3QJLA

One ramp protein binding different rna substrates
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
HMRIEVKLLPLKDNPILPFNYNYEVYSQILEKVNSIEPTIAKLLSSPHGFWTFSRIIVRKRKILPDKGIEILSDDVSLYISSSNEDIIRAIAEAVEKSPEFKIGELSFLVGDIKAIKVKELGKENVFSTLSPIVVRTVKFEGNKLRHWDLYPHDELFMDRLRKVMILRYSEVMGETPKDRDFTIEVLKFKPTRLMVGSSYIRGSLMVFRYAGSEEIARFGYENGFGEKTGLGFGMVKLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cooperative and Specific Binding of a RAMP Protein to Single-stranded CRISPR Repeat RNA
rcsb
source organism Pyrococcus horikoshii
molecule tags Immune system/rna
molecule keywords Putative uncharacterized protein PH0350
total genus 63
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01881 Cas_Cas6 CRISPR associated protein Cas6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qjlA01
3.30.70.1900 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qjlA02
3QJJA 4C9DA 3ZFVA 4ILMA 3I4HX 3PKMA 4C8YA 4C98A 3UFCX 3QJLA 3QJPA 4ILRA 4C97A 4C8ZA 4ILLA
chains in the Genus database with same CATH superfamily
2VJVA 2RSQA 2HHQA 2OEMA 3DCAA 3MMCB 4DFMA 1ZH5A 3V2UC 1LK7A 2HQGA 3HZEA 2MLYA 1LW0A 2N4CA 2VZ9A 2RUSA 2CQ3A 1Q95G 4BHQA 5DM7Q 3KLFA 4LRCA 1RKJA 3DN9A 3IGNA 5D8HB 4JB8B 4XK8C 2G1HA 1TK8A 3OJUA 4QYZJ 1CC8A 5F8JA 2GQ2A 2XYHB 1LWFA 5CYMA 4DL0C 4ZVOB 5HAOA 1HWLA 2OLWA 4S0MA 1M5VC 3D6HB 1RB0A 2EW9A 5KOXA 1GMVA 4FVMA 2CJKA 2PN6A 4B3TJ 1V5VA 4G1PA 2Z2ZA 1VQ5S 1RAOA 1U2CA 1Y3JA 2QO3A 3AY0A 3CMQA 4BC9A 4DPXA 3VAGA 3M2UB 1TQLA 1S9FA 3EGZA 4RW8A 2YNGA 5BJRA 2HFSA 2ZH1A 1IBLF 3QLHB 2IVMA 1FXDA 3HSZA 2B6AB 4ECXA 1RT3A 4LF8F 1WF1A 2LDIA 2V68A 3H59A 1LWCB 4UUXA 4UUWA 2IBKA 1URNA 1Q8KA 3BSCA 4OYOA 2OFHX 3UR0A 3KK1B 4O3RA 4O44B 4NYPA 1ZBTA 5D4PA 1RU1A 2CNNB 4NEZA 5KFPA 1HL6A 3L3CA 3ZZZA 3R5DA 4Q8EA 2ZD1A 1R43A 2RJZA 3ZZUA 5KFFA 3U02A 2W8KA 1N5QA 1VRUB 3EZ5A 2GHWA 1B4SA 3A12A 3W1YC 3QZ7A 1Y9OA 1AROP 2AGPA 1Q5YA 3FEXB 2MQLA 3CJ2A 3NS7B 3O3LA 3HM9A 2C2NA 1FF2A 1SUQB 1VIOA 4DSEA 4ZLNA 4ATNA 4AL7A 1CULB 2FHKA 1R8AA 4CTAB 5IZHA 3ZZTA 2MGZA 1KOHA 1NXIA 4DFJA 1BQNA 2F63A 2KVIA 3C6UA 2YKNA 4MFBA 3OL8A 3QSYB 3ZTRA 1GMWD 2RF2B 3H25A 3PDNA 5L46A 2B4UA 2HIQA 2NPIA 2DCLA 2AJFE 2UUTA 2DGTA 4H54A 2ZEJA 1CS4A 5F0UA 1JLEB 5KFUA 2E9RX 2M8HA 1FKPA 3AB2B 1FKPB 3W2WB 3X3UA 3O8WA 4GKJF 1CJVB 1U0HB 2W2NP 5KFOA 4MJKA 4JI4F 1FEEA 1FDAA 2ZOFA 2W9CA 1HQEB 1X5SA 4JYAF 2GZOA 3VWSA 4RO0A 3VGSA 2Q43A 5KT7A 5ETKA 2QL5B 2U1AA 4BWJA 4F02A 2LA4A 1KBRA 5CYQA 4DHVA 2FHJD 5J2MB 1TK0A 5M2UA 4TXSA 3BBCA 2YKPA 3BM7A 4OHXA 4ITSA 3SFUA 4ECWA 2ZHBA 5IT0A 2HNZA 1C1CB 5KFWA 2QL9B 1CJTA 2ZD1B 3MTKA 1GTHA 1VR6A 2KJWA 1OQ3A 4I6WA 3CT9A 4R5PA 3AQOA 3KMSA 3T1HF 3C66A 4DN9A 3LW5C 1HBOB 4LR7A 3SDEB 5KFNA 2ZH7A 2ZOGA 3ITHA 2A2DA 1SC1B 1CSJA 2Z8QA 4HVZA 4WXOA 1SJ4P 4I6AA 2XWXA 4CQ1A 1TKDA 3IC1A 3QO9B 4AE5A 4DQQA 5C25A 3Q8SB 3P6YC 2ZVSA 1SL0A 1RWOB 1FNXH 1AT1B 4OJHA 2AF6A 2UUCF 2YQ1A 4NXNJ 4K4UA 2K1RA 2MQ8A 3EVMA 2K1RB 2IMWP 5HSPA 2JH3A 3VR1A 3A8KA 3THPA 2XO6A 5HLFB 1WC4A 3MEEB 4B3RJ 1BY9A 1S1VA 4O3NA 1G1XA 3IWLA 4FKXA 1SQFA 4NXMJ 3GFYA 2DHAA 2H5JB 5L1JA 4JI7J 2M9KA 5E7OB 3BS9A 1IBLJ 1GH8A 1ZM4A 1RWKB 1VS3A 5T14A 4RU9A 1HBUA 2RDIA 4ZP9A 1RT4B 4X65J 2AGOA 2UVVA 2PI5A 1GXUA 1FRXA 3GLJA 1Z2ZA 1N8RT 1PYTA 4LRBA 4PXDA 5ADZA 1DARA 2ACMA 4OZ0A 2P5VA 3W5XA 4NCAA 2KU7A 3IBFB 4J90A 4A8XA 1PBUA 4Y6IA 1FI4A 2I0XA 4MKBA 4BS2A 1QAXA 2YQ0A 4QPXA 1F0XA 3LALA 4XPCA 4X4UA 4B3RF 3W2VB 3HFVA 4NA2A 2XSJB 1VQKS 3QIDA 1VJQA 3BSOA 4ZP7A 4DSIA 1VOMA 3D7SB 1TUGB 1RWUA 3A3PB 4ECRA 5HROA 4FPRA 2HZAA 1LK5A 4OZ5A 5K8MA 3I9ZA 2VG6B 3MI7X 2DHGA 5HATA 3HVWA 4IOCQ 2BJ7A 2V0NA 3PM9A 4G1QB 4QJVA 5CD4A 1RTDA 4DR7J 2MLZA 3CIZA 3JS9A 3KJNB 2B8PA 4GKKF 3C15A 2VQFJ 3BO3A 1B0PA 1RAIB 3J7A1 5LT5A 1TR0A 4EZ6A 2FHOB 2HNDB 3TUIC 4QIEA 1LW2A 3MCSA 4KAIA 8AT1B 1TVRB 4RU2A 1HMVB 1QE1A 3GCWP 3QIPA 3EXYA 1DLOB 2HYIB 4N41A 1N32J 4LF6F 4ALZA 4JBCA 4P73A 1ZETA 2V34A 1QAIA 2IC3B 1Y3KA 5ETSA 4O44A 4F26A 1TUVA 1G6BA 5C7PA 1YHQS 1SVDA 2UU9F 2LXIA 2HBZB 3KLIA 4IFYA 2RH3A 2D3ZA 2ZM6F 1CJUA 1QUVA 2YNHA 3UR3C 4ZLPA 4DQRA 3OSNA 2ZH3A 5GAGU 1VQ9S 4K4ZA 2ZOMA 5J1PA 4TQSA 1FKOA 4BBYA 3EZOA 3FMBA 2GC8A 4U96A 5L9XA 1K73T 3QBCA 2Z58B 2GHPA 2Z30B 1P1LA 3M30B 2PEHA 3UW1A 2P2CB 3NCQA 3BR8A 5KT3A 2B5JB 2ZHOA 2B7BB 4XDCA 4DPOA 1UVKA 3AT1B 3DU5A 2WHOA 4FPIA 5I3UA 4E0DA 3QT6A 3NGDA 3VTIA 3P8BB 4IRKA 3Q22A 2HHTA 4X4RA 1SCJB 1QAJA 4DR6F 4L75A 3SSQA 2YNIA 1NDCA 4HYKA 1IBMF 2GJ2A 3ISZA 2ZH4A 1U6BA 2ZH5A 3QJPA 2AX0A 1AUSL 3DOKA 4MK9A 3G6XA 3CC7S 5E3QA 1K9MT 3J7YU 4KO0B 4CZCA 4ZP8A 4DQPA 2BRKA 2HAFA 3NNCA 1DHMA 2FLNA 2AW0A 4ECTA 1Q82T 1RCXB 2BE2B 3BKFA 3OFHA 4NLGA 1EB0A 3PIOQ 4IFVA 1JLAA 4NCGA 1XMBA 1FHTA 4EEYA 3P5TL 3RB0A 3KJFB 3CW2C 5U47A 1HWKA 3W8GA 5GAEU 2O1PA 3IBWA 2E7XA 4OYAA 4IR1A 2D7SA 1FA0A 4NZ6A 3V4IB 5J2NB 2MKKA 2YWWA 3LP0B 3H5YA 2UU9J 3AD8C 3CCZA 3AQPA 2LEBA 3GTYX 3QYYA 5B0DA 3Q24A 1WACA 3F44A 2AJ0A 4K8RA 3I4HX 4KKOA 2BE7D 1UWAA 4J9OA 1CPZA 2DPJA 4DZDA 1LWXA 1R3NA 2GIFA 3D1OA 1REGX 4YDXA 2ZC4A 4JI2J 1HQ2A 4QQBA 1VRTB 2ZJRQ 3MM9A 3BSAA 3Q86A 4FYXB 1KFSA 2JJ4D 3NGUA 3IS9A 2V63A 4P2MA 1S0OA 4O4GA 3H2VE 3TYTA 5HK4A 4JI1J 