3QJLA

One ramp protein binding different rna substrates
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
HMRIEVKLLPLKDNPILPFNYNYEVYSQILEKVNSIEPTIAKLLSSPHGFWTFSRIIVRKRKILPDKGIEILSDDVSLYISSSNEDIIRAIAEAVEKSPEFKIGELSFLVGDIKAIKVKELGKENVFSTLSPIVVRTVKFEGNKLRHWDLYPHDELFMDRLRKVMILRYSEVMGETPKDRDFTIEVLKFKPTRLMVGSSYIRGSLMVFRYAGSEEIARFGYENGFGEKTGLGFGMVKLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PH0350
publication title Cooperative and Specific Binding of a RAMP Protein to Single-stranded CRISPR Repeat RNA
rcsb
source organism Pyrococcus horikoshii
molecule tags Immune system/rna
total genus 63
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01881 Cas_Cas6 CRISPR associated protein Cas6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qjlA01
3.30.70.1900 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qjlA02
3QJLA 4C97A 4C8ZA 3UFCX 4C9DA 3PKMA 4C8YA 4ILMA 4ILRA 3ZFVA 3QJJA 3QJPA 3I4HX 4ILLA 4C98A
chains in the Genus database with same CATH superfamily
4U9RA 2Y3YA 3H5YA 3HHEA 1PJ5A 3RG6A 2VKRA 5D0EA 4QBUA 1FNOA 3CDWA 2L9WA 5M2UA 4TNOA 3PV8A 3UD4P 4I69A 3EZUA 4DCJB 2J6UA 3R8YA 4B9VA 3CJ2A 3O6QA 1RDRA 3K89A 1ROFA 2HHHF 5HK4A 5DLGA 3H59A 2AQ4A 3CC4S 4J9PA 4DF8A 3KLEA 4E98A 5KFTA 2WZ1A 1X4CA 4F4ZA 4DV2F 3BGUA 1SXLA 4P72A 1BXNA 2OPRB 3QFHA 5ETSA 2I1RA 4KB7A 4N8OA 2R2TA 1ZYQA 3I0SA 4ZHRA 2RU9A 4RW8A 3CJTA 1REVA 5L8RC 4JI4J 5LJ5Y 3B8HA 1IBKF 4DDFA 4ED7A 4ZVSB 3G71S 2BJ9A 1S99A 1CS4A 2M52A 2AEFA 3DRRB 2FHOB 2Y1IA 2KVIA 4C48A 4DR2J 1HHTP 3D3CJ 3A8JA 3TX8A 4KIAA 2CADA 1R43A 2Q79A 3MEKA 1R31A 4F3QA 5DQHA 3MEDA 1GH8A 3RAXA 2QLJB 2CPXA 3CT9A 3HFVA 2V67A 1YLXA 2ZH7A 4FXDA 2BANA 3ET6A 3RR7A 2WVDA 1NDPA 5C7PA 1R8CA 1HNWJ 2NR0A 3MM9A 2EC0A 3TJ8A 3HT3A 4JI5F 2F9DA 5DETA 3U02A 5F3ZA 3H4BA 4KTQA 5HN0A 4ZP7A 1HYSA 3MF5A 3OHAA 3M1VA 2ADBA 3M2UB 1UWBB 3CJQA 1NDLA 2BJDA 2UVWA 1TKTA 3OUYA 4FVCA 3SV3A 5KFBA 3PHEA 4N56A 3H98A 2BM0A 1WC3A 2MJUA 8ATCB 3ZTSA 1FWLA 2KFNA 3AD7C 2LYVA 3KDOA 3D9BA 3JTOA 1YJWS 2KT2A 2VJVA 3PIPQ 4WTOB 1N88A 1UZHA 3MM6A 2ZNYA 1SJ3P 5CHCB 4XPEA 5IT9Y 1VHIA 5ETOA 5KT6A 3DOKA 5LMUF 1Y5NB 2DNNA 2BW7A 2VC0A 3QAEA 1VJQA 4DR3F 2CJ9A 2J7KA 1PCAA 2V9WA 2B9YA 2J8AA 4CH0S 2E5JA 1TL3A 2B51A 3VZHA 1TUVA 3BJYA 3N28A 4QPXA 4B3MF 4A8WA 3HX9A 4NE9C 2V34A 2DR9A 4DR6J 3RW7A 2ZBRA 4IOCQ 3UO0A 4ZA1A 1U6FA 2FYXA 3W2WB 5IC6B 4CLWA 3JSYA 3ZZOA 3JAMY 2LQ5A 3DU5A 4NA1A 4QIEA 3MCSA 1IKVA 2AEJA 3VAFA 4F36A 2HGLA 1HQEB 1KQKA 2PEBA 4H54A 4DPYA 2XSJB 2EFQA 2LCWA 2QO3A 1NK6A 3DI6A 1YRXA 4NYZA 4C8NA 5DDRC 3LWMA 1VQ9S 2GVZA 1KD1T 4ZVHA 1UETA 3KLVA 2AKWB 2W9AA 3V5RA 3CULA 4DFPA 4I4BA 3M6VA 1RWXB 4Q0BA 4IG0A 4GO7X 4KV8B 1T9VA 2QL5B 3SFGA 4FYDA 2R42A 3MM5B 1WKJA 2ROGA 4DUZF 2BACA 1BGXT 4ANCA 2Z4PA 2M9KA 3RAQA 3NGKA 4P2XA 2E1MC 2JSXA 4KQZA 3US5A 2FUG9 1PG5B 3R2DJ 2AYGA 3P3DA 1HKAA 1AZSB 4MYTA 4O0NA 4X4PA 4JV5F 2VASA 2WVEA 4ZJLA 3QMQA 3PW0A 4ECUA 2VG6B 4WXOA 2FZGB 2NCKL 4ZPVR 1YVFA 5J2PB 1T03B 3NBPA 1DARA 1MROA 3VGTA 2C2ZB 4CLPA 4UQGA 2VPYB 1GMVA 1EX8A 5E33A 2MLXA 1RT5B 2VFRA 3FJ2A 4GRSA 3L9ZA 2M70A 4H4KC 1YZ6A 5AXMA 5L1JA 2EFGA 3HXMA 4RBTA 2LDIA 4CIOA 2B3TB 3TVKA 4RUHA 3GCXP 2BYCA 1YJ7A 5CD4A 1GAOA 1JLGA 5KFCA 1KR4A 3LAMA 1YHQS 2HHHJ 1LWFA 1MMDA 3AY0A 2JLFA 3K5PA 4QYZK 3HLUA 1AUSL 4DV2J 3W5ZA 4WYWA 4XAKA 3EMTA 3SQGB 4F3MA 5D4OA 1EP4B 3OXGA 2HQDA 1KVKA 2YH0A 1HPZB 1N54B 3M8PA 3CDUA 2F65A 2G2ZA 2CAJA 1O5JA 5D3GB 5CD4H 2V6AA 3OL7A 2VFSA 1IBKJ 1HFEL 4YS2A 1HNXF 2DBBA 5DS7A 1FXLA 2JDJA 2MQMA 4DMZA 1QUPA 1T95A 4LF6F 2MY7A 2UVUA 3FZ2A 1TV6B 4LMZA 1WHVA 1EZZB 2HQ3A 1Q78A 1BWVA 2Q1LA 3RTVA 1RHMB 3BB5A 2RQCA 1SL0A 2BM1A 1VQ6S 5HSPA 4B9UA 3BM7A 2F4FA 3QZ7A 3R5CA 1RT1A 4P2MA 1CULA 1AROP 3KNGA 1VGYA 2WW8A 2DHHA 4JI5J 4DBQA 3HD2A 4J9SA 3Q8RB 2PEHA 4NCBA 1IJEB 1T9UA 2J9DA 3W66A 5A8KA 1G1XA 5F0WA 3UDVA 2AJ1A 3TUPA 1KHWA 1VHFA 2LQJA 1U4BA 2CFXA 2YWFA 1N0UA 2ZOFA 1PSDA 3ICLA 3V81A 5SZTA 2G0IA 2R8IA 2V2QA 2DRDA 4ZVFA 2CVIA 3BSOA 2HNZA 2BW2A 2RHSB 4OIXA 2XI3A 3BGFA 1RACB 2J9CA 1NPPA 3MFIA 5HBMB 1NPRA 4IFVA 3VQSA 4PXBA 4K4SA 1U1QA 1P9QC 5J2NA 2DR5A 2HVZA 2GCFA 2A3JA 3D7SB 5A2QY 2ADCA 1RISA 3TAQA 5F8LA 2ZHAA 2VG7B 4Q44A 2R8HA 3MHYA 3TAMA 3EWGA 3V6DB 4ZK7M 2COLA 5LMUJ 2V63A 5AXLA 4J9NA 3VGVA 4HI1A 2P9CA 3QT7A 2N3LA 4DR3J 4YHHF 3CCRS 3T1YF 2RU3A 1AA1B 3OL9A 3SQOP 3UQSA 3KUEA 4IO1A 1DRZA 3WX4A 3MCNA 2W01A 1N8RT 2J76E 2VDHA 1S12A 5DLFA 1TZ0A 3DM2B 4FXWA 1LFWA 4DZ6A 1MN7A 4M5GA 2HIQA 1EKSA 1H72C 3NLCA 3R2CJ 2KG0A 2OTLS 3E2EA 1S9FA 3JQJA 3C6TB 3GE9A 4TY8B 4IQMA 4K4VA 3KJFB 3BBBA 1AYEA 1D09B 4Y2AA 3UWTA 3TQ1A 1QE1B 5G0RB 5F8GA 4WFYA 2Q3PA 3DRRA 3GV8B 1N32F 1YTYA 2ZH6A 2YWEA 4YB5A 2A0FB 3CJRA 4WU2A 4C11A 2F63A 1Z1ZA 4K7QA 4DEZA 4EU0A 4ED3A 5IWAF 2FZCB 3S1TA 2AGOA 3ZZYA 4G1QB 5LXYA 4NXMF 2C2NA 3NCPA 1S1XA 2XGQA 4PG8A 2EXUA 3MFHA 1NXIA 4LRFA 2MSSA 3M7VA 1M1HA 2MHNA 3M8RA 1UJ4A 1XR7A 3EVWA 2HZVA 1HNVB 3M8QB 2CPFA 4OYAA 2W4CA 4TN2A 3TA1A 3H2LA 2P9EA 4BLGA 5M2PA 1PJ6A 4JV5J 4X66F 3DRPB 4DHVA 5DGAA 3GIRA 4ILMA 3U27A 2CJYB 1A6LA 5KFAA 5KFUA 2MEWA 2A6OA 3BF4A 3TOQA 3M30A 4X65J 2VHGA 4I7FB 1KDNA 4EYIB 1RKIA 4LSNB 1I3OB 5DG8A 2RILA 