3QJLA

One ramp protein binding different rna substrates
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
HMRIEVKLLPLKDNPILPFNYNYEVYSQILEKVNSIEPTIAKLLSSPHGFWTFSRIIVRKRKILPDKGIEILSDDVSLYISSSNEDIIRAIAEAVEKSPEFKIGELSFLVGDIKAIKVKELGKENVFSTLSPIVVRTVKFEGNKLRHWDLYPHDELFMDRLRKVMILRYSEVMGETPKDRDFTIEVLKFKPTRLMVGSSYIRGSLMVFRYAGSEEIARFGYENGFGEKTGLGFGMVKLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cooperative and Specific Binding of a RAMP Protein to Single-stranded CRISPR Repeat RNA
rcsb
molecule keywords Putative uncharacterized protein PH0350
molecule tags Immune system/rna
source organism Pyrococcus horikoshii
total genus 63
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01881 Cas_Cas6 CRISPR associated protein Cas6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qjlA01
3.30.70.1900 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qjlA02
4ILMA 4C98A 3ZFVA 4C9DA 3PKMA 3QJJA 3I4HX 4ILLA 4ILRA 3QJLA 4C8ZA 4C8YA 3QJPA 4C97A 3UFCX
chains in the Genus database with same CATH superfamily
2DNLA 2MTLA 2QSWA 1YLXA 1ZTWA 5HN0A 4LBIA 3NEKA 4GC7A 2AYGA 3Q22A 2LA6A 1KOHA 3N9UC 4F3OA 1PCAA 2X3DA 3P8BB 3ZNUA 4DFPA 4DCOB 2AJ1A 5IM0B 5D6GA 1T0TV 3OFGA 2V9WA 1FRXA 2GQ2A 3CEDA 1KRPA 5IOLA 3ZZZA 4QR0A 1TAQA 3GJTB 4R5PB 1JJHA 3RGIA 2MLYA 3KYLA 1KTVA 2KRBA 2LVWA 4DU7A 2HHQA 2GGPA 4Y2MA 4O3OA 3RJMB 1KC8T 1CJKA 3TQEA 1JNZB 1ZM9A 1BQXA 3DFEA 1KQFB 2IVYA 1ELOA 2ZH1A 3VAMA 2MY7A 3I0RA 3VGVA 1N5QA 4HVZA 4ZIWA 2RF2A 2GJIA 4YB7A 3MAQA 3UDCA 4M94A 3CF5Q 1YJ9S 2EEYA 3LO3A 3GV8B 3QRRA 1TL7B 1SQEA 5D8HB 2E5LJ 4NXNJ 4YY3J 3FZBA 3GFXA 4J91A 1NK0A 3TAMA 2MKSA 1NDCA 5D4NA 3KLFB 3RBDA 4Y2IA 3BR8A 2A2DA 2N7CA 3R1HA 1WF2A 3MM8B 4QW8A 3CMQA 4F4ZA 2DYAA 4B3SF 2L48A 4FF1A 2VPZB 1MW7A 4I0WA 5E0OA 3C16B 3UW1A 3DOMA 1YBTA 1Y5NB 4QYRA 3MTKA 2W25A 5GADI 4LFCF 5HLFA 1RTIB 3G87A 1NRKA 2X7IA 1AA1B 2DNPA 2HLUA 1RT4A 3IGVA 2JJ4D 3O3LA 3CWJA 1S1TA 1LK7A 2RQKA 1RTDB 4FYDA 2YY3A 1N6QB 4FF3A 4HTJA 1RACB 2V94A 4RU2A 2DNNA 2HQIA 2MYFA 4QYZJ 3TAQA 3M1VB 3VQTA 5J2PB 1GXUA 2IMWP 2XS2A 1N4LA 3HHLC 5B0FA 4HHHA 4WIIA 4ED5A 1FTRA 4G1IA 4RJVA 1RK8A 2VA2A 4NZ7A 1NH8A 3C6TB 4AL7A 4DF4A 2BE2A 2F65A 2AP6A 3W66A 4DQQA 2NPIA 1FWKA 3SSRA 1VMBA 3G2XA 4B3RJ 4OQJA 3BS9A 2A6MA 2Z2LA 1KQGB 3TW0A 1S5ZA 4A8OA 2NREA 2UUAF 5DDRC 5GMEA 5HMXA 1UWBB 2JVRA 2ZBPA 2LECA 2GVDA 4U8VA 1PG5B 3GCWP 2ALYB 1RWPB 5CZVA 3MI7X 1VIOA 5HO4A 1S6OA 3SXLA 1S9GB 3B82A 3FFIB 4DR7J 1TK8A 2CWKA 3I0SA 4DHVA 2J9EA 2MY8A 3GONA 2AMCB 1GXTA 3A12A 4J9VA 2PA3A 1FWPA 3FBEA 1Y3KA 1E6VA 3T6JA 5KFQA 1OYDA 2VIHA 3MOZA 2UXBF 1J5EF 1CSJA 3GIKA 1I5OB 4A8FA 3N79A 1BQMB 4CT9A 1FRKA 2E7WA 2R2UA 5GAEI 1ZAXA 1KDNA 3CD5A 4HDHA 3LTOA 3M6UA 5LMUJ 4RW8A 4AUKA 1N34F 1EZZB 1HI0P 2K3IA 2DBBA 5L1LA 1TK5A 4HH1A 5I42B 2RH3A 2IIHA 4X4NA 2AJ0A 4EGLA 3SI8A 2YNFA 3DM2A 2BABA 3OFFA 4ZP7A 1NSAA 4KJIA 2HBYB 4F0MA 4OIXA 4OYOA 2ZFHA 2XTJP 2LQBA 1TTHB 2N4CA 3EICA 2B3TB 3CJ2A 1WI6A 3BQ0A 3RB0A 1NDLA 5KOWA 3OR1A 3W9JA 2D74B 3BREA 3AFGA 3NAHA 1HW8A 1P6TA 3CDEA 2CZ4A 1PC5A 2GX8A 4OX9F 3R6LB 5KG2A 2YNGA 3G8SA 1Q16B 2VB6A 4OI1A 1QE1A 2H51B 3UQSA 3CB4A 3SCKE 2ZEJA 5K20B 1S97A 4NEZA 4TU8A 1JB0C 4N47A 3MFIA 2M2BA 2QLJB 1WC6A 2ILYA 3JSMA 4YHHF 3M9OB 1VDHA 2UUBF 5DLGA 4GC6A 4RW6B 1FJGJ 3OSPA 4NCGB 2NYIA 1NJXA 3W3SA 2VD3A 3R7BB 1ZBTA 3CE8A 2YKPA 1IKXB 5A8KB 1ZAWA 1K9MT 1KONA 1TUGB 3KJNB 3CJ0A 3PJ9A 4OI0A 1Z1ZA 3PW4A 1I3OB 1QAYA 3D0IE 1U09A 4IG0B 3LF0A 4GVLA 2XSFA 3RTVA 3DDKA 5L46A 2M9KA 3TOQA 1FRJA 3HI9A 3DYAA 3TVZA 1VI7A 1U1KA 1HHTP 4K4TA 3PXGa 4OZLA 3SQOP 2WB1D 4M5DB 1VS3A 1V5VA 1RJJA 3CCSS 2PD1A 3G4SS 4NL5A 2CQGA 3H2UB 1FKAF 4DS4A 3A8EA 1IJFB 3UE2A 5A76A 1HQEB 2HGNA 2ZJRQ 2B51A 3HM9A 1RT2B 1RWVB 4IUFA 2AX0A 5IM0A 4ZPTR 1QAJA 5DQHA 2DR9A 2EPIA 1FTCA 1KQSR 4R5PA 3R2CJ 4ZK7M 1U25A 3GJQB 3MFHA 1OY8A 2DIVA 3QJLA 2DIUA 4DSKA 5GAGI 1BD6A 3HSJA 4A8XA 1GEHA 2XY5A 1FE4A 2JC1A 5A6PA 2GAGC 4N76A 4LUBA 4BC9A 2F8HA 1KVJA 4K59A 2HQDA 3CPWR 5DDPC 1G7CB 4Y2AA 3J81U 3FK4A 3HHLD 4LF9J 4DFKA 2G1DA 4FS1A 1XMQJ 2LEPA 2Q3PA 2W2PP 1XNRJ 5B0DA 5B08A 2MZJA 3WC2A 2XI3A 2OIHA 1TVRB 2KZZA 3PW0A 2P8IA 4O0NA 4CIOA 2BQRA 2CJBA 1TL7A 2MLXA 4F4WA 1X7VA 1F0XA 5BJRA 4UOGA 2RB7A 1D9DA 4CT8A 1UVKA 1RKJA 3KLFA 2CQ4A 1R6VA 3W63A 3GJRB 4P2FA 1D3WA 3HKWA 4C9DA 1G6BA 2DGXA 5F9LA 4O44B 3MM8A 2H5EA 4KYZA 4FXDA 3L4BC 1ZPWX 1CC7A 4OYZA 2HBZB 3OL6A 1Q8IA 3T1HJ 4USVA 3C16A 1DURA 3D4JA 1QM9A 2K1RB 2QFJA 4MKBA 1RTIA 2R8JA 2AJQA 3DLBA 5IC4B 1TFWA 3ONQA 2HS4A 3DRYA 4K8RA 4KE5A 2DNRA 1C0TB 3PHTA 4I7FB 5C25B 5M2PA 1RTDA 4MFBB 2E1PA 2ASJA 5KFVA 1ZOTA 1N6QA 2FLNA 2W2OP 4JI6F 4K0KF 2RNEA 3LA0A 1VQNS 3PYDA 5ETVA 3M1VA 2RQCA 5J2PA 2VH7A 4UUWA 3P5BP 3BYPA 1SQGA 2N4DA 5AE1A 3NRBA 1A9NB 2VL1A 1SC1B 1NK6A 1Y4ZB 4MJKA 2RS8A 3RB3A 2MQQA 1U1LA 2J6TA 2K8GA 4EK2A 5FIIA 1OSDA 3C6TA 2ROPA 4UZCA 1C2PA 3NGRA 2B0GA 3AD9C 2CA9A 3VGUA 5D0HA 2V6AA 2DK2A 4S0MA 1U8WA 5CXTA 3N28A 3IN5A 3F44A 2WCXA 3AY0A 1U1OA 1M5OC 1UWBA 2WW8A 1YITS 2VV5A 2ASLA 2HQFA 1SBRA 2DR8A 4J9KA 1YBAA 3IC1A 2H4YB 3K8WA 4TYBA 3FUYA 2C2MB 3TANA 5T14A 5F9NA 4X64F 5JVHQ 1S9GA 3V81B 3J80U 3FFIA 1YZ7A 1WSRA 3QWPA 3KK1B 