4LFAF 1HW9A 2DGWA 1FRJA 2VH7A 3FCWA 3QLHA 4WFZA 1KQKA 4TU9A 2YPYA 2OPRB 1L3VA 2OEJA 4H4OB 2KXHA 4K2XA 1JJHA 5AXLA 2YWFA 2W4DA 1QLNA 2PI4A 2NZ4A 1RT6A 1X5PA 2VHGA 3PR4A 2PIIA 3JYTB 2P8IA 1V6HA 1RABB 2F8EX 1EKRA 4TLRA 1FTRA 3E01A 2IRXA 1CJKA 2NYIA 4ELVA 3B78A 3GMGA 3N79A 2AYGA 3HHKA 2VFRA 3JQJA 3PCOB 4L3KA 2WAQD 3QWUA 1RKIA 2W9BA 1K0VA 3AXMA 1DQAA 5K14B 3ZZOA 3IM9A 2HQCA 4HHUA 2QV6A 2Q6BA 2R2SA 4MIBA 4FF3A 3ZFVA 2JWNA 2WBMA 1LFWA 2WW8A 2ZFHA 3POTB 4NI2B 4ZPWR 2EFOA 3G9CA 3P4UB 3QGHA 4M5IA 1X4FA 2PE8A 2E1PA 4K4XA 3BN7A 1NLKL 1QTMA 3I0SB 1HW8A 3BYPA 4URQU 5KT2A 1BD6A 1WC3A 1HR0F 1NCLA 5K9FA 1AFJA 3C19A 1SJ3P 3NL0A 1KLNA 2AEJA 1EX8A 3NKYA 1RBLA 1O6XA 4ZPDA 2P6SA 5AXMA 2ADBA 1S1VB 3TQEA 2VQEF 3J80Y 1FRLA 3I5AA 1VGYA 1YZ6A 2MEWA 3CCJS 3FSIA 1D8ZA 4OJ3A 1L3TA 4DUTA 2J6SA 5HVGA 2IMOA 5L1KA 1G7CB 1IWGA 2CPJA 4LF1A 4TY8A 4C98A 1N56A 1S97A 1T7PA 1YKWA 1SH0A 3DKDA 2BM1A 2QC3A 3QFHA 2YNHB 5F41A 3THVA 1Q7YT 1JXEA 3UDCA 3AD7C 2Q3PA 3H7HB 5IOLA 3JYTA 1NJYA 2PC6A 2DPIA 1J2VA 1Y5LB 4DJBA 4FF4A 1U26A 1OWXA 1DJ0A 1OPZA 4RNMA 4HKQA 5KOWA 2LXUA 4LF4F 1FDBA 1WD6A 2J9EA 2KG0A 3GIMA 4GRSA 4DV0F 4U6PA 2UUAF 4R5PB 3G71S 4DX8H 3GIRA 1NJZA 1RTJA 1T9TA 1TAQA 3CD7A 4DLEA 1KSPA 4OYZA 1XBWA 4JI5J 2Y0BB 3CD5A 3CULA 3DM2B 2PMZD 2QN6B 4X4SA 1R31A 1UW4A 1LNQA 3RRHA 3NOGA 1FESA 5GAEI 1DTQA 3HDSA 2XSJA 3TOQA 1H38A 4B3OB 1OY9A 1VMBA 2A2CA 2XYGB 2C3PA 5KAKA 1TUWA 4MH8A 2QMUB 1S9GB 4DX7A 1H7WA 3FBEA 4U7UK 2VFTA 1S9EA 5ETRA 4M5LA 1XN9A 4CO1A 3DYAA 4F8RA 1RA7A 2J5AA 2ZUAA 5L39A 2FJVA 3NWGA 4PG5A 3K58A 4JI0F 2IJFA 5LM7E 5JJBA 3BQ0A 2C3MA 4KBIA 3FZ2A 3NP5A 4CWBA 4EI2A 1J5EJ 1MWYA 1NPRA 4IOAQ 3VHQA 3JSMB 1NO8A 1S76D 4IFVB 4NCGB 4NLWA 1N48A 1SKRA 1SI9A 2E7WA 2X1FA 5F8LA 3KYLA 4RJVA 4OHYA 5LXRA 4RR5A 2Z2YB 3F56A 3G4SS 4KIAA 1N5TA 3MGJA 3IP0A 3D1QA 4KE5A 4UQTA 1KRPA 2XMUA 2HLUA 1FFWB 3FC9A 3N4WA 4UOHA 4URGA 3MUMP 1K8AT 2AYBA 3KG1A 1I3OB 4NLVA 1IBKF 1X0PA 1TAUA 2HNYA 4WJBA 4AT1B 4CLFA 1SJRA 2DCUB 4Q5VA 5HI7A 1N32F 1H72C 3G86A 3AOCA 5A6WA 2DNOA 1URRA 3RJMB 5MLCV 2R7WA 2CQ1A 2HFOA 3AFGA 5IC6B 4C48A 3W9IA 2YX1A 1TK5A 3DC2A 2FIUA 3PVXA 2X51A 2XMKA 3M6VA 3DOKB 3CD0A 3W2VA 2RDDA 4EBEA 1X31C 2VG6A 2W25A 3H0PA 4CT9A 1HBMA 4I2QA 3MD1A 4PYDA 2Z2LA 2OIHA 3MPUB 1OY6A 1PJ7A 2D3UA 4MKVA 1U1NA 2CDQA 2OPSB 4OL8A 2O67A 4LR8A 3KJVA 4A8WA 1N5YB 2GFFA 4LSNB 1TZ0A 3D68A 3ZTOA 4JI0J 4LSNA 4PKDB 4Z2XA 4WXWA 3OVAA 4DR5J 1WDTA 2W9AA 3VGUA 1K1SA 4JUZA 3GIJA 4IO9Q 5EX0A 2MZQA 2H3EB 1N52B 4JYAJ 2NXEA 3HHLA 1FEHA 2HWTA 4PYAA 4QBUA 3FEZA 4LIRA 1ZPWX 1S1XB 4RX6A 5A2QU 5CD4H 2ZZTA 1WWHA 2FVCA 2MZSA 2IYIA 1TKTB 4Q43A 1X4BA 1U8WA 1S79A 2XZWA 2ZBPA 2WOMA 2ZJPQ 1A0OB 4A48A 1VRTA 2B4PA 4IFYB 5AT1B 1MG7A 4QOTA 3DLKA 3TA0A 4NRTA 1EIYB 4IG0A 1TKTA 4IG0B 3K5OA 4L3NA 3J81j 3JB9k 3RBZA 3SI8A 5A8WB 4PUOA 3J81U 3VQSA 2CPFA 1KOOA 4USKA 3LP0A 5GMEA 4K4VA 3DLGA 2KB2A 4WWSA 5C5JA 2A0FB 2VICA 2QFJA 1U0SA 1FX2A 3CJTA 3R7SB 2WCXA 1PKUA 3EICA 3LANA 3CC2S 3J7ZT 1EQMA 5CH7B 1R27B 2BRLA 2ALZA 1F60B 1XTZA 1LWFB 2UXCJ 8ATCB 2UXDJ 3FK4A 1PBAA 2AQ4A 5KFMA 2DTJA 4ZVTB 5I42A 1CG2A 3CJ8A 1CJVA 1U0HA 1MN7A 5EGYA 5F9NA 1FNMA 2OO4A 3C46A 2VDHA 3A3OB 3OQ2A 4LQ9A 1QJHA 2DD8S 2DNRA 1N33F 2HQFA 2BQ3A 2FLLA 3C6TA 4DR2J 2F8HA 3TQ1A 1WEXA 2E5LF 4F2SA 1S1WA 2HNZB 3FVYA 3IGVA 1Q5VA 4HLBA 3PX6A 4KHMA 2MQNA 2N3LA 4LRFA 3CJKA 1E6YA 2M5YA 2ZBRA 3CO9A 3VAIA 2Y0SD 1T05B 3JTPA 4M95A 2XCAA 3PW0A 4FF1A 3OFGA 4C2MA 1RHQB 2BJDA 2J9CA 3D67A 3GR0A 3JSYA 5GVQA 2FHMA 4WTYA 1SC6A 3HHLC 5KG1A 4RLEA 1A6LA 4DG1B 3HP6A 1UVNA 2JL9A 2MXYA 3T5LA 1WC0A 2FJEB 4JOUA 2L9DA 4ES3A 4CH1A 4YN3B 4PUOB 5GAHU 4LFBJ 4H4MA 2O5DA 4QPTA 3CJRA 3AB4B 2R7QA 4KB7A 4MIAA 2HRUA 2MZJA 2B9EA 3H8YA 3R6GB 5A8RA 2NXCA 4I64A 9ATCB 2AV5A 2AMCB 4USWA 1PYSB 1KONA 3U7JA 4DU7A 2IBOA 4K59A 4CTAA 2XI2A 1LKZA 4UQGA 2BBEA 7FDRA 2ERRA 4I6YA 4OHWA 2UVUA 4B9SA 3JQMA 4C8MA 2VA3A 3JSMA 3FUYA 4JV0A 1U24A 2QMWA 2XMMA 4NYOA 2E44A 3MMBB 5J2QB 4AXJA 3CJQA 1SQEA 3DOMB 2R8KA 2GA7A 1D0EA 4D3HA 4NA1A 2HS0A 3D66A 4KGKA 4TKTA 3UDLA 3V81B 1SC4B 4UOGA 5IXUA 3EPIA 1RHJB 2HRTA 3W2WA 1UAWA 2OPPA 3M1VA 2UUBJ 4ENOA 3R1LA 2J0XA 1T9UA 1UEKA 1HA1A 2DGUA 2DXFA 1X5TA 2EKYA 2VF3A 2V8GA 4PWUA 5HQLA 1S59A 1WKKA 3QGPA 1JLBB 4F50A 4FYYB 2FLPA 1FD8A 2V2KA 3CJ0A 3RBEA 2R7RA 4X4NA 3UDEA 3BDPA 2JSXA 1KKHA 4C0OC 3J7AN 2K7JA 1SL2A 1NKCA 1SIZA 4NMXA 4ZVEA 5JMNA 4EBCA 2D41A 1S9GA 2IM0A 5E3PA 2W2PP 2LEAA 1U02A 2DR8A 5ETPA 2I8EA 3EGWB 1RDRA 3HFKA 3N5FA 2LQ5A 3PRDA 1RT5B 4OZLA 1HKAA 3UVJA 1RWMB 3G6YA 4MKAA 5ETLA 3Q8QB 4K0KF 4F67A 3KK2B 4B08A 2M88A 4TYAA 2YKMA 3OXLA 4K4TA 1IBMJ 4RW9B 3SQOP 4DCJB 1YWXA 2VC1A 1M5SA 4ZJQA 4EZ9A 4DEZA 1KVKA 2BE9B 1FWPA 3M8PA 3MMBA 1GTEA 3KLIB 4NA3A 2L9NA 4IDKA 4ZCLA 3M6WA 5L1LA 3QJJA 4W98A 2MHNA 3HJVA 2XGPA 3T41A 3LPEA 4PWDA 2J7KA 3X1LB 2FC9A 2ZE2A 5DZ6A 2GVDB 3PRBA 5AXKA 2N82B 5BR8J 1KDNA 2E9TA 4GO5X 3C14B 3HHEA 5IQ6A 3M6XA 4WU2A 3TR5A 3B6BA 3R5GA 4DR5F 2HBYB 1TU0B 4BCAA 2HHHF 3JTNA 5ETVA 3Q8YA 3CXCR 3CMAS 1YI2S 3DMJB 1GK8A 5FDLA 3TEGA 1SKWA 3OVBA 5CZXA 4WF9Q 1WOOA 2JLFA 2R7TA 2GIRA 2M2BA 1AZSA 1T9YA 5A2QY 3OR1B 3H5UA 3I0RB 2EI5A 2J76E 3GR1A 4N76A 1MROB 1N0UA 1VJWA 3EGNA 