1X7VA 1RAAB 2LXUA 3ZNJ1 3AB4B 4KKOB 5KG5A 4FYVB 4S0MA 1BQXA 5JVHQ 2NUHA 2J0QD 1B0TA 1HMVA 1VC6A 5BJRA 4NX9A 1RT7A 3KK1B 2YKMB 2CQBA 2OPSB 4NLYA 3BGLA 3I0RA 1ICEB 1GTHA 3FFIA 3GONA 1SJQA 2R7TA 1VDHA 4C3MA 2UXCF 2OPPB 3SZ2A 2HQGA 1NK7A 4Y3CA 4FF3A 3W7BA 5DQGA 2H9ZA 2QIFA 1TAUA 3F44A 4C8KA 5J1EB 5GMDA 4J9KA 4N47A 4GVBB 3TW0A 3W9HA 1NO8A 2XZTB 4ZCMA 3CMES 5CYQB 3MMBB 4ELVA 3A1YG 3OVSA 1IQTA 4YB1P 2K7KA 2KJVA 2XSFA 2ZKTA 3EZ5A 3B54A 2B4UA 2AT1B 2B5JB 2VFTA 2OD6A 3TA0A 3OLBA 5J2QB 4HDGA 2JEGA 4J9UE 1U47A 2ASDA 5DDQC 1BD6A 2RSQA 3SYZA 2LMIA 2VBWA 3UCZP 3GYNA 1CQNA 1D9AA 4W98A 3V2UC 5BR8F 3OR1B 4A4JA 5HMXA 3D0HE 3SSSA 1DTTB 3BPSP 1RWNB 1NEEA 4FF2A 1QUVA 4KV8A 4I1TA 4NXNF 3MM5A 4WIQA 4DQQA 1SC6A 2G13A 2W7PA 1YJVA 4OJ3A 2VF3A 2GW8A 4X62F 3NNCA 1JLFB 4ZLLA 2KG1A 2W9BB 3AA9A 4JI3F 4FZVA 1CJKA 4ZDNA 5MAOA 4IH5A 1GFWB 2F9JA 3EYZA 2KFYA 1PBAA 2YX1A 1AZSA 3PW5A 1GX5A 3QO9A 1WUUA 2EFPA 1NJIT 2EPIA 4LBHA 4QWBA 2FVSA 1SBRA 3PEJA 2VG6A 1TMJA 1UCNA 2LECA 3UN2A 2XHWA 4KY3A 2FB0A 2LFVA 3RJMB 4ZLJA 5J2PA 3F41A 3MUVP 3DXBA 4DS4A 5GAGU 1UVKA 1NDCA 5HVGA 1EJ7L 5H1SV 3OJUA 3DHWC 4EBCA 1TFYA 1TL1A 1T0TV 4KHMA 3MECB 3FRYA 1FWPA 1TKDA 3MOJB 1KEKA 1OJ4A 1YQHA 3T6JA 3LWLA 7FD1A 4NPOA 3E01A 3PKYA 4RPFA 5KG7A 5A8WB 1LWCB 3T1YJ 2GHWA 2NXEA 3QAUA 3D6FB 1Q4RA 1RA6A 3SQGA 4JB8B 3FSIA 2JX2A 2HWIA 4LSZB 4KH0B 5RUBA 4NLDA 1BQNB 1Q82T 2NYHA 2FLNA 5C24B 4ZIVA 2QV6A 3GIMA 3PZPA 4RW9B 2Y1LB 2C2OB 1E6VB 3W8PA 1Q0NA 1KVIA 2C2RA 2HURA 4NRUA 3BR9A 3C6UA 4ECRA 5I3PA 1ZETA 4O3OA 1N32J 1TV6A 3ZTPA 4U8YA 3IRXB 2MKJA 2X3GA 1HWUA 4KJIA 3PW2A 1YKWA 4M5DB 3BKFA 3OFEA 4J9RA 4RJVA 1L3SA 5IWAJ 1FE0A 2O1PA 2H4WB 4K4TA 4H4OA 1SJ4P 1V3ZA 4BWJA 4CLLA 5GAHI 3AOBA 2V4RA 1VI7A 4M95A 4NXMJ 2FJBB 4P71A 2OEKA 4PXCA 1UVJA 3MEEB 4RNOA 4F0HA 2YX4A 4HHJA 1UFKA 3GQCA 1XR5A 3CB4A 3BQ0A 2ZWPA 2GVDB 4YR0A 1SQFA 4X66J 1WDDA 4D3HA 4O3SA 4UOCA 2P6TA 2Y8WA 1UEKA 3D1QA 1VQ5S 3I32A 1OSDA 2H3EB 2KO1A 2YKNA 4OMFG 3PO4A 4ED0A 1RAEB 3TANA 4B9MA 2QLXA 2OFGX 3HD1A 5HBMA 4PG5A 4LQ3A 3N6LA 3LP0B 4LUBA 2ZZNA 1C0UA 2XMMA 1NZAA 1DFDA 4X4VA 1N5SA 3EVMA 4XIUA 3OFGA 4DL2A 4NLXA 3MD1A 1WELA 1XBWA 3RB0A 4ECWA 3V6DA 2BRKA 3PVXA 1HD1A 2DH7A 4ES1A 4LRAA 1RTJA 1U0HB 3H40A 2FVCA 1P6TA 4NLRA 1GEHA 3P5BP 5KT2A 5B0DA 2FJAB 1F5CA 1RT6A 1Y0HA 4N8NA 1H2TZ 2UXCJ 1RHJB 5DDOC 4JI8F 3WZ0A 2RVJA 4Y00A 5BYSA 4DSIA 1IBMF 4I2PB 3R27A 2L9DA 3CJ3A 1WEXA 3AAWB 3I6PA 3FBCA 3GJRB 4TY8A 4F02A 3JAMU 2GMJA 1RTHB 1IQZA 1X4HA 1VQ8S 1QE1A 1RHKB 2B9XA 2Q43A 4RNFA 5G0RA 5HMYA 1Y10A 2GA7A 2QL9B 4NOHA 1NJXA 1GT8A 4U7UK 2XBPA 5FIIA 4DR4J 3HZGA 4OZ0A 1Q5VA 1O51A 3IO1A 3OL6A 3CJ4A 1KQSR 1MMNA 3LPYA 5T7LB 3L4BC 4G1QA 5KFXA 4NXNJ 1R8AA 1S48A 4DR1F 3WHIA 4X62J 2RRBA 4CT8A 4JI3J 5L9NA 2KRRA 3G8TA 3W1YC 4PXEA 4PZVA 1NHKL 1WDTA 4NASA 3PXGa 3KMSA 2E5GA 2RT3A 2DXEA 5ADZA 4A47A 2C42A 2OFHX 1JJ4A 2DGOA 1RU1A 4OX7A 1F5BA 2MLZA 3SXLA 5D78A 2EFOA 3G96A 3RGIA 1N5VA 1F9HA 3T5KA 3DGPA 4F50A 3D0IE 1A7GE 3TARA 2YY3A 2YNGB 2BEFA 1HIYA 2D41A 3UN3A 3ELHA 4QU7A 1SIZA 4PPZA 2M0GB 3ISND 2WVCA 4ENOA 2CQGA 2IBKA 2CYYA 4EEYA 3GV5B 2BE7D 4LF2A 2XS5A 2IYIA 2XTJP 3I4PA 4OI0A 2KXHA 4LSNA 1YI2S 3KG1A 4KGZB 2MJNA 3CJ5A 3GLJA 2X7IA 3HVTB 2M3DA 1UW9A 2VZ9A 3PY8A 1V5VA 3H5UA 2K8GA 1VR6A 3IG1A 2AP6A 2W1BA 3QT6A 3IP0A 3MPDA 2HHTA 1HI8A 1RT2B 2E5HA 2J7WA 3KK1A 4WXWA 4WFZA 3T5HA 4UOGA 2RD5C 4HEA9 3KOAA 1MG7A 1RWPB 2AF6A 4ZPTR 4QIGA 1D0EA 4DS5A 2VFVA 1UVLA 3GG1A 1FJGF 2DIUA 3DLKB 4BBYA 2KHDA 3Q8UA 3AHPA 3EGWB 2MKHA 1TVRB 2F40A 1HW8A 2KZMA 2UU9J 4P74A 1P27B 1UVIA 1SUQB 5J1EA 1ZM9A 3OXFA 4UF4A 2N7YA 5KFQA 2OH2A 3CW2C 4EZ6A 2OMOA 3K5LA 3HVWA 1EQ0A 2L48A 3PRDA 2R9LA 2BJ8A 2B5JA 2BJ7A 4MJKA 4DV6F 1N48A 5CQGA 1NHUA 1S5ZA 5ETNA 2ZJQQ 4KO0B 2J9DE 4IOAQ 2B7CB 4WFNQ 4MMOA 3HO1A 2FVPA 2HFVA 3CNQP 1NKCA 4QPTA 3BGOP 2O67A 1EKRA 4NLQA 1RAGB 4USKA 2IDEA 3PFOA 2XC9A 4DR7F 2RMLA 1RAJA 5HLFB 2GJ2A 1JLFA 5I3UB 3QQCD 3QGGA 3IR7B 2VJUA 4DPWA 3GU0A 4ZJQA 1N0VC 2VQEF 2AV5A 2B43A 1FDNA 1WSVA 1IBLF 2ZH3A 1HWJA 4M5IA 2E1AA 4DV1F 3H2UB 1K9MT 3QATA 1J2VA 4M5NA 2E5LF 2PI5A 1TL4A 1P1LA 2IMOA 1U49A 5A6PA 1S0VA 1UJ6A 2ERRA 2NPFA 1F9FA 2FJDB 4KFBB 1T3OA 3BQ2A 3MPVA 3K17A 1F3VA 1VRQC 3T3FA 4L75A 1RGVA 2QA1A 3CCMS 3UE2A 4XK8C 4YQWA 2XWYA 2I5JB 4WZMA 3DCAA 1WF0A 2XS2A 3QLHB 4KBIA 4LQ9A 3G6XA 1KRPA 2FGCA 4Y6IA 4K0KF 1D3WA 3Q8VA 3MEGA 2MZRA 2RS2A 1SKRA 1SQGA 3DC2A 3NP5A 2HYIB 3FZBA 5KFVA 1R27B 4JI8J 2C3UA 3NOCA 1ACMB 3GTYX 4WP9A 5KT4A 2YQ3A 3QIPB 2LP4A 2IJNA 1FF2A 2HG4A 3BSAA 1IBMJ 1BQNA 2DJWA 2EEYA 4F2RA 3ADAC 4ITSA 1M5HA 2FIUA 5C24A 4U7CA 2G1HA 1KFDA 5T14A 3W5YA 2FD2A 5LL6d 3VGSA 1S1VA 1TQLA 2QMWA 1WHWA 3IWXA 1FRLA 2W2QP 4TLQA 4HH1A 3FDSA 3JSRA 3HJVA 3J7YI 5CABA 1LXJA 4M5LA 2AU0A 3QNWB 5H9FJ 2IJRA 1NCLA 1N33J 3H4DA 4M5DA 2E7VA 4RWXA 3QSIA 5D6GA 1JLAA 1AB8A 2HRUA 3IGVA 4I64A 3MPWA 1TK8A 1ZTWA 3N9UC 4DR1J 2HQIA 1RI7A 2R3VA 4ECYA 2XMJA 3OW2R 4N41A 4B08A 3MEEA 4KYZA 2KM8C 2WW4A 2DIVA 4J37A 2PFFB 4USUA 1NUEA 1RWOB 2XCPA 3Q2TC 1CJVB 2HS0A 1RWVB 2VODA 3J80Y 3Q8PB 3FEYB 4PWDB 2KU7A 1EETA 3IS9A 3BR8A 2VL1A 5IC4B 2DPIA 4XDCA 4RWWA 3JS9A 4YY3F 3MGJA 3I5CA 5DG9A 4LFCF 4QWEA 3KUHA 2VG5A 3BSNA 