M32B 5L1LA 2IM0A 4ECTA 1K73T 4NLRA 5AT1B 1KQKA 4ZVSB 2BW2A 3SCKE 2V8HA 2JFKA 1FDBA 1JLAB 5DO2A 1S1TA 2VONA 3HVRA 2ALZA 3TUJC 2GO9A 1T03B 3HK2A 3MEDB 2ZOGA 3M8ZA 4CLZA 8ATCB 3B78A 3TWZA 3UD4P 3V5RA 3BGLA 1D8YA 5J2MB 1XNRF 1MMLA 2NXUA 2O66A 2UZAA 4LBIA 3NLCA 1RLCL 2DGVA 4ELUA 4AXJA 4P7VA 5HBMB 2AKWB 3RTVA 5ETRA 5ITHA 1P1TA 4NLXA 4HHHA 4X4VA 2GVZB 4NI2A 2W4PA 1OY9A 3K5MA 2Q43A 1GQEA 3EUNA 3OV7A 3MMBB 3KG1A 2BACA 2W25A 4RBUA 5AXKA 2KXHA 2V6AA 1S1TB 1SB6A 2FTRA 2FYXA 2RB7A 3H7HB 3N5BA 4YP3A 3CCZA 1H73A 2K7JA 2F8HA 2M7SA 3R5GA 4FYWB 4OZ3A 3G9CA 1YJ7A 3R5JB 2QEXS 4FKXA 3MDFA 4GVBA 2HMIA 3D6FB 1I51B 4GVLA 2VZ9A 4P2FA 3I31A 2ZC4A 4M5DB 4WU3A 4E8UA 2QE5A 4LBHA 4F25A 2ZH5A 2IC3A 1NK4A 3WX8A 1DURA 1PYSB 3G6ES 1X0PA 2U1AA 3A3PB 1X9SA 4JI5F 4DSJA 1DTQA 2IPOB 1BQNB 1BQMB 1RTHB 3ONQA 2A10A 1F60B 2C3OA 4I4BA 3BSCA 3DM2B 2DNYA 1LWFA 5D0HA 4X62J 5C25B 4PXEA 3DC2A 5CAAA 2ZH4A 1FTRA 1HW8A 4EYHB 2HQ3A 2W9BB 4DMZA 3ZTSA 2YQ0A 4XTTA 3TI0A 3DI6A 4A8OA 5B0BA 2CPDA 2WBMA 4RW8A 1FE4A 3HZEA 1X5PA 4RNMA 1RT1A 4FPRA 3DM2A 4GMKA 4CLYA 2J76E 1EARA 1IKWB 2HQFA 4LVNP 4PYAA 5JMNA 2CNNB 5KFCA 4IR1A 3IS9A 5IOLA 4YFUA 2BV3A 3M8SA 4DZDA 1L3SA 2OPRA 3DLLQ 1HBNB 3RJMB 2UUTA 3JYTB 7FD1A 1DLOB 3KK1A 3GIRA 2G2YA 5DZ6A 1VCTA 3HVWA 2MLZA 3BH6B 3I82A 5IT9Y 3N4WA 2WVBA 2J9DA 4ZDNA 1MU2B 2XMUA 4YHHJ 3CF5Q 3G71S 4DR5F 3MOZA 4DR4J 1UVMA 1I1GA 3E01B 1YRXA 3J80U 2Y9HA 2BX6A 2UXCF 2BE2B 3FMWA 4CI0B 2FY1A 2XLIA 1URNA 2XMVA 5DM6Q 2CJQA 1OQ6A 3AA8A 2CA9A 3M05A 3NL0A 4KTQA 1VIXA 1S0NA 1WHVA 3AT1B 1VBZA 1YBAA 4HTIA 2DIVA 2M0GB 3L7PA 5C24A 3K2YA 2CPHA 3H4DA 1M1KT 1ZM9A 1WC6A 2PMHA 1NM2A 4ZP9A 3CUNA 1LW0A 2HRYA 2NSBA 3I96A 3DRXA 3PKYA 5D0EA 3AJ1A 3MAAB 2V8GA 3M9NB 2BJEA 2J9DE 5LMUJ 2DB1A 4F3OA 4U7UD 1AT1B 2A2DA 3CWJA 4G1QB 3R5CA 3KLHA 1VQ9S 4ZVEA 1FRXA 3LP1A 3I55S 4X65F 2HQGA 1NEEA 2VDIA 4KH1B 3BR8A 2G2ZA 4O3PA 4NLTA 4EEYA 1HPZB 2VKRA 2C2OB 4DX8H 1IN0A 1NDCA 4ZVPB 1RHJB 5JUMA 3EPIA 1U02A 3O8WA 4QWEA 3QSIA 2VH7A 1YWXA 3KLFA 4ECYA 5CXTA 4TVAB 4J9KA 2AWZA 4IDKA 1ACMB 5C24B 1R3NA 5IWAF 3CDWA 1T9TA 4ID8A 3NRBA 1MW7A 2EFQA 1FKPB 4G1IA 2NCKL 1U0SA 2Z4PA 3QT7A 4KGVB 3UCGA 5KFWA 3OL7A 3D7SB 2MSTA 3W5XA 4A8YA 1CLFA 1IBKJ 4ZCKA 2YNGB 4RLEA 2XYPB 4Z2XA 3DU6A 1FJ7A 2QA2A 4MK9A 2P5VA 4MTPA 5IC4B 4RZRA 4WKRA 4DL7A 5EUHA 3D5MA 4LF2A 4CNYA 4TYAA 4QWAA 1S6QA 2NZCA 4KQZA 4U7CA 5CA5A 1N36J 4ECUA 2CRLA 4LR9A 3ETOA 2LLZA 4Y2KA 5CYMA 5K8MA 3RB0A 3BN4A 5GAGI 2ZDPA 3UN5A 1SUQA 3K5OA 3R1LA 4B9NA 1IBKF 1XIQA 2FGOA 3BZQA 4CM0A 2I1RA 3RBZA 3W66A 3A8EA 4IFVA 3BO3A 4C8ZA 2BXJA 5FJ4A 5I4MA 3KJVA 4J9RA 4MIBA 3DGVA 4URSA 3GV5B 2QX0A 3DXBA 3DNCA 2ZD1B 3I5CA 3OFHA 1U1RA 2ALYB 4RW6A 5A6WA 4RPFA 4TKTA 4K8RA 4OZNA 3HULA 3TOQA 4PG7A 5HVGA 2Y1JA 1NZAA 3VZIA 3HHNB 1LWFB 4OYOA 1VC5A 3SQGB 1K1SA 4QR0A 2JDJA 3AD7C 1AA1B 1FI4A 1NUEA 3CGIA 3T1YF 2G4BA 4L3KA 2DHXA 2HVZA 3OXGA 2QTWA 5LM7E 3IA0A 3P3DA 4YN3B 3W63A 4F04B 4RW7B 3PW0A 1TL4A 4B9UA 2HYIB 1XBWA 4DQIA 2ZDOA 4DCJB 3T1YJ 2YWKA 1N5YB 5KFDA 2X1BA 2K3IA 2YWGA 4LF5J 1SJRA 2ZUAA 1S79A 2ROEA 3RGIA 3ZTRA 2A0FB 4DU8A 3DLKA 4KB7A 4AFFA 5KOWA 3CDUA 3NCRA 3RR7A 4AL5A 3RG6A 5I3UB 1VOMA 4C3MA 2ASJA 4PUOA 3HJFA 1RXOB 1LFWA 2XEXA 3KHGA 1Y00A 2GMHA 1WC0A 2HFNA 1WORA 2W7AA 4UOHA 3R7NB 1VC6A 2XI3A 1X9MA 4LUBA 1N4LA 4DL6A 5KFKA 3F56A 4K4ZA 3L7UA 3TX8A 3EJMA 4ECSA 4FF3A 2IMOA 2HBQB 2YBVA 2DXEA 2QLFB 3GG1A 3RW7A 1GMWA 3FCVA 5LOQA 4DV6F 1M90T 4F2RA 1BGXT 1HNIB 2DXDA 4PXBA 1U48A 2MQOA 3FSIA 3A4TA 3PJXA 3HMJG 4WCEQ 3MWBA 5A8KA 2VDHA 9ATCB 3KHLA 2WBRA 3MGJA 2R2SA 1U0HB 4ZPCA 2R7QA 4HI2A 4M5JA 4ICLB 5MLCV 1S0OA 1QE1B 4P9SA 3ZFVA 5KFRA 2GQQA 3P8BB 3LUYA 4IFYB 4R5PB 4DS5A 1ZZNA 4ZITA 2ZH3A 3KK2B 2JX2A 3LW5C 5D4NA 4KO0A 4B02A 3PR4A 3M30B 1ZA2B 3CJ3A 4DU7A 4IO9Q 2O3DA 3ENQA 2W7OA 3UI3A 1NO8A 2WOMB 3H8YA 4OHWA 3QMQA 4PWUA 1TL3B 1YQHA 4F8RA 1H98A 2VQEF 2NYHA 4KRWA 3QRRA 3HVTB 2ZHOA 3DDIA 3KJFB 1LW2A 3QGPA 2DHHA 4DHVA 2E5LJ 5HI7A 4WYWA 2HVHA 3K58A 4H54A 1LNQA 1NPPA 1WDDA 1SVDA 3KLGB 2RDJA 4K4XA 3D54A 1WHYA 4ZKAA 5HQLA 2J6TA 4LF9F 1TU0B 1RCOB 5E5NA 3HM9A 2BABA 3CJQA 3Q89A 2JVRA 2ZBIA 4NLPA 3PX4A 5B0CA 1G6BA 2OLWA 3T5HA 4QIGA 2F7VA 1UP1A 3KMQA 3J7YU 3G86A 8RUCA 2IY5B 2HHHJ 4OHYA 1CC8A 4IOCQ 1S72S 