5KFEA 4YB1P 2YNGB 1NMEB 1UFKA 2IJRA 2NCKL 1VCTA 2BW7A 2OPSA 4JI2F 3HHLB 1NK6A 4ZITA 3QQCD 2MZRA 5F8MA 4J9NA 4AQYF 1FK9B 2NSBA 2MLXA 4B9NA 4KHPJ 3HO1A 2DR5A 1JXVA 3IMQJ 2LKZA 1PC5A 2WVCA 4ECZA 5DRKA 2W2OP 3BREA 2KH9A 3KK1A 2HHHJ 4U95A 1HYSB 2WB1D 3MOZA 3SCLE 2VJUA 3LF0A 4B17A 4YY3F 4F4XA 2AJQA 4DL3A 3PRVA 3LUYA 3J80U 4DI6A 5HBMA 1EETB 1RT2A 1SPBP 3KFWX 1BE4A 1YK9A 2HMIB 3BDEA 4OI0A 4QCLA 4N77A 4C3MA 3DLJA 2DRDA 1X7VA 3BB5A 3TJ9A 1U1RA 1O8BA 4KV8A 3EM1A 3TP2A 1U8SA 1GXTA 4E8UA 5B0CA 2DHXA 1L5UA 3S6EA 1UVIA 1TL1B 2MKSA 4KTQA 4AYBD 1GAOA 3PACA 4Q44A 4DOZA 1FRHA 1KTQA 1RTIB 1TMMA 1SUQA 3WX8A 1T8EA 2P9EA 2KKHA 2IM3A 2HVZA 4LVNP 3MXHP 2H1YA 4PZVA 4NX9A 4WFBQ 3I5CA 2C28A 2GGPA 3LA0A 3L95X 5IV4A 2F5GA 2WVFA 3HXMA 2BR0A 3DLKB 3OTEA 2F9DA 2ROEA 3VVTA 3MCOA 3WC0A 2XQCA 3FCVA 2LU2A 2IJNA 3D6FB 3I55S 3NMAA 2J6TA 3M2VB 2JEFA 4RWXA 2V2ZA 3U1LA 4G3IA 3BSNA 4K4SA 2R7VA 3GILA 2FYXA 3MPDA 1X4AA 3M7VA 2ILZA 1WUUA 1RT6B 4JI6F 2OTJS 1Q8IA 3SIPB 1W25A 3BEGB 1S1UB 1TFWA 2V8PA 3AJ2A 1V3SA 3UN5A 2HWIA 4ZLLA 1REVB 4LF2A 1KQFB 9RUBA 3D5MA 1NK7A 4O23A 1N5VA 4Y34A 3PR5B 1JLAB 2B6AA 2E66A 3K8VA 4IYQA 4DX5A 5E33A 1RXOB 3JXOA 1UZHA 1DBDA 1YVFA 2FY8A 2JHEA 2OP5A 1HNVA 2VFVA 1VDHA 4OI6A 5F9LA 4TU7A 5L1IA 4DSFA 1NEEA 3WQPA 2PMWA 4CLYA 3DLLQ 4ERDA 4USMA 2WK4A 2KTQA 4R0EA 2VL1A 4NEYA 4X62F 2D3OR 4LF4J 3K5PA 3V6KA 2ATCB 2LEPA 4PQUB 1U49A 2CQ4A 1VHIA 3NS5A 4PXEA 5F8NA 2QE5A 1UW9A 3CCLS 3KLGB 3U1MA 4F36A 1UVJA 2BUNA 4Y28C 4BDPA 1CULA 1Q79A 3NBPA 4NLQA 4X62J 3WX4A 4JI5F 3CB4A 4LF7F 2MKIA 4DZ6A 1NUEA 4DR7F 2XBPA 3DRRB 3EVOA 4GVLA 2XCPA 1E6VA 2X3GA 1YQHA 2XHWA 1YIJS 1VHFA 2UUAJ 1VISA 3IS9B 3BPSP 3MUTP 2OD6A 4OV1A 4P2FA 2YQ3A 1JJCB 3M2RB 2H9ZA 1Y11A 1Y5NB 2ILYA 2CG4A 3QGGA 3CCSS 1X9MA 1GX5A 2H54B 5T7LA 1VC6A 2YPZA 5E41A 3DXSX 2W24A 5LL6d 4ZVSB 5GADI 3D6MB 1HNZF 4ZIWA 4LF8J 3BPDA 2EPIA 2QA1A 4HACB 4CO4A 1UJ4A 2XEXA 3PHEA 4KPCA 2L41A 3AOAA 3OUYA 4U7UD 2ZZMA 1KQGB 5GAGI 3DOLA 2DNKA 2HKEA 2E5HA 4Q8FA 1WKLA 4J9UE 3JAMU 1UJ6A 2OSRA 3SFGA 3TW0A 1H2UX 4C8NA 5DDRC 2GQQA 1RAAB 1M1KT 2CJYB 2G1DA 3BGOP 3OUYB 1OSCA 2VUGA 4M5NA 3W63A 1T05A 1YJ7A 4ZVUB 1S57A 1DQ9A 4QWBA 4CH7A 2QA4G 4JI7F 2HLTA 3W5YA 1DTQB 2BJ9A 1X5OA 2QTWA 4MK8A 4EFAC 4B3OA 1YZ7A 2H5EA 4XIUA 1RTDB 3PKMA 3F73A 3FGVA 3KLHA 1WG4A 1NK4A 3OTOF 1Q8LA 3BH6B 3OL6A 1W2BR 2ZDOA 2HW3A 2DH9A 2O66A 3GSDA 3R5JB 1UPPA 3MCMA 4L76A 2DYAA 3ET6A 2C42A 3OPKA 3UNYA 2Z56B 4DDFA 4PEOA 3PJ9A 2AJ2A 1PO6A 2MQQA 1ULRA 1H74A 1Q7LB 2HFVA 4MAKA 2E5IA 2MTLA 1T9XA 1G2EA 5KFKA 2HZCA 4N8OA 1BGXT 5BYQA 3T5HA 1DFDA 4NLUA 3C14A 2NPFA 3M9NB 2B43A 4KHRA 1ZM2A 1XQIA 3SV3A 3OTBA 1VQ7S 2BQUA 1U1QA 5F8IA 4V19J 3H4BA 2LQJA 3O5TB 3KMQA 1U48A 1DY3A 4J9MA 2AD9A 2EBEA 1FDNA 2EK1A 2V50A 3TUZC 1OMSA 1HNIB 3DDNA 5DZ7A 2KYXA 3PXGa 5KG4A 1QTNB 3HCXA 3IWXA 4ZVPB 4R8UB 4X64J 2V8VA 1X4HA 2B8QA 3D0HE 3BJYA 3IAM9 2MMYA 2AWZA 1F5BA 4O3OA 1KC8T 2DNHA 3MEDB 1RTIA 2P6TA 3CPWR 1RWVB 4PPDA 5J1EA 4MYTA 4DR1F 1IM4A 4OYWA 4U9RA 2VD3A 2F65A 3WHIA 3I4PA 4EYHB 2A1BA 4HHHA 1EZZB 3KHRA 1NB7A 2R7SA 1RHKB 1P27B 1U1OA 1XNRJ 2ZH2A 4DV1J 1AYEA 2MJNA 1NPPA 2KXFA 4CLUA 3V6DA 2ZWPA 2AYMA 3PW4A 3SZ2A 5FLXY 3BF4A 4KO0A 2J7UA 1QVGR 3GFXA 5MAOA 2HHUA 4FF2A 3HMJG 4RW9A 4XTTA 4DXLA 1ACMB 1NZAA 1VBKA 1XR6A 5IWAJ 3OTOJ 2LP4A 4ECSA 2CQHA 2M4MA 4BLGA 1TL1A 2AT1B 2R7OA 4O3QA 1JLGB 2IVFB 3R5BA 3ZTPA 1RISA 2QGFB 5HMXA 1BWVA 3Q8PB 1YBAA 4F4KA 2COLA 1HI0P 1JJ4A 2VKRA 2DIUA 2QMXA 3EGVA 2MQPA 3DHXA 3DRPB 3ILIA 4OZ2A 4LF7J 5DETA 1FRMA 4DR6J 2LYVA 4NASA 1IN0A 3HLUA 5IQQA 3T1YF 3OV7A 1LXJA 4C8LA 1BQMB 1J5EF 2EG2A 5DG8A 3K2YA 4ID5B 3DNCA 4OX9F 4C7QA 4WK3A 1MNEA 1R8BA 1TMJA 2B51A 2XGQA 4GKKJ 2ASDA 4C4WA 4QIFA 1NJWA 3KG0A 6FD1A 4QIWD 1UJ5A 5AXNA 4HTJA 4P6QA 2CPDA 4ILRA 1FO1A 3T6BA 2I1RA 3IBCB 3LH2S 3OXGA 3UE2A 5KFCA 2OUGA 4B3TF 3MEGA 2FD2A 2XHCA 4A4JA 5DQIA 3KOAA 3MR6A 2C3OA 1Q53A 1Y0HA 4CCHA 2GGPB 3HHDA 4KC5A 4CM2A 5C2GA 1JLQA 2GX8A 2V9KA 4RW6A 3G6VA 4F4WA 4K50A 2ZH6A 5DS7A 3RG6A 4NLDA 2G0CA 2BVZA 2L08A 3M2UA 3R7BB 3MEGB 2EFNA 1WEZA 1RAEB 2V8HA 4ECUA 1I94J 5AJ3J 4ED4A 2BE2A 5LSRA 1NDLA 4IG3B 4LR9A 1T11A 1ZZNA 5C24A 3R7NB 1S1WB 4IH7A 2SXLA 3MR7A 1FD2A 2DGQA 3DGPB 2W8LA 1HQEA 2LQ8A 3MCNA 1LWCA 3B8HA 3NCRA 1DTTB 4Y2MA 3ZTQA 3TEHB 1CVJA 4DSKA 1WNEA 2J0QD 4Y2IA 2PA3A 1VIXA 4K4YA 4V1Ak 5D6GA 3A8JA 4FXVA 2B3TB 1MSWD 4IO1A 2GV1A 4FYDA 4I1TA 5K8PA 3MM8A 4RPFA 4W90B 1T3NA 3RGIA 1TKZA 3H2UB 3MMCA 1QD1A 4LBIA 3ULHA 2R8HA 2IAJA 1D9FA 3VV2B 1MMDA 2CNLB 4O4RA 2MDAA 1JKHA 4ZKAA 1HARA 1KD1T 3G87A 3M8ZA 4DL5A 3T1YJ 4ZVGA 3DLGB 3MURP 4PG8A 2CG8A 2HBQB 4DCPB 2DO0A 3NG8A 5FJ4A 3M05A 4WTOB 4HH0A 1CQNA 2H4YB 2QG9B 3MZIA 4ZPCA 4DR2F 1J5OA 5RUBA 2K8GA 1XNRF 2KJVA 2C2OB 1RZMA 5KFQA 4ZN1A 4QW9A 1R8HA 4YR2A 2POKA 1F1BB 3CCTA 1JLFB 1Y7PA 4Z7YA 4J5OA 3GIIA 2ZBQA 1NHKL 4P71A 2PA8D 3IRXA 4EU0A 1O51A 2BJ8A 1XIQA 4I56A 3A1YG 4UOCA 4CRJA 5B0GA 4FZVA 2UXCF 2RT3A 5DLFA 5C24B 1RU2A 5KG0A 4Q45A 1UEUA 5T7LB 4X4VA 2JC0A 3F41A 1C1CA 1SBRA 2LMIA 1NDKA 1N6QB 4LSLA 2V4QA 3FBFA 3C16A 1RTJB 5J2MA 2KYZA 2XWYA 2CRLA 2K3KA 3H20A 5CYQB 4NXNF 2G4BA 1N34F 4Y00A 2NZCA 3C6TB 2KZMA 1Y4ZB 5E0OA 2PMHA 1S6QA 3FRZA 4OJGA 1CJTB 