1J5OB 3KHLA 3LP0A 5FJ4A 4ZP8A 3TP2A 3NGRA 1SQEA 2C3YA 3DDIA 4B3OB 1HWIA 1KHVA 3PYDA 4EGLA 4KPCA 1FD2A 5HANA 2JFDA 1QTNB 1PGZA 1RU2A 2E7WA 3DLJA 3W63A 4USTA 2VV5A 2GIRA 5L1LA 4HVZA 4QR0A 3B4MA 4ELUA 4J90A 5A8RB 2QC3A 2PMZD 4OYMA 4DCOB 2E1PA 2GO9A 4LR8A 4C8ZA 2IRYA 3OD2A 4O44B 2KYZA 3KFWX 4V19X 1WTBA 2DH8A 2A6MA 1XWLA 3WBZA 2RQ4A 3DLHA 5GAGI 2WCXA 1IM4A 3HVAA 2YPYA 1FJGJ 2BQUA 3BDPA 1S6QB 4OZLA 5KFLA 3GV7B 1U7LA 1MSWD 1M5PC 2SXLA 1H7XA 1FX4A 4IOBA 4I2PA 2CRLA 2RJZA 4OYXA 3CGIA 2MQOA 3N5FA 1JLEB 5EWFA 3GFZA 4NLSA 1VBKA 4OQJA 1Y9OA 2CDQA 3BN4A 4CLSA 3NXZA 2QSFA 4MFBB 2GGPA 2NUUG 2JZ5A 2O01C 2EWHA 2HPUA 4DV6J 4MK9A 3RW6A 2MB0B 3BSCA 1VS3A 4XDDA 1FCAA 3DNCA 2HMIB 4P7TA 4LFAF 4JUZA 4YR3A 2EFVA 3PW4A 2POKA 4NLTA 1RP5A 3GJTB 1YDLA 1HARA 1FEEA 5K14B 2D9PA 2ZHOA 2W8LA 1WG4A 2HK3A 4FBUA 3D68A 1EAYC 1F60B 4FS2A 2ZE2B 5KFMA 3OSPA 1NM2A 1VLYA 1SCJB 4ZN1A 4DV3F 3FSYA 3BGRB 2VQEJ 2B6AB 2E7XA 1YJNS 1H6KX 2F8MA 4CTAA 1IBLJ 3QZ8A 4OLPA 4DV1J 1OY9A 1RSCA 3MCMA 4LSLB 4ATNA 3O44A 3PR4A 3DLGB 2W4DA 2HNDB 2DRAA 4RUBA 1FFWB 4GC7A 2GMHA 3M6XA 1ZM3A 3OQ2A 4B17A 1Y5LB 5ITHA 4MTPA 3IBWA 1RYSA 3TUJC 1BWEA 4DV0F 2R7XA 1OQ3A 5EWGA 4ZVTB 3PIOQ 1QM9A 3X3UA 1RWWB 2XWXA 5BYQA 2OPQA 3CJ0A 1DQAA 2WOMB 5IZHA 3W2VB 3OFFA 2B9EA 1CC8A 3A4TA 4K0KJ 3M8YA 1JNRB 2CIMA 1X31C 1T3NA 2ATLA 3P45B 1R0AB 1U26A 1NAQA 3R3TA 2VQFF 1T11A 3QPIA 3KLEB 4DSKA 4V1Ak 2V94A 1UEUA 2J6SA 3QRRA 2VOOA 4YEAA 2NQPA 2C2KB 2V9KA 2BKPA 1GMWA 4K5RA 3I0SB 3QRPA 2P6SA 4RW8B 3GR0A 2FY8A 4WCEQ 1TVRA 3IM8A 2UVRA 1HL6A 2ASYA 3R6GB 3T19A 1URRA 4O3PA 3T9ZA 1CS4B 3OR2A 3VTIA 5DG7A 3TWZA 1WORA 4PWWA 1VOMA 4KRWA 3VAGA 3DOLB 4PR6A 2OO4A 3NCRA 4B3SF 2P2CB 3TZZA 2FJEB 4GO5X 1LWXA 1RWKB 3LPEA 4RZRA 3MEDB 1U09A 4KO0A 1JLQB 1R0BG 1QD1A 5KG1A 1C1CA 1HHQA 3JTPA 2HVDA 3R5AA 2LU2A 1ZBTA 3OHBA 2BANB 1EB0A 1FE4A 3ET6B 1LFPA 3PG9A 4YMEA 3ENAA 1RAIB 2C2EA 4PUOA 3LQVA 3MM9B 2BQRA 3A8KA 2MKCA 4K4WA 1RHRB 2IAJA 4OJGA 5HLFA 3SCIE 5DJBA 1HYSB 3M1VB 1T9XA 1QLNA 4F8RA 2RAQA 3MI7X 3H8YA 4NLPA 3GCWP 2PIIA 2UUCF 1FK9B 2WHOA 3RRHA 9RUBA 4LF7F 2OP5A 3M2RA 3VR1A 1RAFB 3OUYB 2XHCA 3G6ES 5K5MA 4K50A 1QAJA 1M5VC 4YY3J 4DQSA 4W92B 3D3BJ 4LFCJ 1WC0A 4WK3A 2H1YA 2EFNA 4C4WA 1S79A 9ATCB 1PO6A 3UW1A 5KG3A 1EARA 2HKEA 2BABA 1QVFR 2K7JA 3W3SA 3L7PA 3I9ZA 1MMLA 3MM6B 1CSJA 3A13A 3ZZPA 2CPYA 5KG2A 3U1NA 2I5JA 4RW7A 5AE3A 3Q83A 2HFUA 3CVKA 3IC1A 3QLHA 1YBAA 4J9OA 3ZC4A 3ENWA 3QBCA 1RTDB 4W90B 2RH3A 5F0UA 3R9LA 1ZM4A 1RWUA 2C3MA 1VQLS 5DGBA 1A9NB 2ZZTA 3P6YC 2MYFA 1QY7A 3UFCX 3GPAA 3QIPA 2E9ZA 1Y7PA 4AFFA 3EICA 4CLYA 4B3RF 4P52A 2RB7A 3J81j 3AJ2A 3A12A 1HNZJ 4C2MA 1V5IB 3ETMA 3TRGA 3N01A 3TR5A 5I42A 3HM9A 3DI6B 3P5TL 1Q79A 2DR6A 2RUSA 2QMXA 1C2PA 4WE1A 3CCVS 3DLLQ 2EK1A 5BYRA 3CCLS 2JEFA 4RW6B 4LFAJ 2DHAA 4LREA 5C42B 1SJ1A 2MDAA 5D4NA 3CMAS 3H20A 2YBVA 1VIXA 4DFMA 4Q0BB 4IG0B 2NSBA 1TELA 3NEKA 3VVUA 4UUWA 1M1GA 1U2RA 4K8RA 2CPHA 3CJKA 3M8SA 4CO0A 2ZDPA 1NLKL 4DV3J 3S01A 2DYAA 3CCES 1N56A 2DGXA 1B0PA 3P96A 4U96A 1CJVA 2YKQA 4NCGB 2NLWA 3IWLA 2UV8G 2F5GA 1ZAVA 4PWDA 4PABA 3ZTOA 1F9EB 2QMUB 4USIA 4AL5A 3NBPB 1MROB 5KOWA 4PYDA 3GSIA 1S77D 2DHGA 4UY8T 3G82B 2W9CB 4ZLNA 4Y34A 5B7WA 4HT7A 1EHWA 4ECZA 4F0KA 4B3OA 5KFPA 5EUHA 4NCAA 1S59A 2CPZA 1I94J 4F26A 5GMKa 4ED1A 4ZCIA 1WF2A 3N5BA 2VQFJ 2QJ3A 5F8HA 4O3NA 4JV1A 4O44A 4X4OA 2HS3A 3KG0A 4FF4A 2PFDA 3J81Y 2PT0A 3TJ9A 3IA0A 2DVIA 5L1KA 1RQ0A 2RUGA 1ELOA 4FDFA 3AOAA 5L38A 1VQPS 2DR8A 1VQOS 2R8KA 4NLOA 2QGFB 1DLOB 3G9CA 3PTWA 2HFNA 1F1BB 2UUAF 1SI9A 3AT1B 2WK4A 4L73A 4MFBA 2I0XA 5M2RA 1EIYB 3F73A 3PW7A 1NH8A 5LM7E 3M9MB 5KFOA 2KFZA 2GQ2A 5GADI 2LA6A 3GYGA 2HMIA 3E8OA 2UXBF 4DUYJ 1IM6A 5B0BA 2Y8YA 1U6ZA 4LF4F 3KLGB 2JOQA 4OZ2A 3VF0B 1S9EA 3V4IA 2BOPA 1MN9A 3CJ8A 2H48B 2JWNA 2HW3A 3BN7A 5A8KB 1M5OC 1LKZA 1RT3B 3Q8QB 3LP1A 2HVHA 2UUCJ 1HW9A 1MWQA 1XMOF 3BGRA 5D15A 3TUIC 3V81B 2ZNZA 5A0YA 2QE5A 2RDJA 2HNZB 2Z56B 4LSLA 3BYRA 4DSFA 4C8OA 4ZCKA 3DLGA 1AT1B 3VGUA 4IFVB 1Y3JA 3Q86A 5J2NB 3TZWA 4NEZA 2ZKUA 4CLTA 3TX0A 2DXDA 4OHZA 2ZITA 2XLKA 3TAMB 4I2QB 2HNYA 2WSEC 4R5PA 3ZXWA 2WOMA 2OD4A 2R7RA 3W2VA 4FPRA 1CEZA 1A0OB 1UP1A 2BJEA 1VYAA 2CJXB 1R0AA 1H74A 2ATCB 1H0HB 4YN3B 3C66A 4ZKAA 1ZZFA 2FDNA 2GHPA 2CJKA 4OV1A 1I5OB 1FVQA 5D0HA 3LAKA 3UDCA 4RX6A 2Y1JA 4BC9A 2ROEA 2O5DA 1LQ9A 3R5DA 4ECXA 2RRNA 3W5XA 2Z2ZA 4B3RJ 2AJ4A 2OAUA 5DQIA 4NZ7A 3D67A 1R8BA 3AD8C 3D54A 4B3TJ 4X4QA 4ELTA 2BKNA 2ASJA 3CJSA 1VC0A 1R6VA 2XY7A 4OX9F 4ID8A 1TP7A 3AD9C 3K5MA 2KKHA 2AWZA 2MQQA 3DOLA 2QTWA 4LRDA 2VA3A 2Q6CA 3BS9A 2QSWA 1U6BA 1OY8A 3ILOA 4ZPCA 4C11B 4RR5A 2ZFHA 3KDNA 4LFBF 1JLQA 2PD1A 3R7NB 3VAHA 1UPPA 3UDEA 1S1XB 2HBZB 3EPIA 3W64A 2E66A 1GK8A 4KSEB 4HHHA 4K4XA 1X5PA 5D77A 2AX1A 1TK5A 3PACA 1JKHB 1TAQA 5B0FA 1Q53A 2H54B 4HI2A 4C8MA 3RR8A 2C28A 1FK9A 3J80U 2YNFA 3H90A 1LK5A 4RKUC 4OYOA 5JXSA 4F4KA 2H51B 1WOSA 4F4XA 3NL0A 2ZJPQ 5LSLA 3HPOA 1Q8IA 2V8GA 2CQHA 2CUYA 3ILLA 3M30B 3V6HA 1F6TA 4U7UD 2FTRA 1WC4A 1HBOA 1FNXH 4NLUA 2WVBA 3M9NB 4OHVA 4F4WA 5E2QA 3R7SB 4ZPWR 2R7OA 1TKXA 1S49A 4DR5F 1Y3KA 3LALA 2GZOA 3UNGC 5LT5A 4UY85 1DURA 1R8HA 2DNHA 2VU5A 3C3LA 5EN1A 1Q7LB 2G0CA 2FHKA 1HMVB 5GVQA 