1U1QA 2IA6A 3FMBA 1LWEB 2WRMA 2X3DA 3ELHA 3HFZB 3PFEA 2RVJA 5HVHA 3MMJA 4KHPJ 2M88A 1VIOA 2CPJA 4FP9A 2HNYB 1HBUA 4DFKA 1JXVA 1HBNA 2VIHA 1VRUB 2QRRA 4UOFA 5F3TA 5T41A 2GCFA 1VYAA 3VQTA 4A47A 4B17A 2C2RA 4I2QB 4KGMA 2I9SA 1FJCA 1WHXA 3EZOA 1H7XA 2OSRA 2NXEA 1FD8A 1YSJA 2DNGA 4JB8B 4QPTA 4X64J 1K0TA 2J8AA 2H1YA 2O01C 3QLHB 4IG3B 3FRZA 4F4ZA 1KN6A 3VR1A 1FK9A 4JBCA 2J6SA 1LWXA 3ZTOA 1KFDA 5KG5A 2PA3A 1Z4UA 4M5NA 1NB2A 2W01A 2MPUA 4J7CA 1TL5A 3DLHA 4Q0BA 3F0NA 3C16B 4C8MA 1GXUA 2CQ0A 2HMIB 3MUTP 4PWDB 2V8DA 4I6YA 3LALA 5I42B 1YHQS 4GKKF 2NPFA 2CJYB 1RTJB 5KT5A 3PIOQ 2PI4A 4MYTA 1NK5A 5ETVA 2B4VA 1UVIA 1PYOB 1X7VA 2MQMA 1IKVA 3FJ2A 1JXLA 3M8PA 3ZNJ1 1R27B 1U6FA 4TYBA 5DQHA 3CC4S 4GKJJ 1C0UB 2BM0A 4DSLA 3EZUA 2W2QP 1RT3B 2GHVC 1RE1B 3CO9A 1T05A 1YBTA 3BYRA 4K2JA 1SL2A 1FKAF 1NAQA 3TP2A 3Q83A 3M9MB 2J8SA 4FYYB 1EP4B 2IM1A 3GCWP 4W98A 4B08A 1FHTA 2KG0A 4PWDA 3PYFA 1MROB 1REVA 3I0RB 2A2CA 2H4YB 1Q5YA 4N41A 4ZVHA 4OZ1A 1ZTWA 3HD1A 3JQKA 5KFHA 3RYLA 3BGRB 4MAKA 3PHTA 3QFHA 3H90A 5KT7A 2XGPA 3KJVB 2OJ3A 4NLGA 1KD1T 3GR0A 5H9EJ 2ROGA 3W62A 4O23A 2CPXA 1U1MA 1AROP 1OSCA 3GMGA 3MM8B 4HT5A 4ZPTR 1FXLA 2DNPA 2EKYA 2RU3A 3OJSA 4C6AA 2HVEA 1HQUA 1LK7A 2B0GA 2FHJD 3MM7A 2W9BA 2W8KA 2Q66A 1T7PA 1DZ5A 3ZNUA 4R0JA 2FC8A 2IJRA 4CLFA 4WK3A 4CNZA 2E1CA 4ZS6A 3BEGB 1IR0A 1M1GA 1HQEA 3ET6B 3HXMA 1JX4A 1TFYA 1H7WA 2VU5A 3JXOA 3MM8A 1JLCB 3ZZRA 3NEKA 2XMKA 4YR3A 1VQMS 3L7OA 3QWUA 3RU0A 4DSFA 3MCSA 2AGOA 1N8RT 2H54B 2JJ4D 2D74B 2HGLA 2M8DB 2G9OA 3FEYB 4ZCLA 4OMFG 3K59A 2CUYA 4K0KF 5DQIA 3GIIA 3PRBA 2ZEJA 2AJ0A 3OL9A 1YBUA 4CDIA 2Y0SD 4TU9A 2ZBQA 5KFEA 2QYCA 4NLQA 4LF6F 4LF8F 3C6UB 3VWSA 1HNVA 3TAMB 4RBTA 3FQKA 3KLVA 4FS2A 2VQFF 2WSFC 1FF2A 4RUHA 2PD1A 1SC6A 2XI2A 1A7GE 2GZOA 3G82A 4LR8A 1KRPA 4NL5A 2E66A 3OQ2A 1X31C 2XCPA 2K2PA 4OZ5A 5KFBA 2HFOA 4RW9A 3C14B 4O0NA 2R7OA 3K8WA 3T19A 2YNIA 1QD1A 5M2RA 3DRPA 3A3NB 4EWTA 2LXUA 4JV0A 1FFWB 3DCAA 3EMTA 2HK2A 3LTOA 2RKIB 5J2PB 2BMBA 2H4WB 1RWNB 3FRYA 4OZLA 4YB7A 4QW8A 1JJHA 2HSEB 2KHDA 1S9GB 5DDPC 3GU0A 2XYGB 4UZCA 1S4EA 3ZZYA 5CZVA 3LWLA 2YNGA 2CJXB 2DIUA 4LT6A 1V3ZA 3C16A 1Y9OA 3FBCA 3KJQB 3N6LA 1FVSA 4U6PA 4J9LA 3IFEA 4LF7F 2CQCA 2VOOA 3NCQA 3MEEA 5DLGA 3OL6A 4DR2F 1PJ7A 4ER8A 1FK9B 1X60A 2RUGA 3J7Z5 4OYMA 1NSPA 4KE5A 1VGYA 3Q2SC 4O4GA 1TELA 3SCLE 2UVVA 1NNDA 3AXKA 3BDEA 1YI2S 1C1BA 4KSEB 4ETZA 2AGPA 3CMQA 2LU1A 4RX6A 4DSKA 3GIMA 2HFSA 3BBCA 3BGFA 3DRPB 3IBFB 3CIZA 2X7IA 4CO5A 3G2XA 5IXUA 3V4IA 3PW5A 2YKAA 1UFWA 2AEFA 2KT5A 2HRTA 4LSLB 2BVZA 5E7OB 1N5SA 1KP6A 2Q3PA 2DHGA 5IQQA 4ECWA 4N77A 2FC9A 2W2NP 2JFDA 2J5AA 5AJ3J 3SCIE 3GJSB 1S77D 2V0NA 4IO1A 4LRCA 4DN0A 5AE1A 3OHBA 3BJYA 2Q1LA 3JSYA 3Q22A 1WG1A 3BH7B 2B8PA 2CQBA 2RDDA 4FBUA 5EN1A 2MKKA 4X4TA 4HTJA 1HD0A 2BRKA 1ELOA 5HROB 4CLUA 3K5LA 4DSIA 4JI3J 3VAHA 3U02A 4CLTA 2KVIA 3CO0P 3MMCB 2HHUA 1KHVA 2HGMA 3FBBA 3H2VE 1V5VA 2CQ3A 1H6KX 3M8WA 4DPWA 3OVSA 1GX5A 4J9NA 2DNLA 2EBEA 3MPYA 1NJYA 1NJXA 5A0YA 3J7YI 5B0GA 3QWPA 1TVRB 1OO0B 1S59A 3FK4A 3KLGA 5JVGQ 3QAEA 4I7FB 1VRUA 2MQ8A 4UY85 1MNEA 5DGBA 1JLCA 3DLGB 2DGQA 5HVFA 1FRLA 1TL7B 1VMBA 2P8IA 2GQ2A 3I32A 1MU2A 3CDBA 4K4WA 2R2TA 5HMZA 1HHSA 4P10A 4Y2IA 1XN9A 3TA1A 4O3SA 1RWXB 2GAGC 1RP5A 1SIWB 1NRKA 1UFKA 3A12A 3MPDA 1L3UA 1JJCB 3B4DA 4F26A 1WKLA 4I7FA 1SV5A 2AJ2A 1GMVA 4LFAF 3KHHA 5KFYA 4FYXB 3HSJA 1RKJA 4J91A 1VQ6S 1S48A 2BJDA 1OYDA 3TUZC 3ZTQA 3ENVA 5JJBA 1J5OB 2BEFA 2L9NA 3SSSA 2ZH1A 4MK7A 2MGZB 3QIPA 4USHA 2XTJP 3CCUS 4J9SA 2AYEA 4OV1A 1VQLS 2QJ3A 1T95A 3DI6B 4LRBA 2HQIA 5HROA 3WQPA 1UA0A 1Q5VA 3AD8C 1R6YA 3GFXA 1ZAXA 1KNZA 2NZ4A 4OYIA 2VPWB 3OTOF 3SSQA 1HR0F 5GMDA 3D6MB 4QYZJ 4F50A 3WC2A 3PX6A 3TARA 4NYPA 2HBZB 2ZC3A 4URGA 3O44A 3ILIA 4EK2A 3GE9A 4AT1B 1IM6A 4LF5F 3M8QA 3CW2C 4NMLA 4FXWA 1M5KC 3ZO7A 3ENWA 4OI3A 4DL0C 1RWWB 2DRAA 3M32A 4PQUB 4ZVUB 4ECRA 5H9FK 3QGHA 2N7CA 2P9CA 3KDNA 2J7KA 5HLFB 1HNZJ 1P8GA 4A8SA 1S0MA 3RBDA 3H4BA 1AW0A 1FWKA 1BWVA 3HSDA 4RR5A 3NOGA 1MG7A 5GAHU 1X5SA 3CE8A 4KHRA 2E1PA 3TZYA 3KLEA 2JH3A 2Z56B 3PKMA 2GIFA 5A8KB 4NCGB 1VQSA 4G1QA 4EGLA 3KLHB 1B3TA 2VPZB 5KFFA 2MTLA 2CVIA 5L1IA 2KFZA 1SIZA 3H2LA 3LGNA 3JSRA 1HLWA 1WOOA 3KLIA 3PG9A 5IZHA 3AB2B 4WFAQ 3H5SA 2DPJA 5EX3A 