3BYRA 4R0JA 4CO3A 1NBEB 3L7UA 1E6YB 5E3RA 3CJKB 1EQ0A 1R6YA 5HN0A 5KFXA 1IR1A 1F9FA 2X7IA 1JKHB 3AH6A 3MMAB 4JP8A 5EX3A 3EPGA 4GMKA 4WIQA 1RTZA 1JK9B 3AAWB 4ZP6A 3UVJB 3LOUA 4PQUA 1IVZA 3KTQA 1U6FA 1NKBA 1U1MA 3Q83A 4Y2CA 4B9TA 2VB6A 1HI8A 3CVKA 1R8PA 3ILOA 4ICLA 5DM6Q 1B0VA 4PR6A 1PGZA 4HI2A 2HK2A 4ZS6A 1UP1A 3HPOA 3GQCA 4Q2MA 2MGZB 4F3QA 1YJTA 3PFOA 1IKXB 1O5JA 3M8YA 2VOOA 1PCAA 3MM6A 2UXBJ 1OSDA 3CTRA 4B02A 4A8YA 5LOQA 1VK3A 2DNMA 4PXBA 3CGIA 3PYFA 1ZA2B 3CF5Q 4WU3A 2DNQA 1EAYC 1NK8A 1AUDA 3HVAA 3CCQS 2V5HG 3MPWA 1NHVA 4MKYA 1JQGA 3K8WA 4DN0A 1CEZA 5CZVA 3RB6A 3V4MA 2QT7A 4HACA 3N01A 2OMLA 4ZCIA 4OLOA 5CYJA 2F9JA 1JMTA 2LFVA 2ZH8A 1YJ9S 1D8YA 3MAQA 2DGOA 3KLFB 1TL7A 2Z0GA 2IA6A 1XR5A 3PEHA 2EVZA 5KFAA 5B08A 1X60A 3AOBA 2I6WA 3PO4A 3W3SA 4DV5F 1Z4UA 2CIMA 4UT4A 4ETXA 3IXQA 1OS5A 1VLOA 1S6PA 2VPYB 3RBDA 2DNPA 1S0MA 3GCXP 3R27A 3SDEA 3GWCA 3LP2A 3L09A 5I3PA 1KLMA 2I5JA 4A8OA 1YX2A 2B4VA 1Y5IB 4MIWA 3D28A 3UPFA 1D09B 3FRYA 3KJVB 3G82B 2WVEA 1SKSA 2DEJA 2MSTA 3FFIA 4QIGA 2MQOA 4DR3F 2Z4PA 1RYRA 3G8SA 4XO0A 1APSA 1RA6A 4YQWA 1P8GA 4G1QA 3G6ES 2WSCC 4B9LA 2PFFB 1B3TA 3UD3P 1N5YA 1P6TA 3GJQB 3IR5B 2EG1A 1UZDA 4JI3J 4A47A 4P52A 5KTQA 1HFEL 3QRQA 2PFDA 4DR4F 3VAMA 3T1AA 4LBHA 3VQTA 3NS6A 2M7SA 4FBUA 4PXCA 3OFEA 4NMLA 2G13A 2YKOA 4HDHA 5GMDA 4LF6J 1FX4A 2N7YA 2J0SD 2RE1A 4M1KA 2W7AA 5JXSA 4ER8A 1TTHB 4QR0A 2JVRA 4KH0B 1Q1KA 1XMOJ 4P2SA 1XNQF 4F04B 3ETOA 2IHR1 1PJ5A 3PG9A 1CJUB 5IS2A 5EWEA 3PKYA 3M30A 1SH2A 4USJC 2HAIA 1HWIA 2K7KA 4F3OA 1RWPB 3DXBA 3I87A 3MM7A 2MSSA 3K5LA 2E1CA 2JC1A 3E2EA 5A0YB 1IJFB 2MB0B 2VBZA 2AU0A 2W01A 3QGIA 2NREA 1X8DA 1YJVA 3CNQP 1RE1B 2GJFA 2W1BA 4PG4A 4DMZA 3TVZA 1H7XA 1I6JA 1RHUB 1H98A 1X4EA 4RWWA 3O6QA 4N56A 3VALA 2RQMA 1MWZA 2R7UA 1XJWB 3OTCA 2QFIA 2HHXA 1TVRA 1VQSA 2IM2A 4CLLA 3TZXA 1XMQF 2HMIA 1C0UA 1ZAXA 4C0BA 4FNIA 2QYGA 3M6UA 1JIHA 2KM8B 1YG0A 3M32A 4J9KA 3V4IA 1A7GE 1S7IA 3RAXA 2ASYA 2DHSA 4ES1A 4XAKA 1NKEA 4D3GA 3T6JA 2BM0A 2FUG9 3KLGA 3MDFA 3QWPA 2JOQA 3OFFA 2BQRA 2BOPA 2D9OA 4M5GA 3I31A 3CCWA 3FDSA 4C11B 3CCUS 1I94F 1JWWA 1IR2A 3Q89A 3UNGC 1B7FA 1NJXA 3K59A 4JI4J 2YKAA 1N54B 2BKOA 3MUVP 4LJMA 3RB4A 4NLTA 3RRGA 3MM9B 3PEJA 2BMBA 2FHJA 2YNFB 1XMQJ 3SV4A 3IWNC 1HQUA 3US5A 2MZ1A 2CQCA 1LWEA 3BBBA 2GQCA 1HD0A 2B9WA 2LVWA 5LMNF 4WE1B 1ZZFA 5A0YA 2DIVA 2V94A 3C6UB 4MFBB 4RUCA 2JDJA 5CCLA 4TU8A 5I4MA 3QPIA 3RYLA 4N47A 2Y1LB 3T1HJ 1OJ4A 3Q8RB 4DFKA 4I68A 2C3YA 2QLWA 4CLTA 4EGLA 2VODA 2FJWA 4CDIA 2WTFA 3UN3A 4JI1F 4RNNA 1JLFA 4C8OA 1IR0A 1XR7A 4CO2A 1S6OA 4FVCA 4IQMA 2YH1A 2CWKA 1NNDA 1C0TB 4YB6A 1UPMB 2LU1A 4GKJJ 3RR8A 1EP4B 4U8YA 2X3DA 3HSGA 1BQXA 4UW2A 3CDAA 4B3SF 4A46A 4P72A 5C25B 2BDPA 5HL7Q 4ILLA 2A10A 3R1HA 2W9BB 1R0AA 2FLOA 2KO1A 2MZTA 1KHVA 2NUUG 2HK3A 2F7VA 4P7VA 3VAJA 3RAQA 3DM2A 1HI1A 3DGVA 5ETTA 1CQMA 1CJKB 2BW2A 3ET6B 2IFXA 3VZHA 3MM8B 4LT6A 2AYEA 2YWHA 3VGVA 4ZLJA 3CDBA 4IQXA 2G2YA 2J7WA 3E3XA 3IA0A 3R3TA 4KGZB 5THWA 4YFUA 5DO2A 4OI4A 5K5MA 2HQDA 2UUBF 1YITS 5J1NA 4OX7A 5KFDA 2WB4A 3S8SA 2RS2A 1YBTA 2XMJA 2FGCA 2OPQA 2HSEB 4J37A 4CH0S 1BUXA 1F3VA 3ICLA 2FJBB 2R7XA 2ACYA 2ZE2B 2EC2A 3I9V9 2HVDA 3JQKA 1UL3A 5KFSA 4YR0A 3PX4A 4M8LA 2J0WA 1N36J 4DV0J 1MN9A 1PAUB 2GJIA 2MKJA 3SCIE 1L3KA 4HHJA 1PJ6A 4ANDA 1RT4A 3M8RA 4IDKB 5DDQC 4B3MJ 3HJFA 4KPYA 3DOMA 3W61A 2EK6A 4KFBA 1DRZA 2OHDA 2DNYA 4EWTA 2JLEA 5DG9A 2N7CA 2GS8A 1NK5A 3S7RA 3HI9A 3T9NA 2VC0A 2QEXS 3NNAA 1WELA 3MD3A 2B9YA 5DDPC 3AA9A 2B9XA 1TL7B 3G82A 4HDGA 3FKBA 4ETZA 1S6QB 3SBMA 1T9WA 3TZYA 4DV1F 4M5DB 3WBZA 2IRYA 2OFGX 4HT5A 4I7FA 3M8WA 3UD5A 2EEYA 1GMUA 3IM8A 5KFRA 4DS5A 2XY7A 3OSPA 2HURA 4A8MP 2XS7A 3BGRB 4CO0A 4DPYA 4F4YA 1YJNS 3PFEA 4DF8A 1GXLA 4H4KA 4C8KA 1OPIA 3SCKE 3FQLA 1IQTA 4KHPF 2Y1IA 3O44A 2CWXA 5K20B 2RS8A 3KKFA 5EWFA 4DCOB 3KK2A 1HHTP 3AJ1A 2KRBA 2AZ3A 4JI6J 3QT7A 3MMJA 4ZVRB 1YJWS 4I69A 5EN1A 3R97A 2VQEJ 1RWXB 2BEFA 4J9SA 3N6NA 4TVAB 1AXQA 1JLGA 2RU9A 1QAYA 3UCZP 3FFIB 3W7BA 2J6UA 3HK2A 2A6OA 1PILA 2FQQB 2YWEA 1HYSA 5BXIA 1VQPS 2F4VF 3MM6B 3IRWP 1HBUB 1V5IB 1C1BB 4WK1A 4DU8A 3RB3A 3PO5A 3BKTA 1UA0A 1FRKA 2RKIB 3VGTA 4EUVA 3V5RA 1KFDA 2CQ2A 4Y65A 3K89A 3B4DA 5F8GA 1QSLA 1LW0B 2YTCA 5F3TA 5KFLA 4JI8F 3OJSA 1HWUA 2LQBA 2Z57B 1NK9A 2K06A 2DKOB 4WFAQ 1Y00A 2HIYA 3H42A 3TNVA 1F5CA 1RTHB 3QAEA 3PW2A 1KHWA 2D74B 2P9GA 2NLWA 4NLPA 1NH8A 1ZOTA 1FWKA 2CPYA 5J1EB 4ZVQB 3CMES 1ZAWA 2FZGB 4PAAA 2RQKA 3QZ8A 5G4DA 1HNWF 3WIVA 1RT3B 5HJXA 3GG1A 3EUNA 3Q0AA 4ZPBA 5F3ZA 1TFYA 2NSCA 3I82A 3NY0A 3HHLD 4FDFA 1UKUA 4OQJA 4RW8B 4I67A 2BABA 4HR2A 4OMFG 5T41A 4CO5A 1HNWJ 2HFUA 2I9SA 1M0SA 2ROPA 1FFGB 4FXDA 2M3DA 2YX7A 2HQ3A 2AKWB 2DRBA 1MW7A 2IDEA 1WC5A 2R3VA 1AFIA 1FVQA 2J9DE 1TP7A 4NZ7A 3LP1B 1PAEX 2FVRA 4I4BA 4M5HA 5GMKa 1SB6A 4FKYA 1VQYA 5CA5A 4AFFA 3E8OA 3T3FA 2CNOB 1ZPVA 2N4DA 1BQMA 3G2XA 2BACA 3A3NB 3SCJE 4NZ0A 4UTGA 4FS1A 3OTDA 4HTIA 2RKIA 6AT1B 3PW5A 1S0VA 2WBRA 1WF2A 3BR9A 3DRPA 5M2RA 1ROFA 4UY8T 2WW4A 3LWMA 1S1TB 3GONA 3KWMA 3I6PA 1HBNB 1M1HA 2ROGA 4G6VB 1MU2B 2B7CB 2FDNA 1BWEA 4DPUA 1YSJA 1PG5B 3HULA 2UUWA 1HPZB 2JNJA 4F0KA 1HNXF 1HPZA 4PABA 2BOAA 4ED7A 5IT9Y 2HBRB 4NCBA 1IQZA 2IIHA 