1RT7B 4WK1A 1H98A 5J1PA 3GILA 1G3OA 3TAPA 4HR2A 2HIYA 1RTDA 3ZO7A 3BO3A 3RB4A 3I0RB 3FFIB 1URNA 2OI2A 2QRRA 1YRUA 2QT7A 2VH7A 5IFMA 2HGNA 1SL1A 4E8UA 2JHEA 1X5TA 2E1CA 3DKDA 2R2RA 5GAHU 4A8FA 3MM8A 2LQBA 2HRTA 2L08A 1U8WA 1Q7YT 4YDXA 2Q66A 1GNKA 3DDKA 2IBOA 2XNRA 2CQ0A 4RW4B 2UUAJ 1ZAWA 2BBEA 1R3NA 5AT1B 2E1RA 3VHQA 5E3CA 1X0FA 2J7UA 4TQRA 1D1UA 5K8MA 1J5EF 2MZQA 2APOA 2UXBJ 1XMQF 2D7SA 4MKVA 4RW6A 1QTMA 3ITHB 4M5JA 3C46A 4RBVA 5C42A 2XY5A 4LF4J 4MK8A 3U7JA 2PI4A 2BKOA 4OZNA 3AH6A 4O3RA 4ED6A 3HJFA 1UFWA 2CQIA 2F8HA 2NXJA 3WIVA 2NSCA 4OZ3A 1CJKB 4ERDA 3UN5A 3TUZC 2XCAA 2IC3A 2UXDJ 1UVNA 2XMWA 1TU0B 2MXYA 4G6VB 4H4MA 4GC6A 1LW0B 3QO9B 1HBMA 2Q6BA 2QFIA 1QSSA 4NCGA 1H3DA 4OHYA 4ZLPA 3G87A 2E9TA 1UEVA 2DNRA 2B0GA 2ZDOA 5KT5A 2LEAA 1HR0F 2WSCC 4DJBA 1W7WA 1H73A 1IVZA 4RO0A 3G82A 2W9CA 1XEZA 2JC0A 3L3CA 1Q8LA 2U1AA 2QA4G 2W2MP 1TL1B 3DMJB 2JRSA 1S6PA 1K44A 1GX6A 4ZITA 2ROPA 4ZPBA 3E01B 3DXSX 2DEIA 4G65A 4C8LA 1KLMB 2WB1D 3SSQA 3HHLC 1FFGB 1S57A 1F2GA 2Y0BB 4MK7A 2D3OR 1RHUB 2CQDA 4WFAQ 1L3TA 1NKEA 3VAMA 3CPWR 3G8QA 3ETOA 2NZ4A 4X64F 1PILA 3RBXA 1S6OA 2U2FA 1FRKA 4QWAA 1YX2A 3LGNA 2DNPA 3L7OA 1HQ2A 4M1KA 1JLBA 4OX9J 2ZBIA 1DLOA 5KFWA 3C6UB 2FGOA 2CA9A 4EWTA 4OI2A 1CC7A 4WFXA 4LFBJ 3PM9A 1X9MA 3MAAA 4H4OB 2HHQA 4NLGA 4KGXB 2KM8B 4Q8EA 1N5YB 2QA4S 2ZZMA 4USMA 3C16B 2QYGA 3NMRA 4OYWA 3KLGA 1S0NA 1B4SA 4OX6A 4ECQA 2QL7B 3KLIA 3TEGA 5EHHA 3QGPA 4WP3A 3VAIA 4MKYA 3PCOB 3QYYA 4KH1B 2XGPA 1RT3A 5KFSA 4AT1B 2IM3A 3ENVA 5CCLA 3MAHA 2QZ8A 3P49B 3K59A 2BJ3A 3DGVA 4P7VA 1XIQA 1O8BA 3NY0A 3C15A 2YKNB 3RAMA 2JC1A 4R0EA 5HJYA 4J7CA 4B9LA 2NREA 4FXVA 4QYZJ 4TXSA 2A10A 1C0UB 2EKNA 3BZQA 2DB1A 4CO4A 3Q0AA 2W8KA 3R6LB 1AUDA 4TU8A 4DR5J 1AFJA 1LV5A 3SFUA 4KHPF 3FVYA 4JBCA 2H5JB 2MZTA 4I2QA 1XR6A 5LMNF 1RTJB 3TA2A 5AXNA 5AE1A 4Y65A 1LWEA 2OUGA 3KK3A 1RT6B 2HBRB 2KH9A 4CH7A 5J2MA 1N36F 2L3MA 3QJLA 5F3TA 3TQEA 4CLKA 4B3MJ 4ZVRB 3SCKE 1OSCA 2VD3A 1TKZA 4OHWA 5CYJA 4R0JA 4ZPAA 1RAOA 4BS2A 1RWMB 1WG5A 3I82A 4Z7YA 2HHUA 4M94A 3MCOA 1T8EA 1PAUB 4LVOP 1U45A 2GQQA 4NLVA 3CC2S 2CQ1A 1QJHA 4JYAF 4ID5B 4NWBA 3BPDA 4J5OA 2D3ZA 2YKPA 5E3QA 3HHKA 2I2YA 1J5EJ 1QAYA 2EBGA 2HHSA 2E9RX 5KTQA 1XMQJ 2XMTA 4CLFA 1X4EA 3PHTA 4X4NA 4MIBA 3U1LA 2RHQB 1TTHB 2A1BA 2ACYA 5KG0A 3WDOA 2AJ0A 4WIIA 3B6BA 2MQ8A 5K8OA 2V4QA 2CNLB 4DR2F 4TQSA 2IM0A 3MURP 1R89A 3TZXA 4DUZJ 4ES2A 2HEKA 2DO0A 5THWA 3ISZA 3DOMA 4ANEA 1JB0C 4UZCA 2V8HA 2H5EA 4LBIA 4LRBA 5IV3A 5KFZA 2DCUB 5F8IA 5IT4A 4D3GA 5F8MA 1JKHA 2EG2A 2VPXB 1LNQA 3DGPB 1HNWF 3P4UB 4M5MA 1YJRA 1S72S 1VQMS 1YJTA 3X1LB 3CDAA 2CDRB 1XK8A 3HHDA 1KN6A 3EGNA 2OMLA 2WRMA 2GHVC 2HHXA 4USVA 1O6XA 4DV4F 2IY5B 5B0AA 3A3NB 4P2SA 1WEZA 3H2VE 2XI2A 5KAKA 2R7UA 2CPJA 4KGVB 2RF2A 1W26A 1UW4A 4C8YA 1S1WA 4KPYA 3CDBA 4E2FB 3NRBA 3IAM9 3IG1B 2BV3A 5HROA 4TVAB 2IA0A 2FVRA 5E0OA 3NMAA 4DG1B 4USWA 4MT1A 3GR1A 3J81U 2KI2A 3PYGA 1T9TA 1RTZA 3J7YU 4ZOSA 4JI0F 1FRXA 4X64J 3SV4A 4IKAA 4HDHA 3LA0A 4U67Q 1TUGB 5IS2A 4PKDB 1HNXJ 1FA0A 2PDAA 1KFSA 1FDAA 2J0XA 1G7CB 4ZVEA 2L41A 1KLNA 3H5XA 1SC3B 2IFXA 4O4RA 2CQPA 3K8WA 2CZ9A 3K57A 3OXLA 3CUNA 1ZA1B 4LF6J 3TNVA 4TYAA 4DL3A 4RW4A 3SSRA 4RNNA 2LQ8A 4YP3A 2ZVIA 4DR6F 2CNOB 2I6WA 1OY6A 1R7IA 2XO6A 4B9TA 2VONA 2J9EA 4JI2F 3PX6A 1L5UA 1IWGA 3CE8A 1C4CA 5LSRA 3JB9k 1T94A 1JK9B 1VFJA 1FRJA 4LBPA 3HT0A 3NOGA 4K2JA 1L3UA 5AXKA 2CNKB 2GX8A 2V68A 3SEOA 3I4HX 3ITHA 3E51A 1NSAA 5CZVA 1WEYA 1U2CA 3HI9A 2N82B 3N6MA 5DM6Q 2LDYA 2ZWOA 4J9VA 2WAQD 1O0PA 3CO0P 5ETTA 1NJZA 5J1NA 2IM2A 2PSZA 3PNIA 3KK2A 3GJQB 2DY9A 4OJHA 1LW0A 3KLHB 3LANA 1K47A 3LGHA 2G0JA 2LKZA 3TEHB 3EXYA 3N0VA 4FS1A 2MTLA 1FXRA 8RUCA 3KJVA 2BX6A 3VCDA 3DFEA 3GFHA 2QLFB 1OWXA 2DK2A 4QZVB 1MWYA 4P75A 1BQMA 3N4WA 3B78A 3NGTA 1JXEA 1T02A 1WI8A 2YNIA 3UCGA 3DMJA 2WTFA 1M0SA 4DU7A 5CYMB 1CJUA 4GKJF 5LMNJ 1BUXA 2M8DB 2KXNB 1OS5A 3MEGB 3I87A 1KLMA 4YHHJ 1YITS 2YNHB 1C0TB 2GV1A 3BKTA 4UOFA 1FX2A 2Z8QA 5EDWA 1Q8KA 1N36J 3DLEB 3R1HA 2MKKA 3QGHA 3Q8YA 3QGIA 2VIHA 4ZVUB 1W25A 1P8GA 2LXIA 3FRZA 2O66A 2IHR1 2DXFA 4L3KA 4UT4A 2JEJA 2J0SD 2Y0SD 1FRHA 5A76A 3IBFB 3KWMA 3MM7A 4PG7A 2H65B 3JSMA 1S1TA 1X4DA 4JI1F 1S1VB 4JYAJ 4CNZA 3SDEB 3CIMA 1F0XA 4URQU 5HVFA 3ZZTA 3HFKA 3FQLA 1LW2B 1ULRA 2OJ3A 2GNKA 4I56A 4Q45A 1U2FA 1REGX 4IRKA 3HSGA 4W4MA 4A8MP 1RYRA 1JLAB 4CDIA 4MIWA 2QG9B 4Y2MA 3EPGA 3I31A 2XZWA 1N5YA 4IO9Q 1X4BA 5ETMA 1VQKS 2VBXA 3C16A 1JMTA 4C3KA 5KT7A 2DGQA 3NWRA 1S1UB 4OYIA 3VAJA 1X9SA 3BV8A 4LT6A 4ECVA 3ZZUA 4K4YA 2F3JA 1FTRA 2X1AA 5KFYA 4K2XA 1EETB 3DRYA 3IS9B 1NNDA 3NGUA 3POTB 4KGMA 3GG0A 2FZKB 4KHRA 2AGQA 1C1BA 3C19A 4QIWD 3CCWA 1VBZA 4DV4J 3M4XA 2YWKA 1S0MA 2VG5B 1FKOB 1NPKA 2I38A 1AXQA 3L95X 3J7ZT 2OHDA 3QJPA 2XM3A 1B3TA 2G2YA 4DQRA 2PGCA 1TFWA 4CO2A 4WZQA 5H9EK 3OT9A 1XERA 2AJFE 4OI1A 4P73A 2HSEB 1WG1A 1YJ9S 4Q8FA 4JI0J 3NGSA 5CCMA 2F4VF 4ZMMA 3Q2SC 2MGZA 3VAKA 1RBAA 2MQPA 3GJSB 1NMEB 1X5OA 4X2BA 2DNGA 5KG6A 2NYIA 2CQ2A 2CJQA 1W2BR 3KYLA 3JSBA 3DYAB 4IRDA 1RHQB 3B4DA 2EI5A 5E5NA 2CZVC 3RB3A 3EX7B 2V50A 1GQEA 4HH0A 3IN5A 1APSA 3OLAA 6FDRA 4ID5A 3W60A 5GAEI 2GGPB 2BDPA 5A6WA 2CQCA 2DR7A 2AYEA 1KNZA 1LXNA 5E41A 4JI2J 2YQ1A 