3QJSB

The structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
166
structure length
166
Chain Sequence
DQHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes that occur upon photolysis of the Fe(II)(a3)-CO complex in the cytochrome ba(3)-oxidase of Thermus thermophilus: A combined X-ray crystallographic and infrared spectral study demonstrates CO binding to Cu(B).
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 46
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3qjsB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qjsB02
1PY6A 3NP3A 3IBOA 1GR7A 2YAOA 2ZXWB 1GS8A 4E9TA 4XTOA 4WKXA 1KYAA 2DWSA 1CWQA 3NSBA 2HRHA 2IDUA 3AZUA 3CVBA 4PCYA 5G2AA 1GY1A 4HWLA 3X1GA 3FU8A 2VM3A 3ZBMA 3PPSA 3DDLA 1M0MA 1DZ0A 1V55B 2HLEB 3N2JA 3NJNA 3A7KA 1B3IA 1PNCA 4AX3A 1BRXA 2Y01A 1E5YA 2WSDA 1RCYA 2YAHA 2Y02A 5AZUA 3FSAA 3SBRA 3WI9A 2NRDA 2Z73A 4JQ6A 5TGZA 4KNSA 4E9WA 4N6HA 3ABWA 1MDAA 5LDUA 5DYSA 2ZOOA 4E9QA 2B08A 1OCCB 2R7EB 4IARA 2XV2A 3NYKA 1ET5A 3S3BB 4GY4A 4WTQA 5BR5A 3FSVA 1S8LA 5ANHA 2PPEA 4YSPA 1AR1B 5BR2A 3VW7A 2XU9A 1JZGA 5A44A 1M56B 2FTAA 1C3WA 4HIPA 3QBGA 1GZMA 2XX1A 2EIJB 2PPCA 2IDQA 1AOZA 4M4RB 1M0KA 2YCYA 1RZPA 1TEGA 3FU9A 3NJLA 3IE9A 3FPXA 4BWTA 4MFHA 2YAMA 2YDVA 1ZIAA 1SHWA 5I6NA 4QKTA 2J56A 3NJGA 1PZCA 1MZYA 3WKQA 4KNFA 2TSBA 1KG8A 5H2NA 5B6ZA 3S8GB 2HZHA 1KDIA 1JOIA 5B7FA 3WNJA 3UABA 2AZAA 2Y00A 4AKPA 1R84A 2M3GA 2Y03A 5B1AB 1BXVA 3PQRA 5I26A 5F7BA 4BEZA 3QJRB 2UXFA 3HEIB 1GS6X 4HYJA 4BWBA 1KBWA 5AKRA 1ILSA 1WS7A 4F2FA 4BXSV 3S3CB 3OQRA 4AZUA 4BEYA 4IB4A 4GRVA 2VW6A 2PEDA 5I6PA 1PXRA 2JKWA 3X2QB 4YSCA 2UXVA 3PAUA 2L6XA 5A7EA 1ID2A 1JFPA 4GP8B 1OOWA 2P80D 5I5JA 2BW4A 2YCXA 3ABKB 1AZBA 2FQEA 1V10A 1DYZA 2HPYA 3BQVA 3FYEB 1HAUA 1KV7A 2J57A 2Y1AA 4E9RA 1OE1A 2LLNA 6PCYA 1J9RA 1T5KA 3CZUB 3MX0B 4YSEA 1AG6A 3GDCA 3V2YA 5TK2A 2TSAA 2VW7A 1FA4A 3UTXA 4EA3A 3AYNA 3QPKA 4HCGA 1SNRA 2BP8A 3ABGA 4YSDA 3V2WA 5G2CA 2XYBA 3T9WA 3REYA 4CSPA 2HX8A 4QLWA 1F4ZA 2FT8A 4J4QA 2B3IA 2IAAC 2OV0A 4KO6A 5F7AA 5G28A 1TU2A 2AFNA 3NJHA 2I35A 5B35A 5AX1A 2YAQA 3CODA 1JGJA 5B6WA 4EJ4A 3DKHA 1S53A 1BAWA 1L9HA 1VLXA 2EI4A 3VVKA 2Y69B 3FU7A 4KNTA 1ZV2A 2YXVA 3IN0A 2QPDB 5ITCA 3IN2A 4GP4B 1NDTA 2IWKA 1L9RA 3AG3B 2AANA 1BM1A 1FBKA 2H47C 1E30A 3EMLA 5PAZA 2JAFA 5ITEA 4YSRA 2A3TA 1ET8A 4P5RA 2BRDA 2KS9A 2YDOA 5ETZA 1AZCA 2VN3A 2BWIA 4X32A 1M57B 5B3SB 4TXVB 2WJKA 1L9TA 1FFTB 3HAOA 1PZBA 1SHXA 2CALA 2RACA 4PXKA 1PXSA 2UXTA 4JHUA 2I20A 1NIFA 2CUAA 4KOCA 4A68A 4YSAA 4DKLA 1IXFA 2AVFA 4OV0A 1JZFA 1NINA 3X3BA 3UTYA 1WAEA 1XB6A 2XX0A 3FQYA 5H2KA 1CURA 3X3CA 1GUEA 1VGOA 4BUOA 2MRYA 2KSAA 3KW7A 5H2OA 2YAPA 3H4FA 1QKPA 5G53A 3ZPRA 4A4MA 3WNIA 3HARA 4LDEA 1QLEB 4DPCX 2LNLA 2HXAA 2CCWA 1E5ZA 4CSZA 2UXGA 6PAZA 5A8EA 8PAZA 2YXWA 4G7SB 1LN6A 1CYWA 2I7OA 3OM3B 4YVNA 1BXAA 2XVBA 4MBSA 1OCRB 1OE3A 3WIAA 1CC3A 1AZUA 1EHKB 1JXDA 2VSMB 4DP5X 1PMYA 1P8UA 1TKWA 1AQ8A 5I5IA 3TASA 4L6RA 5F8UA 3S8FB 2IH8A 4FA7B 2XV3A 1UATA 3T6ZA 3NJMA 2CBPA 2GHZA 2ZZLA 2IDSA 1UCQA 5FC9A 2GC7C 1L9SA 1TN5A 3PDSA 3FQ2A 5H2JA 4E9YA 5I6OA 4PAZA 2PP7A 3VG9A 4YSOA 1A4BA 1J9SA 3NJKA 1F88A 5AX0A 3WKPA 7PAZA 4EF3A 4HCIA 1ADWA 4MQSA 1F50A 1NWPA 4P5SA 3TU6A 4X1HA 3PAVA 1NIAA 2QDWA 4MQTA 1AIZA 1S52A 4AKOA 2F93A 4XT3A 4JR8A 4TL3A 3EH5B 3DQBA 1SFHA 2EILB 4A2DA 2HX9A 1IUZA 4Q89A 1ZIBA 3WG7B 2KSYA 1PLAA 1X9RA 4W9ZA 3COCA 3NSDA 3X1FA 1KCBA 2BHFA 1GS7A 1KG9A 5H2PA 1Q5IA 1H2SA 4BDVA 2DYRB 1C8SA 3C9LA 3DTUB 3OE0A 1E65A 5DHGA 3EH4B 2XV0A 3GYRA 1L9OA 3T6XA 3PWHA 1TEFA 3TA4D 4KO7A 5J7AA 4FAAB 2I21A 3D4SA 3ABLB 5JJNA 4KLYA 1NIEA 1KCWA 3CDZB 2PP8A 1NICA 1WS8A 4MD1A 1IC0A 3OMNB 4DJHA 2EINB 2VMJA 1NPNA 3QBIA 5I6KA 4NAJA 1SJMA 2XLLA 2XWZA 5AZDA 4G70B 3EHBB 1QHJA 4Y9HA 1MG2C 1WA0X 3NSYA 5D4HA 4BK5C 2FJSA 4F2EA 1MGYA 4A66A 1MG3C 2BZCA 3DIVA 3HB3B 1J9QA 3UADA 5I5MA 5I6MA 2GC4C 4DAJA 4GP5B 2UX7A 4AKQA 3QQXA 3NP4A 5B6VA 4IAQA 1ET7A 1A65A 2WO3B 3HANA 3VGAA 3NYAA 3VI0A 1W6LA 3C75A 2GB2A 1BYPA 4G7RB 3QJUB 1BQKA 3NJFA 3X1BA 4HALA 1IW9A 1S54A 3ASNB 2DY2A 4ENZA 3S3DB 3QAPA 4X31A 5B1JA 4KO5A 3FS9A 3T6WA 1TN0A 1FBBA 2BP0A 2VW4A 1P8HA 2PLTA 3QBKA 1JVOA 1IBZA 1OCZB 4E9XA 1ZPUA 4YSSA 2WO2B 4GBRA 4N4YB 1GW0A 5AHYA 4AMIA 1BRRA 2X88A 4G7QB 3PXOA 3QDCA 1N70A 2IDTA 4DP0X 1YLBB 1PNDA 2FT6A 4KNUA 4W1TA 4DP8X 1NZRA 4BWWA 1PF3A 3X1EA 1ASPA 1GYCA 1AT9A 1I53A 3UTVA 1JZHA 1XB8A 2BWDA 2IWEA 2QPEB 2UX6A 1SDDA 1WA2X 1GU8A 1C8RA 3OE8A 1RZQA 3AY2A 2OCCB 5H2IA 4BWUA 1PLCA 2ZFEA 2IH9A 4DP4X 1XB3A 4G71B 2PCYA 2Q9OA 4HHGA 4NB7A 4GXFA 2NTUA 1NTDA 2XXGA 1MZZA 3JTBA 1ASOA 4F7KA 4XT1A 3KW8A 1E12A 4DP1X 3AG4B 1OE2A 2J4YA 2H3XC 3UTWA 2PPFA 3U25A 2P80A 4AMJA 3OMAB 4HHWA 1PY0A 1X0SA 4N4WA 1IKOP 2QT6A 3UAEA 2WJLA 4FBZA 1A8ZA 3BVDB 1H68A 1KDJA 2VSKB 3NS0A 1W6WA 4BVNA 2MTAA 3FU7B 2AZUA 2OJ1A 3JT2A 3CAPA 2R4RA 4HAKA 3SBPA 4A67A 3UZAA 2BZ7A 5B7EA 1KBVA 5EN0A 1AZRA 1PZAA 2JFCA 2XUWA 2AT9A 3AG2B 5AWZA 4FPDA 4YVUA 1AAJA 5I28A 4BV0A 1V54B 3ZX1A 3PBLA 1HZXA 3TBCA 1OCOB 4XTLA 1J9TA 5FJGA 1J5DA 1UAZA 3OAXA 4MD2A 2XXFA 5D4JA 4DP7X 4YSUA 1KMEA 3RZEA 3AYMA 1BQRA 1KGYE 