2IAJB 4G65A 5A8WA 1F5AA 2UVRA 4LFAJ 2L48A 1GX6A 1RJJA 2XYPB 3E51A 3EMTA 2GHVC 2C2MB 3GJSB 3A8IA 4USVA 3TX0A 2XY5A 3GE9A 2APOA 4DV7F 4YHHF 1VQMS 3GFHA 3IRXB 4USUA 3CD6S 3A8EA 3N6LA 1RAHB 5C2CA 1XMOF 1XNQJ 4IR9A 2KFNA 1CS4B 2WVBA 1BXNA 2JFKA 4AUKA 2CAJA 4LQ3A 3ELHA 3AA8A 1A9NB 4RW6B 3I56S 4DFPA 2IY5B 4OX8A 1D9AA 3FBBA 4WBFA 5J2QA 2E5GA 4NWBA 1IBKJ 1JJ2R 1FDDA 1N36F 3GZ7A 6FDRA 5FD1A 1D1UA 4B9MA 1G3OA 2G0IA 2DK2A 3UCGA 1OYEA 4J9LA 2JEJA 5HANA 3SQGA 3KDNA 4Y3CA 4UZBA 3C8YA 2HGLA 4DL6A 3FMWA 2CKWA 2IA0A 2JX2A 3TVYA 4ANEA 4C97A 4XPEA 2EBGA 3DLEA 4LIWA 2C2DA 2OMOA 4I7FB 4K5RA 2IVYA 4FS2A 3FZBA 4ED2A 3KLHB 1VBZA 1N6QA 3TAPA 2ZVIA 3HD1A 2BJ3A 4DV5J 2EKNA 3TI0A 4DL4A 4C8ZA 3RW6A 5HROB 2DISA 2VFSA 2R9LA 5HLFA 3KHHA 4DPTA 3Q2TC 2OPQB 2RNEA 3KUHA 2CPXA 3ILLA 4MMOA 2XI3A 4LSZB 3T19A 1TKZB 3GJRB 4X4QA 1WC6A 2GMHA 1RT7B 1NSQA 2ZH9A 3H90A 4QZVB 4RUHA 5IWAF 3DYAB 5B09A 2HG4A 4YMEA 1UCNA 5ETNA 5CABA 1J5OB 4QWCA 3UCUP 3EJMA 2ZBCA 4TN2A 2KXNB 4V19X 4CLKA 5KFTA 3UWTA 4C9DA 5BR8F 1EKSA 1EJ7L 3L7PA 3M1VB 1U1PA 2MYFA 3ETMA 5D4OA 3PW7A 3OHAA 3M9OB 1KN6A 3HD2A 2Q6CA 2XZDB 4X66J 4CNZA 3SXLA 5HQ8A 2YBVA 1F3FA 2B0GA 2CPIA 1RBAA 3PYEA 4DR1J 1RP5A 2RD5C 1JNRB 3FJ2A 1Q4RA 4I2PA 1X4DA 2F8MA 1HR0J 5DGBA 3TVKA 1WDDA 1FRIA 1IKWB 1VLYA 3CJ5A 3G8QA 3HFZB 4L6V3 2EFVA 1B0TA 1T0TV 1FE4A 2CJAA 3DMJA 3GJTB 4RNFA 1D9DA 1ZS6A 2AHOB 3BGRA 1RADB 1AW0A 3MF5A 2HQIA 3IG1A 4F7VA 3TA1A 2J8SA 3GYXB 1IUJA 3IG1B 4DPWA 2BV3A 5BYRA 2GMJA 3CJ3A 2JVOA 4N5SA 1CBKA 4K4WA 4A8QA 2A6MA 4UF4A 2VQFF 4JV2A 3AHPA 1PSDA 4IRCA 2VG5B 2DITA 1WTBA 1FJ7A 4Y2AA 1TL5A 1S4EA 1WHVA 2XG8A 1P1TA 2BX6A 3EVWA 5IFMA 1RYSA 3TZZA 2DB1A 5SZTA 5B0BA 3TO8A 2I38A 1Q16B 5A8KB 3BO2A 3ENWA 1BLUA 2NXJA 2O01C 4Q0BA 2W2MP 1B99A 5IC4B 1S9EB 1R0BG 1SC3B 2FZKB 2QJ3A 4U7CA 2DNNA 2V69A 3MHYA 2CZ4A 4X4OA 2ZJQQ 4LF5F 3DFEA 3DLBA 1RTHA 3D6TB 3DRXA 2YY3A 1OYDA 1S1XA 4ZA1A 1UVLA 2ATLA 4TLQA 3N0VA 4USHA 1WSVA 1YBUA 2MY7A 4DV4J 2PD1A 1WTFA 4RUAA 3PJXA 3M8SA 4WCEQ 3CE8A 1IKYA 3KUGA 4YB5A 3TARA 2CQPA 3K57A 2CQBA 3NLCA 4KT0C 4C8YA 1ZAVA 2UV8A 5D4LA 1WEYA 1KTVA 2K3IA 2Q79A 2XNQA 3MPYA 3MEDA 4HEA9 1NH7A 5KFIA 5LMUJ 2B5JA 2H51B 3FEYB 2E9ZA 3PZPA 3CCRS 4B9VA 3TUJC 1U2FA 2KT5A 2PEBA 3LO3A 4WYLA 3M9MB 1KWMA 3D0GE 4DL2A 1P9QC 4ED5A 4JV1A 2B56A 4E98A 2H5IB 3EDQB 4L73A 2IPOB 2GO8A 5LSOA 4N8NA 1WOSA 4F25A 3L4BC 2IRUA 3ENAA 2CPEA 2QSFA 1EARA 1HHQA 4ZCKA 4TY9A 3D1HA 2FC8A 1R0CB 2HS4A 4ECYA 1RWWB 1FTCA 2WSFC 4A8FA 4W92B 3ZZPA 4WZQA 1MMLA 1LOUA 2R8IA 5HP1A 3NCPA 3D9BA 1Z2LA 3TJ8A 2EFGA 3NMRA 2ZKTA 2KT3A 4LRDA 3O1LA 4DR3J 4ELUA 3LP1A 1VQ6S 3CJSA 3AD9C 3DRYA 2RMLA 1VYAA 4HH1A 5C42A 2GAHC 2JEIA 2E5JA 4OIXA 4OZ1A 3VAKA 5AE2A 2ADCA 1S10A 4WFXA 3CCVS 2OI2A 4Y2KA 8RUCA 5KFHA 1V9OA 3AJDA 4BWMA 3SEOA 2VIHA 3TRGA 1CC7A 3BGUA 1X9SA 1K1QA 1Q78A 2ZNYA 3M32B 4P2XA 1AB8A 5KFBA 2U2FA 1FERA 2PSZA 5ETOA 3UFCX 5DGAA 4LFBF 1C1BA 1VQLS 2IDLA 1GMWA 2M0GB 1SL1A 2KT2A 1U25A 2V6AA 3DU6A 3P5BP 1KNZA 1KS2A 4B9UA 1I5OB 1RT7A 1VI7A 1JLCB 2XMWA 3NAHA 3ZZYA 5I3UB 4GC7A 1FKAF 1X4CA 1ICEB 1MU2A 3N9UC 3H4DA 1F9HA 3MAAA 1BQNB 3TA2A 2ZZNA 1TKXA 3Q2SC 4JV5F 4O3SA 1OQ6A 2NYHA 2O3DA 3EWGA 4NYZA 3M2VA 1S1UA 3QAUA 4RKUC 2QA2A 2NQPA 1TL3A 4TYBA 3BQ1A 3MM7B 2RHSB 1QSSA 3DDKA 3H5SA 2XO7A 4NLYA 5H9FJ 2DRAA 2DY9A 2VKZG 4ZIVA 1LFPA 1HHSA 1YRXA 4OLPA 3OR2B 4O0NA 2C2ZB 2QA4S 1R89A 4QYRA 2CVEA 4X65F 1B64A 1HWJA 1S6UA 4J9VA 2YVSA 4LRAA 4C3LA 4OYIA 2CPHA 4U8VA 3TZWA 3T5KA 1VBYA 4B3SJ 3OD2A 1UFWA 5D0HA 3N28A 5I3QA 2OPRA 3OBIA 3KLVA 3HX9A 2ZUGA 3LGHA 3NEKA 2VPWB 2HHPA 3POTA 4OFZA 3N5BA 1RSCA 4CI0B 2QLBB 3OL7A 1RT1A 4OHVA 3IR6B 4DS4A 5CHCB 4LF5J 5JUMA 5GAHI 3I0SA 4EYIB 5IM0B 5ETQA 2UUCJ 3DRRA 3W62A 3WDOA 3EE3A 1YJUA 5FLXU 4U67Q 1SXLA 1UFLA 2LQ9A 4NI2A 4KKOB 1PC4A 2A18A 1HNVB 5H9EK 2AIRB 2OTLS 2GNKA 4K0KJ 1T9VA 2ZKUA 2YWGA 2AX1A 3M4XA 5ITHA 3GP9A 2E1MC 2FGOA 1H2VZ 3BZQA 1FJEB 2KZZA 3B4MA 3EYZA 2YNFA 2R4FA 3NAIA 1SV5B 4DV6J 2J9DA 2VBXA 3KNGA 3R2DJ 1U09A 5A8KA 1W7WA 4WPAA 3SYZA 1SKUB 4FN5A 3W9JA 1YJRA 3P96A 4P75A 2ZITA 5K8NA 2CYYA 5LSLA 1SH3A 2ZDPA 3KLEB 2KN4A 4USIA 2R8JA 2JFDA 1RLDA 2FVQA 1T03A 4X2BA 2GAGC 1WORA 1ZM3A 4ZJOA 2JLGA 1WI6A 3KJQB 4NLXA 4EMDA 1VC0A 2NUHA 2OAUA 3HSDA 1FJGF 1IKVA 3QMQA 4C3KA 1NJIT 3S1TA 2PDAA 4PPZA 1IKWA 1U6ZA 1NK0A 2I5JB 5KFJA 4DV3F 1XK8A 4NXMF 3DOLB 4OYXA 4I2PB 4QW8A 3RR7A 3HT3A 1DAXA 3OR1A 4R25A 1U1KA 2VG7B 2OPPB 1FVSA 2HHSA 1UMJA 3W5ZA 5J2PA 2WONA 2ABYA 2IM1A 2KM8C 4NPOA 4YP3A 2E29A 4J9QA 4A8KA 4KGVB 3W66A 1R0AB 4IRDA 1KLMB 4LBPA 1M1GA 3ITHB 2DT9A 1EHWA 1UWBA 2RVJA 5D0RA 4XDDA 2DHHA 1HMVA 1QE1B 3CSKA 4QR1A 3RW7A 4PRFA 3GU0A 3TANA 4ANCA 3H40A 4FNHA 2PGCA 4M5KA 5HQMA 2C2EA 4DSJA 4UY85 4PWDB 1IJEB 4Q7AA 2W4CA 3CJ4A 4OI2A 2QZ8A 5CCMA 5M2PA 1RHRB 5LXYA 5HVFA 2DXEA 4AXIA 1RT5A 1SJQA 1ZA1B 2F1FA 2XZTB 3JSBA 2D9PA 3UN2A 1NPKA 1WG1A 2DH8A 5H1SV 4LREA 5DQHA 3KHGA 3MEKA 3GV8B 1HD1A 2CJXB 4P10A 3KNAA 2WZ1A 2LLZA 4RW4B 2CA9A 2YKMB 3HSJA 2QRRA 5EUHA 2XMAA 4AQYJ 1Q81T 1FE0A 3GG0A 3D4JA 2DR6A 5KG5A 1IKYB 4DV2J 2UXBF 2KVQE 4URSA 1ZM9A 5G0RB 3R5AA 4JV5J 1DZ5A 3B54A 3LWLA 2I2YA 1FXRA 3K7RA 2FZCB 4WFNQ 3ZTSA 1FKOB 1G4CA 4KJIA 2HRYA 2OEKA 3QT8A 