1U48A 1U1LA 2YQ0A 3U1MA 1VQSA 5DRKA 3BO2A 1NDKA 3T1HF 5K9FA 2ZH5A 4DLGA 5E3RA 2KT5A 4O23A 5BR8J 1CQMA 4QR1A 3CWJA 3D1OA 1VLOA 3NS6A 3BREA 3ULHA 1FESA 4OHXA 2GJIA 1MU2B 2DPJA 4DQIA 2FPHX 1PIEA 1XN9A 1ZOTA 3P8BB 3MUMP 4YOEA 4OYZA 4A8QA 4HL9A 1KONA 1ZAXA 4A8KA 4ALZA 4CTAB 3V6KA 2W4PA 3M32A 1QSLA 3OPKA 1RA7A 3HSJA 3PX0A 4AE5A 4QIFA 5H9EJ 1UA1A 1TL7B 3NAHA 4WU3A 2AYMA 4ZVPB 1PBUA 1V3RA 1HBUB 3R5BA 1IKXB 4J9LA 3MPYA 1U1OA 2F7VA 1DQ9A 1J27A 4EZ9A 2FHJA 3C14B 1VMBA 1PJ7A 2VBYA 4X84A 3JYTB 3T1AA 4F2SA 2OPQB 3V4MA 2QYCA 4V19J 4GKJJ 5KFKA 1FHTA 1KOHA 1IKYB 1OO0B 5CZXA 1GXLA 2GO8A 3MOZA 1RZMA 1SKSA 3UPFA 4X65F 1UWAA 5F8JA 3PJWA 5ETVA 4CRJA 4DG1A 2LVWA 3UI3A 3UVJA 2GJFA 4JI7F 5HVHA 2X1FA 4QW9A 4PWUA 1SVDA 4LF5F 4FKYA 4EI2A 2RKIB 3OTBA 3MMAB 3MR2A 2XB2D 2ZD1A 2J5AA 2FLOA 1Q1KA 1WOOA 1PYOB 5HJXA 4F25A 3WIUA 3M2VA 4JI1J 4X4SA 2FLPA 3OR2B 4IDKB 1Q95G 1BE4A 4N77A 4MYUA 1WD6A 3MD3A 4IG3B 2FC9A 3VZIA 4PQUA 4LR9A 4C6AA 3THVA 3CO9A 5ETLA 4HTJA 1FKAF 4EBDA 2W7OA 1VRTB 3MPUB 1MLAA 1DHMA 2DT9A 4K4UA 4OYPA 2BQ3A 2HVIA 1WC6A 3JXOA 5B0GA 1RAHB 3A8EA 2WONA 1WKLA 4O4GA 1VQ4S 1KSPA 1C1CB 1XC9A 3BYPA 5I4MA 2NPIA 3AFGA 1R8PA 3NGDA 3AB2B 2OEJA 5AJ3F 1N6QB 4FYWB 2KB2A 3BH7B 4PUOB 1RJJA 1DTQB 3TJAA 3K7RA 3I5BA 5EGYA 2CXEA 4UOHA 2IAJB 1HWKA 2IM1A 2YVSA 4DUTA 2HLUA 2W7AA 4MIAA 4DX6A 1FDDA 5BXIA 2HVEA 2EKYA 1Y11A 2HZAA 3S8SA 3ZZZA 2DNLA 1NK8A 2ZM6F 3M2RB 4DPUA 1VRUA 1PKUA 4NYOA 4HKQA 1JIHA 2EG1A 2WSFC 3KLHA 4ZP6A 5CXTA 3PX4A 3T41A 3L7UA 4ZPDA 2DNYA 2CG4A 5KG4A 4I6YA 1Q86T 3OBIA 4KAIA 1RT4A 1SIWB 3SI8A 3G86A 1JXLA 4IYQA 1WF1A 1EQMA 1UZDA 4USHA 5ETRA 3WQPA 3PRVA 1HI0P 4RW7B 2O3DA 2GVDA 1RB0A 5CYMA 2Z2MA 3MR5A 4Y28C 4C3LA 4LF8F 2OGUA 3J7Z5 2LXFA 5DZ6A 2DRBA 2YNHA 1C0TA 3M8ZA 1VK8A 3SCLE 3ILIA 2F4VJ 2HBYB 4FVMA 3DLEA 2IRUA 2VPZB 4WBFA 4Z37A 2FJXA 3VV2B 4LF1A 2EC2A 4NRTA 3HF5A 4LF9F 1VJWA 5GADU 4ANDA 2R2UA 3LP2B 3FCHA 3IBCB 1Q5YA 4B9NA 2D9OA 3WC2A 2M7SA 1Q81T 1YK9A 4CT9A 2IA6A 2EK6A 4A8YA 2HZCA 4NI2B 1P1TA 2OPRA 2V4JB 3THTA 4PXDA 4MH8A 3HMJG 3CTRA 2KVQE 3SDEA 4I6AA 5I42B 3SCJE 4HHUA 2XY6A 1LW2A 2V2ZA 1HNIB 1MNEA 4NEYA 4L72B 2OIHA 2CJAA 4WE1B 1XQIA 3T1HJ 2R7SA 4UUXA 4ED5A 3OTCA 3AQPA 5LJ3Y 3BBFA 4NZ0A 1QAXA 1U1PA 1SL2A 3DU6A 4KGKA 1YGYA 3AJ1A 3BBCA 3C2PA 2FY1A 3TVYA 3CJKB 4TY9A 2AD9A 2B9WA 4WTYA 4AXIA 3LH2S 5D4LA 3EE3A 2JVRA 1NJYA 1S1UA 3A3PB 5HMWA 2K06A 3UR3C 2DGWA 5KFHA 2NXUA 3R1LA 1H7WA 2AZ1A 2CKWA 2KYXA 5F41A 2IRXA 4EYHB 1XNQF 4AD6A 1S97A 1K1QA 3POTA 2BE2B 2HAIA 1HA1A 4URSA 1T05B 4QOTA 1S10A 3K0JA 3UD5A 3M2UA 1I1GA 1KP6A 4L6V3 1UWBA 1R0CB 4HT5A 1FKOA 4EFAC 4KT0C 3KHGA 2HFSA 4RL1A 3HHLB 2DNMA 4FNHA 1KTQA 2FHJD 3IM9A 1SKUB 1HBNB 2CWKA 2NS1B 1XMBA 5FD1A 2DGTA 3ZZRA 1RADB 4O3QA 2JH3A 1SPBP 5JUMA 3CSKA 4PAAA 4PYAA 4CO3A 4JI7J 2JL9A 2ABYA 4NLWA 1OYEA 2D69A 4LF5J 2WVFA 3GMGA 3CEDA 1KKHA 1KOOA 5FDLB 4DU8A 4L3NA 4L76A 1FKPB 1M5SA 3PFEA 4AYBD 5HAOA 3HKWA 3EXCX 1JJ2R 3DYAA 5HQMA 4LR7A 4XPCA 3EDRB 5GMEA 1OPIA 1NSKL 3OVAA 2AYBA 4WWSA 4B9SA 4DN0A 1FRIA 2K3KA 2DNKA 4QCLA 3DN9A 2YWWA 1MWZA 1X4FA 2ILYA 3UDLA 1NB2A 3W2WA 1UMJA 2PO4A 3THPA 4WF9Q 3FUYA 3BEGB 3TVZA 3LOUA 1K73T 4KC5A 4F3OA 4GVLA 1HQEA 5AJ3J 3IXQA 3OSNA 2XSJA 1R6YA 2IVYA 1VBXA 1YG0A 2RQKA 4OZ1A 2K1RB 4DR7J 1VCTA 2ZC4A 1S9EB 5FLXY 3V4IB 2AGPA 2GFFA 3T9NA 1NRKA 1MU2A 4DR4F 3FBBA 3M9OB 3MZIA 3LP1B 1U1KA 2G4BA 5DM7Q 1JLCB 1ZPWX 2CWXA 2ZM6J 5U47A 1QSYA 5A0YB 3QT5A 4PPDA 3LTOA 3FQKA 2IMWP 1TL7A 2JJ4D 2E5LJ 2JFKA 2N4DA 4CO1A 2G1DA 2OTJS 2ASLA 3OFHA 1S9GB 5F9LA 2R4FA 4I68A 2ZOGA 1HBUA 1IKXA 1OYDA 1K0TA 3H25A 4HTIA 5HL7Q 4PEOA 2J6TA 3KNAA 3OTDA 3C14A 3FEZA 3BQ1A 1IKWB 3KJQB 3JYTA 2HNYB 5C5JA 4R5PB 1IR1A 4DPOA 4ER8A 1T03A 3QJJA 1RABB 5C25B 4K5SA 4LF8J 4ZCLA 1S7IA 1G4CA 4CO5A 2BA9A 1IKYA 1RT5A 2QFJA 1UA0A 3M8WA 1FEHA 2B8QA 1N52B 1HWLA 2PA3A 3CDEA 1VBYA 4OYBA 1FWKA 2KN4A 1ZH5A 1KVJA 2CJBA 4EO6A 2GS8A 1M90T 3FCVA 4Z2XA 4LF9J 1BHNA 3I5AA 2PE8A 1Y00A 4CNYA 3AQOA 1WJ9A 3Q24A 1YWXA 2RKIA 1FJEB 3MMAA 1T9WA 4URGA 2V69A 2UV8A 2VKZG 4DL0C 4C98A 1EP4A 5HATA 3TO8A 5KFGA 4IDKA 1HPZA 1RBOB 2R7QA 4QWDA 3PKMA 4IG3A 5CAAA 5D3GA 3KHRA 4AL7A 2JNJA 4Y0FA 2D3UA 2D1CA 2UU9F 4ES3A 3TI0A 1VRTA 1U8SA 3GFXA 1YRTA 2QEXS 4CYUB 2FQQB 2L9NA 3OTEA 4E0DA 4BHQA 2B7BB 4RU2A 4I6WA 2M8HA 1F5AA 3GIJA 1N6QA 2IVFB 3DRSB 2RDIA 3Q8SB 2PMHA 5JVGQ 1WHYA 1DTQA 1RLCL 2HGMA 3PEHA 3FKBA 4R25A 3IAS9 1DZ5A 4OZ5A 2M2BA 3UD3P 3QSYB 2YNFB 3GIKA 4FF1A 2HFOA 1XNQJ 4OV6A 2V2VA 2XZDB 2ZBQA 2FLLA 2DGVA 2CZ4A 3NS5A 2DD8S 5CA5A 1WSRA 4CM0A 4BDPA 3LUYA 1HBOB 2ALZA 4NL5A 2CQ4A 1NK0A 2XMAA 2UVVA 4CLUA 1TKXB 3W61A 1VISA 3CD6S 2W2NP 1NJWA 1FT8A 2GIFA 2LQ9A 2HWTA 1U1NA 2MSTA 1KQFB 2HFZA 5LSOA 5E3AA 1XNRF 2C2MB 3K2YA 2UUWA 1NKBA 4MKAA 2PMWA 4QQBA 4CP5A 4RUAA 2HWHA 2DITA 4DL7A 5KFNA 2VG7A 4YFUA 5SUHA 3D28A 5B0CA 4DL6A 5IT9U 4IH7A 1NK5A 3MR3A 4K4ZA 2LEPA 2DKOB 2V8VA 4MKBA 5LXRA 3VQTA 3M6UA 4AQYF 2ZUGA 3S6EA 4RUCA 4ZVQB 2VA2A 2GQCA 5HQLA 4DL4A 3K8VA 2Z2YB 3MM8B 3LP2A 1V6HA 2C3OA 5L9XA 4JP8A 3D6HB 2UP1A 4DXLA 3CCSS 3DM2A 1UPMB 4NI2A 2V4JA 4JV0A 2RDDA 3PJXA 1TK0A 3GWCA 4JV2A 4HACB 3G8SA 3C6TA 2OELA 2XLIA 2OEMA 2IPOB 1HNIA 1CJTB 2KJWA 3VALA 4C0HA 