4JKNA 4L35A 5E9NA 5B7MA 1X9UA 4K5YA 2IDFA 1JVLA 4RH4A 3PLYA 3AM6A 5B1KA 2JAGA 1AS6A 2FT7A 1VJMA 1S51A 4GYCA 5C1MA 2R7EA 1FWXA 1JERA 4ZK8A 1L9PA 4UAHA 2I7SA 3FQ1A 2YCZA 1AACA 4N8UA 4L0PB 2YCWA 4A2HA 1PAZA 5B1JC 2BW5A 4JHVA 3N55A 4EIYA 3P0GA 4Q8BA 5B34A 1QNIA 4A2FA 3AG1B 1QHQA 3OD3A 3ZDWA 5B1BB 1A3ZA 3NSFA 1JXFA 3NT0A 4K9JA 2ZIYA 2PPDA 3MBWB 3T45A 1O0AA 1NIBA 1M0LA 4JKVA 2HRGA 5PCYA 1AANA 3ASOB 3SBQA 2I85A 4DPAX 2J5WA 3GXUB 2YAEA 4A2GA 1U19A 2KSBA 2BO0A 1XJIA 2QDVA 4KO9A 2EIMB 4GYBA 1X0K1 4NERA 3QAKA 5B6XA 1JV7A 3HAPA 3FYIB 1XMEB 3ODUA 4GPOA 5B6YA 1L9QA 2ZONA 5H2MA 1JZIA 5B2NA 1E67A 1X0I1 1BEXA 1JV6A 1F56A 2GIMA 1GSKA 3ABMB 2FQGA 3NJIA 4YL4A 2BP8B 4DP9X 2G87A 3SN6R 2CAKA 3CVCA 3QBLA 3VHZA 3FSZA 4E9VA 1QKOA 2JXMA 1BQ5A 3QJTB 3ZIYA 3G5WA 1XIOA 3EF4A 4PXFA 4X4KA 4QRYA 3FSWA 3QJQB 5G36A 3AW5A 2X87A 3H4HA 3OMIB 4LDLA 5AFAA 5H2LA 3EH3B 2IWFA 1ZDSA 1WA1X 3T6VA 2EIKB 2YARA 1J5CA 1P8IA 5H2HA 3CG8A 5I6LA 1A4AA 3CVDA 1S8JA 5G54A 3UZCA 2GI0A 3TBBA 3UACA 3C9MA 3ZEVA 1R1CA 3PAZA 1JXGA 2GBAA 1PLBA 1OF0A 3OE9A 4KOBA 2DV6A 2ZWNA 3V9CA 3HASA 2FWLB 1AZNA 1SF5A 3NJJA 3X1NA 1ILUA 2YQBA 5DHHA 5JJJA 2H5UA 2HX7A 2Y04A 5EHFA 5AHZA 1PCSA 1ASQA 3UAAA 3RYMA 1EZLA 4YSQA 1NIDA 3CDZA 3FT0A 3H56A 2VT4A 4WW3A 1AG0A 4UHRA 2I1XA 5B0WA 2GSMB 5LWEA 1GY2A 4XTNA 2PP9A 1A4CA 2X72A 1L0MA 1CUOA 4DP2X 1OV8A 1BYOA 2VM4A 4M3HA 4BXVA 4A2EA 1CYXA 4LDOA 1E0PA 1W8EA 1JZJA 1HFUA 3L45A 4UANA 2PCFA 2Q5BA 5G2DA 3UGEA 4AI7A 1Q5JA 5TK4A 3FPYA 1SDDB 1SF3A 2CJ3A 3ZPQA 3T71A 1JZEA 2YAFA 4UG2A 2N0MA 5D4IA 5IY5B 1IBYA 3ERXA 4BDVB 2RH1A 5JJEA 1HAWA 4NC3A 4HYXA 3WQJA 3HAQA 3MBVA 1AP9A 3V9EA 3NY9A 4E9SA 1DZEA 1IW6A 4XXJA 1SFDA 2BP0B 4QI1A 3UONA 1M9WA 2FNWA 7PCYA 1QM8A 4YSTA 1KGBA 2FQFA 3PXLA 2DWTA 2FQDA 4G72B 2J55A 1AS7A 2DYSB 1AS8A 3QJVB 2PPAA 2E86A 4QIDA 4WAVA 3RFMA 4HCFA 5KKHA 1URIA 1ZDQA 1BRDA 3SQRA 1RKRA 9PCYA 3PCYA 5A45A 3NSCA 1R2NA 4DP6X 2Z55A 3OE6A 3NY8A 1ETJA 1BXUA 2NTWA 1NPJA 2W88A 1N68A 3KJ6A 2F95A 3IEAA 4UF7C 4DPBX 3QJSB 3D12B 1NWOA 2R4SA 2W8CA 3UG9A 4HZ1A
chains in the Genus database with same CATH superfamily
5BO1L 5J9PB 1I1RA 4QRSB 3HMXL 2VDNB 3GTNA 2EYRA 3STBA 2IWGA 5DXWA 3Q1SL 5I0WA 1ZAGA 5H37G 1NAKL 2HAZA 3S36X 4HUUB 4UQ3B 5HVFB 3FC8A 3P0YL 3AZUA 3KCWA 4FL4B 1TVHA 3OKEA 1OO2A 4Y1TA 1CFSB 2Y7QA 3H55A 3MUJA 2YEVB 3JWNH 2W95A 5JW3L 5D4JA 4JFEA 1DZ0A 4CW1A 4QOKB 1PNCA 1EDQA 3DRQA 4OCXH 1ORSB 4OCSH 1G1KA 3P0VH 4ENEC 2YAHA 2F54E 2Z91B 3I74A 3L3DB 3BMWA 3ZT7A 1IE5A 2Q3ZA 4OF7A 3W11C 1HH6B 3WSQH 2OMXB 3O6ML 2K7PA 1N0LA 3CK0L 5BZWB 2MCPH 5AZEL 4E9QA 1ESOA 3P9WB 1ZY9A 4PJHA 2BJML 4AZ8A 2AS5M 4GY4A 3CFIC 4HK3J 1A7NL 1MAKA 3VGFA 2QJDA 1KFGA 2XU9A 3ISWA 3NFSH 2G0KA 5JO5B 1I7UB 5GS0H 3GBMH 3S36L 5DI8B 4KXCA 3QI9A 3U0WH 3SODB 5AYQA 2QZ5A 4C56A 2WYIA 1SYSB 1DE4B 2M2DA 2OXGA 1CG9B 1QUPA 4YHIB 1XGQB 4JRXB 1X5AA 2WWMD 5DRWB 1Q9OB 3RJOA 3KXFD 4X4ZA 3IGKA 2C9UA 3VXOA 1B9ZA 1Y18B 4E41A 5KSBA 2ZYSA 2A73B 3QUXA 4QRRD 3GGWA 1Z5LB 4J4PD 4Y19B 1RULL 5AB9A 3D4YA 4NZTL 2EKSA 3ZDYF 4ISVB 4KK6D 4LB8A 3NN8A 1S78D 3X2QB 2X0UA 3SE8H 5EUKB 4PJDF 3ZGHA 3TF4A 3D87B 3GMOA 3W38A 1DO6A 1S7TA 4L05A 1LNUA 2ZOWA 5KBPA 4EI5D 1Y0LB 3SDAC 4NO5A 1RY7B 1XH3B 2WMPA 2H9GB 3BQVA 3OSKA 4UUJA 3HUJF 2UY7A 4G5ZH 2YZ1A 1A9EA 4HK0A 2HPTA 5KSUA 5EZJB 5KZCB 4BH8B 3DUSA 4KXZI 3V2YA 3ZTNH 4YDKH 2KL6A 4QHNB 5T5NF 4JUSA 4NQCD 5H4ZA 5GZNA 4ZS7H 1W9XA 1M6OA 3BKYL 5BNXD 3BHBA 4KRPD 4R96A 1A5FH 4FN0A 5F89A 1OP4A 4K3DH 4F2MB 3EO9L 1FHNA 4XNMB 3TNMB 3DLQR 4ACPA 4LCIH 1RVFL 2XKNA 1NKOA 4K3GA 5SX4H 5IB3B 2FEDD 5IHZA 1WFNA 1NJ9A 1PPIA 2CLZB 1NH6A 2QMKA 4GLRI 2XJKA 4KNTA 3V8OA 3VI4A 1BM3H 2EECA 1WFMA 4FNLL 3X13B 1EUUA 4UU9B 3D4GA 4OZIB 3N44F 2FUTA 2Y36H 4I77H 5ITEA 2HVKA 3OLDA 2C9PA 5D2LA 2YDOA 1AZCA 2FX9L 3OKMB 5K1VA 1IVTA 2NX5E 2NY2D 3VFNA 3R19A 2AW2A 5HHPA 2XTJB 3WDJA 3HE7A 3SCMA 4U1NB 3MLZL 3VE0A 4PGEA 3HZKA 3NQKA 4HUCA 3P1VA 4AITA 2ZKWA 2FZ3A 1IE4A 1MH5B 4NLAA 3H2QA 3N1MC 4XAKE 4ODSL 4YBLB 5A2JH 3ECVA 2LOEA 3T8VA 3VFVA 5CJXA 5D96C 3CPUA 1CLCA 4PWGA 4MD5A 5DC9B 4S0SD 1D9KB 2B1AH 2YD5A 4N2MA 3A6CL 3P4NB 5I1CL 5G53A 3HARA 4Z7VB 3SD2A 5IVXF 3QDAA 2DKSA 4PHXA 3UTTD 4LPTA 4AVHA 1YNLH 3KEHA 3MLZH 3VB8A 1JN6A 1BZ7A 1JMXA 2UXGA 4A6YA 1DVXA 4ZNEE 1XGUA 3JZYA 5D7JD 4QY8A 3LRKA 1HL8A 4JM2A 1CYWA 3MJGX 4DKFH 4IU3A 3QQDB 4PJFF 2D4FA 2E7HA 3WLWD 1JYXA 1BXAA 1WBYA 4LGRB 1CC3A 1JXDA 2H32H 2YPVH 2EDHA 4P2CG 4YZFE 1AQ8A 3ZK0A 1TTGA 2VDLB 5I5IA 3AT8A 3S8FB 1TPXB 3ECQA 1SBBA 2NW2B 3H6JA 4OCMC 3RWGB 3WFEH 2W38A 4I1NB 1TZHA 5IBUB 2FD6H 4LGPB 4XNYH 1SHMA 3CSTA 1SHSA 1I8MA 3A4FA 1WAAF 2YJQA 2I9LB 2WJ7A 4ZG1A 1AMXA 1HKFA 3S3PA 3DTXA 3ILDA 4APXB 3KLDA 2UZIH 3QHFL 4M5TA 1UG9A 3EBHA 4D7BA 2PETA 4XN1A 2AQRA 2MKWA 5BRZB 1CFQB 1KBGL 4XCEB 5E5UB 4WSJA 2IAMA 5CLYA 4Q89A 1ZIBA 4FFWD 4J5VA 1U8HA 4ELDA 4MJIB 1KG9A 3A23A 2P8PB 3GLZA 3T8XB 2VQ1A 2ZUUA 5GS1B 2JWYA 2PO6B 2VZOA 3DTUB 4J3OD 3FH7A 1MRDH 1SGKA 4PLJD 3EFFB 5BV7L 5I66B 3G6JB 5B1CA 1YG9A 2YGVA 1TEFA 4YC2C 3EBAA 3JV4A 2CH8A 3C5ZC 3Q2NA 3CLFH 4JRYB 2ADFL 5D1ZI 3P0YH 4Y4FD 5BS0A 1XCQB 1TYRA 1IC7L 1NOFA 4PJ9B 1DP0A 1NAMH 