1AZSB 2GVDA 3F0NA 4WKYA 2DEIA 3NOCA 2MKYA 2EFQA 2HHVA 3P45B 2G2OA 5D4NA 3D0IE 1NAQA 4E2FB 3THTA 4DV7J 2F4VJ 5D3GA 3V6HA 3LP2B 3SSRA 5LJ3Y 3ADAC 1WG5A 2HFZA 4WYWA 3U27A 1RHMB 4AD6A 3JTOA 5HVHA 2JEGA 3WIUA 1FK9A 2RQ4A 3R6LB 5F8HA 3TWZA 4OX9J 1S77D 1RACB 2HHWA 2BANB 3ILJA 4RZRA 2BANA 4ZMMA 1KVJA 4Q0BB 1N88A 3DRSB 2UP1A 2MJUA 4FP9A 2KL8A 3FNNA 3JSRA 4KGMA 2MQMA 4KV8B 1WHWA 4ZPTR 2V2QA 4UOFA 5B0AA 1VQ4S 1GT8A 2R2UA 3PV8A 1VQOS 2WSEC 2JRSA 1P9YA 4WIIA 4F4AA 1SQGA 5DLGA 2H48B 4CLZA 3K0JA 2EXUA 1K44A 3IN5A 1JB0C 1YGYA 1JXLA 5KT6A 4NLSA 5KFZA 2DVIA 1HBNA 2LXFA 4ED6A 1UTAA 1ITPA 3BGFA 4IOBA 5L38A 3IO1A 1NU4A 2YWKA 3FSXA 4ID5A 4NL5A 1BHNA 2V9WA 2HGMA 2YKQA 3QT5A 1JLCA 4KSEB 4TQRA 2ZM6J 1VBXA 2BZ2A 1N33J 3CC4S 4OJ1A 3L7OA 4OI3A 1V3RA 1D3WA 5I42B 2HNYB 1S5ZA 2QYCA 1WI8A 3CWJA 5A76A 2Y8WA 1UVMA 2AZ1A 3B82A 1S12A 5KT5A 4ECVA 2NXUA 2OGUA 1Y10A 3PNIA 4IH6A 1PYOB 4CLSA 3JAMY 3H2LA 2OSQA 4KR0B 5KFYA 3BKUA 5ETMA 4DV6F 2HGNA 2QIFA 2XC9A 3V6DB 3CIMA 3BBFA 4RBTA 1S0NA 4OI1A 4A8SA 4H4OA 1S99A 4PG6A 5E5NA 3NXZA 1AA1B 4X64F 1SIWB 2DNGA 2RF2A 2XMVA 2XM3A 2FVSA 3OXFA 4OZNA 4ZJLA 2OKQA 2BKPA 2RILA 3CO0P 1ZTWA 3TUPA 1L3SA 5C42B 1N4LA 5CAAA 2UV8G 1OO0B 4IG3A 4ILMA 2KHDA 4DWIA 4LVOP 1N34J 4X66F 3D3BJ 1LEOA 5KG7A 5HP1B 1Q0NA 3PX0A 4UZCA 3QNWB 4OYMA 2AEFA 3DGPA 4WP8A 1M5PC 1N5SA 2QLXA 3DLEB 2ZWOA 4EO8A 1LQ9A 5AJ3F 5H9FK 2VBYA 3VAHA 1MLAA 1WF0A 1FNOA 5B7WA 2M70A 2GVZA 3CDEA 3P3DA 2KFZA 2DGSA 2GVZB 3BH7B 4P7TA 5HO4A 4USTA 4MT1A 2VU5A 4OZ3A 3EX7B 4DG1A 1NSPA 5LMUF 2CQDA 4ZK7M 3IR7B 2XLKA 1FT8A 3PTWA 5K14A 5AE1A 1HBOA 1H2TZ 2EFPA 1S1TA 3BN4A 1VRUA 4FYWB 2RU3A 3OLBA 1BMQB 3PYDA 2VOPA 2KRRA 3A4TA 4YDDB 4WZMA 4J91A 4J9RA 4P74A 5D0GA 1X9WA 1JLEA 3U1NA 1IWAA 2BKNA 2M52A 3GB0A 3FQKA 4CT8A 2CQGA 2QLFB 3R5CA 5EDWA 3HHNB 4TY8B 3BO4A 2GW8A 5B0FA 4O3PA 2Z2MA 2Y1RI 1ZYQA 3HVTA 3UO0A 4LSLB 5E3AA 3T5JA 1NB2A 1VFJA 2DJWA 2HWHA 2VDIA 4HL9A 4KY3A 3R2CJ 1KEKA 1RI7A 3KUEA 4GVBB 3IAS9 3OLAA 3V81A 3MM5B 2BA9A 3MM5A 2VG7A 2CVIA 3WZ0A 2W9CB 2FPHX 2X1GA 2WRMA 3VZIA 2Y3YA 3LTOA 4JI8J 3MR5A 1N0VC 3C16B 4G1IA 5GADU 2HFNA 4ZVHA 2C2KB 3SQGB 5IM0A 1R6VA 1X0FA 1FWLA 3OVSA 2FVPA 1I51B 1WSRA 2G0JA 1EP4A 3ZC4A 1IKVB 2FY1A 3ZO7A 4NLRA 1NSAA 4J7CA 2VASA 2G9OA 1S6PB 3H98A 3MMAA 4DUZJ 1HNZJ 1NRKA 3M8QB 4AL5A 1J27A 4CYUB 3CDUA 4LF9J 3GV7B 3QSIA 1M5OC 2BJEA 3Q8VA 4PQAA 2HZVA 2W7OA 3QATA 1K47A 4NLOA 2YH0A 2OJ3A 3O2IA 4RW7B 1S48A 2E1RA 4ZN3A 4DL7A 3J7YI 1Q8BA 2N3OA 3N6MA 3MR3A 4BC7A 1HNIA 2UVWA 1YLXA 2K2PA 4Y0FA 4YHHJ 5A6PA 3A13A 1SV5A 2CQ0A 5D77A 3J7Z5 2CNKB 3KK3B 1JNZB 3BQ2A 3HVTB 3HT0A 4Z7CA 2XTJP 4KFBB 1F9EB 3LGMA 1S49A 2ZBIA 2AJ4A 1NM2A 4W4MA 2D3O1 2C2RA 4IUFA 1RLCL 4DUZF 2AEMA 3PYGA 1WHXA 4QWDA 3ZNJ1 4DLGA 4ECQA 4FBTA 3CEDA 3K17A 4ZDNA 2XS5A 1IXKA 1PIEA 3DHWC 1UEVA 2W4PA 3K5MA 3HKZD 1OY8A 4OV6A 2HPUA 1KP6A 1V3ZA 2MPUA 3LPYA 2V8DA 4WP3A 4OZJA 4L72B 2BXJA 3MECB 3PHTA 1IBCB 4L74A 5L8RC 1W2IA 1B7YB 5L9NA 4NRUA 2XLJA 1F6TA 5G0RA 3CCES 2QLJB 1HNXJ 2X1AA 4B3MF 2XY6A 1GQEA 3G8TA 1Q86T 1CLFA 4M5DA 1YDLA 1T02A 2KI2A 3WC2A 1K0TA 4TNOA 2F4FA 3RZAA 1YRTA 5LMNJ 3W60A 4DV2F 2DY1A 1UETA 3HZGA 4QWAA 3HVRA 1U4BA 1TV6B 1QUPA 3RUBL 4J9PA 1TELA 1JLQB 3FBCA 1YRUA 2KDOA 4YY3J 2L3MA 3DI6A 4DV3J 5EHHA 2Y8YA 1RGVA 4H4KC 3EDRB 3L9ZA 4LUBA 4ZHRA 1SJ1A 7FD1A 2GIQA 3NNHA 4I2QB 1FCAA 2VG5A 1GFWB 1RUSA 1O0PA 2CZVC 3KDOA 2IC3A 4MTPA 5KG6A 3TJAA 5KG2A 2LA6A 4EBDA 2GMLA 2VFUA 4LFCJ 4ZPAA 2D1CA 3SSSA 1LW2B 4CM0A 2HNDA 5HMYA 3CCMS 2AP6A 4ZPVR 1KQSR 2E5LJ 2RAQA 3EZUA 4QIVA 1RAFB 4CIOA 5SUHA 4P9SA 1W26A 3D3CJ 2M8DB 2ASLA 4F3MA 1U45A 5DDOC 1U7LA 5AE3A 2FJXA 4QYZK 3HKWA 5E2QA 2F40A 1RQ0A 1S72S 4F0MA 3C3LA 1C2PA 1EETA 1RT2B 3GPAA 4RW4A 2DR7A 4ZOSA 1ZTTA 3BV8A 2R8GA 2YXLA 4CNYA 1S7HA 3UDVA 4FXWA 5DQGA 2GO9A 1WHYA 2CJ9A 2EWHA 2RUGA 2J8AA 4K5SA 4OX6A 3LQVA 5KFVA 3TAMA 5FIIA 5HMZA 4CLWA 3SMZA 3UD4P 1JX4A 2P9CA 2L9WA 4IH5A 3PIPQ 2R2TA 5CYMB 5KT4A 2YNIB 2PO4A 5HJYA 3V6JA 4M5JA 5D3GB 1LV5A 3LGNA 1VC5A 2XULA 3RAMA 2RIJA 3MPVA 2R42A 2E7VA 2W7PA 4DSLA 1F2GA 4YR3A 4X4PA 1HLWA 3AXKA 3ENQA 1TKXB 1MROA 4HI1A 1HBMB 4O0IA 2PT0A 4C0HA 4PCQA 1C0UB 2HS3A 1DTTA 4RNOA 3VAFA 3FSYA 4O4GB 3PY8A 2WVDA 4M63A 3KG4A 1SJFA 2C22A 1REVA 2G2ZA 3I5BA 5F0WA 1WC1A 5LJ5Y 1FXLA 2XB2D 1T95A 2MKCA 4PWWA 5DJBA 4OHZA 3RBXA 2HEKA 1NDPA 1QSYA 3DRSA 2A3JA 4ZCMA 5JVHQ 4ZVFA 3FCHA 3ZZ0A 1XC9A 3MOJB 2CZ9A 3ZNUA 3DLHA 4DF4A 2AJ1A 1WKJA 4QR2A 4RUBA 3ZXWA 2XNRA 1H0HB 3NRBA 4WFYA 1KR4A 2C1EB 2CJBA 4RBUA 3R8YA 3OL9A 4MK7A 3QRRA 5HBMB 3VCDA 4LMZA 2GCFA 2QSWA 2W2QP 1T3OA 4CLPA 2DNZA 2UZAA 2VBWA 3MFIA 1H73A 1H6KX 2YX4A 4CP5A 5IV3A 2HVHA 3P49B 4OYBA 2FB0A 4H4MB 4ED8A 1M5HA 3GFZA 2NS1B 1IM6A 1T94A 1TL4A 3MAAB 2OH2A 3W9HA 3NGSA 1E6VB 4I0WA 4IKAA 2CFXA 1RAGB 1LWEB 4YB7A 1QVFR 4DQSA 1HQUB 2MHEA 4ED1A 3ISND 3NBPB 1XWLA 2F3JA 2ZNZA 5H9EJ 1B70B 2ZHAA 2RRAA 5CQGA 5CXTA 3KLEA 2C3UA 1QDUB 3BGLA 3OR2A 5DG7A 4FYVB 1RWNB 1S4FA 3PJWA 2XLIA 2DNLA 2CXEA 1YTYA 2OELA 1DURA 1TL3B 2D69A 2E1AA 4X84A 3RU0A 4ELTA 2Y9HA 3J81Y 3K5NA 4PG7A 2VPZB 2XSFA 1H3DA 4DX6A 4WE1A 3KHLA 1U2RA 4F0HA 1VQ8S 4QU6A 1F2HA 1RCOB 7AT1B 1FJGJ 2V4JA 3UQSA 2YKNB 4GC6A 3RRKA 3R9LA 3ISNC 