3UNYA 3I96A 2HRYA 3W65A 2I8EA 3RB6A 1S6UA 3CD5A 3UCUP 3PJ9A 1WC5A 5KFRA 1SH3A 4FP9A 3DRXA 4CWBA 4NMXA 1AFIA 4NA2A 3W9JA 2HBQB 1N33F 4DV5F 1SKWA 3OTOF 6AT1B 1JNZB 3AODA 3FEXB 5D0GA 2UUBF 3MMJA 2IC3B 5T41A 1CBKA 1QVGR 4J9MA 4DI6A 4ZIWA 4DV7F 4H4MB 5EX3A 2GMLA 1HBMB 1CLFA 2UZAA 3NAIA 4DN9A 1HNVA 1VQYA 2G2OA 1FXDA 2BE2A 3M8QA 1T05A 2ZOMA 4DV0J 3HVRA 2CQ3A 3GB0A 3DRPA 1GXTA 1ZA2B 1I51B 3AXKA 4UZBA 2HQCA 2IVMA 1S6PB 2EW9A 3HHLA 1YBTA 2ZC3A 3HCXA 5D4PA 4AXJA 1U24A 2D3O1 1WACA 4ZJOA 1HBNA 2B4PA 4UTGA 3CC7S 2MZJA 5EWEA 2LA4A 4I7FA 1HHSA 3KKFA 3A3OB 4C9DA 3MTJA 3QWPA 4EO8A 5KFEA 4P2FA 4EBEA 4CLZA 3I56S 2GAGC 3ZTQA 1FTCA 3RU0A 4KKOA 3BDEA 3MXHP 2X3DA 2W25A 5HO4A 3D6MB 3ZNUA 4C97A 2CPIA 1ZTTA 2DHSA 3Q89A 5FDLA 2ZH8A 2YKMA 3T6BA 1Y4ZB 3AOCA 2OPSA 1FKPA 2MKIA 4EK2A 1NBEB 3RZAA 1I6JA 1GMWD 5HQ8A 1JLBB 2P5VA 3HK2A 2XS7A 2OPPA 4DWIA 1RKJA 1ZM2A 1ZZNA 5LOQA 2DISA 2MPUA 3FC9A 4Z7CA 3HSDA 4B3SJ 4GVBA 2AHOB 1IXKA 1PYTA 3ZTRA 3FCWA 4FPIA 1U25A 1B99A 3LO3A 2GAHC 5CYQA 3MMBA 3MAAB 2HLTA 3HSZA 1KC8T 2IDLA 2V0NA 3NS7B 4QIVA 4DZDA 1FJCA 4EMDA 3O3LA 5IOLA 4A46A 2AJ2A 1RUSA 2W2PP 4KE5A 3KLIB 1K0VA 5J2QA 1UKUA 2K1RA 1RK8A 1WKKA 2YWGA 2B8PA 1PC5A 3K5NA 2OSQA 1JJCB 1GXUA 3R5JB 1UJ5A 3OR1A 1X0PA 3BKUA 3MDFA 4Q7AA 4FKXA 2ZHBA 1D9DA 1DTTA 1JLCA 3BO4A 4LF7J 2F1FA 2RS8A 1WTFA 2Z58B 1SJFA 3C15B 4I67A 1X4GA 3IWNC 1NHVA 2W9BA 4A8OA 4DSLA 3D2WA 2I9SA 3IR6B 3OJSA 5H9FK 2ACMA 4AL6A 5IXUA 1S9GA 1D8ZA 2NXCA 2YXLA 4X4RA 3FBFA 1PAEX 2CPDA 4PCQA 2QLBB 2FJVA 3D5MA 2BOAA 4OL8A 2V2KA 1BMQB 3HZEA 1B70B 1IKWA 4DF4A 3ENQA 1XNRJ 2BJ1A 3W9IA 4OI3A 2LU1A 3O5TB 4RBUA 3CIZA 5C25A 1U0SA 4LVNP 3DHXA 1LWEB 3JQMA 4NMLA 5A2QU 3KK3B 4DOZA 3K58A 3ISNC 2YPZA 2CVEA 5J2MB 4HYKA 4FYXB 5KOXA 3MECA 3EM1A 1SC4B 4U6PA 5D0RA 3MWBA 4AQYJ 1TKZB 1NH7A 4GKKF 4WKRA 4A48A 4Q43A 3R5GA 5A8WA 1LWCA 2RE1A 4ILRA 2XQCA 3T5JA 4RU9A 4TU7A 4JI6F 3PDNA 3WC0A 4ZN3A 1VIOA 2AMCB 4IFYB 1S4FA 1IR0A 1G2EA 2V8PA 2DNZA 3MTKA 3I9V9 2ZBCA 2ZBPA 2KTQA 2RIJA 2VFUA 1TUWA 1YIJS 4LRCA 3NCQA 4N5SA 2BZ2A 1RTIB 4RW9A 2ZUAA 3KG4A 5DDPC 1FI4A 4PQAA 4WFBQ 2B56A 2J0WA 3UR0A 1E6VA 4ETZA 4ZVOB 4CQ1A 2K3IA 3MMCB 1MW7A 5HMZA 4USJC 1H38A 4CYUA 1YJUA 2N4CA 4FBTA 2BXJA 4NZ6A 1S76D 3IRXA 3WX8A 3CCTA 3QWUA 4DV5J 7AT1B 4QW8A 3DRSA 5E3PA 3OTOJ 3DOMB 2BUNA 2YTCA 2UUBJ 3KLFB 1B0VA 1G6BA 4R8UB 4DV7J 2BMBA 3GSDA 3M05A 3RRKA 1T7PA 2X1GA 5HP1B 2DNQA 3R7BB 3CCQS 1HI1A 3HULA 4ZVGA 2EBEA 5F9NA 3EDQB 3F0NA 1DJ0A 1K8AT 3KMQA 1Z2LA 3QRQA 3PO5A 1OMSA 1HQUB 5JMNA 4JOUA 4QR2A 3TZYA 4B02A 2VICA 2XMUA 1RLDA 2Z2LA 3T5LA 3AJDA 2DEJA 4TLRA 3HP6A 1WNEA 4O0IA 4F67A 5L39A 2A2DA 2JLGA 3IRWP 2RF2B 4PG4A 2XYHB 1IBCB 1ZS6A 3JTNA 2LEBA 1TR0A 1S1WB 3SMZA 1FFSB 4OFZA 3HHLD 5IT0A 5IM0B 3I55S 2B4VA 4ICLB 5HROB 2IIHA 4WKYA 3OL8A 4IRCA 4J9QA 2XEXA 4IH6A 5DZ7A 5ETQA 2EVZA 2JLEA 3D6TB 5ETKA 1VK3A 1E6YB 2E44A 4FYYB 4J91A 2OLWA 1NK9A 1P9YA 1V3SA 2YX7A 1U0HA 3NKYA 1WOPA 1S7HA 2X1BA 2IYGA 1UAWA 1LK7A 3PYEA 2JVOA 1IN0A 3CF5Q 2G9OA 2IJFA 3NNAA 3CCJS 1LEOA 4K59A 5B0EA 2DY1A 5KT3A 2KDOA 2ZH4A 1N34F 4C0BA 2MQNA 3EGVA 2R2SA 2ZH2A 4HACA 3KHHA 3R97A 4YR2A 2XMVA 3IR5B 4OI6A 1CJTA 4IR1A 3H42A 1HNZF 2R8JA 2NZCA 5KFJA 4RNHA 1F3FA 3IGNA 6FD1A 1KTVA 1RTHA 4P6QA 4ECSA 1DQ8A 1QAIA 3FSXA 2Z0GA 5G4DA 2F8EX 1S4EA 1SJRA 4ED2A 2JEIA 1VQNS 2V5HG 2R8GA 2AIRB 1QDUB 2X51A 5FLXU 2XNQA 2Z57B 1JJHA 2MMYA 3KJNB 2AW0A 5E7OB 3KK2B 4N7TA 2QA2A 1XMOJ 3PRBA 5T7LA 5I3QA 3KXDA 1RCOB 2WBRA 3GYXB 1SV5B 3L09A 4ILLA 2M4MA 2QLWA 4Q2LA 4LIRA 1SH2A 3KJVB 2ILZA 4M5KA 1XTZA 4G1PA 4X4UA 4ZS6A 1BQMB 3G6VA 4A8XA 2YNIB 1BC6A 1X8DA 3RUBL 4DL5A 1UVMA 1CVJA 3MR6A 2YNGA 1CJUB 1NU4A 3OV7A 4DPXA 1X5SA 2KXFA 4M5HA 2VB6A 2PC6A 2VC1A 2RQMA 4BWMA 2ALYB 2YH1A 1CPZA 1DAXA 3K5OA 2W24A 4BC7A 2AZ3A 2P8IA 5GAEU 2DH9A 1GTEA 2Y1RI 4Q5VA 1Z4UA 1I94F 3V6JA 2KZZA 1U02A 3HVTA 1RE1B 4GKKJ 5ETPA 4RNMA 3D66A 4OZJA 3NG8A 5KFFA 2PA8D 2OSRA 3MM7B 4EUVA 1RT2A 4JI6J 3JSMB 1B7YB 2FJWA 3O2IA 3FNNA 3IFEA 1S1TB 4TU9A 5L1IA 2VOPA 1X60A 4KR0B 2E29A 3FK4A 3SBMA 2DO4A 1X4AA 4TYBA 1WC1A 5K20B 2HK2A 2MKSA 4ZHRB 1REVB 4G1IA 2R7WA 3DLKA 4FNIA 4U8VA 1SUQA 3HDSA 4QWCA 2H4YB 4C7QA 3PYFA 1WI6A 1CG2A 3F56A 1FDBA 3H7HB 4C0OC 2UUTA 1SB6A 4BCAA 2XYPB 4Q2MA 2XULA 5B09A 3EJMA 2VDIA 4RLEA 3MUTP 4XO0A 2AEMA 4YUDA 3W8GA 4LIWA 1YSJA 5B08A 5JJBA 3BH6B 2XLJA 1T9YA 4XTTA 3Q23A 4DUYF 2DTJA 4Y2KA 2MQLA 4M63A 3VWSA 1FO1A 7FDRA 5C2GA 4DFKA 2BE9B 3EGZA 4NYPA 5AE2A 5I3UA 1UTAA 5K8PA 1C1BB 3NWGA 3GP9A 3ZZ0A 2ZEJA 3EUNA 2HS4A 4DSJA 4WYLA 5DO2A 1U1RA 1TKTB 2ZVSA 5IQ6A 3G4SS 1YBUA 4OJ1A 4WP8A 3CXCR 2E5IA 1Z2ZA 2FVQA 3KTQA 2KL8A 3QT8A 2DGSA 3A8IA 1PYSB 4KFBA 2FC8A 3IMQJ 3CCZA 4QJVA 4Y2CA 1FRMA 5MLCV 3N79A 4CI0B 2VBZA 2W2OP 2DNOA 3LF0A 1X9WA 3FMBA 4ED4A 1KBRA 2MGZB 1ZPVA 3DOKB 4CH1A 1NK4A 3D1HA 4UQTA 2B4OA 3MR7A 1TMMA 2C1EB 2D74B 3Q22A 4M8LA 4DPTA 1JWWA 3ONQA 1FVSA 3RBZA 1TL3B 4QYRA 2A18A 2HQFA 1N34J 2GIQA 2MY8A 3O1LA 1SC1B 4IFYA 2XO7A 2ZH9A 3PR5B 1Q8BA 3G6YA 2MZSA 1S0OA 1RXOB 4I0WA 2MHEA 3ILJA 4JI4F 4F7VA 3JQKA 4B3TF 1K1SA 3VVTA 1RTIA 1Y5IB 1IKVB 4DX8H 2M5YA 2QN6B 1OIAA 4WJBA 4ETXA 3N6NA 2XG8A 3MMCA 3G2XA 1FD8A 2GVZB 2YWHA 3LGMA 1JXVA 2MLYA 4OLOA 