4PG6A 3MM9B 2QJ3A 2GO9A 4B3MJ 1R8BA 1RLDA 3SEOA 2D9OA 4X4VA 1DARA 2LXIA 1TL1B 4IH5A 1NKBA 4ILRA 4WFYA 2E1AA 4DQSA 1S0MA 3MOJB 1BQMA 1RBAA 4DQIA 4HHJA 1UPMB 3V6DB 4ZCKA 1FCAA 1AZSB 2M3DA 3FNNA 4OYIA 4USIA 2Q1LA 2ZC4A 1HW9A 5D0GA 5D78A 3R5DA 4DJBA 3DGVA 3FMBA 2MEWA 3ZZPA 1R89A 4KAIA 3TA1A 1SKRA 3J7AN 5ETSA 4J9LA 3PZPA 5I42A 2B4UA 3ZTRA 2AYMA 1HA1A 4PWUA 2LP4A 2G2OA 4ZVGA 3H25A 4ECVA 4NLVA 2BQUA 3PFEA 1XNQJ 5BR8F 4NE9C 1Q4RA 1X0PA 4DV2F 4IOBA 2DR5A 2E66A 5L1KA 4M8LA 4CO5A 4CRJA 3CO0P 4ZVHA 2PEHA 2MZQA 1WC0A 3KXDA 3UFCX 1H7XA 2J9DE 2E5HA 3CJ3A 1SUQB 1OJ4A 3IMQJ 2DO4A 4ECWA 2FHOB 1HNIB 2CQ3A 2E7XA 3KJFB 2HK3A 1S0OA 4KHPF 2HHVA 4G1PA 4EYIB 2W9CB 2FVQA 3Q24A 1IWGA 2CJ9A 3Q8RB 2D3UA 3SV4A 1FERA 4JI7F 1DQ8A 1K44A 4RW6A 5IWAJ 3OTOF 4NCGA 1IVZA 1AFIA 3CDAA 2DXDA 2F4FA 5A8KA 1IXKA 4PYAA 1Y5IB 2HZVA 1FD2A 1SH2A 4F26A 1SVDA 3H2VE 4IG0A 4LF5J 2FIUA 2HNDB 1J27A 1FRMA 3CC7S 4QIFA 2ZJQQ 3G6XA 4TYAA 3UDVA 4RBTA 4ZPCA 5DZ6A 2LQ9A 2J6SA 5CHCB 2FHMA 6AT1B 4DR3F 4AL5A 1EP4B 1HKAA 3MPWA 4M5DA 2QG9B 4O3RA 2UXDJ 3ILOA 2WVBA 2XNRA 3EXYA 3KUEA 1YKWA 1TL4A 3EZ5A 2BJ1A 2F4VJ 4P7VA 5KFIA 4RPFA 1HQEA 2FJDB 1FDDA 3PEHA 3HPOA 1REGX 4ZLPA 1RT2A 4O0IA 2DNQA 3FJ2A 1XC9A 3ZTOA 1YDLA 3PDNA 3Q2SC 2MKJA 4C8OA 2AZ1A 3SZ2A 2BM0A 4GKJJ 2VPXB 2V69A 3A8IA 4LR8A 3DRXA 2FC9A 1NH7A 4L73A 4F4YA 1XJWB 2MQNA 3KOAA 2YPYA 2E1RA 3CTRA 2A0FB 1SC3B 1DBDA 4EMDA 1GNKA 5CYJA 3QAEA 1C1BA 1DZ5A 1U7LA 3THTA 1RU1A 2HAFA 3SCIE 4XO0A 3I5CA 3P6YC 3F56A 2BOAA 2FVSA 3G82B 3JQKA 3MR6A 1U8SA 1RWUA 2OPQB 2P6SA 3BGFA 3OVBA 2FJWA 3EVOA 4DL6A 4EBCA 1VBKA 1IBKF 4HT7A 4DF8A 4F0KA 1TVRA 2RUGA 3RAMA 2DHSA 4Q2MA 3OV7A 4LR9A 2ZH3A 3MCMA 3U1MA 3RR7A 4MAKA 1CJTB 2YKAA 1NPPA 4XPCA 2IRUA 4OL8A 1VK3A 1RTZA 5G0RB 4DL4A 2WAQD 2UV8G 1WF0A 2HHHF 4O44A 5I3UA 3MD3A 3DOLA 4AE5A 1N5YB 5MLCV 2PE8A 2BW7A 4FPRA 3SQGB 4WJBA 2K7KA 3M32B 1H74A 4W90B 4ZN3A 5KG1A 4ZLJA 3AQPA 5IT9U 5IT4A 4DL5A 1XK8A 3EZUA 3P5TL 4EWTA 3BO3A 4ZVUB 2A3JA 2GO8A 2E9TA 2B7CB 3P4UB 3W64A 3VZHA 3RUBL 1HD1A 1C0TA 1NXIA 3LOUA 4FNIA 4I7FA 5C25A 3K8VA 4MFBA 1Z2LA 2DH8A 4QR2A 3FSIA 2UVWA 4IOCQ 1ZM3A 2R8IA 5F8IA 4QJVA 2VG6B 4MKYA 2DGQA 1R27B 4PQAA 3D3CJ 2MKKA 2B56A 1SCJB 3MEDB 3TVYA 1RXOB 4J9UE 2JRSA 1QLNA 3RZAA 2HWIA 3IFEA 2HMIB 4EZ6A 1LWXA 4DU8A 1U24A 2FC8A 4TQRA 3FDSA 2HLTA 3CCWA 4HTIA 1U2FA 2VPWB 4ZCMA 4LF7F 2VKRA 1CQNA 5DQIA 4XDCA 4C48A 1C4CA 1FJCA 1VYAA 2CJXB 4B08A 2YNHB 5KFLA 2FY8A 1S6QB 2G0JA 4ILMA 1HIYA 1EX8A 2HBQB 4JI8F 4J9NA 1C4AA 2MQMA 2M70A 3H2LA 2B8QA 2LDYA 3BSNA 2KI2A 1EKSA 3VAKA 1ACMB 3H40A 2H4WB 2MJNA 4KO0B 4TLRA 4X65J 2DGWA 4WKRA 2ACMA 3W7BA 4DR1F 4LSLB 2YWGA 4B3SJ 1HARA 5LMNF 4IR9A 4HLBA 5D3GB 1LW0B 4CLWA 2DT9A 3V81A 1TFYA 3GR1A 4LFCJ 1ZM2A 3KK1A 3MM9A 4OZJA 4DX6A 1TL1A 2WBRA 1FJ7A 3CSKA 5L8RC 4CO0A 3QSYB 4L3NA 2IM2A 5IT0A 1YJTA 2HHXA 2XMKA 4YDXA 3V6DA 1TR0A 4UOCA 3KLVA 1AZSA 3QMQA 5ETPA 4B9UA 3MCNA 4OI4A 3H8YA 1EAYC 4J9SA 1IKYB 2CQCA 2JOQA 3CNQP 4OJGA 4ECQA 1J2VA 2AEFA 5F8GA 1UVLA 4W4MA 1YSJA 4PYDA 2U1AA 3PIPQ 4ZVFA 1RWWB 2HG4A 2RHQB 3UN3A 3EDRB 4WFXA 2XC9A 3D1QA 4LF6F 4NMXA 4R0JA 5KOXA 4MIWA 4M5KA 1F6TA 2C2EA 2V2QA 2QA2A 2D1CA 5C24B 2UUAJ 2CWXA 2H5IB 4HHUA 2BJ7A 3AB4B 3BSCA 3HMJG 1S0VA 1SUQA 2I0XA 5EWGA 2G4BA 1OPZA 1FE0A 2AZ3A 1NHUA 1B64A 4TVAB 5AJ3F 1X0FA 3GFYA 3GIMA 2OMLA 2J9DA 2W9CA 1UPPA 3I5AA 4F3MA 1TMMA 4X4RA 1FESA 4CLYA 1NK4A 2B4VA 2CQ0A 3VZIA 1B70B 2V5HG 3WHIA 2IJFA 2ADBA 3EVWA 4QWAA 4C7QA 3BH6B 1GMWD 1Q95G 1QSYA 2LCWA 2XGPA 2UXBJ 2OPSB 1J5EJ 4ES3A 1ZA1B 3P49B 1YBUA 1UZHA 3CIZA 3QFHA 5L9XA 1AFJA 4DQRA 1UA0A 1VISA 2HNDA 1VQ6S 3FVYA 2X1FA 3BQ1A 1VQMS 4JI3F 5HSPA 3CW2C 2WVDA 3QYYA 2BJDA 4YMEA 1N34J 3IRXB 1SH0A 1ZM4A 2J76E 4KT0C 4ENOA 5KAKA 1EP4A 3MCOA 5KFMA 4H54A 2GFFA 3Q8QB 2H48B 3D28A 1WSVA 2K06A 1H6KX 1P1LA 2QSFA 5A8WB 1KBRA 2AF6A 3UDEA 1M5HA 3IRWP 4L75A 3QIDA 4IFYB 2ZDOA 4FZVA 2ZKUA 5F3TA 4DV7F 5K8PA 1F2HA 3RYLA 4QPTA 3HVTB 4XDDA 1VHIA 2L9NA 1OWXA 4JI1F 2BYCA 3MMBB 2V2VA 3IS9B 4WFZA 2KN4A 2HHPA 3M9NB 4W92B 2LEAA 4M1KA 4Y2KA 2WOMB 4ZN1A 1B0VA 2RU3A 1BWEA 4EYHB 5EN1A 3X3UA 1OPIA 3OTEA 2CDRB 1NKCA 4OX9J 3OUYA 4OLPA 1FVQA 4P2MA 5ETRA 3NAIA 4NRTA 1H0HB 3OJUA 2CPXA 3MPVA 5D15A 3I96A 4BCAA 3JQJA 1S1VB 2NSBA 4KSEB 2ROGA 3KDNA 1S49A 1UFLA 4YHHJ 3JYTB 4RBVA 3K5OA 2VQFF 1JNRB 5A2QY 3G82A 4RUAA 2CQHA 2MKIA 2OPQA 4Z37A 1WHWA 3ZZTA 4OZ5A 1UTAA 3BEGB 4HDGA 4D3GA 1V3SA 5HBMB 3R5BA 4NYPA 4DR2F 2WRMA 3PRBA 4CZCA 2YQ1A 1NBEB 2YWKA 1Q7YT 4ZKAA 5CD4A 3HHDA 4AQYF 4WYWA 2D3ZA 4DS5A 3B4MA 4IRCA 4ZPDA 4C8LA 2B6AB 1RBLA 3M6VA 3TNVA 1WOSA 2UV8A 2DCLA 1CJTA 2RU9A 2Z2MA 3GG0A 3PO5A 2W01A 2C2DA 4P72A 4Y65A 1WC3A 3ZZUA 1EETA 4I6AA 1A7GE 5KFPA 2QGFB 4IQXA 5G0RA 2R2RA 4OX6A 5HMZA 1N5YA 1JLCA 5GMDA 1ROFA 3UI3A 3ULHA 2Y1JA 2DRAA 2QL7B 2YWHA 3SQGA 1JIHA 1JXLA 3M32A 1VQ5S 2FDNA 1IBCB 3GSIA 4U67Q 3ELHA 1Q8BA 3TEHB 2IDEA 3AA9A 3IM8A 1M5SA 4JV1A 4ZCIA 1AUDA 2MLZA 1IN0A 2Z2ZA 4P7TA 4Y3CA 3CDUA 1U26A 2FPHX 1CLFA 4K2XA 3MMJA 1Q79A 2VG6A 1JKHB 1KKHA 2HHTA 2VPYB 2EC2A 2AQ4A 4K4WA 3B78A 4KTQA 5EGYA 3MEDA 1F9EB 2FLPA 2HNZB 2CKWA 3FCHA 1RT1B 1E6YB 2HMIA 4NX9A 3KLGB 1VBXA 1UAWA 4WWSA 4C97A 5KT2A 1IBMF 1PGZA 3M30B 4J5OA 1VC6A 