2CDRB 2NXNA 2VV5A 4YEAA 3TX8A 5EWGA 3D2WA 4AL6A 3TAQA 3NGRA 2MY8A 3NGTA 1NHUA 1C0TA 5HMWA 4RL1A 1FJCA 5D0EA 4OYPA 3C2PA 1VQNS 2B4OA 2RQCA 1HIYA 1M5KC 4YOEA 3E01B 5E3CA 2KHCA 1RBOB 3QRPA 4K7QA 2KFYA 2FJAB 2WONB 1RK8A 2H4WB 3GSIA 4C11A 3ENVA 4KYZA 3MFHA 1RT1B 2VA2A 4DQIA 3MWBA 1NSKL 2DGVA 3NWRA 4CYUA 3T9ZA 3S01A 2XS2A 2ALYB 3LAMA 3I32A 2FJDB 4KQZA 4K2JA 2V4RA 3GIKA 4RNHA 4WP9A 1RAJA 3ONQA 3OT9A 4ZHRB 1UA1A 4WKRA 1VK8A 5J2PB 2BJ1A 3IFEA 3DDIA 1DLOA 2MKHA 3M2RA 4ES2A 3G96A 2V2VA 2Q66A 1WJ9A 3EXCX 2ZC3A 3UI3A 5JVGQ 3Q23A 2VONA 4C6AA 1BC6A 4Q2LA 1IKXA 1DQ8A 4R8UA 3MEEA 3QO9A 2KG1A 3GV5B 4MYUA 1Z1ZA 2H65B 5A8RB 1FFSB 4ICLB 3QJLA 2AGQA 4DBQA 3W65A 3H5XA 3MTJA 3RTVA 1VRQC 2LECA 2Y1JA 1I1GA 2V67A 4GVBA 4LF9F 2RHQB 5KG3A 2R2RA 2V4JB 2X1BA 2CADA 2IYGA 3CDWA 3QFWA 5KFGA 3KK3A 1T03B 1U47A 2NR0A 3ZZRA 4DUYJ 2DR9A 4M94A 4EK2A 3NGKA 3MR2A 4ED3A 2ASJA 3Q8UA 2CQIA 4DR4J 4ED0A 4NOHA 1XERA 1QY7A 1TV6A 4KH1B 4RBVA 5IT4A 3GYNA 4F2RA 2CPZA 3VVUA 3I0RA 2EC0A 2BYCA 3I96A 4F4ZA 5D15A 2DGXA 3TAMB 4ID8A 1GEHA 1MMNA 4NE9C 1M90T 1MWQA 1R8CA 1WOPA 2DO4A 1OIAA 2LDYA 2RB7A 3AODA 3M8QA 1R7IA 1JLBA 5FDLB 1LXNA 3MECA 3OHBA 2OD4A 1GNKA 4DV4F 4Z37A 5IT9U 4KGXB 1UWBB 5B0EA 3W64A 1C4AA 1L3UA 2UXDF 2RDJA 3OW2R 2QL7B 2CUYA 1XEZA 4RW7A 2LCWA 2RRBA 3QIPB 5K8OA 4DUYF 2FTRA 2JZ5A 1C4CA 5D78A 1X4GA 3VF0B 1KVIA 1QM9A 4HT7A 2DH7A 2Q1LA 3W8PA 4YS2A 3KXDA 5BYSA 2VPXB 4X4TA 2XMTA 3LAKA 4LFCF 2DBBA 4M5MA 3M8PB 4N7TA 3D54A 3CUNA 4KRWA 3DI6B 2HVIA 2DXDA 2QX0A 4QWEA 3GYGA 4GO7X 3MAHA 4QU7A 1U1LA 2CJQA 3HF5A 4EO6A 2WOMB 5J2NA 3C15B 1NZ8A 1ELOA 2RRNA 4YUDA 4JI3F 2HVEA
chains in the Genus database with same CATH topology
2RSQA 2HHQA 3DCAA 3MMCB 4DFMA 1ZH5A 3V2UC 1LK7A 2VZ9A 3HZEA 1LW0A 2N4CA 2CQ3A 4BHQA 5DM7Q 3KLFA 1RKJA 3DN9A 3IGNA 5D8HB 4XK8C 1TK8A 5F8JA 3OJUA 4QYZJ 1CC8A 2GQ2A 1LWFA 5CYMA 4DL0C 1HWLA 2OLWA 1M5VC 2EW9A 5KOXA 4FVMA 2CJKA 2PN6A 4G1PA 1VQ5S 1QSLA 2QO3A 1Y3JA 3AY0A 3VAGA 4BC9A 1S9FA 3EGZA 3M2UB 1TQLA 4RW8A 2YNGA 5BJRA 2ZH1A 1IBLF 3QLHB 2IVMA 1FXDA 2B6AB 4ECXA 1RT3A 4LF8F 1WF1A 2LDIA 3H59A 1LWCB 4UUXA 4UUWA 2IBKA 1URNA 3BSCA 3UR0A 3KK1B 2OFHX 4O3RA 4O44B 4NYPA 1ZBTA 5D4PA 5KFPA 1HL6A 3L3CA 3ZZZA 3R5DA 4Q8EA 2ZD1A 1R43A 2RJZA 3ZZUA 5KFFA 3U02A 2W8KA 1N5QA 1VRUB 3EZ5A 2GHWA 3QZ7A 1Y9OA 1AROP 2AGPA 3FEXB 2MQLA 3CJ2A 3O3LA 3HM9A 1FF2A 1SUQB 1VIOA 4DSEA 4ATNA 4AL7A 2FHKA 1R8AA 4CTAB 5IZHA 3ZZTA 2MGZA 1KOHA 4DFJA 1BQNA 2KVIA 3C6UA 2YKNA 4MFBA 3OL8A 2RF2B 3H25A 3PDNA 2B4UA 2HIQA 2NPIA 2DCLA 2AJFE 2UUTA 2DGTA 4H54A 5F0UA 2E9RX 5KFUA 1JLEB 2M8HA 1FKPA 3AB2B 1FKPB 3W2WB 3X3UA 3O8WA 4GKJF 5KFOA 4JI4F 4MJKA 1FEEA 1FDAA 2ZOFA 2W9CA 1HQEB 1X5SA 4JYAF 3VWSA 5KT7A 4F02A 2Q43A 4BWJA 2U1AA 2LA4A 5CYQA 4DHVA 2FHJD 5J2MB 1TK0A 5M2UA 4TXSA 2YKPA 3BM7A 4OHXA 4ITSA 3SFUA 4ECWA 2ZHBA 5IT0A 2HNZA 1C1CB 5KFWA 4MKYA 3MTKA 2ZD1B 4R5PA 1GTHA 2KJWA 4I6WA 1OQ3A 3KMSA 3CT9A 3T1HF 3AQOA 3C66A 4DN9A 3LW5C 1HBOB 3SDEB 5KFNA 2ZH7A 2ZOGA 3ITHA 2A2DA 4HVZA 1CSJA 2Z8QA 1SJ4P 4WXOA 4I6AA 2XWXA 4CQ1A 1TKDA 3IC1A 3QO9B 4AE5A 4DQQA 5C25A 3Q8SB 3P6YC 2ZVSA 1SL0A 1FNXH 4OJHA 4K4UA 2AF6A 2UUCF 2K1RA 2IMWP 2K1RB 2JH3A 3VR1A 3THPA 5HLFB 3MEEB 1BY9A 1S1VA 4O3NA 1G1XA 3IWLA 3GFYA 2DHAA 5L1JA 2M9KA 5E7OB 3BS9A 1GH8A 1ZM4A 1VS3A 5T14A 4RU9A 1HBUA 2RDIA 4ZP9A 1RT4B 2AGOA 2UVVA 2PI5A 1GXUA 1FRXA 1N8RT 1Z2ZA 4PXDA 5ADZA 1DARA 4OZ0A 2P5VA 4NCAA 2KU7A 4A8XA 4BS2A 4Y6IA 2I0XA 4MKBA 1QAXA 4XPCA 4QPXA 1F0XA 3LALA 4X4UA 4B3RF 3W2VB 1VQKS 4NA2A 2XSJB 3QIDA 3BSOA 4DSIA 4ZP7A 1VOMA 1RWUA 4ECRA 5HROA 4FPRA 1LK5A 4OZ5A 5K8MA 3I9ZA 2VG6B 3MI7X 2DHGA 3HVWA 4IOCQ 2V0NA 3PM9A 4G1QB 4QJVA 1RTDA 4GKKF 3CIZA 3BO3A 1B0PA 3J7A1 5LT5A 1TR0A 4EZ6A 2FHOB 2HNDB 3TUIC 4QIEA 1LW2A 3MCSA 4KAIA 4RU2A 1TVRB 1HMVB 1QE1A 3QIPA 2HYIB 3EXYA 1DLOB 4N41A 4LF6F 4ALZA 4JBCA 1ZETA 1QAIA 2IC3B 1Y3KA 4O44A 4F26A 1TUVA 1G6BA 1YHQS 2UU9F 2LXIA 3KLIA 4IFYA 2RH3A 2D3ZA 2ZM6F 1QUVA 3UR3C 2YNHA 4ZLPA 4DQRA 3OSNA 2ZH3A 5GAGU 1VQ9S 4K4ZA 2ZOMA 5J1PA 4TQSA 1FKOA 4BBYA 3FMBA 2GC8A 5L9XA 1K73T 2GHPA 1P1LA 3M30B 2PEHA 3UW1A 3NCQA 5KT3A 3BR8A 2ZHOA 2B5JB 2B7BB 4XDCA 4DPOA 1UVKA 3DU5A 2WHOA 5I3UA 4E0DA 3NGDA 3VTIA 4IRKA 3Q22A 2HHTA 4X4RA 1QAJA 4DR6F 3SSQA 2YNIA 4HYKA 1IBMF 2GJ2A 3ISZA 2ZH4A 1U6BA 2ZH5A 3QJPA 2AX0A 3DOKA 4MK9A 3G6XA 3CC7S 5E3QA 1K9MT 3J7YU 4KO0B 4CZCA 4ZP8A 4DQPA 2BRKA 3NNCA 1DHMA 2FLNA 2AW0A 4ECTA 1Q82T 2BE2B 3OFHA 4NLGA 3PIOQ 4IFVA 1JLAA 4NCGA 1XMBA 1FHTA 4EEYA 3P5TL 3RB0A 5U47A 1HWKA 5GAEU 2O1PA 3IBWA 2E7XA 4IR1A 2D7SA 1FA0A 4NZ6A 3V4IB 5J2NB 2MKKA 3LP0B 3H5YA 3CCZA 3AQPA 2LEBA 3QYYA 3Q24A 5B0DA 1WACA 3F44A 2AJ0A 3I4HX 4KKOA 4J9OA 1CPZA 2DPJA 1R3NA 3D1OA 4YDXA 2ZC4A 4QQBA 1VRTB 2ZJRQ 3MM9A 3BSAA 1KFSA 2JJ4D 3IS9A 1S0OA 4O4GA 3H2VE 3TYTA 4LFAF 1HW9A 2DGWA 1FRJA 2VH7A 3QLHA 1KQKA 4WFZA 4TU9A 1L3VA 2OPRB 4K2XA 4H4OB 2KXHA 1JJHA 5AXLA 2YWFA 2W4DA 1QLNA 2PI4A 2NZ4A 1RT6A 1X5PA 3PR4A 2PIIA 3JYTB 1V6HA 2F8EX 4TLRA 1FTRA 3E01A 2IRXA 2NYIA 4ELVA 3B78A 3GMGA 3N79A 2AYGA 3HHKA 2VFRA 2WAQD 3QWUA 1RKIA 2W9BA 1K0VA 1DQAA 5K14B 3ZZOA 2QV6A 2Q6BA 2R2SA 4MIBA 4FF3A 3ZFVA 2JWNA 2WBMA 1LFWA 2WW8A 2ZFHA 3POTB 4ZPWR 2EFOA 3G9CA 