1R24B 4U1GB 1INQA 1CU4H 4Q9QL 2VZUA 3UTPD 1PSKH 2LU7A 4CRPA 2DIJA 2UUDH 5GGUA 4QHLA 3ESNA 1MQKH 3R8BB 3UPAA 2VXUH 4CGUB 1UT9A 4Z5RB 3SY6A 2FJSA 5FR3A 3POCA 4NEHB 4IMLB 4FE9A 4AL8C 1J9QA 1HXYA 4IBWA 4HC1L 2GJRA 4FJ6A 3HFMH 1HEZB 1K72A 2NXZD 4MQTB 2J71A 5EIQA 5LO7A 3AWEA 1BOGA 3B1TA 1UWGL 2WO3B 3C75A 1U8LB 4OBRA 3FO0H 5H37H 3DOIA 1NANI 4IRSC 3ZHFA 1ACZA 2HLAA 3KWWA 2CKBH 4APQC 5D1QD 2WLJA 4LBEB 4ENED 4X31A 1FYTA 1JZ7A 1ZPLA 1BVLB 1LQSR 2BP0A 3TPUA 1FHGA 4PJBB 3GSNH 2NY3D 4HUWB 4NRXB 3F7YA 3DMMA 3SQBB 3PAYA 5DUPL 5GRUH 3Q0HA 2GSGA 2EEAA 4MQ7A 3QIUB 2JV6A 4P5TD 4UINL 1AD0A 5FDYA 4BK5A 2X70A 1CLZL 3MRFB 4GKOA 4DP0X 1I8IA 2R1XA 1CD8A 2C9VA 3VFPB 3GKWH 4KNUA 4ZTPH 2VN4A 4QHUA 1M2VB 1YEIH 1IC5H 3RVTC 1JNNH 1LO5A 3TCXA 1RZKC 3RPIB 2DB8A 3VYOA 5FHAH 5FAAA 1ASPA 4WI5A 2WTRA 4KMQA 3UTVA 3OKOB 2FWOA 1E40A 3LRSA 1PCXA 3PDDA 2G5RA 3AY2A 3Q44A 3SDAA 5KBKA 3KNBB 4G71B 3M1BB 4NB7A 1DJZA 2DTML 1X5YA 2VXQL 4XP9H 5JW4M 3FB6B 3FQXB 3VQMA 1MWAB 4DP1X 4KKLD 4NNYB 3ZTNL 5JNYB 2ADIA 4HZLB 4HX1B 3VD3A 5FOBA 1EMTH 3QIUC 2WJLA 2RFXB 4P8QA 3TYGH 1QLEL 1DQTA 2FJFB 4AQZA 4FMKA 2G2RA 2C3WA 2IANE 4IBSA 4RDQF 3F01A 3FO1A 4NRZB 1B2YA 1D6EA 3U36A 4F57L 1NBYA 3FUIA 5I28A 2F68X 4IBLT 4Y2NA 5E4AA 4I5BA 1WGVA 5AQ0A 5C0IA 1JGUL 2TRYA 3ZJAA 1FIGL 1MOEA 4LDCA 2ICCA 3PREA 1DBMH 3U7YL 5K9KB 1GL4B 3CFEA 5KANG 1KTDA 1FPTL 1F0LA 5A3ID 4RH4A 5FYLE 4K9EL 3RDTC 1DVFC 1M05A 1H8NA 3KPTA 4XCCH 3BVXA 1P4BH 1L9PA 2I7SA 2CPUA 1AACA 4PEEA 3WXVH 4B9KC 5I1GL 1G7IB 2F53B 1TUPA 3DK0A 4EOWL 4UILH 1ORSA 4JRYE 2KT6A 5DVOA 2OPCA 4AEIL 4ELMB 4F8OA 4RDQG 1RK1A 2ICWI 4JRXA 2ZYIA 4JKVA 2HRGA 3G6JE 5F8RC 3WAJA 5IJVB 3QDGD 4R26H 4OAWA 1KXQE 4A2GA 2BSSB 1MI5A 4KX8A 1Z9NA 2X12A 3BH9A 2MWCA 3EBGA 3T08A 4MA7L 1I85A 1G6RA 4G7VL 4NERA 4WV1B 1CBJA 1QFOA 3F85A 4HAGA 4NT6A 3GDBA 3HG1A 1KGCD 5B2NA 2WZPD 5ESQB 2B20A 4DP9X 3QISA 5L2KD 2CAKA 4J3BA 1K9TA 1QVOB 1QKOA 4NUJB 3DVGB 3GRWH 3SPHA 3QDJE 3CFDB 1T0OA 4JY4A 3OMIB 4WU7B 4X6DE 3ARDB 4KFZC 1ZLSL 3BYTA 1VADB 2YA1A 2J6EH 2WNKA 1Y6KR 3CFKB 4FNPA 3DJRA 4XTRC 2W9LA 2HFGH 3QUKA 2FGWH 3QRGL 3TBBA 3C9MA 3TVMD 2GBAA 3QCTH 1PLBA 4OZ4B 1EJOL 3QEHA 4AEHL 1DDTA 2IFGA 3DX8B 4UM9A 3B3IA 1IGIH 2GT9B 2H5UA 1FAIH 1CFMA 1P7QA 1ADQH 1TVBA 2VT0A 4GMSH 3ATBA 3G6DL 5DJCA 2JKIS 3ZYOA 1UFGA 3K1KC 4L8BB 4KXAA 1I82A 4TQPA 5DQJA 4IMLA 1IGIL 3QEUA 2LW3A 1GPOL 2R23A 4XNMA 1NA8A 1ADQL 1CYXA 5D1XA 4DK6A 5IMMB 2NX5B 3DUUA 1XF1A 4BCZA 1VF5C 3TCTA 1I4FA 4AIOA 5JJEA 3D2TA 4WKZA 3FMGH 5SWSA 4WHTB 5GPRA 5EN2A 2DM4A 1GTNA 3VSVA 3EFFA 1XX9C 5DMJB 2Y5QA 3L4YA 2FQDA 3WEMA 1MFAL 2K8QA 5C0RH 3QB7C 5HPOA 3FFDB 3L5WA 5FO7B 3EO1A 3JVFC 5C0DB 3APMA 4P23B 4NM8L 3WNKA 5IFHL 5CLXA 2I9LA 4JFDD 3VFVB 3FQRA 2GK2A 4S1DC 5E0FA 1KIUA 6FABH 1AR2A 2DICA 2W88A 2ZICA 3KJ6A 3IEAA 1A3LL 1TZHB 5DEFB 5C6TL 1IGFL 3O2VH 4ODTH 3UTQA 3LZNA 1MFAH 5DF0A 5SWZE 2GB2A 5IGXH 1T03H 4UNTA 4ZTPL 3DHPA 1YNTA 4XMPH 2VR6A 4PJDA 1RIVH 5FM5M 3IJYB 2FSEA 1CR9H 3ROOB 5F7LB 1KG0B 3BGMB 4CNIB 1XGPA 4UT9A 3KYMB 2YD4A 3L4ZA 4JFZH 5FGBA 1S9YB 2ARJQ 4GAFB 1LP9E 3KPPB 2B9BA 2G60H 3DX9B 3J07A 3L3KB 4A7GF 4AX3A 5ICYA 2KS0A 5IGXL 3UPRA 2W92A 4FQ1H 3VGHA 5AZUA 1PKQB 4MHHG 5F6IB 1E3ZA 3KPRA 4E9WA 4DERA 5DYSA 1ZJAA 2LLGA 5GRZA 1U8KA 2XV2A 4FFYH 4QRAA 1BWMA 5CP3H 2YA2A 3RIFK 3MVSA 4NZ8A 2E27L 5DZAA 5DU7A 5A44A 3GWJA 4NKOB 1KTRL 4G9DB 4R84A 1X5LA 4M4RB 4XN7A 2A7BA 3FB7B 1NKRA 1YAIA 4IIZA 3STZB 4DZBB 2OMTB 2Q8BH 4CMHC 2Y6TE 4L9DA 4LASH 3VG9B 1RUPL 4KNFA 3LOWA 3PF2A 5H2NA 2AEPH 3UBXI 1F4XH 2F9BT 3K3QA 1DVFA 3O45B 4FG2A 4QCIB 3UABA 1EHLL 5CMAB 5DO2D 2H7WA 1AQHA 3VWKA 1EAQA 2XIIA 2IG2L 2XN1A 3IJ7A 4LLWB 4TQEH 3S37H 3VXPB 4QOKE 2UXFA 4K5OA 1OK8A 1GS6X 3HEIB 1KBWA 3PIQA 5L2KE 2Z91A 1CFNA 3C5SB 4R97B 4NN6C 1CXHA 4A55A 2ID5A 2ZSVB 2HLFD 4Y5XC 5HDRA 3ME0A 3NZ8B 3JUYA 4PJBF 4PJ9D 4ICWA 4FL4C 4QRPD 1OWRM 4C55A 2BW4A 5D4QA 2XWBA 4EZMA 3ABKB 1J8RA 1AZBA 4GPVA 1V10A 4PW4A 2CLRB 5IQ7H 1NEZA 4FI7A 3QEUB 4MSWA 3WMQA 3D52A 5HD8D 4MDJB 3GDCA 5DI8A 4JHZA 5AZ2H 1QUNB 3BIKA 2BVTA 2EDKA 3KXFB 3PJSA 4UQCA 4Y8AA 5DWUH 5B3NA 5J9PA 4J3WA 1B88A 5JPMA 1QSVA 3FT3A 1R3HB 2EH8H 1U8MA 3EJZD 3LXAA 3MJ9A 3V4UL 2YD3A 3OKDA 4LLYB 3SPJA 5DJ0A 3QZWG 3RGVA 3SZKC 1F3JB 4MA8L 2LTQC 3GMQB 3QUYC 4IGBB 3CVHL 5CSZA 3UZQA 2JIXD 2X6BA 5HGGS 2K6ZA 4FQ2H 1INDL 4ONFH 4W9JC 5HDQL 1CGWA 4OR1A 1G4MA 2QBWA 1NDTA 3SKJH 2X6MA 5ANMB 1F4WH 1VKXA 1KNOA 1W0VB 4MXVE 1OAZH 2P24A 1PLGL 3INUH 4OF0A 5AW8B 3P73A 5I30H 1TQBC 1PEWA 3EDEA 3BH9B 3QG6B 4TMPA 4W9FC 1BQHB 1HE7A 1W0WA 3WCYA 1G9EA 1L9TA 2F74A 2VXUL 2APSA 3L7EA 5EBMA 4A68A 3QULA 4KOCA 5HGDB 4LHQB 3RWHA 4BA8A 3VXQB 2VDOB 1OD7A 4TUUA 1KEGL 2MIZA 4F93B 3CZEA 2IGTA 1DQDH 5F7EH 1ZS8B 3UAJA 2VQTA 1OQOA 5IB1B 4XNXL 3D1MC 1YMME 3WNIA 1S9YA 5JOPD 1T80A 4XXDA 5IQOA 3L3KA 4AYBA 3RIAF 4WY7L 4KKZA 4PRHA 5J6HA 1RK1B 3ZUCA 1UB5B 3OM3B 1Z1WA 2Z8SA 1T0NA 4L4JA 1P4IL 3VXRA 4ZI8A 5LQBL 4ADGA 5C0IB 1TKWA 3P11H 2F1BA 1OT1A 4XNXH 4YLCA 1IM9B 2OMUB 1NEZB 5DLMH 1CLYL 1A6ZA 1HQ4B 2V6HA 4DK5A 3T6ZA 1O5DT 2X1QA 1G9MH 4OLZH 2DQCH 4L1SA 1IFRA 5C0DA 3K72A 2E7MA 3TT1H 4WY7H 2GC7C 2O5XH 3EYQC 4RVBA 