4B3MF 4N47A 3W65A 5LMNJ 2YKMA 1LWCB 4JI1J 3AQOA 4UUWA 3PCOB 1KS2A 1HQ2A 4ECVA 2DGTA 4EO6A 2E9TA 4KGXB 4LVOP 4Y3CA 4XPCA 5KFTA 1IKYB 2XCAA 3QBCA 4ZVTB 4ZHRB 2JOQA 2UUAJ 2QGFB 2DJWA 1IBLF 3ICLA 2H51B 1UWBA 2P2CB 4F3MA 4DL5A 2DCLA 4QCLA 2R7TA 1UJ6A 1S6OA 2V69A 4DSEA 1KLMB 2WB1D 4NLOA 4OZJA 2BE7D 1OMSA 4OIXA 4UUXA 4WFZA 3AOBA 1PJ5A 2OH2A 5CYMB 4RW4B 2QMXA 1LWCA 2UUWA 4OJ1A 3VAJA 3PW4A 2HZVA 4WU2A 2Y1RI 1KFSA 4JI6J 5CYQB 3DN9A 2FHOB 2KB2A 2E7WA 3VCDA 1PO6A 1YITS 4IDKB 2Z2LA 3VAIA 1RAAB 3GFHA 3DYAB 2XS2A 4AL6A 2X1AA 2RSQA 3PYDA 1TUWA 4WYLA 2ZH6A 2JLGA 1TKXA 1C1CA 2R2UA 1UEVA 1ZAVA 3M2VA 3SMZA 7FDRA 2XMAA 4HEA9 2CZ4A 2J7WA 3QRPA 4WIIA 2IYIA 3THVA 1R0CB 2G1DA 2HNZB 2R7RA 2MJNA 1PKUA 2HNDB 5E3RA 4P71A 4DV7J 2LQ9A 1DHMA 2Y1LB 3TR5A 2Y3YA 4DR2J 3TEHB 3RB6A 1VS3A 2XC9A 3KK2A 4DQPA 4LF7J 2ZZNA 1OY8A 3MD1A 4CLWA 3V4MA 2KFNA 1IKVB 4YQWA 3NMRA 4DLEA 4B9SA 3H20A 3Q2TC 3PO5A 1P9YA 2FJVA 2IRUA 5GAEU 2KJWA 3DDNA 4JI7J 3LQVA 1RCXB 1WOPA 4CO4A 4F36A 3T5JA 2ADBA 1FD2A 2ZKTA 3IM8A 3M6XA 3M2RA 4GO7X 4U9RA 4ZVFA 2PT0A 5FLXU 3CPWR 4WTOB 3CJ2A 2HAFA 1F3VA 3PEHA 3WBZA 3T5KA 1TUVA 1XC9A 2IMWP 3NKYA 3PW2A 2C28A 3PV8A 4A4JA 4NLYA 4KH0B 1KQSR 2JNJA 3OR1B 1GTEA 4EMDA 2J9CA 5ETTA 4CP5A 2K3KA 4I69A 2OHDA 4B9LA 5A8WB 2UUBF 1KBRA 4C3KA 4Y2CA 1S49A 4OJHA 3MM5A 1JLQB 3NWGA 5HMWA 3RZAA 3SFUA 1R8AA 1FEEA 1NKBA 2MB0B 2MYFA 2NUHA 3VALA 4TY9A 2DNOA 1TZ0A 1RKIA 2HS0A 2H5IB 3D0HE 4CWBA 4LIWA 3EX7B 1N5TA 4PUOB 4J9OA 2B4PA 4DQQA 2HK3A 1D9FA 3ISZA 2RRAA 1YJ9S 2LEAA 5CD4H 4JP8A 3UDVA 1K1QA 1XNQF 3UN3A 1NHKL 1RWKB 3KWMA 1YJUA 1KEKA 5DQGA 1R8PA 2LYVA 4U96A 5K5MA 4HI1A 2KM8B 2ZHAA 2CXEA 4TQSA 2Z58B 1NSAA 3HFKA 4EO8A 2POKA 4R8UA 1FWLA 1HNXF 4UY8T 2GC8A 4W90B 3M8YA 2DR9A 1SJ1A 3OTEA 2JWNA 3RUBL 4AL7A 1SI9A 2AD9A 4HACA 3QSYB 4JV5J 1SQGA 4J5OA 1FNMA 3DRYA 4Q2LA 2DNNA 1RT7A 3Q8PB 3KUHA 5EWEA 2OI2A 5C25A 3GB0A 2PFFB 4DV0F 4LBPA 3VQSA 3P49B 1PCAA 3ITHA 1HBMA 2UUCJ 3HHLB 2EK1A 2AT1B 4NLWA 4CO0A 3OVAA 3JYTA 2W9CA 3NG8A 4MKAA 2OD4A 4ZHRA 2XLJA 3RRGA 3R3TA 4IFVB 1WNEA 2JLEA 3IG1B 4M5LA 1WHWA 5KFJA 4K50A 3MOJB 2KZMA 1FERA 3VGTA 1H3DA 5CCLA 1HMVA 2QC3A 1D09B 2WVDA 2Z2ZA 4OI4A 1L3KA 2RRBA 4XDDA 3R9LA 3TANA 4KPYA 4DR4F 1HWIA 1S7HA 3OUYB 3NMAA 2G0CA 1NKEA 1S57A 1VBYA 1RHQB 3DXSX 3GP9A 3BGOP 4NZ0A 2UV8A 2OAUA 4WPAA 4CYUA 5KT4A 4DOZA 4X4PA 2J0QD 2GVZA 2F4VJ 2R7SA 2GX8A 4KGKA 4JYAF 1RT2B 3AOCA 1S1XB 5KT2A 3ZZUA 1P1LA 2AIRB 4H4MB 5HN0A 4ID5B 2AU0A 4HLBA 1LKZA 1N32J 3PVXA 1IR1A 3WC0A 4IRCA 2FHKA 1OIAA 1IJFB 5J2MA 1F9FA 2ZJRQ 4Y0FA 3UVJB 3MEKA 5BJRA 3QIDA 3R5AA 3R6GB 3W2VA 4UTGA 1FX4A 2LVWA 2KM8C 2DEJA 4ZPVR 3M8RA 4ED8A 3T3FA 5ETLA 1SH3A 4ZA1A 2MKJA 4ATNA 2FUG9 5F8MA 3C46A 4ZPDA 1Y11A 1H2UX 2G2OA 2EKNA 4GC6A 3QRQA 3UFCX 3HD2A 4JYAJ 1RT5B 2DBBA 4PPDA 1OWXA 1Q8KA 4ZVOB 1S76D 3DOKB 2RMLA 3F44A 3L95X 1RWUA 2WB4A 5HBMA 4DBQA 1WTBA 4N7TA 4OX7A 1U4BA 1LXNA 3W64A 3WZ0A 4E98A 4EUVA 1IBMF 2V67A 2MSSA 2J7UA 4CLLA 1RTDA 1G1XA 4Y28C 4X4OA 4ERDA 3MR7A 4C7QA 2M8HA 1SBRA 1RAFB 3W1YC 3ZZ0A 3MAHA 5KFAA 1X8DA 4DUZF 1QTMA 4V19X 3ZTPA 2LEBA 5F0WA 2ABYA 1RHRB 1XR6A 2L48A 1ZPWX 4OHVA 5T7LA 4CYUB 2HAIA 1SV5B 1DQ8A 1UMJA 2MLXA 2CIMA 4Y6IA 3TQ1A 2WONA 3JQMA 1YIJS 4DPUA 2MKHA 2HBYB 4FPIA 4RW4A 4S0MA 4KJIA 2XMTA 1KQGB 4Q2MA 4RWXA 1IKYA 4WWSA 5F41A 3KK1B 2J0XA 2A6OA 1F5AA 2RS8A 4IOAQ 2B9XA 2OPPA 4MT1A 3T6BA 3HPOA 4JI6F 4ZP7A 5KG4A 1S97A 3N5FA 4KV8A 4DS4A 2WCXA 3V6DA 1BE4A 2FJEB 2YKOA 2NS1B 1FXRA 3VHQA 4F2SA 2XNRA 4OYWA 3HI9A 2HRUA 4X4UA 4YB1P 2MHEA 3TZZA 1QVGR 2RQMA 1W26A 2MKCA 1QM9A 3IM9A 3J81Y 4R8UB 2KXFA 3BO4A 1HARA 4RWWA 2BKPA 3EYZA 1B4SA 1BQNA 4DF4A 1MN9A 1S6PA 4UT4A 1ICEB 2P6TA 3JTOA 1VQOS 4QU7A 1FNXH 1CJVA 2B5JA 4OX6A 4XO0A 3I4HX 1J27A 2MZTA 3GYNA 1RHMB 5FLXY 4NCGA 5LSOA 2AYGA 5G4DA 4F0MA 3UDCA 2N3LA 3DKDA 1UPMB 5LMNF 5HP1A 4J9VA 1ZETA 2E44A 2VV5A 3ISND 1FDDA 4MYUA 2M3DA 3VAMA 3M1VB 1Q95G 1U49A 2O5DA 2C2NA 1YLXA 1VRTA 1D3WA 3KTQA 4NXMJ 2ILZA 2WSEC 1JLBB 1T03A 2C3MA 3UVJA 3G8SA 1WC5A 3ETMA 1WACA 1ZAWA 1KC8T 3BF4A 3C2PA 3POTB 1LW0B 4NA1A 1CJUB 2EFNA 3MUMP 1O5JA 3F73A 3TAQA 1F3FA 4OYAA 4O3NA 4OI1A 4KHPF 1VQ4S 3R7BB 3GYXB 2LXFA 4NASA 4ZPAA 3WDOA 3HFVA 1RT2A 1XWLA 2CQ1A 2ZH7A 3FVYA 2YNHA 3G96A 1M5OC 1XJWB 