3EZOA 3FCWA 2RKIB 2ZH5A 2RDIA 1IM6A 2EFPA 2RJZA 4WYLA 1N52B 5JVGQ 2LFVA 2HNYB 4OMFG 3J7Z5 2KZMA 2YNHA 5AXNA 1S6QA 1JLGB 1S1WB 4PRFA 4PAAA 1F5BA 3WZ0A 5E3QA 3T19A 2D9PA 2JH3A 3FBBA 1ITPA 3CCQS 3QIPB 3KG0A 4KO0A 1U0SA 3UWTA 3I6PA 1RAFB 4N8OA 1S57A 2ZC3A 4LSLA 5U47A 3K89A 2LQJA 3UD4P 2IAJB 1U2CA 2G2ZA 4JOUA 5D3GA 3C15B 1T11A 1LW0A 2MZSA 1GMVA 3K5MA 4BBYA 1IJEB 3C19A 1V6HA 3THPA 5HANA 1VLYA 3D54A 1HWJA 4L3KA 3R27A 2EW9A 4LRFA 3B4DA 2OI2A 2RD5C 1BC6A 2MQOA 3GG1A 2WSEC 4LVOP 4JI6J 4K0KJ 3M6XA 4A8QA 4ECZA 2QLXA 1S7IA 2AEJA 2QYGA 2MSSA 3L7UA 2ZHAA 3FZ2A 3GCXP 1BMQB 3NMRA 2FTRA 1IKYA 5DRKA 2OSRA 2MHEA 2KG0A 4QIWD 4MT1A 1T3NA 2OUGA 2L41A 3GYXB 2DNKA 2LU1A 3DLHA 1FF2A 3VQSA 4DSFA 4LT6A 1MWZA 3T5KA 3NGDA 1NSPA 3R9LA 2POKA 1XERA 1NDKA 4CLKA 3HZGA 5C24A 3UDLA 3R5GA 4NLWA 4DZ6A 1FK9B 2B43A 5EDWA 2AIRB 3B6BA 2R7XA 4E8UA 2D3OR 1HFEL 3IWNC 4KFBB 2IVMA 2D7SA 1UZDA 1CQMA 3SBMA 3LGNA 3DDIA 2RS2A 2WW4A 3OXGA 4F3QA 2M0GB 1U1MA 3N6NA 1YJNS 1WHYA 3UN2A 4GRSA 2V34A 3AOAA 4I67A 2CPHA 1KLMB 1FRHA 2CIMA 1KFSA 4M63A 5IQQA 3MUMP 3GPAA 3ZTQA 4X64J 4BS2A 4UZBA 3GJSB 4H4KA 3D66A 1VJQA 4Y0FA 3H42A 4LREA 3OHBA 4TY8B 3HJVA 5DQGA 2Z8QA 1CVJA 1NLKL 1RISA 4I68A 5CYQB 3PKMA 1WNEA 3G6VA 2H3EB 3MR2A 2OPSA 2X1BA 4QZVB 3J7YI 4WFAQ 3I56S 1Q5YA 4DMZA 5L38A 2IJRA 4MTPA 1HBOB 1DJ0A 4CCHA 3LUYA 1T9XA 5IFMA 3N6MA 5DS7A 3J80Y 2Y1IA 1B0PA 3D1HA 3IRXA 2BJEA 1NU4A 1WJ9A 2HS0A 3V2UC 2IBKA 5A8WA 4OI3A 5FLXU 4IFYA 4QWEA 2ZOGA 1PSDA 1Y5LB 4K7QA 3R7NB 4FKYA 3AD8C 3HVTA 1RYSA 4FVMA 2I9SA 2XMWA 3IM9A 2A6OA 4A47A 3MMBA 3IS9A 4DV2J 1J5OB 1UA1A 1N8RT 4DOZA 4JI5F 3TA0A 5FDLB 1IR2A 2XSJB 2WOMA 3PG9A 4JP8A 4QIGA 4X2BA 4ELVA 4IO9Q 5GMKa 1QVFR 4OHZA 4LJMA 3ISNC 2WONB 3ZFVA 5F3ZA 3MPDA 4DR5F 4DCPB 1CBKA 3PW5A 4KHPJ 1JLQB 2QIFA 5MAOA 1S1VA 2ZH8A 4FVCA 2P2CB 1SIWB 2ZM6F 3FMWA 3JYTA 4ERDA 1HBUB 1U02A 5KFAA 1KFDA 4JI7J 4IH6A 1X4BA 3VAIA 4WTYA 1JJ2R 4ZVSB 3OTOJ 1Y11A 4DV3F 5B7WA 3OTBA 2B5JB 2DNZA 1HNZF 1NCLA 2GVZB 3ZZOA 2VFSA 2V4RA 2HHSA 2EWHA 1A0OB 3G9CA 1K1QA 5HBMA 3NBPB 3CCRS 3EGNA 1T03B 3LP1B 3ILLA 2ZOMA 4CNYA 4G6VB 1SKSA 2KFNA 2RMLA 1RABB 2B6AA 4ETXA 2BR0A 1S99A 3HD2A 1BXNA 3A3OB 1QD1A 1U49A 4P52A 2XYHB 5KG6A 4DR3J 2FJAB 3NKYA 3CCLS 3RB6A 1BWVA 5C2CA 2BRKA 4B3TJ 1LXNA 1LOUA 2VODA 4CLPA 3L7PA 1VRQC 2CPFA 1U48A 4DV6F 2HS3A 1B7YB 4J9OA 3ENWA 3MD1A 2BW2A 1U6ZA 5DM6Q 3EVMA 3BN4A 4QCLA 4WF9Q 3JQMA 3IP0A 1Y00A 5HJXA 1HLWA 3QGIA 2Y0BB 1RHKB 1YTYA 1B4SA 2W7AA 4NA2A 4A48A 1R8PA 4DV4F 3HHLB 2OKQA 2YTCA 3AJDA 4DG1B 3N4WA 4RO0A 4N41A 1YVFA 1LQ9A 1YRUA 3TX0A 1HYSB 2AWZA 2DD8S 1CC8A 3EX7B 1F3FA 1TL3B 2UUWA 2MJUA 1L3VA 3KFWX 2KJVA 3L09A 2QN6B 3LPEA 2HNZA 1JQGA 4ZOSA 3SFGA 1RT1A 1E6YA 2HIYA 5HVFA 3KLGA 3VAHA 3T1YF 4PG8A 1IBKJ 2ZH4A 4DX7A 5CH7B 2CPEA 3M30A 4BHQA 2B4OA 4MK9A 4O23A 2RKIA 4CNZA 2XLJA 3OL8A 4A8YA 1NAQA 3SDEB 1QAXA 2V0NA 2RDDA 3HKZD 2XULA 2CAJA 2HNYA 3LQVA 1YZ6A 4MIAA 1N0UA 2W7PA 2ERRA 2NZ4A 3V6JA 4ZPBA 1JLGA 5LJ3Y 1S1WA 2MXYA 3UD5A 4LFBF 3LALA 4PXBA 4NLXA 3QIPA 4JI0F 4NLOA 2HHHJ 4P2XA 2IAJA 3VF0B 1X4GA 5ETMA 1RBOB 3C15A 3KDOA 1B99A 5CCLA 3X1LB 2VFRA 1FEEA 2JHEA 1T94A 4WTOB 1PIEA 1KN6A 2ZHBA 1D8ZA 2AJFE 3TP2A 3O1LA 1T9TA 2XCAA 3EWGA 4HI1A 4CO4A 1M90T 1R31A 1BY9A 4DL2A 3JAMU 3CT9A 2GA7A 4DV1F 1RWOB 3MAHA 2IM0A 4CP5A 2R8GA 4HYKA 1T95A 4P71A 1KLNA 5BYRA 3VTIA 1WC1A 2RE1A 1H7WA 3VAFA 5AE2A 2OPRB 4DBQA 2N82B 1IM4A 2OP5A 2M8DB 2PN6A 3PCOB 4DEZA 4LQ3A 2QA4S 3W5ZA 1KVIA 3FEZA 2UUCF 1RDRA 2HQCA 4LF7J 1FFSB 1ZYQA 2YKMB 4LR7A 1ZS6A 4BWJA 1EKRA 5B0GA 3IAM9 3W2VB 2CUYA 2IFXA 2XLIA 4DPWA 2BQ3A 1Y7PA 4LSZB 4JI8J 1FK9A 3HD1A 4NYZA 4IRDA 5M2UA 1PKUA 4KFBA 3ISND 5IXUA 4D3HA 3MCSA 2E5GA 1RWXB 2ZBRA 3F41A 4DN0A 1UVIA 2DGTA 3E51A 5LMNJ 1KLMA 2ZVIA 3GSDA 3DNCA 2PFFB 2AYEA 5DGBA 3HFVA 1ZZFA 5HROB 4HH0A 5LSLA 2Y9HA 3GU0A 1EARA 5IQ6A 4J9QA 5T7LB 2ZH6A 3BPDA 4TY8A 5KTQA 2G1HA 4DR4F 3M8WA 1QVGR 4DUYF 5CYQA 2VKZG 1YX2A 3KWMA 3AQOA 3H5XA 1WKKA 5HK4A 4FPIA 2JDJA 4FYXB 3QT7A 2HZAA 2EBGA 2GV1A 1HBOA 3JSMB 1BLUA 2KVIA 1XQIA 4DSLA 4KBIA 4J90A 3OD2A 1M1GA 1O6XA 2RAQA 4ZVEA 3HHEA 2VJUA 3K0JA 2ZE2B 4CYUB 2VONA 2XEXA 1U47A 2XZDB 4WXWA 3TJ8A 1UW9A 1VC5A 2BRLA 4LF6J 2BACA 3O6QA 1REVA 3PR5B 1D0EA 5DDOC 4QU7A 2NCKL 4LRAA 1J5OA 4A8KA 1N54B 4NXMF 5FDLA 3BGUA 1PILA 1WEXA 1YRTA 2XSJA 1FDAA 5AXKA 2AW0A 2C1EB 3MECB 3PTWA 2WONA 2DB1A 2Z58B 1JLEB 2JZ5A 1VLOA 2EKNA 3PIOQ 3TI0A 1Q86T 3HLUA 5KFRA 1TK0A 5AJ3J 5KFGA 1JLQA 3W9IA 2W2QP 2NR0A 3NMAA 9RUBA 3VV2B 5CA5A 3GR0A 5L39A 2QRRA 2P6TA 4U7UD 2ALZA 3DHXA 1U45A 1HBUA 1ZZNA 1VBZA 4YOEA 4F7VA 5A8RB 1ICEB 3NGUA 1HWIA 2B5JA 4OZ2A 3VHQA 3RBEA 2GVZA 4KKOB 2LU2A 2V68A 4O3QA 1S9EB 4LMZA 3IAS9 3LAMA 1SL0A 2R8KA 3EPIA 3LANA 2E1MC 3NBPA 1T03A 3LP1A 4ILLA 2EG2A 1Q8KA 2MKCA 4PXEA 4JI3J 1X4CA 3KG4A 4N5SA 4U8YA 3M8PB 2XYPB 3CJ5A 3S01A 1QSLA 2CPYA 3BYRA 3DXSX 4UQTA 4Q5VA 1G2EA 2OPPB 3L7OA 1N32F 2JL9A 5LL6d 2CG4A 5KFTA 4DV7J 1UEKA 4I6YA 3QNWB 3I87A 4B3RF 1NMEB 1DLOB 2X3GA 4JI1J 1RADB 2ZHOA 2ZJPQ 2CQDA 2BJ9A 4P74A 1AT1B 4KC5A 1N33F 3SV3A 1QTMA 3FC9A 3EDQB 1YJWS 4X4SA 1HQ2A 3KG1A 2NQPA 3H98A 4DUZF 3HHLA 2AJ4A 1RT5B 4DG1A 2F5GA 4ZP6A 3VCDA 4MKVA 2L9DA 1RTJB 2CG8A 2BJ3A 1HYSA 