5DEZA 4YDLB 1XGRB 3NEEA 4RGNC 4HT1L 1A5FL 2IXQB 5JA9A 3TBVA 3GJFH 5K93A 3UEQA 4BEIA 4Z77B 3B37A 2ZCHH 5JPNB 4PP2B 2F93A 3O6LL 3STLB 1XIWA 4PGDA 3GSWB 1J8SA 3B1UA 1UOKA 3KYOB 5F7MC 4DTGH 2OBGA 3H2PA 3NIFE 4ALAL 1TCMA 4KROC 5K9QI 2ZSVA 3T6XA 5DHGA 4CADB 3PWHA 3QUKB 3VFMA 3CLWA 3IK2A 3U48A 3D4SA 1HIML 4KX9A 2YKLL 3NFNB 4M9PA 1AD9B 2PP8A 3A6BL 3D0LA 4HUXA 1YEGL 2D73A 2IBZY 3O2DL 2A9NH 4NAJA 3UC2A 5H4YA 1OB1B 2ALAA 3IPBA 3MR9B 3PGCB 1QP1A 2VLRE 4ZUVB 5HHOB 2WBJB 5D4HA 4L8BA 3FQUA 3ZR5A 3LKSA 4JFOA 4QLRA 4X99A 4PTUA 5E5MA 3KVQA 3DIVA 3FQTA 2FO4A 4FG0A 4X6CE 1Z9SB 1SXSA 4R3SA 4GSUA 1ULVA 2VH5H 1JWSA 4JDTH 4KTEL 5CEZL 4IAQA 3LIZL 5GSRB 1A65A 4PGJA 1CD1B 3VGAA 3NYAA 2A9NL 3QFDA 1IGMH 1XEUA 3U0PB 1B6UA 1BYPA 1DJXA 3BKML 3OR7A 4P2QD 4HEPA 3DJ9A 2ICWB 4PMEA 5J12B 2R39A 1A02N 5A1AA 1E8XA 3FZUD 3GRGA 3F00A 1IRAY 3LQZA 3BAEL 2JKLA 3E2HC 4PTTB 4D0BB 2Y3AA 3WFEL 4OFVA 1U4EA 5DZ9A 4YHLL 1SVZA 3X12B 4Z7AA 1RJYB 4DQAA 5C0JB 2XWTB 2DQFB 5LWYL 3NH7H 2FT6A 5L4MA 3A67L 3C12A 1JAEA 1UEYA 2P43B 3Q5YA 1S9WA 3MRHB 3RFRA 4YPGB 2YQ3A 4R2GC 4LLVB 4HKXB 4P5KA 3DHUA 3RWFA 3CSPA 1AHWC 2P7TB 3WU1A 4N6QA 2NCMA 1MFUA 4XPGL 5DD1H 5GISH 3GXPA 1UD4A 3UBHA 2XZAH 2NTUA 2EE9A 5ITBL 2L3BA 4P4KD 1A9VA 5T1JA 1PZ5B 3EOAB 2F8VA 4A7GA 1QSEA 2H3XC 5I0XA 4A6YH 3WJLC 3U25A 5IMMA 1TF4A 4I13B 1HHJB 4XNUH 5C9JB 3AT9A 3VMPA 2OS7A 3ZGIA 3F7LA 1QASA 2R1WB 3KPSD 2AZUA 3IU3A 2EH8L 1IC7H 3DARA 2X4QB 1WIPA 1AZRA 2YBRA 3KLLA 3AG2B 5AWZA 5MEQA 1I1AB 1XBDA 5KYUA 2EE0A 1XR8B 5FKAB 1NCBL 1PFOA 4X9FA 3TBCA 1G5GA 3V6BR 2Z31C 4Q74A 1YJDL 3B2PA 5A6LA 1F8TH 5D2NA 1H9VA 3OKOA 2Y7LA 5B7MA 1X9UA 4Y88A 3BSZH 5EC2A 1IM3D 2Y4SA 1H3TA 1FRGL 1VFUA 4MDJA 3EG9A 5LCVL 3BPLB 3PXJA 3CFTA 2O6PA 2LQRA 2R7EA 1DR9A 2RQEA 3SKMB 4M1CD 5LVEA 5AVWB 4K5MA 1IC4L 2ZAIA 3QUZA 3V0DA 3LEVH 3GS4A 2GTZB 4XNAA 2CO7A 3K8KA 3NT0A 4HUWA 1MWAH 4NRXA 2HT3D 3C5ZD 5L6YH 4JZOA 3C8DA 5IEHB 1O0AA 1B4JL 4QAWA 3BCFA 3SBQA 1H0DA 2C4FT 5DVMA 2Q87A 1U8JB 3EJYD 4X9HA 4O4YH 4LL9A 1ERNA 3LDBB 4XI5D 5DJXB 3UJTH 5CJ5A 5I19L 5HYSB 1HDMA 3L1EA 3OKLB 1BAGA 1OGAD 4KJPD 4DKAA 2VMFA 3C09C 4M7LT 4NM8H 3WHE0 3ABMB 3V0IA 2FQGA 3OZKA 4YO0A 3ARZA 2G87A 4Q9CA 5KVGL 3TL5A 5F96L 3IGAB 3LSOB 4IRZH 3OC5A 3Q6FA 2F19L 5E8NB 2X6UA 1ODAA 1HHKA 1OEZW 2ZJSL 3HAEB 3D39E 3MA7A 3AW5A 4X4KA 1NSNH 3O9WC 2ICWA 4UT7H 3VD1A 1OAKH 2ZOKB 3L3HA 3U9UA 2EIKB 4AJ0A 3ULVH 4BM7A 4QRUA 2DBJA 2XA8H 2XVKA 3UZCA 1U8OA 2XQ0A 4CMMB 3EFDH 3UACA 3MKKA 2TRHA 2OSLA 3NPSC 3C87A 4ZTEA 1D7FA 4HDIA 1I1YA 3O6LH 4XC3H 3F8UB 3NJJA 2Q86B 1ILUA 3TVMC 4GO8A 4LSQL 4KWUA 1JGUH 3LKOB 4HJJH 1QFUL 4YDIH 3U7YH 1A6UL 5F7UA 1IM9A 1W72L 2WUBL 1AP2A 3E9UA 1NC4D 2WGXA 3VG0H 2NNXA 4NJAL 3V0VA 5B0WA 2V7HB 4QHNA 1DQJB 3EUDA 4FF9A 1D2OA 4ADIA 1GYWA 2E9WA 4FABH 1MCBA 3Q2LA 1R5WB 4C59B 2K45A 5CWSA 1I7TB 1K2DA 1FNFA 2FO8A 1WC7A 5DJDA 3RL1A 4PJEA 3A4AA 4WJ5A 1IJ9A 3L45A 1IKNA 3IJ9A 2WVUA 2CKNA 2EVIA 5IB1A 1X7QB 4YNYA 2A74C 3QUXD 4M03A 4QRRA 3UTTE 3WKML 1UUNA 2JIXB 2OI9C 4J4PA 3ZHDA 1QSEE 2YPKA 2PN5A 4Z7WE 3QUMA 1MFNA 3LY6A 3RNKB 1O9ZA 1NUGA 2IANA 3BPLC 5ENWB 4X9YA 1BZ9A 1O6SA 1KCVL 1VFAB 2DWTA 2CKBB 3O4LE 3PXLA 4U6VL 4I3GA 3U30B 4EAEA 3NFNA 3HE7B 3SCMB 2OTPA 2ICEC 5IQ7L 1JDCA 5DJZA 5FWRA 1Q72L 1B9KA 1J8HA 2UWEE 3UZVA 5KSAC 1KNOB 2GVYA 5FXCH 1FFOA 4XCNB 4Q0XL 4QNPE 5C08A 4KKRA 3W81A 1JL8A 4HK3N 2NW2A 5CJ8A 2BLFA 2Z31A 1WTGT 4RWYH 2VKXA 2ADYA 3GNML 3BW9B 3PP3K 2R2EB 2FK9A 4LPCA 3TYFB 2Y7SA 4JG0L 3UG9A 4HZ1A 4EI5A 4RFNC 2B39A 2A9ML 3HG0A 1ZOXA 1L0QA 2DWSA 2A9BA 3OLIA 4BFBD 5A2IH 5KJRL 3VDBA 4AQ8A 4XPAL 4EI6A 4ONHB 4X5LA 4Y2DB 4ODXB 2DLGA 3SDCB 4FHKA 2HUEA 2ADJB 1KIPB 2XZZA 1BECA 5GZND 5FLUA 4R4FH 1XR9A 3IWUA 5T1LB 3VXMD 4KZ0A 3B56A 5LGJB 1S9XA 2MCG1 4E5XB 3OZ9H 5JXAL 5KJRH 3RI5F 3CH1A 1S7TB 1KOAA 2B9AA 4YLQT 4IARA 2CRMA 5D2NB 3OPZH 1YEDA 2ENSA 3O8XB 1OAUH 5FA3A 3G04A 3IETB 4KVCL 4PRDB 2P28B 5D71L 1AJ7L 1EXUB 1JZGA 5E0QA 1A9EB 3QBGA 4U2YA 4KKQA 2ZNWA 5AKVA 5F2FA 3RIFF 3EGXB 4OM0L 4I48A 3SE9H 3FAXA 3BVUA 5MHSE 4MCMA 1UADC 4CC4A 4RMQA 4KKPA 4X7TA 3VM7A 3EADA 3QUZB 3SDYL 2IPTL 5I8CA 6CGTA 3L9BA 2APVA 2WKOA 4ATTA 4Z77A 1SVCP 5HYJB 2Y00A 5CU5A 5D71H 3L5XL 5FEBA 4A2MA 3O4OC 3LIUA 3LZFL 3SY0B 3KL0A 5BW7A 2G5BB 4GRVA 1QBML 3U9WA 1UYWH 2PW2A 4OM1L 2JKWA 4NHUB 2V7HA 3CVIL 4DUXA 3O3AB 3SDYH 3ALXA 3BXNA 3D5OF 2IGFL 2EYSA 3OPUA 3IRCA 3NA9L 1MCSA 1K5WA 1ROWA 3RNQA 5CZVH 1MFEL 2HFFB 5A2CA 1G1OA 1NFDA 3T04D 1SY6A 4QRBA 1Z2KA 4LMQI 2NY3B 2OSWA 2E3VA 4OKVA 3MV11 1JDAA 3MUY1 2WGNB 2WSKA 4KKCD 5IHLB 2J1XA 4U1SB 3BUBA 4IM8A 2UWEB 4CSPA 4XCFL 5SV3A 2BNRE 4GXUN 3TN0A 2AEIT 1HHHB 4BFJA 3MXVL 3T3PF 5DHVA 4P2QE 1JZ2A 3AROA 5DYFA 4OZGF 4O9HL 1ZTXL 3V5KB 3KE0A 3LJ3A 4FOMA 3QO1A 4JMXA 1ZT7B 5ESVB 4RA0C 5F7NC 4Z7WB 4JM2B 5MENA 2BK8A 2A74B 2MPVA 2WQUA 2ADIB 3AG3B 1FBKA 2V5SA 3BH8B 2YGPA 3QH3B 4XP1H 3RX7A 4DFIA 3IF1A 2X5PA 4OJAA 1G43A 4LLDB 2HT2D 2KS9A 5ETZA 3BISA 5JW4Q 1N67A 4KQ4H 1RJYA 1N5AA 1PXSA 1Z3GL 1OLLA 3LRLA 4I18A 1YY8A 4X5PA 4YSAA 3N1FC 4LFHG 4YHML 4PCTA 4PJAE 4O2FB 1A6UH 3W1ZA 3QJFA 4OLUL 4JZJC 1VGOA 1MDTA 1FNSL 2VJ0A 2YAPA 3GEFA 3GSUB 1XSKA 