3BBFA 4YY3F 1WKKA 2L41A 3RW6A 1GH8A 3OR2A 4H4KA 7AT1B 4DV7F 4J9UE 1VR6A 4F7VA 3SDEB 3RAQA 1NXIA 4UF4A 2B7CB 2WHOA 4B9VA 1IQZA 1S4FA 2YH0A 2WW4A 3BQ1A 4YB5A 1AFJA 2UVWA 4IQXA 2WVCA 4KFBB 2E5LF 2OPSB 4M5IA 2APOA 2IRXA 2I0XA 3IAS9 5G0RA 2R3VA 4OX8A 1KTQA 8AT1B 2GMJA 3BGUA 4DFPA 2H65B 3LF0A 3P45B 1G2EA 1RWOB 5KG3A 2C2MB 4B3OA 4N8OA 3BDPA 1A9NB 5D8HB 5SUHA 3B54A 3GFYA 4ILMA 2KYZA 4R25A 1ZM2A 1T9YA 4WP9A 3WX4A 2R8HA 2ADCA 2XZWA 1TK0A 3FFIA 1WTFA 1TKXB 2RIJA 2IHR1 2EBGA 2VJUA 1QAIA 1RADB 5KG0A 2FLNA 2CZVC 2VHGA 2D3UA 3R5BA 3HKWA 5FIIA 2COLA 4ZJOA 5K14B 1C2PA 1XTZA 4DV2J 5D4LA 1IR2A 2DNRA 1RT6B 3LANA 4ZVRB 5KG2A 2HWTA 2QL5B 4XAKA 5KFNA 4XPEA 3JB9k 1ZM3A 4DV4F 2K1RB 3IN5A 1HW9A 2MMYA 3HX9A 5K8NA 3SZ2A 1NK7A 5EDWA 2DR8A 2FVQA 4L74A 2C2DA 2BQUA 2W2OP 3IRXA 2MKIA 3BSNA 3V6KA 3HT3A 4DV1J 5IFMA 2LQBA 4Z37A 3RR8A 1TMJA 3NOCA 3GIKA 3GQCA 3GLJA 3VAFA 1U2CA 1C1BB 2E5JA 4IH5A 1EKRA 4OV6A 4DI6A 1YKWA 4RNHA 2FLLA 1X4AA 4ICLA 3GTYX 4TLQA 3FSYA 1X4EA 2F63A 1CVJA 1BWEA 1X4GA 4OYBA 1FXDA 1FE0A 3HHKA 1WC1A 4N76A 4NLVA 3MFIA 2W9AA 1OY6A 4U7UK 3UW1A 4XK8C 5IT9U 4X4SA 4YR2A 4WE1B 5T14A 1VHIA 2UXDJ 5BYQA 2KDOA 1FKPA 3T5LA 1HI0P 3KK3B 3SSRA 5B0DA 3V81B 3P5BP 2BJ9A 4W4MA 5D77A 1FJGF 3AA9A 1O0PA 3M2RB 1HNZF 1S1UA 3GONA 5I3PA 3ZZPA 4CO3A 5HSPA 2MKYA 3HT0A 2V4RA 1NDLA 2YXLA 4Y34A 1RTIA 2KZZA 3QJJA 1Q8LA 4K5RA 5SZTA 1WSRA 2YQ3A 4BC9A 4USMA 2OSQA 3M8PB 2Z2MA 4W92B 9RUBA 4ANDA 1JLGA 3SCJE 1TAUA 4YY3J 1FDNA 5IQ6A 1RJJA 1WEXA 1PSDA 3A8JA 3LP0B 4NA2A 1HR0J 5DRKA 2VFUA 3OXLA 3TJ9A 4LIRA 4Q8EA 2HHVA 4LFAJ 1NBEB 2AJQA 3M8QB 4V1Ak 3NNHA 1EJ7L 3C6TA 1RAIB 3W8PA 3T1HJ 4CTAB 4C8LA 5BR8J 1PAUB 3TVKA 3OFFA 3I87A 1SXLA 1CJTB 1N56A 4OLPA 1SPBP 4BS2A 1U09A 2ZNYA 3LGMA 4FVMA 4ZP6A 1U1PA 4K59A 1Q82T 5A8RB 3IR5B 1RI7A 2VB6A 3HF5A 3PDNA 1Q4RA 3WIVA 1X0FA 1EKSA 6FDRA 4FS1A 3LH2S 2DK2A 5KFIA 2IJNA 4P2SA 3QLHA 4LJMA 3HKZD 4DV4J 1NK6A 5LSRA 3OSNA 3CCLS 2GAHC 2B8QA 2DH9A 2R9LA 2LA6A 4ENOA 1WJ9A 2CJAA 1KKHA 3H98A 4DX5A 3DFEA 2MQLA 4X66J 1VBKA 3D28A 3HHEA 1CEZA 3HHLD 4JI2F 2HNYA 4ED2A 2HG4A 1HA1A 2ZE2B 4Q44A 1HWKA 3MURP 4CRJA 1N34F 1TUGB 2R8GA 4CT9A 2C2ZB 1R8HA 1NSKL 4P6QA 1MMNA 2E5HA 3SXLA 1S12A 2LMIA 3JS9A 4DEZA 3AJDA 1VQ5S 3GPAA 1TKDA 3QJPA 2PN6A 1S1WB 2EFPA 3GYGA 5AJ3F 2UXBF 2QLJB 2HVDA 1JIHA 1RBAA 4FZVA 2EVZA 4CQ1A 3TRGA 5D3GA 2DISA 5J2QA 1M5HA 2V94A 1CS4A 2YPYA 4LRFA 4M5HA 5B0FA 5GAGU 1U6BA 2YX4A 2FJDB 2QT7A 2VPXB 2XSFA 3HVTA 3M6VA 1EETA 3N01A 4NZ7A 4A8XA 3CJKA 4C4WA 3I4PA 1F0XA 2CQ2A 3J81U 4O4RA 4CLSA 4YDXA 1N88A 4TLRA 2DNQA 2DGWA 1JLFB 2DR7A 1RT3A 1HD1A 2ASLA 4ECQA 1JLQA 1S1UB 2NSCA 2VL1A 2H48B 3IGVA 3MZIA 1NH7A 3UNYA 2AF6A 3CNQP 4E2FB 2LDIA 2ZM6F 2X3GA 2GIRA 3JSMB 2ZVIA 4IFYA 4ZLNA 2G0IA 3TJAA 4R5PA 1UCNA 2L08A 4O4GB 4USTA 1FRMA 3UO0A 4C11A 1TKTB 2WK4A 5KG6A 3TVYA 4DR1J 2LQ5A 1H74A 2DR6A 2GHPA 4AUKA 5L46A 1F9HA 1WDTA 2IDLA 3OJUA 5F8NA 4YMEA 2E7XA 1B0PA 3LA0A 2BE2A 4DX7A 3HLUA 2A1BA 3OUYA 2NUUG 3J7A1 2HQCA 4MKBA 3HVAA 3IBCB 4HHUA 1YK9A 5ETPA 2PC6A 1J5OA 4A8KA 1U26A 1FRHA 1GNKA 5J2PA 3CVKA 5E3PA 1U2RA 4DFJA 1M0SA 5E2QA 1FKOA 1OQ3A 2E5IA 1XR5A 2M5YA 1P9QC 5DLFA 1VQ7S 1L3TA 3H25A 1N6QA 2FJXA 1KSPA 3HJVA 3TZWA 1BUXA 3DRSB 4PYDA 1UEUA 1N48A 2CWXA 1R8BA 1DQAA 3G82B 4PCQA 3EDQB 2ZH2A 4OI0A 1AXQA 2IAJA 3I6PA 4BHQA 4ELVA 2Q6CA 1RT7B 4GRSA 3L09A 1Q53A 4HVZA 4R0EA 4QW9A 2HEKA 5HQMA 4ANCA 2QFJA 1I94F 1DARA 3E8OA 2VG5B 1XQIA 3HSZA 4YDDB 2F40A 5E33A 2N82B 4P7TA 2XY5A 5J1EB 2K1RA 3AOAA 2EWHA 3FQLA 1BQMA 1TK8A 1S9EB 4I6WA 1R0BG 2DGOA 5J1NA 4A48A 5K14A 2AMCB 3MPWA 4TY8A 3ADAC 2BUNA 3DLEA 4IOBA 4KAIA 5F3ZA 4UZBA 1U45A 4J9PA 3DLBA 4C8NA 4BBYA 3FFIB 3BKTA 5FDLA 5DETA 5E3CA 2ERRA 1U8WA 2FVRA 2Z8QA 3FKBA 3GWCA 3BSOA 2GVDB 4LSNB 2J6UA 2UV8G 4CIOA 5GADI 4LFCF 1N33F 4LF9J 1ZM4A 3NBPA 4JV5F 1R89A 1Y3KA 3V2UC 4ZCIA 4KBIA 3K57A 4KO0B 1RLDA 1TP7A 4NI2B 3PZPA 3G87A 4WK1A 4J37A 3M4XA 3KUGA 1YRUA 3K0JA 4K4TA 1WI8A 5ETNA 1F5BA 4D3GA 2PO4A 5L1JA 2MLYA 2E9RX 5F8HA 3SDEA 3MM9B 2WTFA 1M5VC 3PHEA 2VG6A 3CCWA 1W2IA 3NNAA 2AYMA 4WZQA 4IG0A 3DOKA 1WSVA 2YNHB 3JAMY 4X66F 1T8EA 2JEFA 4TQRA 4LF1A 1RWVB 4NZ6A 1RAGB 2MXYA 2ZWPA 3TAPA 2AYBA 3M1VA 2L9WA 2MZ1A 3EZ5A 2MDAA 1ZPVA 1NMEB 4G3IA 2X1GA 5I3UA 1VJQA 3MTJA 