4RUCA 3O8WA 1TL3A 2AJ2A 2GW8A 2VQFJ 1RWMB 2BX6A 1UFWA 1DRZA 2ZBCA 4JYAF 1XWLA 3PJXA 4P9SA 4KHMA 4TNOA 3BO4A 4NI2B 4OV6A 3I32A 1H98A 1I94F 4ECRA 3TQ1A 4RL1A 4DR2J 3TYTA 2L3MA 1FX4A 1TZ0A 3CCTA 2ZUGA 3VAGA 3SDEA 4AQYJ 1DQAA 4ZITA 1SJFA 4OJ3A 1PYTA 2FJVA 1RAHB 1WG1A 4X66F 1NM2A 2KHDA 5K5MA 2X1AA 3VAJA 2IA6A 3A3PB 3TUJC 2W2NP 2WZ1A 4A4JA 3OXLA 2N3OA 2DNOA 2XNQA 4ZVOB 4CLSA 3H4BA 1NHKL 1YQHA 1KD1T 2GMHA 3HP6A 2ROEA 1UJ4A 1PJ6A 3LAKA 4I2PB 2QYCA 1Y3JA 2IDLA 2EKYA 1XTZA 4ZJLA 4USHA 5ETQA 4ELTA 3KKFA 3UVJB 2FD2A 1TUWA 1WOOA 4UQGA 4PG5A 2XY6A 2JEGA 5DM7Q 3OLBA 3TZZA 1X5PA 1OMSA 2B9XA 3V4IB 4V1Ak 2CVIA 2RRBA 2HRTA 2YX7A 3NS6A 1WC4A 3SSQA 4DSJA 5D0EA 2FJBB 2OPRA 4X4PA 4NA3A 3OW2R 1CJUB 1Q0NA 1NDPA 4AXIA 4ES1A 1C1CB 4ED1A 1F9FA 4WP3A 1QUVA 2FVCA 1GAOA 3IG1B 1IBMJ 1HWKA 1K0TA 4TU9A 1VJWA 1EJ7L 2DO0A 1F2GA 5K8OA 2UUTA 4O3NA 2YKMA 3DI6B 5KFHA 3DU5A 3W2VA 3CVKA 3ZZ0A 1WKLA 2M5YA 3RAQA 2MPUA 3TX8A 2M4MA 3MM5A 4LF4F 4FXVA 1RUSA 3IGNA 1XR6A 3TEGA 2J0QD 1PAEX 3T5JA 2E29A 1T05A 1JX4A 1RKIA 4EBEA 4F50A 4LBHA 4CM2A 5HROA 1YJ7A 4CLLA 1IQTA 3U7JA 5T7LA 1H73A 4E98A 2PT0A 2ZZMA 2VBYA 4ECYA 1R8HA 2EVZA 1NJIT 3EM1A 1FFWB 5HL7Q 5E33A 3EJMA 3AXMA 4TXSA 4FXWA 3PVXA 4FYYB 1NB7A 2ZWOA 2OLWA 1MWYA 3KNGA 2PEBA 3KLEB 2QMUB 1XMOF 2OD4A 1U2RA 3OTCA 1Z4UA 2JX2A 1PBUA 4WPAA 2HEKA 3K7RA 2U2FA 2C3PA 2ZE2A 4CYUA 4ZVPB 2BDPA 1PBAA 4ECUA 3CJSA 3K59A 3OJSA 3JB9k 1DQ9A 1S77D 1L3KA 2J7UA 2W9AA 3PO4A 3M4XA 4FF2A 4Y2CA 3TAPA 2F9JA 2XB2D 3D6TB 3RR8A 2Y1RI 5J1NA 1T9YA 3DHWC 4FP9A 1OIAA 2R2TA 2K2PA 4OHYA 3ZTPA 3DRRB 3PM9A 3MECA 1IUJA 1FXRA 1JLEA 2NUUG 4F25A 2CADA 5AE3A 2KXFA 2NXUA 1OYEA 2HVHA 2QLBB 5CZXA 4PPDA 1JJ4A 2HBRB 5B0AA 2OD6A 1KQKA 2I5JB 2DTJA 1ZTTA 2PGCA 4ELUA 2CPDA 5A8RA 4KKOA 4I6WA 1S9EA 5G4DA 4FBUA 5C42B 2V2KA 1VR6A 2V50A 2OTJS 4I2QB 4OLOA 3NNAA 1FFGB 1C1BB 3QT5A 3CD6S 3QGGA 2PA8D 4PKDB 1CS4B 4F67A 2EK1A 8RUCA 3ET6B 2VA3A 4F2RA 3GQCA 1KSPA 3M8PA 3Q0AA 1FI4A 3TZYA 1WI8A 2OPPA 3I31A 3BGOP 4RNHA 3HSDA 4RR5A 1Y0HA 4IG3B 2DGUA 3J7A1 2FJXA 3DKDA 4IFVB 1DLOA 3A4TA 3S1TA 1UCNA 2FZCB 3W2WB 3EGVA 3H5UA 2FGOA 1NHVA 7FD1A 4JI5J 1IWAA 1KOOA 3QGHA 4USJC 2UZAA 2E44A 2VF3A 1U1NA 3G8TA 3A13A 2DNYA 3HVWA 1S1XB 4N56A 4F36A 1GX5A 2BEFA 2GNKA 5I3UB 3CD7A 2V2ZA 3DOLB 3UNGC 2XO7A 2VDHA 1RT5A 1TU0B 4DR5J 1HHSA 2ADCA 4YR2A 2I38A 1RTJA 5KT4A 2HFNA 2J6UA 4TY9A 3Q8PB 2ZM6J 4M95A 2HHWA 2R7QA 1KHVA 5B0EA 5KFXA 4DV3J 5KFNA 3D67A 4ZIVA 1HNZJ 2J7KA 4QQBA 3MWBA 4DFJA 4NI2A 5KT7A 2ZDPA 2G2YA 4NWBA 2KT3A 2E9ZA 2B4PA 4RNMA 2Z56B 4YR3A 1SJRA 2GHVC 3PEJA 3HF5A 1LFPA 4OYBA 2DVIA 3T9ZA 1NZ8A 3WIUA 4UOFA 1M1KT 2KKHA 3LWLA 1S4EA 2DR6A 1HI8A 4ZP8A 5KG3A 2VG7B 4DV6J 5LOQA 1VC0A 1S79A 1RHMB 1R7IA 2P9CA 3O44A 4I2PA 2KH9A 2MGZB 2YPZA 3JXOA 3M8YA 2EG1A 2GJ2A 4O3SA 3Q83A 1NSKL 1VQ7S 5ITHA 5IS2A 1OSCA 1BQNB 5KG4A 3UVJA 1RQ0A 1NJYA 4DV4J 5RUBA 1CG2A 1DY3A 1S4FA 4AFFA 2VUGA 2V4JB 3V4IA 5F8NA 3MXHP 3MR5A 1RA7A 3SFUA 1KWMA 2DKOB 4YDDB 3QPIA 2ZNYA 1NUEA 1L3SA 3MEKA 5ETKA 1CJUA 2F9DA 2WVEA 1PAUB 2ZVSA 3DLLQ 2N3LA 3TUZC 1C1CA 2Q6BA 3QJPA 4XPEA 2XYGB 2AHOB 3OTDA 3IG1A 3T1YJ 2B9WA 1W7WA 2YWWA 4Q45A 1KS2A 1PJ5A 4K4XA 2Z0GA 3SIPB 2CQ2A 3DI6A 2C42A 1L3TA 5ETNA 2XBPA 1VQYA 2E9RX 2FB0A 4X4QA 4WCEQ 2F40A 5KT6A 3NXZA 2P5VA 2Z4PA 3W65A 1TELA 4X4TA 4ED0A 4K4SA 3POTB 3BBCA 2JLEA 2C2ZB 1N5TA 1X5TA 1X31C 1WUUA 2OAUA 2ASYA 4F8RA 4LBPA 4JI0J 1HNVB 5D77A 4DQPA 1Q5VA 3J7YU 2CNNB 2JNJA 3W61A 2XMVA 4KY3A 3I4HX 4DX8H 5E5NA 1JXEA 3QQCD 2JC0A 4OJHA 2RRAA 1H2UX 4HKQA 4N77A 3CJQA 3M9MB 4CH0S 2IHR1 5H9EJ 4X62F 2PIIA 9ATCB 1CEZA 3EUNA 4ED8A 2OTLS 1D8YA 4DV1J 2GHWA 1FT8A 2PDAA 2UU9J 2XS5A 2B8PA 3IR5B 3IWLA 4ZMMA 1P1TA 5THWA 3GTYX 3BPSP 5F41A 1HWLA 3KLEA 4ZLLA 5HI7A 1D9AA 2W4DA 2MKHA 2BOPA 4DPYA 4USKA 1RHRB 5I3PA 3MHYA 3D6HB 2UUCJ 5KG7A 2QL5B 3JAMY 2QTWA 3P96A 5M2RA 2HQ3A 4P6QA 2R7SA 3A3NB 1X60A 1M0SA 3JTOA 4CLFA 2XY7A 1GTHA 4J9PA 2JVOA 3EGWB 3E8OA 3RW7A 3DRRA 4MIBA 1Y9OA 1RWKB 3DLKB 4XK8C 3ENQA 4DPOA 1GMWA 2CQ1A 5BXIA 4Q8FA 3J7ZT 2R4FA 4ZVRB 3I5BA 1LEOA 4DXLA 4ID8A 1RCOB 3IXQA 4ID5B 4DV0F 3GIIA 1RHUB 2I5JA 1Q7LB 2HSEB 4B9MA 1I6JA 4CO3A 3OUYB 4DR4J 2KM8C 3DLEB 2CJQA 4DUYJ 1LW2B 4I64A 1OQ6A 4ANEA 1HPZB 4DL7A 5C42A 4LIRA 1GT8A 1LWCB 3CJKB 4BC7A 4I2QA 4BDPA 3TUIC 2GMLA 5E3AA 4KGKA 3PW7A 2ATLA 3H0PA 1O8BA 2B9YA 1TUVA 4H4OB 3JTNA 2YKOA 4ED3A 1SC6A 5D4OA 4MKAA 4ED6A 3TJ9A 1CS4A 4DV5J 2UVRA 1S0NA 3ET6A 4NCAA 2FHJA 3M2VB 2KFYA 2VBWA 2RILA 4UY85 4M5MA 2CQPA 4ATNA 2LXFA 1ZAVA 5HQMA 1YJUA 4C0BA 2VFUA 4JI4J 4RNNA 3OT9A 4RWWA 1R43A 2G0IA 4IG3A 3N5FA 4KQZA 4LF8F 1S76D 4ANCA 4KGMA 1GTEA 4IFVA 3KHGA 3W2WA 4NZ0A 2PMWA 5H1SV 3OLAA 4OYMA 1DAXA 3SYZA 2I6WA 3PFOA 2GQQA 2DH9A 4NXMJ 1QUPA 3BBFA 1HWUA 2ZWPA 1D09B 2IC3B 3QZ8A 1EETB 4CTAB 2QMWA 2GHPA 3LP0B 1R3NA 5F0WA 2RQ4A 2FHKA 1S1XA 3KK3A 5LJ5Y 4OZ0A 3TA2A 4X65F 2FLLA 2G13A 4Z7CA 1JLCB 4NZ6A 1TQLA 2JLGA 3UR3C 3MDFA 3GIRA 3RU0A 5D4LA 1SH3A 3Q8SB 1RT6B 1NB2A 4C8NA 3LWMA 1VQ8S 2MSTA 3RRHA 3QLHB 1QJHA 4QIVA 5KT3A 4MYTA 2ZOFA 4A46A 3OVAA 1PJ7A 4UF4A 2VICA 2HURA 4RWXA 4CO1A 4Z2XA 2YQ0A 2DJWA 3ETOA 1R0CB 4HL9A 2BKOA 4F04B 4GVBB 2L9WA 4JB8B 2R3VA 3PRDA 4KHRA 3G96A 3EYZA 5J2MB 