3TNMA 1FYTD 4KRNA 3UC0H 3S37L 4OLYH 3NEOA 2X9XA 2ISDA 4AT6A 5GRXG 1BFVH 4RISH 3K2KA 4YHMH 4G7SB 3QPQC 5LGJA 2APWA 2JQAA 4OLUH 4LKCA 4PJFA 2XG5A 4NSKA 4HFUL 2ATKB 4Y4KB 4C4BA 5CBEA 3WD5L 2JI1A 2EACA 3PDOB 3Q1EA 2NZ9C 5IMOB 2YC1B 3EUUA 5GJSH 5JHLA 2G4EA 2Z7YA 1CE6B 2WBWB 3K4ZA 3AITA 4ODWA 2DBLH 1EZSA 1M3IA 2VZTA 2NY1D 3A4DA 3N85H 1SOKA 1I1AA 1CT8B 3GHEH 4X2UA 1TSRA 2JB5H 5FC9A 1AQKH 2BIQA 5AOMA 2DJUA 3BJLA 3K6FA 5EIVA 1NFDE 5K39B 1T1WA 4A04A 1WEJH 1S7RA 2JTDA 3RGHA 1B3JA 1MCHA 2PCPB 2QDWA 1UWXH 3EH5B 3DQBA 1R3IL 2XKUA 4XXDB 4BKLA 1M7IA 2Z1PA 2KSYA 4LVNC 4DGUA 1TQCC 3CH8A 3SZ6A 1HNGA 2DQEH 1N8OE 4JY4B 3BZEB 1L5GA 1KJ3L 2ESVA 2XRAL 2NUTB 3DECA 4NBZB 1FAKT 3GMPB 1ZEAH 4RSYA 5I30L 3NIFF 1VPOH 3ATFA 5J7AA 3QZWB 2I21A 2R69H 3CXFA 5F71A 4B50A 3REWB 1OKEA 4KLYA 4TSCH 1E50A 5F3HA 4HSAC 3U0TA 2XWXA 1AGFA 1MN4A 5EOQL 4WW2C 3GXTA 4GKNA 4J3OG 4KMLB 3BN9D 5EOTA 5IBLD 4PVBA 3LZQA 1JHLH 2YMXH 1E90A 3RZCD 2D9CA 1KBKA 2QVTA 4JHWH 5I8KL 3TJEL 2V2WB 3JWNC 3OZ9L 2BC4A 5ABZA 4G8AC 4ODSH 5FW8A 5JYLA 3H6AA 3DPBA 2YMTA 2JQZA 4X50A 3S88H 2J3SA 4PD4J 4FXKB 2QSVA 4J12A 1AJ7H 1MCWM 3EYOA 5G5DA 2AJZA 3LB6C 1UD6A 4FFYA 3QAPA 3V6ZB 2XBDA 2P5EA 3BUYB 1ES0A 3HPLB 5F1OB 3IVKB 2G2PA 4N2FA 4DEPB 1GMEA 4K3JH 3GC3A 4XN9A 4AE1A 5I19H 5IJBC 4DKFL 5AW7B 1EFQA 5EBLB 2L8AA 3FFDA 3B2XA 4U0RC 5BVPH 3FQWB 3EJUA 3TFKD 4K0OA 4XP4L 2HP4A 1SN2A 4M6NL 1KJ2B 1BP3B 4JFED 3NCXA 3GLDA 3MGOA 4V1DD 4EEEA 4FNTA 4HD9A 1T89C 3HZVB 4RMTA 2QPEB 1AHWB 2QPSA 3NESA 3ZL4H 2ITCB 1BJ1J 4F8PA 1S46A 5D5MB 4FULA 2YS4A 5F6HI 4GIPD 5CD5C 2OX5B 3ZDYB 3GSVA 4V11A 4IQHA 2OMBA 1HN1A 4L48A 3HCVB 4MCYA 4UT6L 4XO3A 3V52H 1MJUL 3CTTA 2B2XH 4X4MA 5I8CB 4AMJA 5EUOB 1SN5A 1IKOP 4MJ6B 4NO3B 4JPQA 4R4ND 3UAEA 4JKPL 4JDZB 3SOTA 3MRPB 1F18A 2YC1A 5AL0A 3V6FB 5B7EA 3OL2A 3TZVC 3SGDI 1MVFA 3MLYL 1ZA6A 1VA9A 5F97E 1E4KC 5K9JL 3TVMA 3F7VB 1AH1A 4BE6A 2JF1A 3FTYA 4JGUA 4Q14A 1KMEA 1P5VA 5C0FB 2H0PA 4KXDA 3RI5K 4X6CB 2WXIA 1RZJH 2H8PA 1EZUA 2BP5M 4OB5H 4C4UA 1F4YH 4CN1A 5C1MA 2E8ZA 4HC1H 4HW6A 4LCUA 4NC2B 1IARB 1PX4A 2MSPA 4LOUC 1RHHB 2NSQA 4OFPA 1PAZA 2DH3A 3BWUC 4QCIA 4U1JA 2DWEB 4BSJA 4AL8H 4MQSB 3WKMH 3BAEH 4P2YA 4BELD 3NSFA 3CVHA 5C86A 3S2AA 4DZBA 3ULVD 2PPDA 3BZ4A 4PREA 1P5UB 2J20A 4XP6H 5FYJD 1S7QB 3RL2B 2YBRB 5GRYA 1JHTA 2XVLA 2VLLA 3CH1B 3DX0A 3RX8A 1RQ5A 3AMKA 4WFGD 1JGVL 4ZMNA 2Z7WA 3FRPB 5T1DH 3I02A 3MYJB 1P4LB 2SEBB 5FPIA 4TL4A 1JV6A 1NGYB 3DGGB 1XCQA 4U0RB 3FSZA 3V4VA 3S5YA 3W3BA 5GRWA 2CNZA 4FFTA 1G7MB 2B8OT 3EF4A 3MRCB 1F4HA 5CSBA 2E5EA 3HN8A 5EA0L 1FLRL 3LAFA 4TSBH 1G0YR 3QUZD 1WA1X 2PTTA 3MX0A 4GBXB 3RGVB 4XWOD 5HHNB 2YRBA 3S6CA 5MHSD 3BWZA 2VAAB 1KGWA 4X9IA 4DGIL 3LS5H 5IEKA 1SZNA 3WIFA 3MV7A 1HEJC 2LAAA 1SXCA 3MROA 4GSXA 5TE6L 3BRDA 4YE4H 2PW2B 4ZPTA 3CCHA 5J11B 3BXNB 8FABB 1FLRH 3IXTA 3GXDA 1DBAH 2BOBA 3CXDL 1OGAA 4TSBL 2JLLA 2WZ6A 2F8IA 3QA3B 1KF9B 1T4KB 3PWPA 3EOTH 4LZKA 4LSTH 2Y24A 2D9QB 4OSUL 3OF6A 3F7YB 3L1OH 1JVKA 5E24E 4AM0B 4K7FB 1T1ZA 3B4NA 4HIJA 2X0WA 1N9PA 2VWEC 1Z9OA 3DI3B 5CD3B 2R69L 5IQNA 4L1DA 4AEFA 1ZLUH 3MTXA 5GSVB 1RURL 3HNTL 3CFCH 1KGUA 2R1YB 3N40P 2RCSH 3HKZA 3RKPA 3NACL 4IOFC 3FFOA 4PQXA 2Q5BA 4AYDC 5TK4A 3LTVA 2CJ3A 3IMVA 2M26A 5IK3B 2N0MA 4PB9H 4EIUA 4LESA 3KVPA 2D3VA 3VGBA 3TPKA 2FECL 2HMID 5A2BA 4BZ1L 5A16A 4GO6B 3CXHJ 3L54A 3NY9A 4YIQB 3QWOA 3TBSA 1LWRA 2WINA 2VLMD 1EDYA 2QMJA 3QIWD 4HEPG 1KGBA 3EDKA 2VUOA 3P4MB 1U8CA 1P0SE 1E9QA 2GJZA 1A7OH 3C6LA 4KDVA 1OQXA 5JIMA 1CE6A 2CR3A 3FUHA 3VWKD 2A0LD 4GRMB 4Y5VA 3M45A 2PKDA 3QFJA 4AIZA 1RKRA 4CILA 9PCYA 2LU4A 3FUFA 1JV2A 1CL7H 1LEKA 2Z55A 3E6FA 3PFQA 5JMOC 4Y4FA 5FWQA 2BINA 3GI9H 2GJ6B 3QJSB 3D12B 4XXCC 4HBCH 2WV3A 3BN3B 2W8CA 2GEQA 3K6DA 4KZDL 4DNLA 2R4RH 1Q1JL 4HJGB 2GKIA 1BG9A 1WFIA 2ZXWB 3JQOB 3Q2CA 3RTQC 2OMZA 4XGZB 4AMWA 4XTOA 4R7LA 2R2BA 2HRHA 4OKDA 3DUHA 4YWGH 3ZOAA 1ZTXH 2EXSA 3X1GA 2IIJA 4LFHD 4PJBA 1BG1A 2GY5A 1MXDA 3PWUB 5IBTH 4BGLA 4H2AA 1BRXA 1S3KL 3K2UL 1I8LC 2IPUG 3IFPA 1IFHH 4GKZA 2D3NA 3GBML 5JIHA 3S36H 5KG9A 5EF0A 3C8HA 1IAMA 2J5LB 5I1KH 3LKQB 4JKLA 5AYTA 4EDXB 1VEPA 1J86A 4YOKA 4RBPH 4JFDE 4NBXB 3S3BB 3PWLB 3TH3T 3BYYA 1NANH 4RAUA 4CUCA 4MNGA 1KLGA 4YSPA 4Z3GA 1DBJH 3SJVA 1EO8L 2A77L 4FCAA 5FYKU 2EO7A 4P46C 2OYMA 1TEGA 2VITA 3F05A 2BSRB 2PWEA 4LNRB 4TPRL 4OD1H 1LO4L 4NZTH 5KJ4A 3MBXH 2AEQL 2FATH 5TQ2H 4L3ED 4F8NA 3DX7A 5JHLH 4OLYL 5GGTA 5B6ZA 1FL5B 3BZDA 4PY7B 3IWVA 1DVYA 3RUGB 5MI0C 1BBJA 1E28B 1PKQE 1WO2A 5EO0A 4HX1A 5I15L 3IXTB 5C09D 2F58H 5I26A 2P8LA 3Q3GB 1YHPA 1XMWA 2H6OA 5BMFH 4F2FA 4O51A 1YEJL 1DJYA 3OQRA 2VW6A 4UMSA 3JTTA 3QAZC 1PXRA 4JCLA 4CA4A 2XFXA 1PQZB 3CX2A 4NKQB 3DSFL 5KYUB 4P46A 2VZ3A 4RQQA 3WLBB 1FI8C 4XE0A 5I15H 3V79C 1HWWA 1LEKB 1WT5A 4RWYL 4PRHD 2Y9RT 4FTVE 4E9RA 1M2OA 1OGTA 1WWAX 1JPST 2BVYA 3AADB 1KIRA 3D2UB 3N0PB 5DWPA 2TSAA 2VW7A 1L7TH 1EEZB 3PNWA 4IJ3B 1KYOJ 1EIBA 2I26N 3LEXA 1KT2B 1QQDA 3QUXC 3ZE0F 4M8QB 5A2LH 5KVDL 1SJEB 3QUHA 5FGSA 1KFAL 4G3YL 3HR5A 3TBSB 2BERA 3MXWH 4PRPE 1SUJA 1OSYA 1PU0A 5JOFB 4A7UA 1VFBB 4BSVB 1BAWA 4TNVK 3FU7A 3LQAL 4YDMA 3PV7A 3IN0A 2QPDB 3GM8A 5EFIB 2G60L 4GT0A 