2J8SA 4OX8A 2HAFA 4X4TA 2FHMA 1N5TA 3M6WA 4UW2A 4ECTA 5F8NA 3RRGA 2RRAA 2ZJRQ 1GMUA 3NNHA 2XMKA 1H2VZ 1IUJA 4F04B 1U1MA 3OVBA 1IWAA 1W2IA 3KLFA 1F2HA 3M32B 4R8UA 2VPWB 2Y9HA 1KWMA 3AA8A 2KHCA 3QIDA 3ZFVA 2WB4A 5HP1A 2M88A 2DCLA 3QFWA 5L46A 4F4YA 1IR2A 3HFZB 4IQXA 3TYTA 4ED8A 5IV4A 1ITPA 4AUKA 1L3KA 1HR0J 1OPZA 1FJ7A 3SIPB 2NXNA 2HHVA 2WBMA 4F0MA 3S7RA 1HD0A 2Z30B 2BVZA 1HQUA 1HLWA 3CMQA 2A2CA 4DCPB 3DLBA 4H4KA 4F4AA 3HKZD 1L3VA 4ZP9A 2R7VA 1H2UX 2BRLA 4IR9A 3H0PA 3KUGA 4DX7A 5K8NA 1XJWB 3CD7A 1IJFB 1KS2A 4HLBA 2HHPA 8AT1B 3FBEA 3D0GE 1RBLA 2KT3A 3CCUS 1OQ6A 2CNNB 1N5QA 1J5OA 4Y2IA 5IM0A 1PC4A 4U95A 4ICLA 1JQGA 1YZ7A 4CCHA 3MAQA 1FERA 3UVJB 4CM2A 2XYGB 4NA3A 1LOUA 3CD0A 1JLGB 4DSEA 3GZ7A 3O8WA 1D8YA 5A8RA 1LWFB 2MKYA 4TKTA 1VQ7S 1BLUA 1E6YA 2CPEA 2ZD1B 5D8HB 3AXMA 3M2VB 1NSQA 2HHWA 3RYLA 3M8PB 4DLEA 1B64A 4YDDB 1NB7A 2DGUA 3FMWA 4PQUB 4P10A 1WHXA 1S6QA 4FN5A 4DQPA 1AW0A 1BY9A 3J7A1 4QU6A 2DHXA 2K2PA 1B7FA 1Q16B 2OKQA 4WPAA 5IQQA 2YKOA 5KFDA 3EZOA 2WONB 4O4GB 2GC8A 1M5KC 1JLEA 3D4JA 1DBDA 1UFLA 1M1KT 4PRFA 2C22A 2V8DA 2VUGA 2AX0A 4LJMA 1V9OA 1JX4A 4OI4A 1NZ8A 3GFYA 1TL5A 1DY3A 4P9SA 1FNMA 2PN6A 4PG6A 1RT1B 1N4LA 5CH7B 2N7CA 1CULB 1D9FA 1NSPA 4MAKA 3B82A 1KQGB 4YB7A 1SH0A 4GMKA 4YB6A 5K14A 1RCXB 3E3XA 2N3OA 1UL3A 3FGVA 1VRUB 4CZCA 2KRBA 2QX0A 5HI7A 1SV5A 3EVOA 1WWHA 2C3PA 2ZE2A 1VC5A 2RNEA 2P9GA 4A8SA 4N76A 3LW5C 3RBDA 4DFJA 5EX0A 3HHNB 4G3IA 2LLZA 2B6AA 3W62A 2UXDF 3H5SA 4DX5A 5C2CA 2ZH1A 3GIIA 1C4AA 2BR0A 2H5IB 1RT4B 3DDNA 2AJQA 3C8YA 3RBEA 2CG8A 4KHPJ 2HNDA 5KFIA 2YKAA 4IUFA 3J7AN 2MZ1A 2C2DA 4L74A
chains in the Genus database with same CATH topology
1JLFA 1CC7A 3AQOA 1YWXA 4WFXA 5I3UB 2RKIA 3Q24A 1FJEB 3MMAA 3QGGA 4U9RA 4URGA 3IR7B 3H5YA 3HHEA 3PM9A 1X9MA 1N0VC 2UV8A 4H4OB 2VQEF 2HHQA 2AV5A 2B43A 4NLGA 1FDNA 2VKRA 2KM8B 2VKZG 4QBUA 4Q8EA 1N5YB 2QA4S 1FNOA 4DL0C 2ZZMA 4C98A 1EP4A 3CDWA 2L9WA 3TO8A 1IBLF 5M2UA 5KFGA 4IDKA 2ZH3A 1HPZA 1HWJA 4TNOA 3PV8A 2R7QA 3UD4P 4I69A 4QWDA 2E1AA 4DV1F 3NMRA 3EZUA 3PKMA 4IG3A 3KLGA 5D3GA 3H2UB 1S0NA 4OX6A 2J6UA 3KHRA 4AL7A 4ECQA 1K9MT 3KLIA 4B9VA 1J2VA 4Y0FA 5EHHA 2E5LF 3CJ2A 2D3UA 3QGPA 2PI5A 3O6QA 2D1CA 1RDRA 2UU9F 1TL4A 3VAIA 4ES3A 1P1LA 3TI0A 4MKYA 2IMOA 1ROFA 1VRTA 2HHHF 3QYYA 1U49A 1U8SA 5DLGA 5A6PA 3H59A 2AQ4A 1UJ6A 4J9PA 3CC4S 1S0VA 4DF8A 2ERRA 2NPFA 1F9FA 3GFXA 4E98A 3KLEA 2FJDB 4KFBB 2XGPA 5KFTA 1RT3A 1T3OA 3BQ2A 3MPVA 5KFSA 1X4CA 1YRTA 4F4ZA 2QEXS 3T3FA 4DV2F 3BGUA 1SXLA 2IM3A 1RGVA 3ENVA 2L9NA 5CCLA 2OPRB 3OTEA 2QA1A 3MAHA 2QZ8A 2I1RA 4KB7A 4N8OA 3CCMS 4E0DA 4BHQA 3P49B 2B7BB 3K59A 3UE2A 2R2TA 4XK8C 4YQWA 4RU2A 4I6WA 2M8HA 2XWYA 4P7VA 1F5AA 3GIJA 1ZYQA 2I5JB 1O8BA 4WZMA 3DCAA 1WF0A 3I0SA 2IVFB 3DRSB 4ZHRA 2RDIA 1N6QA 2RU9A 2XS2A 3Q8SB 4RW8A 2PMHA 3QLHB 1REVA 5JVGQ 2YKNB 4KBIA 3RAMA 4LQ9A 5L8RC 3G6XA 1KRPA 2FGCA 4Y6IA 1WHYA 2JC1A 1DTQA 4R0EA 4K0KF 4B9LA 2NREA 5LJ5Y 1D3WA 4FXVA 3B8HA 3MEGA 1IBKF 2MZRA 4DDFA 4ED7A 2RS2A 4QYZJ 1SKRA 4TXSA 3G71S 3DC2A 1S99A 2HGMA 2A10A 1C0UB 3PEHA 3NP5A 2HYIB 3BZQA 2DB1A 4R25A 3IAS9 4CO4A 3Q0AA 3FZBA 2W8KA 5KFVA 1R27B 1AUDA 4TU8A 1DZ5A 2M52A 2C3UA 1AFJA 4OZ5A 2M2BA 3UD3P 3DRRB 2FHOB 2Y1IA 5KT4A 2KVIA 2YQ3A 2YNFB 1LV5A 3GIKA 4FF1A 2HFOA 3SFUA 4KHPF 3QIPB 3FVYA 2IJNA 1FF2A 4JBCA 2HG4A 3BSAA 1HHTP 2MZTA 4I2QA 2FLLA 2DGVA 2CZ4A 3NS5A 3TX8A 1BQNA 1XR6A 2DD8S 2DJWA 5CA5A 4KIAA 1R43A 2Q79A 3MEKA 5LMNF 4F2RA 1R31A 1RTJB 4ITSA 1M5HA 3TA2A 4Y65A 4F3QA 5AE1A 2FIUA 5AXNA 5C24A 5DQHA 4U7CA 4BDPA 3MEDA 1GH8A 1KFDA 3LUYA 1LWEA 5T14A 3KK3A 3RAXA 2FD2A 1HBOB 2ALZA 1RT6B 4NL5A 2CPXA 2CQ4A 3CT9A 1NK0A 5LL6d 2KH9A 4CH7A 1S1VA 5J2MA 1N36F 2L3MA 3QJLA 1TQLA 2QMWA 2UVVA 1TKXB 1WHWA 3IWXA 5F3TA 2ZH7A 4FXDA 2BANA 1FRLA 4TLQA 3RR7A 3CD6S 1R8CA 4HH1A 1NJWA 1FT8A 3SCKE 1OSCA 2HWTA 2LQ9A 3FDSA 3JSRA 3MM9A 1U1NA 2NR0A 3J7YI 2VD3A 1TKZA 4OHWA 2EC0A 5CYJA 3HT3A 2MSTA 4R0JA 1LXJA 4ZPAA 2HFZA 1KQFB 5E3AA 5LSOA 4JI5F 2AU0A 2F9DA 5DETA 4BS2A 1WG5A 5H9FJ 1XNRF 3U02A 5F3ZA 3H4DA 3H4BA 3I82A 4KTQA 5HN0A 4M5DA 4ZP7A 1HYSA 3MF5A 2HHUA 3K2YA 4M94A 3OHAA 3M1VA 2UUWA 2ADBA 1NKBA 4MKAA 3M2UB 4RWXA 4QQBA 4RUAA 5D6GA 1T8EA 1JLAA 2HRUA 3IGVA 4I64A 4LVOP 1U45A 2HWHA 2DITA 4DL7A 3MPWA 1UWBB 2GQQA 2VG7A 4NLVA 5KFNA 4YFUA 1TK8A 3CC2S 1ZTWA 2CQ1A 3N9UC 1QJHA 5SUHA 3D28A 5B0CA 4JYAF 4ID5B 4NWBA 4DL6A 2BJDA 2HQIA 4IH7A 1NK5A 1RI7A 2UVWA 4J5OA 2D3ZA 3MR3A 4ECYA 4K4ZA 2XMJA 1TKTA 3OUYA 2YKPA 3OW2R 4FVCA 3SV3A 2LEPA 3PHEA 5E3QA 3HHKA 4B08A 5KFBA 2V8VA 4N56A 2I2YA 4N41A 4MKBA 5LXRA 1QAYA 3VQTA 3MEEA 3M6UA 2EBGA 3H98A 4AQYF 2BM0A 2ZUGA 3S6EA 4RUCA 2MJUA 2KM8C 2HHSA 2VA2A 2DIVA 2E9RX 5KTQA 4J37A 2GQCA 2KFNA 2PFFB 4DL4A 2LYVA 3K8VA 2XCPA 2XMTA 3MM8B 1X4EA 3LP2A 3JTOA 3Q2TC 1V6HA 2C3OA 1YJWS 5L9XA 2UP1A 2KT2A 2HS0A 4X4NA 4MIBA 3U1LA 2ACYA 2A1BA 5KG0A 3WDOA 3CCSS 2AJ0A 4WIIA 3DM2A 3J80Y 1N88A 3PIPQ 3Q8PB 2VODA 3FEYB 4PWDB 2KU7A 5K8OA 3MM6A 2V4QA 2ZNYA 1SJ3P 1EETA 2V4JA 4DR2F 3IS9A 4JV0A 3BR8A 5CHCB 4XPEA 2IM0A 2VL1A 4TQSA 3PJXA 5IT9Y 3MURP 1R89A 1TK0A 3GWCA 5KT6A 3DOKA 4JV2A 5LMUF 4ES2A 3G8SA 3C6TA 1Y5NB 2DO0A 4XDCA 2DPIA 4RWWA 5THWA 3ISZA 2DNNA 3DOMA 4YY3F 