2D41A 3QO9B 1FDNA 2X1GA 4HR2A 4LQ9A 3KHHA 3KHLA 3BKTA 4DX5A 3BDPA 3H90A 1N32J 4DPTA 3GFHA 3PHEA 1FNMA 1QSSA 2VG7A 1IR0A 3EMTA 5HMWA 5CABA 2XS7A 1BE4A 1O0PA 1VOMA 4AL6A 1XR5A 4EU0A 4AXJA 3R3TA 1N33J 3AH6A 2C22A 1X4DA 1YHQS 2YKNB 1WDTA 5LXRA 2YX1A 2V8GA 4ER8A 2MGZA 2XHWA 4IYQA 1M5PC 4DSIA 3PY8A 5SUHA 1K8AT 3IO1A 2CDQA 3F0NA 5ETTA 4IDKA 1BQNA 3CCMS 4DUZJ 1OY9A 2PFDA 4MMOA 4IQMA 3GMGA 3P3DA 1R6YA 2V4JA 2DY9A 2BBEA 2NPFA 1AB8A 3C8YA 5J1EB 4ED4A 1NPKA 2OELA 1LWEB 4JYAJ 5GAHU 1U6FA 2KT2A 5KG5A 4Q7AA 2Y1LB 4M5LA 1I94J 1X4AA 3DGPB 2CPIA 3MUTP 3C66A 3S6EA 4PWDB 3GZ7A 1HNWF 1FNOA 4OHXA 4GMKA 2XMMA 2IM1A 2HWHA 3OL9A 2IA0A 3NY0A 1YJRA 4CH7A 1JLFB 1F5CA 2VFTA 2DNHA 3POTA 1JWWA 4X66J 3NCQA 2AU0A 4DZDA 2CJYB 4Q2LA 1U1PA 3PW2A 3V6HA 1SJ3P 5DDQC 2YQ3A 3AXKA 1HQUB 5HVGA 2VOOA 1X4HA 1DFDA 3QRQA 1HNVA 4YR0A 2AX1A 4OYPA 1SL2A 4NLPA 5E41A 1GX6A 3V4MA 1VQSA 5A2QU 4Y6IA 3K2YA 1VK8A 3MEGB 1HNXF 2J8AA 2CZVC 1VRTB 5DLFA 3NLCA 8AT1B 5DG9A 1EIYB 1YRXA 2HVEA 3HZEA 2I1RA 2Q66A 1T7PA 3SSSA 4RNOA 5F8MA 3CCJS 3BN7A 2G9OA 4OYAA 4G1QB 1T9WA 3AB2B 2E1CA 3M6WA 5J1PA 4DPUA 4U9RA 2KXHA 1S59A 3MF5A 3KLIB 3K57A 4H4MB 1RYRA 5AXMA 1SPBP 5KFYA 2EFGA 2QEXS 4I4BA 5AT1B 2DRBA 2M52A 1MWQA 4OI2A 4FDFA 2YKQA 5DJBA 2XO6A 4YP3A 3J81j 2K3KA 3HJFA 2R7UA 4C2MA 4WFBQ 2W8KA 4NASA 3T41A 1UEVA 5KFKA 1XR7A 1LKZA 2WTFA 2C3OA 3AD7C 1SL1A 5K9FA 2UVVA 1TP7A 3CDWA 3DLKA 4LF4J 3FRYA 5H9FJ 5KFUA 2PMHA 2AGQA 4F0HA 1YWXA 3KUHA 3R1LA 5L1IA 2C3MA 5AXLA 1LFWA 2H54B 4ANDA 4KPCA 1M5VC 4RLEA 4ID5A 4P75A 2HRYA 1B3TA 2YWFA 5L1JA 1JK9B 2QV6A 3DLEA 1LW2A 2PC6A 2LQ5A 1HR0F 1U6BA 2CFXA 1HPZA 2KYZA 2Q43A 3E01B 2VG5B 3BJYA 5A0YB 2KFZA 1LWCA 3CJKA 3G6ES 3G8QA 2ZZNA 3HVAA 3VR1A 3AHPA 3A8KA 4H4OA 1RGVA 2AKWB 1WOPA 4TU7A 3VGSA 4L72B 3ETMA 2GAHC 1YG0A 1MSWD 2UUBJ 1XMOJ 1SIZA 4JV5F 3M2VA 2VBXA 2R7VA 3MM7B 2AEMA 3OVSA 3ILIA 1WTFA 4ED2A 2MZ1A 4U95A 2V8HA 2FVPA 1S9FA 4F4KA 1MMDA 4U7CA 4U6PA 2KB2A 1U1RA 5LT5A 5EX3A 3CC4S 2CJKA 2X51A 2H5JB 3SMZA 4Y34A 5GADU 4J9RA 2DHHA 4RBUA 4B9SA 1R0AB 1X9WA 1DTTB 4ZP9A 1NSQA 3RRGA 3W60A 2IC3A 1D9FA 1H2TZ 4CTAA 5CQGA 2ABYA 3LP0A 1WTBA 1OO0B 2VOPA 5F8JA 3P45B 2XGQA 4CH1A 3BKUA 3MEEB 1IR1A 5JMNA 2HVDA 1FRIA 4AYBD 1RT6A 2IY5B 2KTQA 1AROP 4K4UA 2ZITA 2F7VA 4HT5A 1UVNA 3QLHA 1VCTA 3FQKA 4C8MA 3OPKA 3IR7B 3ICLA 2JWNA 3BF4A 2FVRA 2B9EA 2XCPA 4E0DA 1JXVA 3U1LA 2ATCB 3GV5B 1O5JA 1HD0A 2YNIB 3I4PA 2CXEA 2NS1B 1SQFA 3KMQA 4GVBA 3K58A 4C3LA 4USMA 5J2MA 2IJNA 1PO6A 5E7OB 1B0TA 3QO9A 2AYBA 3E2EA 1RT3B 2KG1A 4C3KA 3CCVS 2FQQB 2OMOA 4EO6A 2VQEF 1YGYA 4YB6A 3MZIA 2IRYA 4P2SA 2QZ8A 4UT4A 1VQOS 2QA1A 1Y10A 5KFJA 4PCQA 5KFCA 2E5IA 3D0GE 2BE7D 3HFZB 4NEYA 5C5JA 2WVCA 4ZCLA 2ZZTA 1DTQB 2RUSA 4ICLB 4KIAA 2YKNA 1HL6A 4LRCA 3J81Y 2W24A 3DRSB 2OJ3A 1FDBA 3T9NA 3C46A 4KRWA 4LF2A 3CCUS 4NMLA 3MPUB 4L74A 5DO2A 2VZ9A 2LXUA 3M8RA 2KO1A 2C2OB 5GAEU 1WDDA 1TKXB 2V8DA 2HFUA 4EI2A 2KRRA 1VQPS 3Q8UA 5J1EA 2VC1A 1F3VA 2BJ8A 1LWEA 2DNMA 3U27A 3DXBA 4QR1A 1NKEA 4ZVQB 2OHDA 1TL5A 3NNHA 1P8GA 5LSRA 2QE5A 1IBLF 4NLDA 4WE1B 4ECTA 3WBZA 3DGPA 4PWDA 4UTGA 3AOBA 2GIQA 1NK8A 1RWNB 1NJZA 1RHQB 1XBWA 4F4AA 1JLFA 1SXLA 4XAKA 3UPFA 2DXEA 2O3DA 1TKDA 2NXEA 2W8LA 2BZ2A 4YB5A 1S12A 2MZTA 3TUPA 4L6V3 3PYEA 4K5SA 1KNZA 4RX6A 2RVJA 3MR7A 3BSAA 3WIVA 2OEMA 4PXCA 4EZ9A 3OBIA 3C14B 2W7OA 1HQUA 3GYGA 5D0RA 3G71S 5IV3A 4ECXA 1ULRA 3CCES 4USWA 2R7TA 2B7BB 2HQGA 3GYNA 3MPYA 4PR6A 2MQ8A 4JV2A 3HX9A 1RAOA 3H20A 2GS8A 5CCMA 4PXDA 4X4UA 3MEGA 1RAEB 4P73A 1R8CA 1VRTA 3FEYB 2HFVA 2GIRA 2QLFB 2PO4A 2UXCF 2IM3A 3TRGA 3AA8A 2XMJA 1UVMA 1PC4A 2W2MP 3UD3P 2GQCA 6FD1A 1X9SA 3VALA 2OH2A 2WVFA 4HEA9 2CVEA 2JLFA 4G1QA 2WK4A 4NLSA 3DMJB 4YEAA 4LFAF 1WG4A 4M5NA 2CZ9A 3ZO7A 5CAAA 5F8HA 3HHKA 3ITHB 4URGA 3CJ4A 4ZPWR 1F1BB 1N36F 1P27B 4Y00A 1IKXA 3KLIA 4EUVA 2WSFC 1S6UA 1JLBB 1EQMA 4H4MA 1NO8A 1VGYA 3D7SB 2IYIA 2E7VA 3R8YA 3N01A 3FQLA 4HI2A 4J7CA 2GZOA 5H9EK 3DLGB 5HJYA 3CJTA 3FBFA 3T5LA 4ED7A 4K4ZA 1MMLA 2F8EX 2IMOA 3NCPA 2HFZA 2R7RA 3GB0A 1VRUB 4O4RA 3HO1A 1H38A 1RA6A 4R25A 3FKBA 3KHRA 3VGTA 4DR6F 4B3TF 4PUOB 4F2SA 3RBXA 2CPZA 4IO1A 4ALZA 2C2NA 2DGOA 2M88A 2CRLA 2C2KB 5KFZA 4I56A 4DPXA 1PYSB 2O1PA 1REVB 5BR8J 4GKKF 5GAGU 2KHCA 4CO2A 1KEKA 3DLJA 3GP9A 2PMZD 1QTNB 3CJRA 2LA4A 3GILA 3WDOA 1BHNA 3D6MB 1FWLA 4YN3B 4NYOA 3NOCA 4X62J 1EHWA 5C7PA 1FKPB 2J0XA 5ETOA 1RSCA 2RHSB 3E01A 2VG5A 2JEIA 5A0YA 4XIUA 1X5SA 1AW0A 2OSQA 2A18A 1Q82T 3I9ZA 2YH1A 4NPOA 2EBEA 2P9EA 1S72S 3UCUP 4WIQA 3IWXA 4NLYA 2D69A 1UEUA 2EXUA 4KH0B 3SCLE 3MM7A 1T3OA 4CWBA 3MMCB 3TJAA 2FLOA 1H2VZ 4BWMA 2SXLA 3CD0A 4ZA1A 1V3RA 3CMES 2YXLA 3THVA 1L5UA 2P9GA 4FYWB 4OZNA 3M2UB 4XTTA 1KP6A 2OFHX 2MQLA 4EBDA 4PG7A 4ECSA 1R0AA 1DTTA 3MAAB 4N7TA 5DGAA 1XMBA 4YFUA 2R8HA 1R8AA 3FCVA 3TWZA 4ZDNA 3O5TB 2HIQA 4NRUA 2R9LA 1NJWA 4JI2F 1BGXT 1LK5A 3MEEA 1G3OA 1N56A 2OO4A 2RDJA 3W62A 1CULB 2K1RA 4DV0J 4NCBA 2DGVA 4PPZA 1LNQA 3PX0A 2MHNA 4R8UB 5HQLA 3DN9A 1DHMA 1URRA 2Z30B 3CUNA 4OHWA 3Q8YA 1CJVB 1S1UB 4MYUA 2FY1A 3CULA 3U02A 2NUHA 1RI7A 5JJBA 1X4FA 2YNIA 4DFMA 2GMJA 4RUBA 2J0WA 4OHVA 3DU6A 2MMYA 1UFKA 1X5OA 3WC0A 4X84A 3RG6A 4CQ1A 2QMXA 3M05A 2IRXA 2EC0A 4Q8EA 1V3ZA 1RT3A 