4NZUL 1L9RA 4JFTA 3RL2A 4LLAA 4WVRA 2NLJB 1CBVL 4NQUA 1AY1H 1FP5A 1JZ8A 4G3YH 4YSRA 4UAOC 2XQBL 2V7NA 1DFBL 5EIIA 2BWIA 4X32A 3IAQA 4ZFQA 4XR8C 4KJWC 4FG6C 1FFTB 1XCWA 3D69A 5HYIA 5IROD 1FH2A 4JHUA 5EO1A 5LNDA 4DN3L 1CICC 1P6FA 2WLIA 2HB0A 1MI5D 1IO4C 3FQYA 3V9FA 2YFOA 1KXTA 1CBVH 4HUUA 4UQ3A 2VLME 4UCFA 2YEQA 2AXFA 3WEOA 2IADB 2Q8AH 2Y2WA 3BT0A 4Y2DC 4LARH 5DMGD 1ORQB 4X6FA 3I50H 3L5XH 1NGQL 4Z95L 5DRXA 3NG5A 4DPCX 3G08A 5I0DA 1XZWA 3GJEA 1F3DH 1DQML 1MLBA 3HNVL 3D0VB 4NGHL 4NNXA 4DN3H 3D4CA 3ULSB 5DS8B 2BSTB 2I7OA 1XR8A 2HFEA 5FKAA 2IGFH 1OCRB 4DP5X 4X7EC 1PMYA 4MDRA 2P5WE 3NA9H 4NO3A 3K6SB 2NY6D 3ETBJ 4FA7B 5H35B 1MQ8A 4PRPA 1LD9A 2CO4A 4ZOBA 1FVEA 1IGTB 5ALCL 1TN5A 2WLNA 3DYPA 4FI6A 3TGXA 1JPFA 5DJ6B 4L29A 1WUZA 1P7QD 4ZDHA 2FEEI 4ZRGA 1H15A 1D5MB 2G9KA 3P0GB 1OLZA 1DUZA 3II2A 4J2QA 1Q9OA 1A0QL 5MP6H 2O26U 5EOCH 3HVDA 4H25A 2YK1H 3CNKA 4K3HA 3KS0J 1SFHA 2OTWA 3B43A 5JXEA 4CGTA 4E0RA 1X7QA 3WY4A 4H0IA 4ZXBB 2Q7AA 2MQCA 3VXSB 4DZ8B 1GW6A 3Q05A 1EUTA 3MU3A 4GW5B 5DRNA 3B2UD 5H2BA 5KZCD 5DFVD 3QH3A 2JJSA 3TA4D 3VFSA 2A0LC 3SDXE 4P4KA 4MNQA 3HFML 3KPLA 5E1AA 4KH2A 1VRSA 2ZD0A 3CUPB 5E8OB 3OMNB 3MRQA 4GG8B 4IRJB 3L95A 4AYSA 2WD0A 2XG4A 1F58H 4H1LA 3LZPA 5A3IC 2VN6A 2VUKA 3GFUA 4G70B 1RZFH 3TNNA 3MA9H 4OGYL 1MG2C 3QAZB 4M43H 3BSGA 1IIIA 3DOHA 4FYRA 4QMEA 4TULH 5CGTA 5IF0B 5C09E 1EXHA 3B2MA 4PRAB 3SPVA 2D2OA 4TVPL 5E99H 4IBZA 4GP5B 2XQYG 1KJMB 4UOW1 3RDTB 5JPNA 1NFKA 5J5EA 3QORB 5HHMB 2EDJA 3TA3C 1SEBA 4M7LL 1CLZH 5D70H 4JFDA 2ITFA 2ZWSA 5F6HJ 3RA7L 5AVYB 3LH9A 1R34A 3S3DB 2VIRA 4G6MH 5BV7C 5ISZB 2WM0A 1TQBB 1DVZA 3DIFB 3KLHC 5C0EA 2VW4A 2Y2TA 4AGMA 2WO2B 1G7LA 5E23A 1VSCA 1U8CB 1R3LB 3K8MA 2NY5L 4JM4H 5ECJE 4EUPA 4JVUA 5IM7A 1C5BL 2QELA 2DTMH 4H7VA 4FNSA 1Y0LA 3NZ8A 5ANMA 3AS3A 5I1JL 1LO0L 3GZPA 2UY7B 4KBPA 1JFQL 2XTLA 1PD0A 3MRDA 4RIRB 1FGNL 3P9MB 1DUYB 1YMMA 5KOVC 3TO4C 2VDKL 4G42A 1U95B 2IPKA 2PCPA 3GSRA 2I32A 1C8RA 1TOXA 2P3YA 3TYGL 2ZAHA 1ZXQA 4KQ3L 1T3FB 3W9DA 4ABWA 5GXBB 1O7DC 4B3VA 1JNHB 2AXWA 4JR9H 1ONQB 1JF5A 1UJTA 2HG0A 3CFDA 1F6FB 4ANWA 4P2RA 1E43A 3VGDA 4UWQB 5AW9B 2W94A 5CMAA 2HJLA 5IVXA 1OE2A 1SMAA 4WW2F 1Y18A 4XB8A 3HPLA 1E3XA 2DMCA 4MDIA 2C4XA 1PY0A 5LKNA 1XCTA 3L6FA 4NZDA 5JLZB 3FCTB 5JHDD 2V8LA 3L3JB 2WQXA 5D1ZC 3KPRB 3JWOL 1Q9LA 5BZZA 4BFNA 3VJ6B 4NPJA 2YKLH 2WLHA 4N8VB 3KYKH 3O3EB 7CGTA 3FN0L 1P1ZB 2VOTA 1JD9A 25C8H 4YSUA 4HJ0C 1HESA 5JIKA 4JKNA 4L35A 1TJHH 4HWZB 4NPYB 2XI9A 4WO4B 1WP6A 3B9AA 3L2MA 5EU6E 1S51A 4MWFB 3GKZA 1WFTA 2HA1A 4WFGE 1D6VL 5HGDA 2ZXQA 5FCUL 4OCWL 1ZHNA 3Q9PA 5DUML 5C7XL 4GQPH 4JHVA 2HRPH 2X53A 4ONOA 5DGQA 5DRNB 2EC9T 4Z3IA 4MA7H 2B1HH 2DWDA 4MS8C 2D7TH 2OULB 3ZDWA 2ZP8A 2PXYB 4PJ7E 4BCYA 2FWSA 3MJ7A 4FHBD 5C0BE 3ZPDA 3QRFM 3ARDD 3CUPA 2IOIA 5CEZD 1F6LL 9CGTA 2WYZA 3I3EA 5FCUH 3QJHA 3ZDXB 2MEJB 1E4XI 1XJIA 1DQMH 2ATPB 4MJIE 4N5ED 2FCBA 4TRPL 1ETZB 2J6EL 1IAIL 5B6XA 1AIFB 2ZXCA 1FVEB 2Z9TA 1U95A 1F56A 1A1MA 4GG6B 1GSKA 4HKJB 4AMKH 2CO3A 3UCRA 4Y7OC 3QBLA 2VXQA 4WWPA 3UDWA 4IRZA 3KJ6L 3IMRA 3ZN6A 2DQUH 1ML0A 4OJDH 5K5YA 1DCEA 1Y6NR 1FNEA 1K4CB 1YNKH 4N9OB 1R3HA 1KZYA 4XNYL 1I7TA 1GGUA 3V52L 5KVDE 3DA0A 1FG2A 1AXIB 3Q8CA 5JR1L 3CMGA 3QHTC 4L8SC 4F2MA 2JJTA 4I4WB 3M86A 3RVWD 2EO1A 3FCTA 1FFNB 3E6HA 1R1CA 1QRNB 2UZIL 4BRVA 1KXQA 1S5IL 5I24A 1G7LB 4G8GE 4D8PA 1OB0A 2EO9A 4NHUA 3MRFA 3JYCA 3VJ6A 1G7HB 4K7PX 1IFHL 1FN4A 4L37A 3IDXL 3RVUD 5F1NA 1ZA6B 3C9NA 3LQAC 2B59A 5IIEA 2BWQA 1QWHA 4TS6A 1XGTB 5HPMA 5ALBL 5E1QA 4WU5B 4OCXL 2DL9A 4MCNA 1SOQA 4G8IB 5DK2A 3PWNA 1QHOA 1QEWB 5L7XH 4UHRA 3VXRD 1N5YH 2YGNA 3OSVA 4M1GL 5B3JF 2QGBA 4DWHA 5AZEH 5EZLB 4H0LC 2A6IB 2QHRH 2R4SL 2J1KA 1LEGB 3ARBA 4PJCB 2XTJE 3F84A 5ISZD 1W8EA 2I9TA 4UANA 3WHXA 5JHLL 3K71A 2OK0H 4FLSA 4MA3A 5I8EB 4G6AC 3V5HA 1IBYA 2W0KA 1CG9A 3K74B 1NDMB 3W9EB 2WB7A 1BVKB 3D3VA 5JPNC 3HB3D 4AWJC 5I8OL 1E8ZA 4HZAA 2BP0B 2JJUA 5T5FL 3TPUB 2PXYD 4ODXA 2EDBA 3NUKA 2FNWA 4AQEA 1IT9H 1IL1A 1YEKH 3WIHA 5FHBH 3HMXA 1PFCA 4OI9A 5AB1A 3VDCA 3QUML 5CR8A 1EH9A 1RXLA 4PUBL 5GGTL 4WNQA 2E8YA 3T4YB 2WLLA 1ZHBA 3L17A 4HPOL 2OLDA 2QADD 3RFMA 4R2GB 3DMMC 3QG7H 1MHHB 5I1IH 4ZSOB 3VH8B 3D09A 1E4JA 4QJ3B 4XVTH 4KNQA 1HHGA 2YA0A 3G9VA 3H7BB 4RGMB 3TA3D 3OE6A 1MJ8H 1IKFL 3U7WH 1LD9B 5FHBL 4BFIA 2ZJSH 1B0GB 1UXWB 5D7SL 3WIIL 5BS0E 5I1JH 3HRZB 4KAQL 2WLKA 3NK4A 1OIOA 1J05B 5IT2H 1FGNH 1GS8A 5GGRA 1CI5A 4TV3A 2AC0A 3L5HA 2BSTA 4X8JA 4PCYA 5CIPH 5T1LD 3VXMB 3G5VB 4U4IA 5EU7C 3VXSA 4JVWA 4Y19E 1MJ8L 4NN5B 4XOEA 1DQQA 2OMWA 2E27H 2HLEB 3MLRL 4UTAL 5C07A 1O6SB 3ZE2B 5F3HB 4P9HC 4YHZL 1RCYA 4H20L 4CU8A 1K3IA 3HG1B 5GRJL 2A6JA 3FSAA 1PZUB 1D6EB 1IAIM 2R1WA 3ISYA 2NUTA 4G82A 2Q8BL 4U3SB 3E8UL 5JORA 3SSGA 3P73B 3THMH 1QI3A 2BIIA 3RPKA 3WV0A 4Q9RH 2PPEA 4JAMA 3WNOA 2YR3A 2FTAA 3MGTA 3GSNA 4U6XA 2EIJB 2C9AA 4OZFA 3PABA 3C2AH 1BF8A 2RQ8A 4WI0B 3BE1L 5I23A 4XZUB 1JPFB 5DJ6A 1FF5A 3IGAA 3LSOA 1MZYA 1WTLA 5BPPA 5FF6B 2HZHA 4Z3HA 1MCWW 4AM0Q 5KAQF 4Y2DA 2B1AL 5AD0B 3P77B 1RUQL 1KENL 2DS4A 4Q7DA 5ID0B 2Z93B 1UUSA 3QJRB 2DRUA 3WEAA 1XGUB 3ABZA 3KLSA 5DWUL 4IB4A 2BHZA 1JS4A 1MSPA 