2UUBJ 2CQIA 2AQ4A 3CJTA 3KJNB 2HZAA 3ULHA 4X64F 2M70A 3LP0A 1XMOJ 1N5YA 4NLDA 2HNZA 3TA0A 3MAAA 4EBCA 1NJIT 2DH8A 3GJTB 1CSJA 2XB2D 5K8OA 1Y5IB 4KKOA 3D9BA 4WXWA 5KFXA 4UOGA 1RGVA 4JI4J 1IM4A 4PAAA 5IM0B 1C1CB 5ETQA 3A1YG 1EETB 1AZSB 2GV1A 4LQ9A 4USWA 2RH3A 5HANA 2HZCA 4GO5X 3W2VB 1RBOB 2OELA 3MMAA 2V8PA 1W25A 4U95A 1FCAA 1F6TA 3US5A 4DPYA 4EYIB 1UVLA 4AQYJ 2XM3A 2VG6B 2CPYA 3NGSA 2D41A 4PZVA 3MM9A 4PG5A 2D3O1 2B51A 2QZ8A 1RA7A 2GA7A 2V4JB 2VBWA 3KG4A 2CKWA 4FKYA 4KV8B 2W2PP 5C2CA 1KLNA 1EAYC 5IS2A 3R27A 5IV3A 2PMWA 2LECA 2WW8A 1IKXA 1NU4A 2VG7A 1QAYA 3PRDA 4H4OB 4O3OA 3VGVA 5B0AA 3MR3A 4EBEA 3UDEA 1VQ8S 1GK8A 1ITPA 4LSZB 2DPIA 1S0VA 1AYEA 3C8YA 2EFGA 1JXEA 3V6JA 2CPIA 4IH6A 2I38A 3W7BA 3IC1A 4QBUA 1UEKA 3THPA 2QYGA 2V2KA 5CABA 1Q81T 4QYZK 2ZWOA 3MHYA 3L3CA 4IKAA 4A8QA 4ETXA 2D3OR 3IXQA 1N0VC 1N54B 2RF2B 4NLUA 2KVQE 3TVZA 1OJ4A 1TAQA 1N6QB 1RTDB 5C42A 4FNHA 1SUQB 3EDRB 4TN2A 5KFVA 3H40A 4ED1A 2FJAB 4JV2A 4JI0F 3IBWA 2CPEA 2L9DA 5E3QA 2VQEJ 1NB7A 1G7CB 4I1TA 2CYYA 3CTRA 3E3XA 4LQ3A 1YTYA 2ZITA 1WF0A 3M2UB 5E0OA 1HNWJ 1C4CA 1IBLJ 3NGKA 4QIFA 2UUAF 5DDOC 5F9LA 4O44A 3RB4A 2F1FA 2R8JA 1YRTA 3QJLA 3BS9A 5J2NA 1U8SA 2Z2YB 3M7VA 4LF4J 3EWGA 2ZBRA 4OL8A 4QR1A 1MWYA 2R4FA 2VUGA 3ILOA 3MR5A 3R7SB 2DNKA 2ZKUA 1HNWF 4L75A 1TFWA 4WKYA 3J7ZT 4Z7YA 2BJ1A 2CQPA 4JI7F 1E6VB 2HLTA 4DV2F 1ROFA 4ZJQA 2I8EA 4U67Q 1O8BA 2DRDA 3PXGa 4CCHA 4CH0S 4ZVGA 1TMMA 3UE2A 3MM6B 3TW0A 3D1HA 4HT7A 3SFGA 2MQQA 3PM9A 1F2HA 4F0HA 3W8GA 4V19J 1PILA 4OHXA 4ES1A 1S5ZA 2JRSA 4Q0BB 1BHNA 2HFZA 4MIAA 3TYTA 3M2UA 3CC2S 5F8JA 2LU2A 3EGNA 5H1SV 2HHTA 1APSA 1KR4A 1VHFA 2B9YA 3OTCA 3D0IE 2ASYA 1S1XA 3OD2A 1RABB 4IH7A 5DG8A 2HHWA 1T3NA 4JI8F 4JI4F 3DMJB 1CULB 3CIMA 1HL6A 2UVUA 3VZHA 5BXIA 4QWDA 2OPRB 4ZOSA 2E1MC 4OX9F 5L9XA 4C0HA 4A8MP 2XG8A 3D1QA 3W2WA 2DTJA 2QSWA 3I5BA 5ADZA 2RU9A 4JI8J 4ILLA 3N6NA 4PG4A 1IKWA 4YB6A 2FZGB 4Y2MA 4PR6A 1JLAA 3AODA 1KHWA 4FDFA 2RQKA 2RQ4A 1E6VA 3OTOJ 2AGQA 1NJZA 2K06A 2DT9A 3W60A 3D0GE 5K8PA 3ZZTA 1X4BA 2FD2A 2B5JB 3OTDA 4P75A 1ZZFA 2CG8A 5A6PA 3NS5A 5LT5A 2XBPA 5ETOA 3KYLA 4DF8A 2ZOMA 2Y1IA 3CD0A 2D69A 3CJRA 5D6GA 1S1WA 5KFQA 3PJWA 5KFOA 3BM7A 4WZMA 1MWZA 3FBEA 3S1TA 5F8GA 3X1LB 2LDYA 6AT1B 3JSBA 4OJ3A 5GAEI 2PFDA 4KIAA 4LRAA 3UD3P 1RAOA 1T9VA 1WG5A 5HO4A 1QAXA 2KG1A 4U8VA 1VBXA 1DBDA 4HYKA 4FF2A 1UW9A 1X5TA 2YKNA 4DV3F 2CZ9A 2FY8A 4OQJA 2WOMA 5GVQA 3PJ9A 2QA4S 1DTQB 1B64A 2M9KA 3W3SA 2JHEA 3W2WB 3IO1A 2BQ3A 1UVJA 5LXYA 2V2VA 4YR0A 3CDEA 3RBXA 2A3JA 3CJSA 2OEKA 4PG8A 1OYEA 4ED3A 3K89A 3NXZA 3JAMU 3S8SA 3MR2A 4DUYF 1CBKA 3DMJA 4DLGA 1SJFA 3JQJA 4KFBA 5A76A 1IKXB 3S6EA 4F4KA 1SKRA 1R43A 4JOUA 1C0TB 2JVOA 4DZ6A 5LJ3Y 2ZH9A 3KOAA 1QE1A 3IMQJ 2ASDA 5L38A 1F5CA 1EB0A 3GJQB 2D3ZA 2B6AA 3MMBA 1OS5A 2EC2A 2MJUA 2N4DA 3OT9A 2N3OA 3J80Y 1B7YB 5A8WA 3Q8YA 1FRJA 2BM1A 5CCMA 2LQ8A 2XNQA 2CPFA 2B9WA 2QLBB 5LMUF 3C19A 3NAHA 2E1AA 4Q43A 3PACA 3THTA 3LO3A 3T9ZA 1T9XA 2E1RA 3KLEB 1Q86T 3TNVA 1MWQA 3M9OB 4KKOB 4TNOA 2PEHA 2ZZMA 3KXDA 3QT5A 5KG1A 3O2IA 3D68A 1V5IB 5HMXA 3HCXA 3MEDA 3CCSS 5GMEA 3SEOA 5ETMA 4HH0A 4K4UA 2MEWA 4BWMA 1JK9B 2V2QA 3QZ7A 4I67A 1NPKA 3EVWA 1A0OB 1RAJA 4RNFA 4YHHF 2D9PA 1RTIB 3PY8A 3O5TB 4RUAA 2DKOB 2JZ5A 4HL9A 2HHSA 1RZMA 1R6VA 3FCWA 5LXRA 2UXCJ 2BW7A 1TL1B 2W24A 4F67A 4TY8B 1D9DA 3DRRA 3WIUA 1SJ3P 3CCES 2CFXA 2BANA 1CC7A 3ZZZA 1UVNA 1UJ5A 2AX0A 2EI5A 2W2MP 4DV5F 1FWPA 2B4UA 4ES3A 1YJNS 4B3RF 1XR7A 4ZLPA 2I2YA 2VC0A 4JI3F 2JEGA 2DVIA 3MPVA 4NXNF 1ZBTA 2EW9A 2OFHX 1AUSL 2VA3A 3HO1A 1FVQA 2QL9B 3R2DJ 2KRBA 2ZD1A 3T1AA 4DWIA 3JTNA 1RACB 3E01A 2I6WA 2C3UA 1U1KA 1RK8A 1AFIA 3EVMA 1H72C 1HQUB 2QO3A 2ZNZA 3MM7B 4OLOA 1N32F 1JB0C 1UVKA 2HURA 1T9UA 4NEYA 4Q7AA 5HL7Q 2OPPB 4PXCA 3LPEA 1JJ2R 2DR5A 4O3QA 1Q78A 4JI5J 3S7RA 1RWMB 2PGCA 2KL8A 4BLGA 3B82A 3HHLA 2VC1A 5KT6A 4XIUA 1TK5A 1D9AA 4P74A 3NAIA 1Q16B 4USIA 2I5JA 2YWHA 4NE9C 2DCUB 3DDKA 1DRZA 5A8RA 2J0SD 2H9ZA 2MHNA 1GMUA 3ZZOA 3DGPB 4NOHA 1N33J 2KTQA 2XSJA 4RNNA 1SL1A 4X4RA 3OHAA 3A8IA 1YJRA 1IWAA 4AD6A 1NPRA 4DL3A 1CJTA 1RBLA 1YG0A 1B99A 2VASA 5A0YB 4M1KA 1RQ0A 1LK5A 2RAQA 1H2TZ 6FD1A 4L76A 2R42A 2F8MA 3JTPA 2ZJQQ 2CDRB 3F41A 5D4OA 1KVKA 2QG9B 3AHPA 3DLJA 3QGIA 3D6TB 2XQCA 4DUZJ 