3SCJE 2NYHA 5KFWA 4URQU 3PR4A 4PABA 2RRNA 2OFGX 3OR2B 2VC0A 1X9MA 4TN2A 4U96A 3RB4A 3H7HB 4LF8J 4MK7A 4PZVA 3V6KA 3DRPB 5HAOA 1DTQA 3KLHB 1IKVB 1VQLS 4ICLA 1TV6B 5HMYA 2G0CA 1FNXH 2DRDA 2ZBQA 2QLWA 4QYZK 3PACA 2HPUA 3DRSA 1LV5A 3TARA 1L3UA 3KJVB 1WF1A 3HK2A 2DEIA 1WHXA 2DGSA 4DL3A 4LF1A 5C2GA 4C4WA 1TKXA 4A8SA 3BGLA 1N0VC 4LIWA 4FF4A 4B17A 4Z7YA 3K5NA 2Z57B 2O66A 3E3XA 3DC2A 5D4PA 2CPJA 2MB0B 2XI2A 3W8GA 1YI2S 2HYIB 3PYGA 4WE1A 2F8MA 4TKTA 1WKJA 2COLA 1G1XA 3L95X 2QX0A 3CO9A 3F73A 1SJQA 1HBNB 5EHHA 2JFDA 4IKAA 2VU5A 1GK8A 2RIJA 7FDRA 2XZWA 3EXCX 4G65A 5IT9Y 3N6LA 3HCXA 5HVHA 3RRKA 1BUXA 5EX0A 4UOHA 3BGRB 1ZETA 4HACB 1T9VA 1IKWB 2IYGA 2F63A 3AODA 3ZXWA 3HSZA 3C14A 1TMJA 1FO1A 3MGJA 3MTJA 1VQKS 4C8KA 1N5VA 1N48A 2HHUA 5K8NA 2VHGA 1EQ0A 2HW3A 2DHXA 1RU2A 2RT3A 2VBZA 3EE3A 4UUXA 1FX2A 3MM5B 5HATA 1AUSL 1KHWA 4WZMA 3NGTA 2NXJA 2CNOB 4B9TA 4FS2A 2VASA 5IZHA 1HNIA 1RAJA 4DR1J 2H1YA 3M8SA 2M8HA 4J9MA 1T05B 1S6PB 1MMNA 2NXNA 2KDOA 3EGZA 3KMSA 4WFNQ 4MK8A 1TAUA 4PEOA 2H9ZA 3H59A 3DMJA 2HGMA 2Z2YB 1AYEA 4ZPVR 5E3RA 3NL0A 3R5AA 1FA0A 3QT6A 3ITHA 3G6YA 3IBCB 2PSZA 2Y0SD 2J9CA 4YB1P 2BMBA 2CNKB 3AJ2A 3UCZP 5J2NB 4B9VA 1JLBA 3KUGA 1KTQA 3AJ1A 1SV5B 4MH8A 3DOKB 5DG7A 1HNWJ 2AV5A 4JV0A 4ZLNA 1M5KC 2XG8A 2AD9A 2KVQE 5KFEA 3DLGA 1GMUA 1UKUA 3D3BJ 1OQ3A 3CIMA 1KR4A 3GWCA 1T9UA 1JMTA 1RP5A 3KK2B 1VRUA 3BSOA 3MM6B 4PUOA 4NLRA 5KFDA 2C2RA 3VWSA 3OSNA 3MR3A 2A1BA 2FHJD 4NOHA 3AAWB 2E5LF 4NXNF 3Q8VA 4YY3F 4OFZA 4CLZA 3K5LA 2EK6A 3QSIA 1I51B 5LSOA 1EB0A 2J8SA 3W9HA 1WELA 4ETZA 4ZHRB 1HNXJ 1HBMB 1RAAB 3NWRA 3RBZA 1VQ9S 4OZ1A 4C11B 5KFSA 1FKPA 2HFOA 5CYMB 5HQ8A 1V5IB 2HZCA 3PV8A 4ZJQA 2EFQA 2KYXA 4YS2A 5KFFA 3KNAA 3NG8A 5K8MA 5H9FK 4YQWA 3NP5A 1X4EA 2F1FA 2DEJA 3UCGA 1F60B 4FNHA 1U0HB 3MMCA 2MKYA 4DWIA 1RTHB 4WP9A 4QU6A 1XIQA 2FYXA 2RSQA 1UJ5A 2CQBA 4RW9B 2AT1B 3M2UA 1TKTB 3B54A 3R6GB 4RUHA 5KT5A 4EO8A 4Q0BB 1VHFA 4F4XA 2O01C 3BO2A 2YBVA 4B9NA 2XQCA 3MAAA 4NA1A 2QFIA 3G86A 3N5BA 1RLCL 1QY7A 4NLQA 3M7VA 3T6BA 2D3O1 4NLUA 1QAIA 4CM0A 2C28A 5KG0A 5ADZA 2GC8A 2EFOA 2C3UA 3UN5A 4IR1A 4LRDA 3ADAC 2LKZA 2Y3YA 3DDNA 1CULA 2C3YA 3M8QB 4OI6A 4A8WA 2DPJA 1W26A 2FGCA 2FZKB 1RT7B 3H5SA 3LPYA 4R8UA 2LLZA 3IBWA 1VIXA 1N5SA 2Q6CA 4WKYA 1CJVA 1HR0J 3D2WA 2V9KA 1S1UA 2DHGA 2BKNA 3N0VA 1O51A 1MROB 4C98A 3Q86A 4DR7F 3GLJA 1OY6A 4WZQA 3NCRA 3OFHA 6FDRA 4KV8B 3LW5C 4M5HA 2IPOB 4M5JA 4JV5J 2A2CA 4V19J 5KFOA 4ZPAA 3NGKA 4KR0B 1SJ4P 3CGIA 4OJ1A 4GO7X 4M5GA 3QRPA 4KGVB 3HT3A 4ES2A 4DDFA 1YIJS 3M2RB 2V63A 3FGVA 3CXCR 3OR2A 3S7RA 2W1BA 3PJWA 3NOGA 4CDIA 4K50A 1JLAB 5LMUF 1R0BG 3H4DA 1F5AA 5E2QA 3DRPA 2ZKTA 2PI4A 3W1YC 3NS7B 5EWEA 3KLHA 1JJCB 1IKVA 4DLGA 1TV6A 1LXJA 4URSA 3JSBA 2JFKA 1FXDA 3LH2S 2IBOA 3KJVA 4ITSA 3WX8A 3GE9A 2LYVA 4RU9A 4YUDA 4F02A 1FRLA 2BA9A 2R7WA 4K5RA 4IOAQ 1FEHA 3VVUA 1SKWA 1N88A 3PYFA 2QL9B 4LSNB 1RE1B 4O4GB 2XMAA 3GV7B 5IV4A 2Q79A 1WD6A 1MU2B 2HK2A 4O3PA 1S10A 3WQPA 2ZH7A 2O5DA 5FD1A 3W5XA 3C2PA 3BKFA 2BV3A 3S8SA 3UO0A 1WG5A 1RCXB 3A8JA 1U4BA 4WXOA 3FRZA 5GVQA 1HBNA 1U1QA 2VFVA 4LVNP 3BM7A 2J5AA 2DH7A 2YWEA 3H5YA 3I9V9 4IH7A 3OHAA 1SI9A 2BANB 1D1UA 2UVUA 3PRVA 1FJGF 5K14B 4DLEA 1HMVB 4RZRA 1RHJB 3BGRA 1XEZA 3BBBA 4LRBA 5DG8A 1MG7A 2XMUA 4HACA 1IKWA 3CMAS 3CJ8A 2RQMA 3T3FA 2W4CA 2VQEJ 1YK9A 3LP2B 3L3CA 3QFWA 2HGLA 2DISA 1GH8A 3MUVP 1UETA 5T41A 2M7SA 4KGZB 5A6WA 2CNLB 2FUG9 1T02A 1SKUB 3T1AA 1Z2ZA 4RW4B 3PKYA 4M5IA 4DI6A 4L76A 3D1OA 3HHNB 4UY8T 3K5PA 2PI5A 3ZZRA 3C6UB 4B9LA 3RW6A 1C0UB 3QGPA 3OFEA 1NNDA 4FYVB 4NLTA 3Q23A 1Q78A 1W2IA 4J37A 2CYYA 4OX8A 2V8PA 1MNEA 3JSYA 1S6PA 3LGMA 1FD8A 3ISZA 4JUZA 2DY1A 4RW7B 3D9BA 2LDIA 1F9HA 2GJFA 2KL8A 1UJ6A 2EI5A 1NEEA 1GFWB 1XN9A 1IBLJ 1B7FA 2KU7A 5LXYA 5J2NA 2MZRA 5J2QB 1SV5A 2HRUA 3DOKA 2DPIA 4I69A 1NK7A 2J0SD 3TO8A 4DN9A 4OX7A 5CD4H 3MMAB 5EUHA 4LF9F 3QAUA 4C8YA 4IRKA 1XMQF 3KK2A 2W9BB 5HP1B 1XNRF 4QW9A 3ZZYA 2ZD1B 4A8MP 1HHQA 1FVSA 3MM6A 4W98A 5L9NA 1FHTA 2KM8B 4H4KC 5B0BA 5EWFA 4WU2A 1TKZB 3I82A 2ZNZA 3NNCA 2DCUB 3U1NA 4WBFA 3Q2TC 1PYOB 4GO5X 1NK9A 1ZPVA 2HWTA 1H72C 5ETLA 4B3OB 2NLWA 3FEXB 4ZHRA 4B02A 2N7YA 4PQUB 1WHVA 1HBMA 1FKOB 2FZGB 3BR9A 4PWWA 1LWFB 2QT7A 2XMTA 4R0EA 2VJVA 1T8EA 4E2FB 2UXCJ 1GXLA 1UMJA 4C11A 4NLGA 1VBYA 1MN9A 3OQ2A 1I1GA 1GQEA 3T1HF 5CYMA 1S48A 2J7WA 8ATCB 4ZJOA 2XLKA 2Y8WA 2XZTB 2AGPA 3IBFB 4LFAJ 3BDEA 4ZS6A 3QZ7A 3HXMA 2EFVA 4WU3A 5B0CA 1Q8LA 3CCZA 3HFKA 3UR0A 3BH7B 1U0HA 1N36J 1UWAA 4QWBA 2JEFA 3ZC4A 1RTHA 3HDSA 4AT1B 1VFJA 2GGPB 2BVZA 3KJQB 4RW9A 3DCAA 3W5YA 3JSRA 1CJKB 1TKTA 1UP1A 3M8ZA 1CPZA 4KPYA 2ACYA 2GIFA 3O2IA 4Q0BA 5I3QA 3FSYA 1RB0A 5DZ7A 4C6AA 1SC4B 2AGOA 4QWCA 3I0RB 2EFNA 2RF2B 4DR6J 1M1HA 3ILJA 3EPGA 4TLQA 1K1SA 3W8PA 3R5JB 4DL0C 1WORA 4OYWA 2HVZA 2WHOA 3QT8A 3ENAA 5JUMA 4GKKJ 5JXSA 1K47A 3TAMB 3M8QA 4OV1A 3OL7A 2WSCC 3CC2S 4Q43A 4BLGA 3NS5A 2ZH2A 1RT7A 1URNA 1FJEB 3QWUA 3KK3B 4RKUC 2F3JA 2HFSA 1OS5A 4FN5A 5FLXY 4EFAC 1WC5A 3FBCA 2CQIA 3WX4A 2DNGA 2W4PA 3ZNJ1 3BQ2A 1MROA 1JKHA 3TR5A 3DOMB 5BYSA 3R5CA 5HLFB 4CLUA 4CLTA 4B3MF 2WB4A 1K0VA 4KV8A 2LQ8A 1RT4B 1S1TB 1WEZA 4JBCA 5F8LA 5E3CA 3A1YG 4RNFA 2KXNB 3NWGA 3AOCA 1Q53A 3RAXA 