3QGHA 1X4FA 2PE8A 4K4XA 3BN7A 1QTMA 3I0SB 1HW8A 4URQU 5KT2A 1HR0F 1BD6A 1AFJA 5K9FA 1SJ3P 3NL0A 1KLNA 3NKYA 5AXMA 4ZPDA 2ADBA 2P6SA 1S1VB 2VQEF 3J80Y 1FRLA 3I5AA 1VGYA 3CCJS 3FSIA 1D8ZA 4OJ3A 2J6SA 2IMOA 5L1KA 1G7CB 2CPJA 4TY8A 4C98A 1N56A 1S97A 1T7PA 1SH0A 1Q7YT 2BM1A 3THVA 5F41A 2YNHB 1JXEA 3UDCA 2Q3PA 1NJYA 3JYTA 2DPIA 2PC6A 1J2VA 1Y5LB 4DJBA 1U26A 1OWXA 1DJ0A 1OPZA 4RNMA 4HKQA 5KOWA 2LXUA 4LF4F 1FDBA 1WD6A 2J9EA 2KG0A 3GIMA 2UUAF 4U6PA 4R5PB 3G71S 4DX8H 1NJZA 1RTJA 4DLEA 1TAQA 3CD7A 1KSPA 1XBWA 3CULA 3CD5A 3DM2B 2PMZD 4X4SA 1R31A 1UW4A 3RRHA 1FESA 5GAEI 1DTQA 3HDSA 2XSJA 3TOQA 1H38A 4B3OB 1VMBA 2A2CA 2C3PA 5KAKA 4MH8A 1S9GB 1H7WA 4U7UK 2VFTA 1S9EA 4CO1A 1XN9A 3DYAA 4F8RA 1RA7A 2J5AA 5L39A 2FJVA 3NWGA 4PG5A 3K58A 4JI0F 2IJFA 5JJBA 3BQ0A 2C3MA 4KBIA 3FZ2A 3NP5A 1MWYA 4IOAQ 3JSMB 1NO8A 1S76D 4IFVB 4NCGB 4NLWA 1N48A 1SKRA 1SI9A 2E7WA 2X1FA 5F8LA 3KYLA 4OHYA 5LXRA 3F56A 3G4SS 4KIAA 1N5TA 3MGJA 4UQTA 3D1QA 4KE5A 1KRPA 2XMUA 2HLUA 3N4WA 4URGA 1K8AT 3MUMP 2AYBA 3KG1A 4NLVA 1IBKF 1X0PA 1TAUA 2HNYA 4WJBA 4Q5VA 1SJRA 2DCUB 5HI7A 1N32F 3G86A 5A6WA 5MLCV 4DV0F 2DNOA 1URRA 2R7WA 2CQ1A 2HFOA 2YX1A 1TK5A 3DC2A 2FIUA 3PVXA 2X51A 2XMKA 3M6VA 3DOKB 3CD0A 3W2VA 4EBEA 2VG6A 2W25A 4CT9A 1HBMA 4I2QA 3MD1A 2Z2LA 2OIHA 1U1NA 2D3UA 4OL8A 2CDQA 2OPSB 2O67A 3KJVA 4A8WA 1N5YB 2GFFA 4LSNB 1TZ0A 4LSNA 4PKDB 4Z2XA 4WXWA 3OVAA 2W9AA 1K1SA 4JUZA 3GIJA 4IO9Q 5EX0A 2MZQA 1N52B 3HHLA 1FEHA 2HWTA 4QBUA 3FEZA 4LIRA 1ZPWX 1S1XB 4RX6A 5CD4H 1WWHA 2FVCA 2MZSA 1TKTB 2IYIA 4Q43A 1X4BA 1S79A 2XZWA 2WOMA 2ZJPQ 4A48A 1VRTA 2B4PA 4IFYB 4QOTA 3DLKA 3TA0A 4NRTA 4IG0A 1TKTA 4IG0B 3K5OA 4L3NA 3JB9k 3SI8A 5A8WB 4PUOA 3VQSA 2CPFA 1KOOA 4K4VA 3LP0A 3DLGA 2KB2A 5C5JA 2QFJA 3CC2S 2WCXA 3LANA 3J7ZT 5CH7B 1R27B 2BRLA 2ALZA 1F60B 1XTZA 1LWFB 2AQ4A 5KFMA 2DTJA 5I42A 1CG2A 5EGYA 5F9NA 1FNMA 2OO4A 3C46A 3OQ2A 4LQ9A 1QJHA 2DD8S 2DNRA 1N33F 2BQ3A 2FLLA 3C6TA 3TQ1A 2F8HA 1WEXA 2E5LF 4F2SA 1S1WA 2HNZB 3FVYA 3IGVA 4HLBA 3PX6A 4KHMA 2MQNA 2N3LA 3CJKA 1E6YA 2M5YA 3CO9A 3VAIA 2Y0SD 1T05B 3JTPA 4M95A 2XCAA 3PW0A 4FF1A 3OFGA 4C2MA 2BJDA 2J9CA 3GR0A 3JSYA 5GVQA 2FHMA 4WTYA 1SC6A 3HHLC 5KG1A 4RLEA 1A6LA 4DG1B 3HP6A 1UVNA 2JL9A 2MXYA 3T5LA 2FJEB 4ES3A 4JOUA 2L9DA 4CH1A 4PUOB 5GAHU 4H4MA 2O5DA 4QPTA 3AB4B 2R7QA 4KB7A 4MIAA 2HRUA 2MZJA 3H8YA 5A8RA 4I64A 2AV5A 1KONA 3U7JA 4UQGA 2IBOA 4K59A 4CTAA 2XI2A 1LKZA 2ERRA 2BBEA 7FDRA 4B9SA 4I6YA 4OHWA 2UVUA 4C8MA 2VA3A 3JSMA 4JV0A 1U24A 2QMWA 2XMMA 4NYOA 2E44A 3MMBB 5J2QB 4AXJA 2R8KA 1SQEA 2GA7A 1D0EA 4D3HA 4NA1A 2HS0A 4KGKA 4TKTA 3UDLA 3V81B 5IXUA 3EPIA 3W2WA 1UAWA 2OPPA 3M1VA 3R1LA 2J0XA 1HA1A 2DGUA 2EKYA 1X5TA 4PWUA 3OW2R 2V8GA 4F50A 3QGPA 1JLBB 2FLPA 1FD8A 2V2KA 3CJ0A 3RBEA 2R7RA 4X4NA 3BDPA 2JSXA 4C0OC 2K7JA 1SL2A 1NKCA 1SIZA 4ZVEA 4EBCA 2D41A 1S9GA 2IM0A 5E3PA 2LEAA 2DR8A 2I8EA 3EGWB 1RDRA 3HFKA 3N5FA 2LQ5A 3PRDA 1RT5B 4OZLA 3G6YA 4MKAA 3Q8QB 4K0KF 4F67A 3KK2B 4B08A 2M88A 4TYAA 2YKMA 3OXLA 4K4TA 4RW9B 1YWXA 2VC1A 1M5SA 4EZ9A 4DEZA 4NA3A 3M8PA 3MMBA 1GTEA 3KLIB 4ZCLA 2L9NA 4IDKA 5L1LA 3M6WA 3QJJA 2MHNA 2XGPA 4PWDA 2J7KA 3X1LB 2FC9A 2ZE2A 3PRBA 5AXKA 2N82B 2E9TA 4GO5X 3HHEA 5IQ6A 3M6XA 4WU2A 3TR5A 2R7VA 4DR5F 2HHHF 4BCAA 3JTNA 3CMAS 1YI2S 3CXCR 3DMJB 5FDLA 1SKWA 3OVBA 5CZXA 4WF9Q 2JLFA 2GIRA 2M2BA 5A2QY 3OR1B 3H5UA 3I0RB 2EI5A 2J76E 3GR1A 4N76A 1MROB 1N0UA 1VJWA 3EGNA 5KFEA 4YB1P 2YNGB 4JI2F 2OPSA 1NK6A 3HHLB 4J9NA 5F8MA 2MZRA 4AQYF 1FK9B 2NSBA 4B9NA 3HO1A 2DR5A 2LKZA 1PC5A 4ECZA 5DRKA 3BREA 2KH9A 3KK1A 1HYSB 2WB1D 3MOZA 3SCLE 4F4XA 3LF0A 4B17A 4YY3F 2AJQA 4DL3A 3LUYA 5HBMA 1EETB 1RT2A 3KFWX 4OI0A 2HMIB 3BDEA 4QCLA 4N77A 4C3MA 3DLJA 1X7VA 3BB5A 1U1RA 1O8BA 4KV8A 3TP2A 1L5UA 1U8SA 1GXTA 4E8UA 5B0CA 2DHXA 1UVIA 3S6EA 1TL1B 2MKSA 4KTQA 4AYBD 1GAOA 3PACA 4Q44A 4DOZA 1FRHA 1KTQA 1RTIB 1T8EA 1SUQA 2P9EA 2KKHA 2IM3A 2HVZA 4LVNP 3MXHP 4NX9A 4WFBQ 3I5CA 2C28A 2GGPA 3L95X 3HXMA 2BR0A 3DLKB 3OTEA 2F9DA 2ROEA 3WC0A 1VC0A 3I55S 2LU2A 2IJNA 3NMAA 2J6TA 3M2VB 2JEFA 4RWXA 3U1LA 4K4SA 4G3IA 3BSNA 3GILA 1X4AA 2ILZA 1RT6B 4JI6F 2OTJS 1Q8IA 1W25A 3BEGB 1S1UB 1TFWA 3AJ2A 1V3SA 2HWIA 1REVB 1KQFB 3D5MA 1NK7A 4O23A 1N5VA 4Y34A 3PR5B 1JLAB 2B6AA 2E66A 3K8VA 4IYQA 5E33A 1DBDA 1YVFA 2JHEA 2OP5A 2VFVA 1HNVA 4OI6A 5F9LA 4TU7A 2YH1A 5L1IA 4ERDA 4DSFA 1NEEA 3DLLQ 2WK4A 2KTQA 4R0EA 2VL1A 4X62F 2D3OR 3K5PA 3V6KA 4PQUB 2LEPA 1U49A 2CQ4A 3NS5A 4PXEA 5F8NA 2QE5A 3CCLS 3KLGB 3U1MA 1UVJA 2BUNA 4Y28C 4BDPA 1Q79A 4NLQA 3NBPA 4JI5F 3CB4A 4LF7F 2MKIA 4DR7F 2XBPA 3DRRB 2XCPA 1E6VA 2X3GA 1YQHA 2XHWA 1YIJS 1VHFA 3IS9B 3MUTP 2OD6A 4OV1A 2YQ3A 3M2RB 2H9ZA 1Y5NB 2ILYA 2CG4A 3QGGA 3CCSS 1X9MA 1GX5A 5T7LA 1VC6A 5E41A 3DXSX 2W24A 5LL6d 5GADI 1HNZF 4CO4A 2EPIA 2QA1A 1UJ4A 2XEXA 3PHEA 3OUYA 2L41A 2ZZMA 1KQGB 5GAGI 3DOLA 2DNKA 4Q8FA 2E5HA 1UJ6A 2OSRA 3SFGA 3TW0A 1H2UX 4C8NA 5DDRC 2GQQA 1M1KT 2G1DA 3OUYB 1OSCA 2VUGA 1T05A 1DQ9A 4QWBA 4CH7A 2QA4G 4JI7F 2HLTA 1DTQB 4B3OA 1X5OA 4EFAC 4MK8A 2H5EA 4XIUA 1RTDB 3PKMA 3F73A 3FGVA 3KLHA 1WG4A 1NK4A 3OTOF 1Q8LA 2HW3A 3OL6A 1W2BR 2ZDOA 2DH9A 2O66A 3GSDA 3OPKA 2C42A 4DDFA 1PO6A 2MQQA 1ULRA 1Q7LB 4MAKA 2E5IA 1G2EA 5KFKA