2DH7A 2VA2A 4X4QA 1RT5A 3EICA 1WC4A 2VF3A 3HDSA 5F0UA 4C8OA 2W4DA 4EBDA 1VI7A 5L9NA 1E6YB 1WUUA 2IYGA 2RD5C 2UXBJ 2CQHA 4B3TF 2GJIA 2IDEA 3KUEA 5GADU 3LWMA 2FVCA 1CJKB 4N56A 3O3LA 1B70B 2V4QA 2PI5A 3CCTA 5KG7A 5CH7B 3SBMA 1PJ6A 1HKAA 2H3EB 3MCMA 2F4FA 3ENAA 3KK3A 1S9GA 1PBAA 3K7RA 2VICA 4NA3A 1X4CA 2AP6A 4KHMA 5B7WA 4I0WA 1GTHA 3FEZA 3PR5B 1HWJA 1YVFA 1VISA 2DHAA 3C14A 2AJ1A 2HGNA 2SXLA 3SQOP 3NBPB 5LSLA 1FA0A 2XSJB 3Q8UA 1TKZA 2G13A 2R7WA 1RAHB 1R8CA 3CCVS 3PEJA 3MEGB 1HHTP 1TQLA 2XMMA 3W9IA 2JEJA 4O0IA 3OSPA 2RKIA 4PWWA 4C8KA 2NLWA 2V8VA 4PKDB 4EFAC 1UTAA 2RILA 3IG1A 1S7IA 3E2EA 2BDPA 3FCHA 2HFUA 3O6QA 3U27A 2CWKA 4DV5J 1I5OB 2Q79A 2YQ1A 2IRYA 4DPTA 2XHWA 3QATA 2YWEA 1FNOA 1GXLA 3OFGA 4QIWD 2MZJA 1FX2A 2B3TB 4RW7A 2PMZD 3FDSA 1NKCA 1RYSA 3QFWA 1B0VA 4B9TA 4CT8A 1XEZA 4NPOA 4O44B 4B3TJ 3LP2A 3PNIA 1URRA 4L72B 2KU7A 4RW8B 5KT3A 4AYBD 2W7PA 2WONB 2BOPA 2HHHF 1KDNA 5D15A 3OL8A 3GCXP 1FTCA 3LOUA 4ZPBA 1QTNB 1TL1A 4UQGA 3CULA 4WJBA 3OBIA 4Z7CA 1NK8A 2CNLB 4J9MA 4C9DA 2FLOA 3CB4A 3FNNA 3QO9B 2HLUA 3MMCA 2C2EA 3A3OB 4MMOA 1Y0HA 1RYRA 2OEJA 4IQMA 3K5NA 3GJRB 4QOTA 1JNZB 3NNCA 4F4WA 1HNXJ 1YX2A 2FVPA 1IXKA 4KR0B 3UDLA 3MTKA 1JLEA 1K8AT 3NS7B 1CPZA 1RT4A 1YDLA 3GZ7A 3QYYA 4NYZA 2DGSA 2GQCA 3IR6B 1Y3JA 1QSYA 2V2ZA 2RRNA 4H4KC 2YX7A 1XNQJ 3IWLA 2DGXA 3PYEA 4YUDA 3NP5A 3TEGA 4C0BA 1XERA 3V4IB 1MROA 1IJEB 2YKPA 3EE3A 4KT0C 1ZH5A 1QJHA 2B9EA 4K2XA 2AJFE 3AAWB 3G6VA 5BYSA 3ZXWA 2KI2A 2E5GA 3QAUA 3AD9C 3EGWB 3V81A 3QT8A 1T9WA 2J9EA 1NLKL 2ZJPQ 2P6SA 4M63A 1NHUA 2V63A 3MEEB 1NK9A 1LV5A 4DUYJ 2Y8YA 2HHQA 1T05B 3SI8A 3D1OA 2CVEA 3UCZP 1VDHA 4UOCA 4MKVA 1FFGB 1VK8A 2HKEA 2C22A 1CQNA 2B7BB 4CM2A 4MH8A 2F65A 3QPIA 4NXNJ 1F2GA 2EPIA 2B6AB 4I56A 3T41A 5EHHA 4LR7A 1CJKA 2ZBCA 2XY7A 3CJKB 2U2FA 3MR6A 3TJ8A 2B4OA 1HMVB 1R7IA 1E6YA 3H2UB 1RHKB 1Y4ZB 1UZDA 4ANEA 2GGPB 4PG6A 1V6HA 4ES2A 4N5SA 2RS2A 2YH1A 1S6PB 2MQNA 2YWWA 2EG1A 2BKOA 2BZ2A 5K20B 1WG4A 4I2PA 5AXLA 1RUSA 2ILYA 1O6XA 3AH6A 3OLAA 2KFYA 1HBMB 2FDNA 3UN2A 2DNHA 1U2FA 2KYXA 2LP4A 2YKNB 4OYPA 5IC6B 2V9WA 1PAEX 2EG2A 4USKA 3G8TA 1R0AA 2BJ8A 2O1PA 3KG0A 4ZIVA 5AE3A 5LL6d 3CCMS 2HVIA 1LFPA 1PYTA 2F5GA 5CQGA 2OEMA 2V5HG 2XO7A 2LXIA 1BMQB 2HWIA 2MGZA 3BQ0A 4DR3J 3B6BA 2FQQB 4WE1A 4D3HA 1X4HA 4PXDA 2XLKA 4OYXA 2DXFA 3QNWB 4OX9J 3DHWC 5DDRC 3HHLC 1KLMA 3EGVA 4B9MA 3NS6A 1RISA 2M52A 4ZVQB 1D1UA 1RU1A 4K4SA 3UQSA 1UWBB 2V34A 3P5TL 1FDAA 2VJVA 1UZHA 2FIUA 3ISNC 3MXHP 1HFEL 1HI1A 4RUBA 3RB3A 3KFWX 1CULA 4PABA 5HQ8A 4MIWA 3G4SS 1K44A 3VV2B 2AJ4A 1LQ9A 5KFLA 2ATCB 2IBOA 1BD6A 1YGYA 2G1HA 1GT8A 2H5EA 5B09A 2IM3A 2QN6B 3I0SB 4NEZA 2N4CA 2R8IA 2XULA 3KHRA 1LEOA 1LW2B 3IRXB 1N5QA 1VLYA 2E7VA 3AB4B 3LP2B 3BQ2A 2XY6A 4EZ9A 4EZ6A 2M2BA 1EP4A 2MZSA 2VG7B 3VF0B 4OYZA 3W5ZA 5KAKA 2ZHBA 3FC9A 3CMAS 1N36F 1VQNS 1BXNA 4UQTA 4DV1F 2QIFA 1W7WA 2WAQD 4WXOA 3CC7S 5J1EA 3FGVA 2OIHA 1REVB 1T0TV 1QAJA 1KQFB 3KLFB 2XZTB 2RT3A 4M5KA 4JUZA 3BO2A 2IBKA 2MY8A 4DN9A 2OP5A 2QLWA 4OJGA 5L39A 3R2CJ 1KVJA 2RDIA 2HQDA 1WD6A 3N6MA 5KFSA 1DFDA 1QDUB 1JWWA 1LOUA 2VFVA 3CEDA 1CG2A 1UKUA 3MM6A 4XDCA 4MK8A 4F02A 2RQCA 1EHWA 2OD6A 3LP1B 5IWAJ 3IWNC 2AX1A 1IVZA 1FFSB 3UNGC 1PIEA 1U0HA 2W1BA 1UL3A 3Q0AA 5G0RB 1B0TA 2OPQB 3I9V9 3KDOA 1WEZA 2RHSB 1I3OB 4IRDA 3GIJA 3OR1A 5H9FJ 5GMKa 4F4XA 4DQRA 3OFEA 1SKWA 2VOPA 2DO0A 1WWHA 5I42A 2YNFA 3OPKA 1F1BB 1RB0A 3BSAA 2ATLA 3BV8A 2NR0A 4ZN1A 1SKUB 2EC0A 1XMQJ 3HP6A 4CLKA 3EXYA 3AY0A 5KFZA 1GFWB 1TKTA 4LRDA 5C42B 1CQMA 3UR3C 2ROPA 4X65J 1PG5B 4DR3F 1BY9A 2NREA 2JEIA 2GW8A 4F4YA 4GC7A 3V6DB 4BCAA 1M1HA 3QQCD 4MJKA 3FZBA 2HS3A 4CZCA 1C4AA 2VBXA 2D9OA 3POTA 5E41A 3SV3A 1C0TA 1TR0A 2DEIA 3W9HA 3BYPA 1G3OA 2BOAA 3PTWA 5CD4A 2KXNB 2XZDB 5DG9A 3MECA 1L3VA 5DZ7A 2HFVA 4P2XA 3TA2A 1S9FA 3C3LA 4DR5J 2QFIA 1LXJA 4I6AA 2IVFB 1WKJA 5J2NB 5AXNA 4AQYF 3KNGA 1X4FA 2QMUB 1FJEB 5C2GA 3QO9A 3DOMB 4QR2A 1IBMJ 2FZKB 2GO8A 3CD6S 3P96A 4IYQA 5HAOA 4C98A 4FVCA 4IUFA 5J2QB 2JC1A 2BR0A 5DS7A
chains in the Genus database with same CATH topology