2R42A 1AXQA 2JSXA 3M2RA 1W25A 3D5MA 1QDUB 2HKEA 2QO3A 4C3MA 1JLAA 1RAGB 2BM1A 2BXJA 4KGXB 2ILZA 2A10A 3CDBA 3TVKA 3TZWA 3K17A 4K4VA 2DXFA 4QOTA 4K2JA 3JS9A 2MQPA 1Q1KA 3HT0A 1K73T 2BE2B 1MN7A 1UW4A 3R7SB 2V67A 3JTPA 1UVJA 5E3PA 4C0OC 4Q44A 4WK1A 4TQSA 1XNQF 4QIEA 1ZH5A 4JI2J 1YJVA 4LSNA 1P9YA 4O4GA 5B09A 2UP1A 2VDIA 1NZAA 1W2BR 5DETA 3Q89A 1MU2A 3V5RA 2R2SA 3FSXA 2GVDB 4IDKB 2ZH9A 2CJAA 5SZTA 5FJ4A 3D0HE 3L9ZA 2XHCA 2V4QA 5LM7E 2UU9F 4AD6A 1ZA2B 4C8ZA 5F0UA 3US5A 2LEBA 2YVSA 5I4MA 4QPXA 3I0SB 3UNYA 1RZMA 2BANA 4DUTA 3C3LA 5IWAF 3BZQA 5K14A 2KT5A 5BYQA 1E6VB 1HMVA 2L08A 2HAIA 3QBCA 4Y28C 4WP8A 4P10A 1X8DA 2K7JA 2YX4A 3B8HA 3ENVA 2BE9B 3T5HA 1WWHA 2Y8YA 2IVFB 1RAIB 2BUNA 4QBUA 2NXCA 2DR7A 3LP2A 1SB6A 4LF5F 2NSCA 4U7UK 2GCFA 4RW8B 4RW4A 1S7HA 4DSEA 4OYXA 2BKPA 3D68A 1WEYA 2I2YA 3C6UA 2YNFB 2I8EA 1IQZA 2ZBIA 3DM2B 3HSGA 5GAHI 2H65B 4EEYA 4QWDA 1C0UA 2UXDF 4LFBJ 2NZCA 2YH0A 4K4YA 2JEJA 4USUA 3GFZA 3R2DJ 2OEKA 2QC3A 2V8VA 1MLAA 2F4VF 1H3DA 4X4OA 1G4CA 2MDAA 1FXLA 2ZUAA 1V9OA 2HVIA 3IA0A 4C0HA 2O67A 2XM3A 2APOA 1UL3A 3IR6B 3OR1B 3ZTSA 1Q81T 1SJ1A 1NK5A 2DITA 4I1TA 4GKJF 2DHAA 4RW7A 4OZ3A 1VQ4S 4PG4A 2QA4G 5KFBA 2YNGB 1A6LA 2LMIA 2XWYA 7AT1B 1QE1B 4V19X 3NGSA 1NPRA 5J2QA 2FJEB 3KTQA 3BV8A 3PNIA 2OGUA 2KJWA 3GIJA 1KVKA 4CI0B 3MURP 3QJJA 3HVRA 4DV5F 4G3IA 2XWXA 3PX6A 3MMAA 4DCJB 4ZVTB 4FKXA 3BB5A 1HI1A 3D6FB 3HULA 2W9BA 2OEJA 5HP1A 3TZXA 4JI4F 2ASDA 2ZD1A 2E5JA 3R97A 1WACA 4UW2A 4KB7A 3LGHA 4USTA 3PX4A 1TKZA 3I55S 3DYAB 4KH1B 2R7OA 3OXFA 4N8NA 4FBTA 4WK3A 2WBMA 3QATA 4B3OA 1APSA 1P9QC 3VVTA 3AT1B 4PQUA 5IC6B 1FKOA 1LWFA
chains in the Genus database with same CATH topology
5GAGU 3IS9B 3MECA 4WFZA 2DNLA 2KN4A 1IUJA 2HHPA 1FXRA 2KHCA 2QSWA 1JLEA 4CO2A 1ZTWA 5HN0A 1KEKA 3DLJA 3M9NB 4W92B 2LEAA 4M1KA 4Y2KA 2PMZD 4GC7A 2WOMB 1B0VA 2RU3A 1BWEA 4EYHB 2AYGA 5EN1A 2LA4A 2NUUG 3GILA 3X3UA 1OPIA 4F25A 3Q22A 2LA6A 3WDOA 3OTEA 1KOHA 3N9UC 5AE3A 4F3OA 2KXFA 4DFPA 2NXUA 1NKCA 3OUYA 2HVHA 4NYOA 2AJ1A 5CZXA 4PPDA 4OLPA 1JJ4A 1FVQA 5IM0B 5B0AA 5D6GA 2OD6A 1FKPB 2J0XA 1KQKA 3NAIA 2I5JB 4NRTA 3OFGA 2V9WA 2DTJA 1FRXA 1ZTTA 2GQ2A 2PGCA 4ELUA 1H0HB 2VG5A 3CEDA 3E01A 3OJUA 1KRPA 2JEIA 5A0YA 4XIUA 1X5SA 2CPXA 3ZZZA 3MPVA 1AW0A 4QR0A 2OSQA 3I96A 4BCAA 2A18A 1Q82T 2CPDA 1TAQA 1S1VB 2NSBA 5A8RA 4R5PB 3I9ZA 1JJHA 4KSEB 2YH1A 3KYLA 4NPOA 1KTVA 2ROGA 4KKOA 1S49A 1UFLA 2EBEA 2P9EA 1S72S 3JYTB 4I6WA 1S9EA 3UCUP 4RBVA 3K5OA 5G4DA 2VQFF 5C42B 4FBUA 3IWXA 4NLYA 2V2KA 1JNRB 2KRBA 2LVWA 5A2QY 1UEUA 2OTJS 4RUAA 4I2QB 2HHQA 4OLOA 3NNAA 2GGPA 2CQHA 2MKIA 1C1BB 2OPQA 3SCLE 4Z37A 1WHWA 4Y2MA 3ZZTA 3MM7A 4O3OA 4OZ5A 3CD6S 1T3OA 3MMCB 3QGGA 2PA8D 4PKDB 1KC8T 2FLOA 1H2VZ 3BEGB 4F67A 4BWMA 4HDGA 2SXLA 2EK1A 4D3GA 3CD0A 1V3SA 5HBMB 1JNZB 1ZM9A 1BQXA 3R5BA 1V3RA 4ZA1A 3CMES 2VA3A 4F2RA 3GQCA 4NYPA 1KSPA 4DR2F 2WRMA 3DFEA 3M8PA 1KQFB 3THVA 1L5UA 3PRBA 3Q0AA 2IVYA 2P9GA 4CZCA 1ELOA 2YWKA 4OZNA 1Q7YT 1WI8A 4ZKAA 2ZH1A 3VAMA 2MY7A 3I0RA 3HHDA 4WYWA 3M2UB 1N5QA 2D3ZA 4AQYF 4DS5A 2OPPA 3B4MA 3I31A 4HVZA 4RNHA 4IRCA 4ZPDA 4C8LA 2RF2A 2GJIA 2B6AB 4YB7A 3M6VA 3TNVA 3MAQA 2OFHX 2UV8A 2MQLA 2DCLA 1Y0HA 4IG3B 3UDCA 2RU9A 2Z2MA 4EBDA 4PG7A 4M94A 3GG0A 3PO5A 2DGUA 3CF5Q 3J7A1 4ECSA 1YJ9S 1R0AA 2C2DA 1DTTA 3LO3A 4Y65A 2FJXA 3ZZUA 1EETA 3GV8B 4IFVB 1DLOA 3S1TA 5DGAA 1XMBA 1SQEA 4I6AA 3W2WB 4YFUA 1A7GE 3H5UA 2R8HA 1R8AA 2FGOA 5KFPA 5D8HB 4IQXA 1NHVA 5G0RA 2R2RA 3FZBA 3GFXA 7FD1A 4OX6A 5HMZA 1NK0A 1KOOA 3QGHA 4USJC 3TAMA 2MKSA 2UZAA 4ZDNA 3O5TB 2HIQA 5D4NA 1N5YA 1JLCA 3KLFB 1ROFA 4NRUA 3UI3A 3ULHA 3RBDA 2E44A 4Y2IA 1U1NA 2Y1JA 2R9LA 2DRAA 2YWHA 1NJWA 3SQGA 4JI2F 1BGXT 1LK5A 1JIHA 3BR8A 3G8TA 3MEEA 1JXLA 1G3OA 3M32A 2A2DA 1N56A 1VQ5S 2N7CA 2OO4A 2DNYA 2FDNA 1S1XB 3HVWA 4N56A 2RDJA 1GX5A 3R1HA 2GNKA 5I3UB 1WF2A 3CD7A 3MM8B 3UNGC 3DOLB 4QW8A 4F4ZA 2XO7A 2K1RA 4NCBA 2DGVA 4PPZA 1RT5A 4U67Q 4B3SF 2L48A 1Q8BA 1HHSA 2ADCA 4FF1A 2VPZB 3PX0A 2MHNA 1MW7A 4R8UB 4YR2A 2I38A 3DN9A 4I0WA 1RTJA 5KT4A 1DHMA 2HFNA 3AA9A 5KFIA 1URRA 2J6UA 5E0OA 3CUNA 1M5SA 4OHWA 4TY9A 4JV1A 3UW1A 3DOMA 3Q8PB 4QYRA 1Y5NB 3MTKA 2W25A 4ZCIA 5GADI 1AUDA 4LFCF 5HLFA 1RTIB 1S1UB 1IN0A 4M95A 4P7TA 4MYUA 2FY1A 2HHWA 4Y3CA 3CDUA 1NRKA 1U26A 2FPHX 3CULA 1CLFA 3U02A 2R7QA 2NUHA 2DNPA 1KHVA 1RI7A 5B0EA 2HLUA 5KFXA 5JJBA 1RT4A 4K2XA 3IGVA 2JJ4D 3MMJA 1X4FA 3O3LA 3CWJA 1S1TA 1LK7A 1Q79A 5KFNA 2VG6A 1JKHB 2YNIA 4DFMA 2HHTA 2RQKA 2J7KA 1RTDB 2GMJA 4QQBA 4FYDA 2J0WA 4OHVA 2YY3A 3DU6A 2MMYA 2VPYB 3MWBA 4DFJA 1X5OA 2AQ4A 3WC0A 4X84A 4K4WA 1N6QB 3B78A 4KTQA 5KT7A 4FF3A 4CQ1A 5EGYA 4HTJA 2V94A 3MEDA 2ZDPA 4RU2A 2QMXA 3M05A 2DNNA 2HQIA 4NWBA 2IRXA 2MYFA 4QYZJ 3TAQA 2EC0A 2KT3A 3M1VB 3VQTA 2FLPA 2HNZB 4Q8EA 1V3ZA 2B4PA 2CKWA 3FCHA 1GXUA 5J2PB 1RT3A 2E9ZA 4RNMA 3SCJE 4YR3A 1RT1B 1E6YB 2IMWP 1SJRA 2HMIA 5KFWA 4NX9A 3KLGB 1VBXA 2XS2A 1UAWA 2GHVC 4URQU 4C97A 3PR4A 3PEJA 5KT2A 1IBMF 3HF5A 1PGZA 3M30B 4J5OA 1LFPA 2RRNA 1VC6A 1N4LA 2OFGX 2RKIB 3HHLC 2ZH5A 2RDIA 5B0FA 2EFPA 2VC0A 3OR2B 2RJZA 4WIIA 2DVIA 1X9MA 4ED5A 4WYLA 4TN2A 3RB4A 1FTRA 3T9ZA 1N52B 4MK7A 4G1IA 1RK8A 5JVGQ 3V6KA 2HNYB 2VA2A 4OMFG 4NZ7A 3J7Z5 3DRPB 