3T0ED 1H0DB 2JELL 2GI7A 3MRMA 4ZFGH 4KZEL 1YNTF 5IVZB 3V0EA 4P9HH 3KGRA 2FQEA 4QHUB 1KV7A 4QRPE 3D85A 1SJXA 4PBXA 3UG5A 4Y5XB 1X7SA 4CVWA 1W72B 1FV1B 4R2GD 3QPKA 1TQTA 4YO0B 3PRZA 3Q1SH 5G2CA 1AMYA 4GSDL 1AKJD 2GW5A 2XYBA 3EDDA 2FJGA 4MBRA 3HG2A 1ZGLP 4BKTC 1QABA 3QJFB 4PRIB 1XF2A 1OHQA 4JFYA 4L4TE 1G87A 2KLTA 3ECBB 1PLGH 3INUL 1HXYB 3L3GB 12E8H 3PP4H 3QHFH 4JG9A 2I5YL 4CVXA 2HN7A 2AK4B 4I2XE 5B35A 3MRPA 3CODA 1J5IA 3KL3A 2VLRD 4TLTA 1TVDA 3WSQL 1OP3K 1WT5C 3PUCA 2FL5B 4HHAB 3BAWA 5HDBE 1K8IA 1BAFH 5FYJE 3EYSH 1XL4A 2X44D 3EMLA 4ORGB 1K5NA 1ETZA 4R90H 4JG1L 2H2SC 4JLRB 4FXGA 1M71B 3WJMB 3DK2A 1NC2B 2FNBA 1YN6A 3GSNB 4GUPB 4U6XB 2C1PA 1TTAA 1EJ8A 4MHHI 3WE1A 1DVFD 2C9RA 1OSZB 1NAML 2CUAA 2V0AA 2AVFA 1Y1DA 4LEXH 1JZFA 1WAEA 3LEXB 3FT1A 4NWTH 2NSXA 4JW3A 2ZXGA 5IROC 4AOFA 5LQBH 1A6TA 3SE9L 3KYMA 3L08A 1MCOH 1WC7B 3SOBL 1QEXA 4OI8A 2XN0A 3GXIA 5AD0A 4L8CB 3AGWA 4GEJA 3BP4B 2P8LB 4V1DE 4U7SA 5KSBE 4PI2A 2AJUL 2EVFA 4Q6IB 4ZS6C 5AB0A 3EGDB 2BSEA 2CGRH 4KUCD 5AW4B 4U3CA 1ZSHA 3IGLA 1SLWA 1LHZA 1MNUL 1F42A 2WYHA 4DKEH 4XAKD 4F37F 1P8UA 4PTTA 4D0BA 1PDKB 2E7DA 2DYPB 1QFPA 4RRPM 2ZX7A 5JA8B 1UATA 2WIIA 2Y1ZA 2P5ED 2ZZLA 1OSEA 5E2VL 4NHCH 3EFOA 4KUZH 2VDKH 4NXKA 3MRGB 2BIMA 2PP7A 4YSOA 4GRMA 3NJKA 3QIBC 5CJBA 5LCVA 1QX1A 4NQED 4EF3A 5FGRA 4AQ1C 2WTRB 3SE3C 3IETA 4PRDA 3FTSA 1JZ5A 1O5PA 1NIAA 2HT4D 3Q43A 1J0KA 3V4VB 4PH8A 1MCNA 2HX9A 3FQNB 5DQ9A 1J5HA 4H4NA 4JDEA 1TJIL 1VFBA 4X8JB 4QT5B 3DSNB 3CU7A 2K78A 3K91A 3L4XA 2XPGA 4QXGL 4WHYH 4IU2B 1NBZA 1N6VA 5ID1B 1E65A 2YUWA 4E5XA 1LE5B 2OFQA 4JFSA 1GZPB 4KO7A 4E41E 1WVZA 1JGEA 4G1EA 2A1WL 5CJQL 1BVZA 4HS3B 2ZWYA 1UC6A 1X7TA 5DFVC 1ITCA 5AVXB 2R9HD 2V3FA 1JZ3A 3LPGA 3SO5A 3FO2A 3MRJB 3S5LG 1WRFA 4Y5VB 4F2EA 3QPXH 4AG4H 1OGSA 3NEXA 3L16A 2KKQA 5E8PA 1RHFA 3VXSD 1WLHA 4MMYA 3TLRA 1QEWA 1JHKH 4G9FB 2VABB 4HEMA 3QAQA 2AQSA 4NC1E 3RP1A 5CD3A 1NGZA 1FORH 1E8YA 2H6PA 4HJSA 3HANA 5FF6A 1H8SA 2BOLA 3RVVC 5MENE 1GSMA 1ND0A 1VEOA 3HLAA 3CFKA 4MCYB 4OQTA 3OGCB 2BOBB 4J3OC 4PLJC 1BZ9B 1VFAA 2RJMA 3UAFA 1DJGA 5J4MA 5KSAA 1E9QB 1YO4A 2PLTA 4MNQD 2WKOF 4KI1A 2XY2A 1WWCA 1GGBL 2R29A 4J6RL 3V4PA 4U3XA 4DAGL 5ICZA 3BVNA 3AM8C 2X4QA 4NN7B 5GHWL 1A3RL 4F7EB 1E5CA 2NNAB 3D33A 4HETA 5GJSL 1XH3A 2APXA 3MNMA 4RGMC 1JV5A 5DTFB 5LBSA 5FO8A 1HZLA 3PWLA 1GYAA 1PF3A 2I69A 1QNZL 4MAYA 4Y2DD 4MRBA 3WS3A 3CDYA 4PP1D 5EBGA 1JZ6A 1ZE3H 5JIDA 3IDJA 4WUKL 5EORL 1A3RH 4IIQC 3VXQA 1HXKA 1ZT7A 2IH1A 5ESVA 4TVPD 1G7PB 2OXGB 3BEWB 1NMBH 4NO0B 4TUJA 1A25A 5E2JA 3UTWA 4R7VA 2WUCH 1UXWA 4YN3A 2B0SH 3GMQA 3RG1C 4IEFB 5JXED 5GGVL 3UFIA 3MV8E 2I60H 3ZXAC 3D85D 3QP3A 3V0GA 1PTZA 3T4YA 3GIZH 3IT8D 4Z8FL 1E9OB 3L8QA 1KBVA 1PZAA 1Q94A 2XUWA 4NOBA 4Q9QH 1TZOA 3HC3L 4L4TD 1A8JH 2B1OA 1IBGL 4DVRL 5EUKA 4MB5A 4AQEB 3AU1A 4JO5A 4Y4FB 1P2CA 3HC0B 3OAXA 4JBSA 1C8QA 5I75B 1TO4A 1JUFB 3E7JA 3UMTA 5B39B 1KGCE 3V5DB 1G5AA 2I60L 4MMZB 2IDFA 3RWHB 1J1PH 3GMMB 5L8KB 4LGSB 4Z8FH 1KCKA 1JK8B 1CLOH 1SQMA 4HH9A 4YHKL 2J44A 4W9KC 2XN9B 2EXTA 1F3RB 5F9WB 1J48A 5IV2B 4NAMA 5L0QC 1NLDH 2IOMA 1TIUA 1NLBH 2YQGA 3AREC 4MXQC 4Q4EA 3T0EE 1QNIA 4CU6A 3AG1B 4KRLB 2ZCKH 4UTBL 4UZSA 5I17A 2EVHA 3MZTA 4Z0XA 3VCLB 1C16B 3SY0A 3RDJA 5EWIL 3BZFA 2AI0L 3LRHA 1WWBX 5E2TL 2CLVA 3ARGC 5F0PB 1UQSA 2NZ1A 3SOBH 1JD7A 1QTYT 5F88B 2WLMA 5CKAA 3BPOC 4N1HB 1NBQA 2JMRA 4L4VD 3LN4B 4HPOH 1UCBH 3VD5A 1N64H 1U3HC 4X0NA 1MWOA 2OR9H 3EJPA 3QG7L 4N2NA 5DA4A 1J7VR 1B2WL 2O6CA 3D4ZA 4I0PA 5C08E 4K3DL 4DKDC 4E9VA 4HIXH 5ICXA 2HUHA 2R0KH 4QXTB 1MFBH 3KYOA 3G5WA 4OZFG 4XP9L 1N4XH 2Z3FA 2VDQL 4Y4HB 3C6LD 3F7PC 5IFHH 4H8WL 1ND0B 3A5VA 4LDLA 5AFAA 5J56B 4W4OA 4XRCB 4ELMF 2WVVA 1YPZE 2VDNH 2A4EA 4V2CB 1P8IA 1MELA 1XQ4A 5HY9B 2MKLC 1A1OB 3MFGB 3NIDB 5ID0A 2PCXA 2YD9A 1JXGA 1MJUH 3LYRA 4K94C 1OF0A 1ED3B 3OE9A 3NN8B 4Q6IC 2EUVA 4CNIA 4H88H 3V6OE 1N7MH 4JREC 3CHPA 5H94A 4P3WA 3X1NA 4M3JA 3QXTA 5KSBB 4Z7NB 1ANUA 1EZLA 2OJZL 1NBVH 2FHBA 3RVUC 1IJNA 1NIDA 3H56A 5EU4B 4JFUA 4KHTH 4K9EH 4U1GC 4N0UA 1AG0A 3VYPA 3HAEG 3AM8A 1RZ8A 1MIEL 2FEJA 2CHZA 3UZVB 3GM0A 3L7EB 4XTNA 3C60D 4NQQA 4XCCL 1CGSH 2HT4C 2PP9A 4KY1L 1VZGA 3GSOA 2CM6A 3SYOA 3WXVL 4QXVA 4MA1C 4XNQB 4Y1AE 5HYQA 5DUMH 1MCKA 3PQYE 1L0MA 3WN5B 4KI5D 5CEXA 1GGCH 1R0AH 1TXKA 3AQZA 1J9CT 3L4TA 4QEGA 5J0BA 4YPGA 2BNUB 5ETUA 3HZVA 1OSPL 2AMGA 3QEQE 1RZJC 2V2XA 1T20B 2DI7A 3QPXL 4AG4L 1F1GA 1RK7A 1O6TA 3FUKA 2EDQA 4U6YB 3K5RA 2EXWC 1YSOA 5D1ZD 3ULUL 2ERJB 3FQWA 4CBPA 1UM6L 4HA1A 1DZEA 4XAWH 3U1SH 2CNYA 5EEZA 4K7PL 1LEIB 4G6AD 1MI5B 4NOFA 1DQIA 3EYFB 4PJIB 3EHBD 2EUWA 1KJ2L 2W81C 4I2XB 1P53A 1LMKA 2D0HA 3C2SA 1AS7A 4EXPX 1GC1H 2DLTA 2J8UB 3F7QA 4WWKD 2P5EE 4NAQA 1QACA 3U6XA 4EVNB 1B0WA 2FVNA 2BFVL 1N0XH 3UJIL 1ZDQA 2NY1C 3T65A 5FV2A 2WP3O 1CFBA 2EIEA 1GGBH 2G9HB 4PWJA 4Q2ZA 7FABH 1BBDL 4MQXD 2VN5A 3B83A 3P2DA 2W91A 2BC4B 4BK8A 2HSIA 3V0AC 4QRPB 1JG9A 4U6TA 2X09A 1INEH 4LVEA 3DO4A 1FZKB 1O6VA 4WI4A 2FBOJ 4GQ9L 3D3VD 3LPWA 4YXLL 1EBPA 3NRFA 1I1FA 4MD5B 4UYQA 4HWLA 5E94B 3DV4B 2VLKB 5IIEB 4JO2H 5C8JB 1I3RB 5DJ2A 3NJNA 1YJDC 1FBIH 4F5CA 1B3IA 1P7QB 3QCVL 4R0LA 3IYLW 