2OO4A 1QY7A 3RAMA 3MMAB 4K4VA 1RA6A 2I5JB 4NXMF 3N28A 1S9EA 3M6UA 3KNAA 4Q45A 3DHXA 1XMBA 4RUCA 2DHSA 1XMOF 2YKQA 3C6TB 4I2PB 4B3OB 4ALZA 4QPXA 3MD3A 3G8QA 4ED5A 4M5DA 3MECB 1U25A 3IGNA 2OPSA 1HQEB 1XK8A 2NYIA 1H0HB 4M8LA 1GXTA 4NRUA 4DDFA 1JNRB 4USJC 2CQDA 2F3JA 2EFVA 1V9OA 1X4DA 5IT0A 5DM7Q 3KKFA 5F8LA 3Q8QB 4JV1A 1JJ4A 2VPYB 3MF5A 3CXCR 1QVFR 5EGYA 1Q79A 1SJQA 5HLFA 4NRTA 4DL4A 3EGZA 1FKOB 1H2VZ 4TU8A 1R31A 2MZQA 2WSCC 1KONA 3HHDA 5I3QA 3VAGA 2JL9A 3DRRB 1UA1A 2JLFA 4CO1A 4H4MA 2RJZA 2KT3A 1UJ4A 2VFRA 2FHMA 1QUVA 1ULRA 2OPQA 4Y00A 1J5EF 2UUCF 5IT4A 3QZ8A 4M95A 2FHJA 4O3RA 2DD8S 3DU5A 2VD3A 4HDGA 4QJVA 2YY3A 4ED0A 3FSXA 3JSMA 3NGDA 2QA1A 4RW9B 2UU9F 4ED6A 1NK0A 2PDAA 1TV6B 2HIQA 4OHZA 3RRKA 5AE2A 1C0UA 3DLEB 2KH9A 2F8EX 1SKSA 2W8LA 4ID5A 2RE1A 4PQAA 1YJWS 1Y7PA 2R8KA 3R5DA 5CHCB 1DJ0A 3DYAA 2VG5A 4PPZA 3RAXA 1OPIA 3GR1A 2K8GA 4RKUC 5K9FA 5CYQA 1QSLA 2LQJA 4QU6A 2IAJB 5EWFA 5FD1A 1SH2A 4ECZA 2PA8D 2ZVSA 3SQGA 3VAKA 4GKJF 2JSXA 4ELTA 4K5SA 1AUDA 1SJ4P 3S01A 4RW6B 2GFFA 4DR1F 2W9CB 3OW2R 1HBUB 2OTJS 3CCQS 3ITHB 5KFGA 2BRLA 1V3RA 2PIIA 3EXCX 2N7YA 1D0EA 1RT1B 5D4PA 2A18A 2CDQA 5THWA 1LWEA 4HKQA 3K8VA 1VQYA 1TKZB 5E3AA 4WFBQ 4WTYA 3OR2B 1WF1A 3MM5B 1NJWA 2XWYA 1VC0A 1QSSA 4ZMMA 1X9WA 1YJVA 4X84A 2L3MA 4BWJA 3VTIA 2XMWA 1S6QB 4IR9A 2LCWA 4I64A 2HW3A 3D2WA 1RT6A 2BANB 2LKZA 2GHWA 2IVMA 1A6LA 2YWFA 4QQBA 3H5UA 1VRTB 2OTLS 4ZPWR 1FESA 5IM0A 2GIQA 3H59A 3OVBA 1GX6A 1VFJA 2DITA 2C3PA 2FGCA 2PSZA 4WFXA 1NHVA 1XMQF 2R7UA 2V9KA 1U1NA 4E0DA 5MAOA 4DPOA 1SL0A 2J0WA 5D3GB 1KVIA 3U7JA 2ZOFA 1RTJA 5CZXA 1Q8BA 3Q8RB 5JVHQ 1T02A 4Y2AA 4DQSA 1Q7YT 1U24A 5KFUA 2EFOA 3BR9A 1N52B 3RBEA 1WF2A 2K7KA 2YTCA 5KFPA 4YOEA 3UCUP 4NYOA 3IRWP 3DGPA 3UWTA 2DO4A 3QIPB 2QV6A 3GV7B 3NCPA 4QZVB 1VK3A 4N8NA 5DJBA 5AXMA 4CO2A 5M2PA 4FYDA 3CT9A 2Z0GA 3OXFA 4I2QA 3U1NA 1S99A 2YNIB 5F9NA 5KOXA 3K58A 2MKSA 4RU9A 1U1LA 2DNMA 3I0SA 2DNZA 4DR7F 1K0VA 2P9EA 2HS4A 4BC7A 5BR8F 1OSDA 4CH1A 1HI8A 5B0EA 2VODA 4WFYA 2RNEA 1RT4B 1JMTA 2D1CA 3DLKB 2JC0A 3DLGA 5JXSA 3PIPQ 4NWBA 1Z1ZA 2X51A 3TAMA 2BYCA 5LJ5Y 5FDLB 4Q5VA 3H5YA 1QUPA 5L1KA 1U47A 4M94A 3M6WA 2C42A 1JKHB 4MFBA 2CQGA 2KO1A 2IFXA 3GSDA 2GMLA 1RTHA 2NPIA 2YKMB 5DG7A 2KT2A 3H5XA 3AQPA 1QLNA 3CCRS 2IC3B 2W9BA 2XGQA 1ZOTA 4QWCA 4HDHA 4NLSA 1DTTB 3KLIB 1L5UA 3CJ0A 1GAOA 1Y5LB 3MAQA 3CD7A 2RF2A 4QYRA 4HH1A 2VFTA 3ZC4A 4ED7A 4BDPA 2Q6BA 3O1LA 2FJWA 1K9MT 2EK6A 4QIEA 3UPFA 5EWGA 2P9GA 4ZP8A 2UXDF 4CH7A 4Q8FA 1Q1KA 2O67A 4L6V3 2UP1A 1MMDA 3C66A 2OMLA 3MEGA 4OFZA 3TUIC 4J9QA 4WFNQ 2FVSA 2ACYA 2GGPA 3DOLB 1W2BR 4C8YA 2DGUA 1ZYQA 4RU2A 1HYSA 1OPZA 2R7XA 1KOOA 1IQTA 1FRIA 3IWXA 2GNKA 2W4CA 3I5AA 5A2QY 4FF1A 3I0RA 3CJ4A 4RNOA 3AJ2A 1X5OA 4X4NA 2ZFHA 3R1HA 1I6JA 2VKZG 3PW7A 2IA0A 1B7FA 3OLBA 1UAWA 1N0UA 2YNFB 4QIVA 4L3NA 4A46A 4B3SF 2F9DA 1D8ZA 3GILA 2KJVA 1JLEB 5J1PA 3SYZA 3DOLA 1P27B 2QSFA 2KRRA 2MQPA 1U1OA 1JLGB 3LPYA 3U1LA 1YJTA 3MFHA 3M2VB 1FEHA 1M5SA 2GJ2A 2HPUA 3HZGA 4JI1F 2IVYA 2ZH8A 4LSNA 3T1HF 1HWLA 3EPGA 2D7SA 3C6UA 4DG1B 2R2RA 4PQUA 3BN7A 2HWHA 4FN5A 1KOHA 1KTVA 3E51A 3CCJS 1PC5A 3K5PA 2HHPA 4C3LA 2VBZA 1FT8A 2AW0A 1ZETA 1DQ9A 5B08A 1S1VB 5KFMA 1UW4A 2CG4A 5DGAA 2NQPA 1J2VA 1U7LA 3B4MA 3MUVP 1P6TA 3IAM9 4ZCMA 1WELA 3I9ZA 4C0OC 2E29A 3OTBA 2E9ZA 2OFGX 1U6ZA 1WI6A 1BLUA 2CJKA 2YVSA 5GAHI 4DR6F 1TL3A 3PFOA 5KTQA 3Q23A 1FRKA 4DL2A 4A8FA 4WF9Q 2ZE2A 2FJBB 3CMES 2VFSA 3M30A 1V3SA 2VBYA 1UETA 3BB5A 1VQKS 4IRKA 1PGZA 4OI2A 1BQXA 3BGRA 2AV5A 5EX0A 1SH0A 1SQEA 2KHCA 3CJ5A 5DDQC 1IUJA 1N5VA 1HBOB 1Z2LA 4ECXA 3N0VA 5T7LB 2BA9A 4DG1A 3Q8SB 3GG0A 2ZUGA 3N79A 1R0AB 4QWBA 1JLBA 4LF4F 4FXDA 3DRSA 1Y5NB 2FB0A 3BREA 1T94A 5C5JA 4UW2A 3GFZA 4OZ0A 4X2BA 1VQPS 3T9NA 2MZRA 2YX1A 1Z2ZA 1M5PC 1TV6A 3QGGA 1RDRA 1Q8IA 3LAKA 1HPZA 3PX0A 2HNDA 4NCAA 1JLFA 4DFMA 3P6YC 3GV8B 3CSKA 4EU0A 2XMJA 1ZTTA 4YEAA 2UVRA 2LEPA 4RBVA 4TU7A 3PO4A 1HNVB 4FXVA 2BQRA 4IG0B 1O51A 4C11B 4C97A 2W7PA 1TK8A 3CD6S 3RRHA 4TXSA 4PRFA 1HNIA 4IG3A 3IR7B 4URQU 2DRBA 4MKYA 5U47A 4C2MA 1S10A 4FBTA 4ITSA 3B8HA 3G6XA 3LAMA 1HYSB 2LA4A 3UR0A 3U1MA 3KMSA 3I56S 1FO1A 2QA4G 1HBOA 1UFLA 3N9UC 4LFBF 2CJ9A 4FNIA 1T3OA 2R7VA 3FEXB 4KC5A 5F8IA 5HP1B 2PE8A 2IM2A 3V6HA 1DLOA 2OMOA 4A8WA 1HWUA 2F9JA 2XS5A 2MY7A 5HMYA 3IS9B 4ZK7M 1TVRA 1DTTA 1VJWA 4Y65A 4G1PA 4DJBA 2CQ4A 4JI4F 4F3QA 1D9FA 4H4OA 1WEYA 5CYJA 2HHXA 5L8RC 3TO8A 3Q24A 3G6YA 2OKQA 2V4JA 2X1FA 