2XLIA 1HNIA 3MGJA 3I5CA 1JB0C 2KJWA 5DG9A 2VC0A 4LFCF 3QAEA 3VALA 4C0HA 4QWEA 4DR3F 2CJ9A 2VG5A 3I96A 2HRYA 3BSNA 1J5OB 2J7KA 3KHLA 2V8HA 2H5EA 3LP0A 2I8EA 5FJ4A 5KFZA 3RB6A 1S6UA 4ZP8A 3TP2A 3CD5A 2DCUB 2V9WA 2B9YA 5F8IA 5IT4A 3UCUP 1SQEA 2C3YA 2J8AA 2E5JA 4CH0S 4D3GA 1TL3A 4B3OB 1HWIA 2B51A 5F8MA 3VZHA 1KHVA 1TUVA 1JKHA 3BJYA 4EGLA 1FD2A 2EG2A 2JFDA 3N28A 4QPXA 1PGZA 2VPXB 2E7WA 3DLJA 4B3MF 2VV5A 5KFRA 1SH3A 2GIRA 4FP9A 3DRXA 4A8WA 5L1LA 1HNWF 4HVZA 4QR0A 3B4MA 4ELUA 3HX9A 1AFIA 1YJRA 5A8RB 4NA2A 1S72S 2DR9A 1VQMS 2PMZD 1YJTA 3X1LB 3RW7A 1N33F 3CDAA 4IOCQ 4DV5F 1XK8A 4ZA1A 1U6FA 1SKWA 3HHDA 2GO9A 3OTOF 3W2WB 4C8ZA 1KN6A 2IRYA 4O44B 2KYZA 3EGNA 2OMLA 3KFWX 2WRMA 1JNZB 2GHVC 2HHXA 3FEXB 3JSYA 3ZZOA 3JAMY 4DV4F 1WTBA 2LQ5A 4V19X 2DH8A 3DU5A 4NA1A 1XWLA 3WBZA 2UUBF 3MMJA 2IC3B 4QIEA 5T41A 5B0AA 3MCSA 2RQ4A 1IKVA 3VAFA 1QVGR 4J9MA 3DLHA 2HGLA 5GAGI 1HQEB 4P2SA 1KQKA 4DV7F 2WCXA 1IM4A 1WEZA 4H4MB 4H54A 5EX3A 2XSJB 2GMLA 3H2VE 3HVAA 1HBMB 2EFQA 2LCWA 2QO3A 2XI2A 5KAKA 1NK6A 3DI6A 2BQUA 1CLFA 3BDPA 2R7UA 1YRXA 2CPJA 2RF2A 4NYZA 4C8NA 5DDRC 3LWMA 1VQ9S 2UZAA 1UW4A 1S6QB 4OZLA 5KFLA 3NAIA 3GV7B 1KD1T 1U7LA 4C8YA 4DN9A 1S1WA 1MSWD 1M5PC 4KPYA 3CDBA 2SXLA 4ZVHA 1UETA 1HNVA 1H7XA 1VQYA 1FXDA 2BE2A 3M8QA 3NRBA 4IOBA 3IAM9 3KLVA 3IG1B 4I2PA 2BV3A 2W9AA 2CRLA 2RJZA 5HROA 1T05A 2ZOMA 2IA0A 2FVRA 3V5RA 3CGIA 3CULA 2MQOA 4DFPA 3N5FA 5E0OA 3HVRA 3NMAA 2CQ3A 3GB0A 4I4BA 4DG1B 3DRPA 1GXTA 3M6VA 3GR1A 2KI2A 1JLEB 5EWFA 4Q0BA 3GFZA 4NLSA 4OQJA 4IG0A 4GO7X 4KV8B 1Y9OA 3J7YU 4ZOSA 3SFGA 4JI0F 1FRXA 4FYDA 2CDQA 2IVMA 3BN4A 3MM5B 1S6PB 2QSFA 3SV4A 2EW9A 3HHLA 2ROGA 4DUZF 2ZC3A 2BACA 2GGPA 4MFBB 1BGXT 2NUUG 2JZ5A 2O01C 5D4PA 4AXJA 4IKAA 2EWHA 2HPUA 1U24A 4HDHA 4MK9A 4U67Q 2Z4PA 2M9KA 1WACA 3RAQA 3RW6A 5IS2A 3NGKA 1HBNA 2E1MC 2JSXA 3BSCA 2MB0B 2B4PA 4PKDB 1FA0A 1VS3A 4KQZA 1FCAA 4XDDA 2PDAA 3CC7S 3US5A 2FUG9 2MZJA 3DNCA 2HMIB 5EWEA 1KFSA 1FDAA 2J0XA 1G7CB 4ZVEA 2LA4A 2L41A 1KLNA 3H5XA 4I7FA 2IFXA 4O4RA 2AYGA 3P3DA 4P7TA 4LFAF 4JUZA 4YR3A 2CQPA 1HHSA 3KKFA 3K8WA 4MYTA 3K57A 4X4PA 4C9DA 2EFVA 3PW4A 4JV5F 2POKA 2VASA 3MTJA 3OXLA 3QMQA 3QWPA 3CUNA 4EO8A 3PW0A 4NLTA 5KFEA 3TNVA 1RP5A 4TYAA 4EBEA 3I56S 1HARA 1FEEA 4ECUA 2VG6B 4WXOA 5K14B 2D9PA 2ZHOA 2W8LA 4DL3A 1FTCA 1WG4A 4RW4A 4FBUA 3RU0A 3SSRA 4KKOA 4RNNA 3BDEA 3MXHP 1F60B 4ZPVR 4YP3A 2W25A 5HO4A 4DR6F 1YVFA 5J2PB 1T03B 3NBPA 1DARA 4FS2A 1MROA 2ZE2B 4C97A 1R7IA 2CPIA 1ZTTA 4UQGA 5KFMA 2VPYB 1VLYA 2DHSA 3OSPA 4B9TA 2VONA 5FDLA 2J9EA 4JI2F 5E33A 2ZH8A 4DV3F 2YKMA 3PX6A 3T6BA 1Y4ZB 1RT5B 2VFRA 2OPSA 1FKPA 3FJ2A 3FSYA 2MKIA 1L5UA 4H4KC 2M70A 3CE8A 1C4CA 3BGRB 5AXMA 5LSRA 3JB9k 1T94A 1JK9B 1VFJA 1FRJA 2B6AB 2E7XA 3RZAA 2EFGA 3HXMA 5L1JA 1I6JA 1YJNS 1H6KX 2F8MA 4CTAA 1L3UA 5HQ8A 5AXKA 1JLBB 2P5VA 2GX8A 4RBTA 3QZ8A 3HK2A 2XS7A 2LDIA 3SEOA 3I4HX 3ITHA 4OLPA 4CIOA 2OPPA 3E51A 4DWIA 1RKJA 1ZM2A 2B3TB 5CZVA 3TVKA 4RUHA 1WEYA 4LSLB 2BYCA 1ZZNA 4ATNA 3O44A 1GAOA 3PR4A 3DLGB 1JLGA 2W4DA 2DISA 3HI9A 2HNDB 5KFCA 2MPUA 3N6MA 2N82B 5DM6Q 2DRAA 2LDYA 1KR4A 4GC7A 2GMHA 3LAMA 1YHQS 3M6XA 1ZM3A 3OQ2A 4B17A 1LWFA 1Y5LB 5ITHA 4MTPA 2WAQD 1O0PA 3IBWA 1RYSA 1MMDA 1NJZA 3AY0A 2JLFA 5J1NA 1IXKA 3TUJC 1BWEA 3K5PA 4DV0F 2R7XA 2IM2A 1U25A 1OQ3A 2PSZA 3HLUA 5EWGA 3PNIA 4WYWA 4XAKA 3KK2A 3SQGB 3LO3A 5CYQA 3MMBA 3PIOQ 1QM9A 2HLTA 3X3UA 4F3MA 2XWXA 5BYQA 5D4OA 1KC8T 2V0NA 1EP4B 3OXGA 2YH0A 2OPQA 1HPZB 3CJ0A 1N54B 3M8PA 4OJHA 4QIVA 1DQAA 2WOMB 3CDUA 5IZHA 1FJCA 1LW0A 3O3LA 3W2VB 3OFFA 4A46A 3KLHB 1O5JA 1CC8A 5D3GB 3LANA 4KE5A 5CD4H 3KLIB 1K0VA 5J2QA 1JNRB 3OL7A 1UKUA 2K1RA 2CIMA 1RK8A 2LKZA 1T3NA 3EXYA 2VFSA 2ATLA 2YWGA 1HFEL 3N0VA 1R0AB 1PC5A 1HNXF 2DBBA 5DS7A 3K5NA 4FS1A 1U26A 2JDJA 1FXLA 2OSQA 1FXRA 1NAQA 3R3TA 2VQFF 2MQMA 4DMZA 3QPIA 1GXUA 3KJVA 3KLEB 1UJ5A 1QUPA 1T95A 4DSKA 3VCDA 3OR1A 2V94A 3DFEA 3GFHA 1X0PA 1OWXA 3MDFA 4Q7AA 1UEUA 2J6SA 2DK2A 4LF6F 2ZHBA 1D9DA 1DTTA 4QZVB 1MWYA 2VOOA 1BQMA 3N4WA 2MY7A 4YEAA 2UVUA 1JLCA 3B78A 3FZ2A 1TV6B 4LMZA 1JXEA 3BO4A 1T02A 2NQPA 1WHVA 1WI8A 2YNIA 2F1FA 2HQ3A 3UCGA 1Q78A 2V9KA 3DMJA 2Q1LA 2WTFA 3RTVA 2RS8A 3BB5A 1WTFA 2RQCA 1M0SA 4K5RA 3I0SB 2P6SA 1SJFA 4I67A 1SL0A 2BM1A 5CYMB 1X4GA 1VQ6S 4RW8B 3IWNC 3GR0A 4GKJF 1NHVA 4B9UA 2W9BA 3BM7A 4A8OA 4DSLA 4WCEQ 2M8DB 2KXNB 1OS5A 3D2WA 1TVRA 2I9SA 3IR6B 3I87A 3MEGB 1KLMA 3OJSA 4AL6A 1HL6A 2ASYA 3T19A 2UVRA 3QZ7A 1YITS 2YNHB 3R5CA 1C0TB 2GV1A 5IXUA 1S9GA 1RT1A 1URRA 2Z8QA 5EDWA 4O3PA 3T9ZA 3OR2A 3VTIA 5DG7A 3DLEB 1AROP 1D8ZA 3KNGA 1VGYA 2WW8A 4X4RA 3R1HA 2MKKA 2CPDA 4PCQA 3QGHA 3QGIA 2FJVA 1VOMA 4KRWA 1W25A 1P8GA 2LXIA 3FRZA 2O66A 3D5MA 3VAGA 4OL8A 3DOLB 2V2KA 2IHR1 3HZEA 1IKWA 4PR6A 4DBQA 4DF4A 2OO4A 3ENQA 4OI3A 2JEJA 4J9SA 3NCRA 2PEHA 3Q8RB 4B3SF 4NCBA 1IJEB 2J0SD 2Y0SD 2J9DA 2LU1A 5A8KA 1G1XA 1FRHA 2FJEB 5F0WA 3KWMA 2AJ1A 4GO5X 3MM7A 4PG7A 3O5TB 4RBUA 3CIZA 5C25A 4RZRA 4LVNP 3JSMA 3MEDB 1U09A 3DHXA 1KHWA 1LWEB 4NMLA 4KO0A 3KK3B 1JLQB 1VHFA 2LQJA 1U4BA 1S1TA 2CFXA 2YWFA 5KG1A 4DOZA 1C1CA 3K58A 1N0UA 3ISNC 2ZOFA 1PSDA 1X4DA 3ICLA 3JTPA 3V81A 5SZTA 4JI1F 3R5AA 2R8IA 2CVEA 1S1VB 5J2MB 4HYKA 4ZVFA 4CNZA