1M1KT 1NH8A 3C6TB 4AL7A 2KZMA 2YNHA 2KKHA 5AXNA 3LWLA 1S6QA 4DF4A 1DTQA 2BE2A 3KLHB 2AP6A 1JLGB 4DQQA 1HI8A 2NPIA 1IKVB 4ZP8A 3SSRA 1VMBA 5KG3A 1VQLS 2VG7B 4ICLA 1TV6B 1S1WB 4PRFA 5HMYA 1F5BA 2G0CA 1FNXH 2QLWA 1VC0A 3WZ0A 1S79A 4OQJA 5E3QA 3PACA 3T19A 2D9PA 2JH3A 3BS9A 2HPUA 3DRSA 1LV5A 3CCQS 2Z2LA 3QIPB 3KG0A 1KQGB 3TARA 4KO0A 1R7IA 2P9CA 3TW0A 1L3UA 3KJVB 3UWTA 4A8OA 2NREA 3I6PA 2UUAF 4N8OA 3O44A 1WF1A 3HK2A 2ZC3A 4I2PA 4LSLA 5U47A 2KH9A 2MGZB 5DDRC 2EG1A 2GJ2A 2LQJA 4O3SA 5HMXA 3UD4P 1UWBB 2IAJB 4JOUA 2JVRA 1WHXA 2DGSA 4DL3A 5D3GA 1VQ7S 1LW0A 2MZSA 5ITHA 2LECA 5IS2A 3K5MA 4C4WA 1TKXA 4A8SA 1OSCA 4BBYA 1BQNB 3BGLA 5KG4A 1IJEB 1N0VC 1RQ0A 1NJYA 4LIWA 4FF4A 1V6HA 4B17A 3THPA 5CZVA 1VLYA 3D54A 3K5NA 1HWJA 1CG2A 1S4FA 2O66A 3E3XA 3MI7X 1VIOA 4AFFA 3DC2A 5HO4A 2VUGA 2V4JB 1S6OA 2EW9A 3R27A 5D4PA 3SXLA 3V4IA 1S9GB 5F8NA 3B4DA 2CPJA 2MB0B 2XI2A 3B82A 3MXHP 3FFIB 3MR5A 1TK8A 1RA7A 2RD5C 3I0SA 1BC6A 1YI2S 2HYIB 4DHVA 3SFUA 2J9EA 2MQOA 4YDDB 2MY8A 3GG1A 4WE1A 2WSEC 4LVOP 1GXTA 2F8MA 3QPIA 4TKTA 2COLA 2ZNYA 3L95X 1G1XA 1L3SA 3MEKA 3CO9A 2PA3A 3F73A 1Y3KA 3M6XA 4A8QA 4ECZA 2QLXA 1SJQA 2F9DA 1E6VA 2ZVSA 1HBNB 3T6JA 3DLLQ 5KFQA 5EHHA 2JFDA 4IKAA 3MOZA 2UXBF 2MSSA 1J5EF 2N3LA 2ZHAA 1CSJA 3TUZC 1C1CA 2RIJA 7FDRA 2XZWA 2Q6BA 3GIKA 3QJPA 3FZ2A 4A8FA 4XPEA 3N79A 3EXCX 1BQMB 3OTDA 4CT9A 3IG1A 3NMRA 2FTRA 1FRKA 1IKYA 5DRKA 2B9WA 5IT9Y 3N6LA 2OSRA 2E7WA 4Q45A 2MHEA 3RRKA 2KG0A 4QIWD 2R2UA 1KS2A 5GAEI 1ZAXA 4K4XA 2Z0GA 5EX0A 3BGRB 1T3NA 2CQ2A 3DI6A 1ZETA 3CD5A 2C42A 4HDHA 1L3TA 3M6UA 1IKWB 2XBPA 1VQYA 4RW8A 2E9RX 4AUKA 2IYGA 2L41A 2FB0A 3GYXB 4X4QA 4WCEQ 2F40A 2DNKA 2LU1A 5KT6A 1N34F 3DLHA 1FF2A 2P5VA 3VQSA 2Z4PA 1FO1A 2K3IA 3MGJA 3MTJA 1HI0P 1VQKS 2DBBA 5L1LA 1N5VA 1N48A 1TK5A 4C8KA 2HHUA 4HH1A 5I42B 2RH3A 4DSFA 5K8NA 2AJ0A 4X4TA 4EGLA 4ED0A 3SI8A 4X4NA 4LT6A 4K4SA 3POTB 2YNFA 1MWZA 2HW3A 3DM2A 2JLEA 3T5KA 2DHXA 2RT3A 1N5TA 1X5TA 2BABA 3OFFA 3NGDA 4ZP7A 2OAUA 4KJIA 2ASYA 2POKA 2VBZA 1XERA 4F8RA 3HZGA 4OIXA 5C24A 1HNVB 4NLWA 3UDLA 4UUXA 5D77A 2ZFHA 4DQPA 1FK9B 2B43A 2LQBA 2N4CA 2B3TB 3CJ2A 3MM5B 1WI6A 5EDWA 3J7YU 3BQ0A 3RB0A 1KHWA 2R7XA 4WZMA 4E8UA 2D3OR 1HFEL 5KOWA 3IWNC 4KFBB 2IVMA 2D7SA 1CQMA 3OR1A 4B9TA 2XMVA 2D74B 3LGNA 4FS2A 2VASA 5IZHA 1HNIA 2RS2A 3BREA 1RAJA 3I4HX 3NAHA 3OXGA 4DX8H 5E5NA 2M0GB 4F3QA 1U1MA 3N6NA 1HW8A 3M8SA 2M8HA 4J9MA 1JXEA 1WHYA 1P6TA 1YJNS 3CDEA 2CZ4A 1T05B 1PC5A 1S6PB 4I67A 2CPHA 2JC0A 1KLMB 4OJHA 1FRHA 1H2UX 2CIMA 2RRAA 4HKQA 4N77A 1MMNA 1KFSA 2KDOA 2GX8A 4M63A 5IQQA 3EGZA 4OX9F 3MUMP 5KG2A 3M9MB 3KMSA 4WFNQ 4MK8A 4CH0S 2IHR1 2YNGA 3G8SA 4X62F 5H9EJ 4BS2A 1Q16B 2VB6A 1TAUA 4OI1A 1QE1A 3UQSA 2PIIA 4H4KA 2H9ZA 3CB4A 3H59A 3DMJA 2HGMA 3SCKE 4Y0FA 1CEZA 3OHBA 3EUNA 4ED8A 2OTLS 4ZPVR 4TY8B 1D8YA 1S97A 5DQGA 5E3RA 2GHWA 2Z8QA 3NL0A 1FT8A 2PDAA 4TU8A 3R5AA 1JB0C 1FA0A 1CVJA 1RISA 4N47A 2XS5A 4I68A 3MFIA 5CYQB 3IR5B 3IWLA 4ZMMA 2M2BA 3G6VA 1WNEA 3PKMA 3ITHA 1P1TA 3G6YA 2ILYA 2PSZA 5THWA 3MR2A 2Y0SD 3JSMA 2OPSA 5F41A 4YHHF 2J9CA 1HWLA 2X1BA 3M9OB 4QZVB 4YB1P 3KLEA 3AJ2A 3UCZP 3J7YI 5HI7A 2UUBF 5J2NB 1D9AA 5DLGA 4WFAQ 4GC6A 1JLBA 3I56S 4B9VA 2W4DA 1KTQA 4RW6B 3AJ1A 4DMZA 5L38A 3OSPA 2MKHA 1SV5B 4MH8A 4NCGB 2NYIA 3DOKB 5DG7A 2BOPA 2AV5A 4MTPA 1NJXA 3W3SA 1HBOB 1DJ0A 2VD3A 4JV0A 1M5KC 1ZBTA 3CE8A 2YKPA 1IKXB 5A8KB 1ZAWA 2XG8A 2AD9A 4CCHA 5KFEA 5I3PA 3LUYA 3DLGA 1K9MT 3MHYA 5IFMA 3N6MA 5DS7A 3J80Y 1UKUA 1KONA 1OQ3A 2Y1IA 5KG7A 3CIMA 1B0PA 1KR4A 3CJ0A 3D1HA 3IRXA 3GWCA 3JAMY 4OI0A 1Z1ZA 3PW4A 1JMTA 1QAYA 1RP5A 1U09A 3D0IE 4IG0B 3P96A 3LF0A 1VRUA 3KK2B 5M2RA 2HQ3A 2XSFA 2BJEA 4P6QA 1NU4A 3RTVA 3DDKA 2M9KA 3TOQA 1FRJA 3HI9A 3DYAA 3TVZA 3BSOA 2HS0A 2R7SA 3V2UC 1VI7A 2IBKA 3MM6B 1M0SA 5A8WA 4PUOA 4NLRA 1U1KA 4OI3A 1HHTP 3JTOA 4IFYA 5KFDA 4K4TA 4QWEA 2C2RA 2ZOGA 3PXGa 3VWSA 1PSDA 1Y5LB 2XY7A 3OSNA 1GTHA 3MR3A 4OZLA 3HVTA 1RYSA 4J9PA 2JVOA 3EGWB 2WB1D 3E8OA 4FVMA 2I9SA 3RW7A 2A1BA 1VS3A 2XMWA 4M5DB 2FHJD 1RJJA 3DRRA 4MIBA 3CCSS 2PD1A 3G4SS 4NL5A 1Y9OA 3DLKB 2CQGA 4NOHA 4XK8C 3AAWB 4A47A 2E5LF 3MMBA 3ENQA 4NXNF 3IS9A 4YY3F 4OFZA 1J5OB 4DPOA 1UA1A 1N8RT 3H2UB 3K5LA 1FKAF 4DOZA 4DS4A 4JI5F 3A8EA 2EK6A 3TA0A 5FDLB 2CQ1A 5LSOA 1IJFB 1WELA 3UE2A 4ETZA 2XSJB 2WOMA 4ZHRB 1HQEB 4Q8FA 3J7ZT 4QIGA 1HBMB 4X2BA 4ELVA 2R4FA 2HGNA 4IO9Q 2ZJRQ 3I5BA 2B51A 3HM9A 1RT2B 5GMKa 1QVFR 1VQ9S 4OHZA 4LJMA 3ISNC 2WONB 3ZFVA 4IUFA 5F3ZA 2AX0A 4OZ1A 4ID8A 3IXQA 4C11B 5IM0A 4ID5B 4DV0F 5KFSA 3GIIA 1FKPA 4DR5F 2HFOA 4ZPTR 1QAJA 2I5JA 1Q7LB 5DQHA 3PW5A 2DR9A 4B9MA 1JLQB 2EPIA 1I6JA 5CYMB 4CO3A 5HQ8A 2HZCA 3PV8A 1FTCA 3OUYB 2QIFA 5MAOA 2KM8C 1KQSR 3DLEB 2CJQA 2EFQA 1S1VA 4R5PA 2ZH8A 2KYXA 4FVCA 1LW2B 4I64A 1SIWB 1OQ6A 2ZM6F 4ZK7M 3FMWA 3JYTA 4ERDA 1U25A 5KFFA 1HPZB 4DL7A 3KNAA 3NG8A 3MFHA 5C42A 5K8MA 2DIVA 1HBUB 4YQWA 4LIRA 3QJLA 5KFAA 2DIUA 1GT8A 1KFDA 1LWCB 4IH6A 1X4BA 3NP5A 4WTYA 3CJKB 4BC7A 4I2QA 3VAIA 3TUIC 4BDPA 2GMLA 1X4EA 5E3AA 2F1FA 4KGKA 1JJ2R 4DSKA 5GAGI 3PW7A 4DV3F 3UCGA 1BD6A 5B7WA 1F60B 3OTBA 2ATLA 1O8BA 2B5JB 2B9YA 2DNZA 4FNHA 1TUVA 4H4OB 3ZZOA 4A8XA 1HNZF 3JTNA 2VFSA 2YKOA 3MMCA 2V4RA 4ED3A 1SC6A 5D4OA