2FLPA 2CJBA 1Q7LB 2IJFA 5BYRA 4OI6A 2FPHX 1H38A 1JKHA 1PC4A 4K4YA 3T6JA 3MI7X 3FZ2A 4HHJA 2XS7A 2QMWA 2XWXA 2B56A 1DAXA 3CDAA 1S1VA 4NX9A 3DOMA 2M4MA 2CPZA 1S6UA 3SV4A 4G6VB 4CTAA 2C3YA 4LSLA 3CD5A 4MFBB 5D78A 5M2UA 4NCBA 2KN4A 4AXIA 2F4VF 4LMZA 4X62F 1NH8A 2QLXA 3X3UA 1MSWD 1BC6A 4ILRA 2KKHA 4I68A 2B43A 4AE5A 2BBEA 3M32B 5L1LA 2IM0A 4ECTA 1K73T 4NLRA 1KQKA 2BW2A 3SCKE 2V8HA 2JFKA 1FDBA 1JLAB 5DO2A 1S1TA 2VONA 3HVRA 2ALZA 3TUJC 2GO9A 3HK2A 3MEDB 2ZOGA 3B78A 3UD4P 3V5RA 3BGLA 1D8YA 5J2MB 1XNRF 1MMLA 2NXUA 2O66A 2UZAA 3NLCA 2DGVA 4ELUA 4AXJA 4P7VA 5HBMB 3RTVA 5ITHA 1P1TA 4NLXA 4X4VA 2W4PA 3K5MA 2Q43A 1GQEA 3EUNA 3OV7A 3MMBB 3KG1A 2BACA 2W25A 4RBUA 5AXKA 2KXHA 3N5BA 1S1TB 1SB6A 2FTRA 2RB7A 4YP3A 3CCZA 2K7JA 2M7SA 2F8HA 3G9CA 2QEXS 3MDFA 2HMIA 2VZ9A 3I31A 2ZC4A 4M5DB 4WU3A 4E8UA 2QE5A 4F25A 2ZH5A 2IC3A 1NK4A 1DURA 3G6ES 1X0PA 2U1AA 1X9SA 4JI5F 4DSJA 1DTQA 1BQNB 1BQMB 1RTHB 3ONQA 2A10A 1F60B 2C3OA 4I4BA 3BSCA 3DM2B 2DNYA 1LWFA 5C25B 4PXEA 3DC2A 2ZH4A 1FTRA 1HW8A 4EYHB 2HQ3A 2W9BB 4DMZA 3TI0A 3DI6A 4A8OA 5B0BA 2CPDA 2WBMA 4RW8A 1FE4A 3HZEA 1X5PA 4RNMA 1RT1A 4FPRA 3DM2A 4GMKA 2G4BA 2J76E 1IKWB 4LVNP 5KFCA 4IR1A 3IS9A 4YFUA 3M8SA 2BV3A 1L3SA 2OPRA 1HBNB 2UUTA 3JYTB 7FD1A 1DLOB 3KK1A 5IT9Y 3HVWA 3I82A 3N4WA 2J9DA 4ZDNA 1MU2B 2XMUA 3CF5Q 4DR5F 3G71S 3MOZA 1UVMA 1I1GA 3E01B 1YRXA 2UXCF 2BE2B 3FMWA 4CI0B 2FY1A 2XLIA 2XMVA 5DM6Q 2CJQA 1OQ6A 3AA8A 3M05A 3NL0A 4KTQA 1VIXA 1S0NA 1WHVA 1VBZA 1YBAA 4HTIA 2DIVA 2M0GB 3L7PA 5C24A 3K2YA 2CPHA 3H4DA 1ZM9A 2PMHA 4ZP9A 3CUNA 1LW0A 2HRYA 2NSBA 3I96A 3DRXA 3PKYA 3AJ1A 3M9NB 2V8GA 2BJEA 2J9DE 2DB1A 4F3OA 2A2DA 3CWJA 4G1QB 3KLHA 3R5CA 1VQ9S 4ZVEA 1FRXA 3LP1A 3I55S 4X65F 1NEEA 3BR8A 4O3PA 4NLTA 4EEYA 1HPZB 2VKRA 4DX8H 1IN0A 5JUMA 3EPIA 4QWEA 3O8WA 4ECYA 3KLFA 2VH7A 1YWXA 4J9KA 2AWZA 4IDKA 5C24B 5IWAF 1R3NA 3CDWA 4ID8A 3NRBA 1MW7A 2EFQA 1FKPB 4G1IA 3UCGA 5KFWA 2Z4PA 1CLFA 3OL7A 4A8YA 2MSTA 4ZCKA 2YNGB 4RLEA 4Z2XA 1FJ7A 3DU6A 2QA2A 4MK9A 2P5VA 4MTPA 4RZRA 4WKRA 4DL7A 5EUHA 3D5MA 4CNYA 4QWAA 4TYAA 1S6QA 4KQZA 4U7CA 5CA5A 4ECUA 2CRLA 3ETOA 2LLZA 4Y2KA 5CYMA 5K8MA 3RB0A 3BN4A 5GAGI 2ZDPA 1SUQA 3K5OA 3R1LA 4B9NA 1IBKF 2FGOA 3BZQA 2I1RA 3A8EA 4IFVA 3BO3A 4C8ZA 2BXJA 5I4MA 3KJVA 4J9RA 4MIBA 4URSA 3GV5B 3DXBA 3DNCA 2ZD1B 3I5CA 3OFHA 1U1RA 4RW6A 5A6WA 4TKTA 4OZNA 3TOQA 4PG7A 2Y1JA 1NZAA 3VZIA 3HHNB 1LWFB 1VC5A 3SQGB 1K1SA 4QR0A 2JDJA 3T1YF 3CGIA 2DHXA 2HVZA 3OXGA 3IA0A 3P3DA 4RW7B 3PW0A 1TL4A 4B9UA 2HYIB 1XBWA 4DQIA 2ZDOA 2YWKA 1N5YB 5KFDA 2X1BA 2K3IA 2YWGA 1SJRA 1S79A 2ROEA 3RR7A 5KOWA 3DLKA 4KB7A 4AFFA 3CDUA 3NCRA 4AL5A 5I3UB 1VOMA 4C3MA 2ASJA 4PUOA 3HJFA 1LFWA 2XEXA 3KHGA 1Y00A 2GMHA 2HFNA 2W7AA 1X9MA 1VC6A 2XI3A 4LUBA 1N4LA 4DL6A 5KFKA 3F56A 4K4ZA 3TX8A 4ECSA 4FF3A 2IMOA 3GG1A 3RW7A 4DV6F 1M90T 4F2RA 1BGXT 1HNIB 4PXBA 1U48A 2MQOA 3FSIA 3PJXA 3HMJG 4WCEQ 3MWBA 5A8KA 3KHLA 2WBRA 3MGJA 2R2SA 4ZPCA 2R7QA 4HI2A 5MLCV 4ICLB 1S0OA 1QE1B 3ZFVA 5KFRA 2GQQA 4IFYB 3LUYA 4R5PB 4DS5A 1ZZNA 2ZH3A 3KK2B 2JX2A 3LW5C 5D4NA 4KO0A 4B02A 3PR4A 3M30B 3CJ3A 4IO9Q 2O3DA 3ENQA 2W7OA 3UI3A 1NO8A 2WOMB 3H8YA 4OHWA 3QMQA 4PWUA 1TL3B 1YQHA 4F8RA 1H98A 2VQEF 4KRWA 3HVTB 2ZHOA 1LW2A 3QGPA 4DHVA 2HVHA 5HI7A 4WYWA 4H54A 3KLGB 2RDJA 4K4XA 4LF9F 3D54A 1WHYA 4ZKAA 2J6TA 5E5NA 3HM9A 2BABA 2JVRA 2ZBIA 4NLPA 3PX4A 5B0CA 1G6BA 2OLWA 3T5HA 4QIGA 2F7VA 1UP1A 3KMQA 3J7YU 3G86A 4OHYA 1CC8A 4IOCQ 1S72S 1U1QA 2IA6A 3FMBA 1LWEB 2WRMA 3PFEA 2RVJA 3MMJA 2M88A 1VIOA 2CPJA 4FP9A 2HNYB 1HBUA 4DFKA 1HBNA 1VRUB 2QRRA 5F3TA 5T41A 4A47A 2GCFA 3VQTA 4B17A 2C2RA 4I2QB 4KGMA 2I9SA 1WHXA 1H7XA 2OSRA 1FD8A 1YSJA 2DNGA 4QPTA 1K0TA 2J8AA 2O01C 3QLHB 4IG3B 4F4ZA 3FRZA 1KN6A 3VR1A 1FK9A 4JBCA 2J6SA 5KG5A 1KFDA 2PA3A 1Z4UA 4Q0BA 3DLHA 2MPUA 1TL5A 4C8MA 1GXUA 2CQ0A 2HMIB 3MUTP 4PWDB 2V8DA 4I6YA 3LALA 5I42B 1YHQS 4GKKF 2NPFA 1RTJB 5KT5A 3PIOQ 2PI4A 4MYTA 1NK5A 1UVIA 2B4VA 1X7VA 2MQMA 1IKVA 3FJ2A 1JXLA 3M8PA 5DQHA 1R27B 1U6FA 4TYBA 1C0UB 2BM0A 4DSLA 3EZUA 1RT3B 2GHVC 3CO9A 1T05A 1SL2A 1FKAF 1NAQA 3TP2A 3M9MB 1EP4B 2IM1A 4B08A 1FHTA 2KG0A 4PWDA 1MROB 1REVA 3I0RB 2A2CA 4N41A 4ZVHA 4OZ1A 1ZTWA 5KFHA 3RYLA 3BGRB 4MAKA 4NLGA 5KT7A 2XGPA 3KJVB 2OJ3A 1KD1T 3GR0A 5H9EJ