4XT1C 4PJ5E 4IRSB 4MA8H 2EKJA 2UUDK 1W16A 2VERN 3CXDH 1INDH 5I9QC 4R90L 4TVPE 4Z3EA 3EJTA 3VI3F 2JKXA 4F33B 1GCFA 4YXLH 1E4WH 1G0XA 3CHSA 4BKSC 5E8NA 3TA3A 5BR5A 1UWXK 3U46A 3KPLB 4XX5A 3FO0L 4ELKA 2VRKA 5BR2A 3V0JA 2QEJA 2X89A 3CZKA 2ZUVA 3AVEA 5DVPA 5HJBA 2YCYA 3E2HB 3GSNL 3ML8A 1AHKA 3RURA 4IRJD 1X5MA 2XC8A 5ISZA 4PRAA 5IROA 3HHSA 3SPVB 3VW3L 2P1YA 3BVWA 1GRWA 2GTZA 4PB9L 1EA9C 3PHQB 4J8RB 4W6XB 1WZ1H 4ELMA 3QXUA 1EEYA 1VERA 2NPLX 3BAYA 4RGOL 4X7SH 2VTFA 2OL3H 3RWDA 3RFZC 3QUMH 3KLKA 5LGYA 4F7MA 4PUBH 5GGTH 3U0WL 4QYOA 5D7IF 3ILQD 1EHXA 2LFEA 3TO4A 3VXME 3M1OA 2GSIA 2BHYA 3PV6B 4CAGA 1PYWB 4EQ2A 3PAUA 2L6XA 4P57B 2KHAA 2NCEA 1LE5A 3OHXA 2KERA 4QRTA 1JPSH 2RR3A 1SXZA 1SXAA 1OGAB 4M7JH 4KFMA 1P6WA 2K6WA 1E6JH 4JB9L 1XAKA 4JM2D 2UY6A 6PCYA 1HHIB 5M95B 4ZZFA 1AQMA 4U7MA 3C8KA 3ROLA 3WY2A 3AABA 5KS9E 3WIFB 2YJLA 4ZSOE 2JXMB 5FO8B 3O2WH 5CN3A 4HUNB 3SE4A 1A7PH 1T2JA 3B5TA 3BEWA 1T66C 2ZWKA 1KACB 2BHUA 3FT2A 1EVTC 1MFBL 3ARTA 4MCZB 4UTAH 3EIFA 4YWGL 1TETL 3R06A 1QSZA 4H8WH 2OJEA 4HZLA 2X2HA 5GRJH 4JQIH 5TDOB 4D0CB 5C9JA 3U4EB 2P42B 4ODHL 5CEYA 3E8UH 1XDTT 4ZS7L 3BKYH 2WCGA 3QRBA 1D9KC 4MDIB 1OTUC 2COQA 3TCLB 1JV5B 2QKIC 5DTFA 3RNKA 4AZ8B 3CV5A 4IS6B 3FN3A 2AQ3A 5H35A 2C3VB 2FWOB 4HPYH 4NPYA 3S8WA 2CBTA 3SDDD 2CCVA 3I6SA 2MOVA 2CALA 3DOSA 4FTVA 5C70A 2AXGA 4F24A 4PJXF 3ZE0E 4KK9C 1DBJL 2XX0A 1NINA 4R83A 1NBVL 5H2KA 3QHZH 1E42A 3MLSL 4MD4B 5EOCJ 3RL1B 3RWCA 1NBCA 3TONA 2Y36L 1GOHA 1N12A 5H2OA 4LDLB 1KTDB 2FX9H 5IW1B 2OR8A 2NR6C 4P4RA 4LDEA 1UOVA 2EE3A 2OSLB 3MLWH 4RRPA 2PWDA 35C8H 3MUGB 1G1YA 3AXIA 3MOBL 1FYTE 3PGDB 1NCTA 4FFZA 3F64A 3N85L 4R8WL 3G5XA 4Z0BH 1LWJA 3ULVC 4IK6A 1M7DB 1DBBH 1NBYB 4YHNB 2GUYA 2GTWA 3ALPA 4Q4IA 5BOPA 1YYML 2CXKA 3QYNA 1K8IB 4P9HL 3ZTJH 1J0JA 5LAXA 1MFVA 3QJXA 4X6EB 4FQIH 2RFXA 3TASA 1FSKC 3QXAB 4QTIH 3MV7D 5EIIB 4B0MM 3TZVB 1YMMD 4G6JH 4FP8L 5JOPE 3GINA 1EERB 2IDSA 4KI5C 2PW1B 3RVXD 2Z4TA 5AW3B 2N1TE 4JRLA 3STZA 3NH7L 1GMIA 4HWBH 4K15A 1L4IA 5TE4L 5M7QA 2WQWA 4AIZB 1F88A 4PRIA 4DGYL 4ZXBD 2G2NA 4P3DB 3TU6A 3NMEA 1HNFA 1NMAL 4X1HA 1VADA 3H54A 1C16A 3BGFC 4HMCA 1F90H 5T3XH 3SB3A 2HRLA 3PWUA 5JDJA 3TIDA 1JK8A 4HH9B 2CMRL 1PLAA 2VB5A 15C8H 4W70A 5CFAA 1LGVA 3U6RA 4F92B 1UURA 3L4VA 2XN9A 3W0WD 5BXFA 2CDGB 3BMVA 3SGJA 3ZDXE 1EWHA 1C8SA 2Q6WA 2WZAA 2FB4L 5ENWA 1QAWA 1QSFE 4UOW0 5D7KD 3ZDZF 3OKKB 2NTFB 3DX9A 3GBDA 1D5XA 1G6RB 1G7JA 1GIGH 5C0BB 3NCFB 4MGXA 5ICYB 5IW6A 3UX9B 3AUWB 4YDNA 5DK2B 2A9AA 5ESAA 4FQXA 4N5UA 1IC0A 4NO2B 3MV01 2F7IA 1CMOA 1BOYA 2FDBP 4JJ5A 1KUMA 3QFJB 5TF0A 1ZSDB 3TWCL 3U7AA 1DL7H 2D8KA 2OW6A 1RP9A 4WO4C 4GRLD 4TYUA 2YWZA 3WO4B 1KIQB 2RH0A 1H15B 4Q9BA 4Q6YA 4K3JL 4PY7A 3UGXA 1G9NL 3FMGL 5I5MA 1CDJA 3FUEA 3NCBB 1HILB 2BS71 1WYJA 4MZ3A 4LLQB 4FFVD 5B6VA 4K94L 1B0IA 1W6LA 4LL4A 4LNRA 2R2BB 2W9EH 3DROA 1G6RL 4WI0A 4XZ4A 5TH2A 5I1HH 1MCLA 3RY6C 3HBZA 5C0RL 1JXJA 4GW5A 1P4IH 2DQTH 3AREA 3KPRE 4ZPVB 4NGHH 1RSFA 3PWVB 4XBEH 1TN0A 4QOKD 3T6WA 2EIZA 4CMMA 1IBZA 4WO0A 3Q5TA 4UQ9A 5BRQA 4U6YA 2C3VA 4MAZA 5G4MA 1GW0A 4AMIA 1ZHBB 3V95A 4G7QB 1V3JA 3LPPA 2DI8A 1WE5A 1YLBB 2RBLA 1A3LH 4BBWA 5EULV 1ZLUK 2H3KA 2OR9L 4XXCA 1IX2A 4UOJA 5DZJA 4S0TD 4DP8X 5BUAA 1PIFA 2O30A 5FA3B 2M8XA 3RTQA 1CE1L 4X83A 1F00I 4Q6KA 4QF1A 3K4AA 1CGYA 3LKNB 2P46B 1DJSA 1E7UA 1NGYA 4B3EA 4H8HA 5D2LE 3HRZA 4HMDA 2BIOA 1OGPA 4ZX4A 5FYKL 4DTGL 2AJ3B 1F6AA 4JO8A 4J3OH 4YHOL 5KW9H 4CMHB 3ZO9A 3IKKA 4P05A 1A21A 3QEQD 4FQ1L 4GSRA 4WHCA 3FH8A 4Z76B 5CJXC 2XWCA 1S8DB 5L2KA 4JFYB 1E4HA 1U92A 4PLNC 3MREA 4ONHA 5CZKA 1QFWH 1UD2A 5CSZB 3UZQB 3VSQA 3SE4C 5I1DB 4FQXB 5FYKH 2AJXH 2BVPA 3CAPA 4P5TC 5J13C 5ISZE 3UZAA 1UTDA 1I1YB 4ZO8A 4WWKB 2BFGA 3HE6B 2ITDA 4JK0D 1WPCA 2BIPA 1F1AA 2R2HB 3G6AB 3QZMA 4P23C 4FNQA 4RMBA 4B9FA 3VFUA 1YECH 3TEZA 3FCSA 5HHME 3UG4A 3FRPA 5ACZB 2ZG1A 1USZA 2BY0A 3BWAA 4YGVA 3MA9L 1WAPA 2CDFA 3KPQA 5C09B 5D5MF 3D9AH 4PGEB 3UO8B 3VE0B 1T6VN 5HDLA 2VSCA 5IR1A 1FWXA 1KJVB 1YZZA 3KLAA 1NCDL 4TVPH 1OSPH 5DJYB 3RE0A 1BLIA 2KC0A 3FO9B 3H9ZA 4HJTA 3E0GA 3QWRD 4TTDD 3TT3L 4U1LB 4EIYA 5CCGE 3S4SB 1M53A 5EB9A 5DS1A 1UZGA 4JY5H 5JOFA 2FBJL 2HN7B 3KH4A 4IK7A 2CSPA 3FTWA 1M0LA 3DETD 3FTVA 2VDPB 1I1FB 1NCDH 5FYJU 5LAXB 2N7BA 2FH8A 3C9NB 4P2RE 2D7QA 3VI3B 4DVBA 5KANI 1FVCA 2R59A 4LLDA 2CK2A 1JI1A 2VM9A 2C7FA 5DHDA 5JPMC 4XBGB 4LVHC 2A9CA 5SWSD 1K5NB 4UILL 2FO1A 1VFMA 4G9DA 5AVVB 2NXZB 2EC8A 3GMMA 4RFNB 3FTGB 1M1XA 1SYSA 3QJTB 3K5SA 3RQ3A 1NKGA 3BAJA 4WW2A 5SX4I 3E3QC 3FSWA 2Q10A 4PS4H 3DV6B 5F9AC 3O11B 2DBLL 3FRUA 4MD4A 4FZ8L 1VEMA 4GRWF 3EOBB 5KSUB 2QV4A 2QPUA 3M6DA 4N0RA 3ULUD 1TTUA 1MXGA 1A4AA 3AQXA 4X4XB 5I73C 2DQJH 1A4JA 4JFEE 4ODVH 4RA3A 2GEEA 4JG0H 2VO5A 1NUFA 4X6CF 1CIUA 2QQQA 3BESR 3GSQA 3ZHLA 5T3ZE 2QVFB 5ADOL 2FWLB 2R0ZH 3U30C 2NTFA 3GSXA 5DHYB 2CDEB 3JZ7A 4NKMA 3U79A 5DSCB 2ZXEB 3VXRB 1NL0H 3RVXC 5LLIC 3RKDD 1M71A 3SGJC 3UAAA 1OM9A 2V3DA 1ECYA 2OYLA 2DM7A 3VSUA 4PMFA 5JXAH 5DD0L 3L1GA 3WFHB 1T7VA 1NLDL 3P4NA 5A6IA 4BXVA 1BYOA 1HHIA 4A2EA 4QNPF 2VL5B 1E0PA 3G6JF 4L3CB 4ZMAT 2LVEA 3QULB 4WJKB 4B96A 3QNZB 3IJHB 3I6LE 3S9DB 3N9GH 3DJSA