3QJTB

The structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
166
structure length
166
Chain Sequence
DQHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structural changes that occur upon photolysis of the Fe(II)(a3)-CO complex in the cytochrome ba(3)-oxidase of Thermus thermophilus: A combined X-ray crystallographic and infrared spectral study demonstrates CO binding to Cu(B).
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 41
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3qjtB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qjtB02
3DQBA 1M0KA 1URIA 2XX0A 1KGYE 4MD2A 3QJQB 4XTOA 1PY6A 2A3TA 2ZWNA 2WSDA 4HALA 2BP0B 1O0AA 2AANA 4KNSA 3WKQA 5TGZA 4DP5X 2VN3A 5AX0A 1QHJA 3CAPA 5DHHA 3X3CA 1NWPA 1PZBA 2QDVA 3OAXA 3A7KA 1QKPA 2YAHA 4P5SA 1BQKA 2FJSA 3QPKA 1KDJA 4YVUA 3FPXA 1AAJA 3DKHA 2EI4A 2Z55A 5G2DA 4A2GA 2JXMA 3SBRA 1TEFA 4DAJA 4BEZA 2AZUA 1FBBA 2FQGA 2GI0A 2WO3B 3FU9A 2YXVA 3H56A 5G54A 2BZ7A 5I6OA 4PCYA 4BK5C 4TXVB 3PLYA 4GYBA 4KO5A 1E0PA 1PMYA 2G87A 5A45A 2CBPA 2GC4C 4IB4A 3UTYA 1VJMA 3NJMA 4N8UA 3NJFA 2KSYA 3TBBA 3U25A 2GSMB 4BXSV 2BP0A 4FBZA 1IBZA 2FT6A 2VM4A 1A3ZA 3OE6A 2GHZA 2Y69B 1IW6A 3FU7B 3H4FA 2W8CA 4BUOA 4J4QA 4FA7B 1M0LA 1QM8A 5H2NA 1OCCB 1S51A 1BQ5A 4Y9HA 1GZMA 2QPDB 3CODA 4XXJA 2CJ3A 3X1FA 3ZIYA 5B7MA 2I35A 3PWHA 4LDLA 1L9QA 4BDVB 5B7EA 5JJEA 2J55A 1RCYA 4PXKA 3V2YA 5FC9A 2PEDA 2YXWA 3S3DB 2ZIYA 1JFPA 3QBKA 4LDEA 4DKLA 1TKWA 4DJHA 1PLAA 8PAZA 3PAZA 2E86A 4N4YB 1E65A 1ASOA 5B6YA 3UAEA 3FU7A 2DWSA 5I6PA 1NICA 2DV6A 3EF4A 2PPCA 2I7SA 4Q89A 1GS6X 2Q5BA 3IN0A 1S52A 4A2FA 4WTQA 2QPEB 2W88A 1J9RA 2XV2A 2FNWA 4DP8X 2JAGA 3D12B 5I6KA 4RH4A 4KO7A 1PF3A 3ERXA 4GBRA 3FYIB 4BDVA 4YSQA 1ZIBA 4UHRA 3HAOA 2BW5A 3T6WA 4YSAA 3DDLA 2DY2A 2XXGA 5EHFA 3FSVA 4GP4B 1SNRA 1NTDA 1FBKA 3NP3A 1SF3A 3GXUB 4A2DA 3FSWA 3HAPA 3QDCA 2JAFA 4QIDA 1UATA 3X3BA 5B35A 1W6WA 2FTAA 3FT0A 4HAKA 4KNTA 1BXAA 3UTVA 3ZPRA 5AZDA 3UTWA 2PP9A 4DP6X 2Y00A 1FFTB 3CVBA 1U19A 1NIBA 3PXLA 4MFHA 4X4KA 2FQFA 3CDZB 2IDQA 3AZUA 5I6MA 1XB8A 3UGEA 1WS7A 4QKTA 1JXFA 1IBYA 1V55B 3FSAA 2EIJB 1AR1B 1BXUA 3PAUA 5ETZA 3MX0B 5EN0A 3UADA 3JT2A 3NJGA 4G71B 4FPDA 2PPDA 2M3GA 2HX8A 2TSBA 5H2IA 3EHBB 3X1EA 3OMNB 4F2FA 3UTXA 1F88A 3AYMA 4A66A 3EH4B 3KW7A 3NJJA 3ASOB 5IY5B 1C8SA 3PPSA 1JOIA 4F7KA 7PCYA 1GR7A 1CYXA 1L9HA 3CDZA 1E12A 1M0MA 1IUZA 2JKWA 4DP1X 5F8UA 4YSOA 2I20A 1E5YA 3V9EA 2HX7A 4YSCA 3X1NA 5G2CA 1XB3A 4E9RA 2BWDA 3QAKA 2VMJA 2IDTA 2PLTA 2HRHA 1R2NA 1LN6A 4L0PB 4DPCX 2GB2A 5F7BA 1BAWA 1IXFA 4M3HA 1E5ZA 4JHVA 1GW0A 3X2QB 1J9QA 1KBWA 1M9WA 3ABKB 1R84A 5B6VA 3T6ZA 3ABLB 5TK2A 1S53A 4PXFA 5BR2A 2FT8A 3QQXA 3FU8A 4Q8BA 3QJVB 2WJKA 4A67A 2PCYA 1L0MA 4G72B 3RYMA 5F7AA 3PBLA 1BRDA 1J9SA 1WAEA 3UONA 4P5RA 1BM1A 1JGJA 1S54A 4JR8A 3SBQA 4KNUA 1M57B 3HEIB 2OV0A 2HZHA 2KS9A 1GYCA 2X87A 2XVBA 1JVLA 1ZPUA 4GYCA 1RZQA 1PNDA 2FQDA 5ITEA 4W9ZA 3ABWA 2XLLA 1A4AA 2Z73A 1NIDA 1UCQA 1OE2A 2MTAA 3T6XA 3PQRA 1C3WA 3NSYA 3T9WA 2KSBA 3UZCA 1OCOB 2UXTA 1F4ZA 2VSMB 3N55A 2EIKB 5I6LA 1V10A 1L9SA 1OOWA 1GY2A 5D4HA 4E9QA 4X1HA 1JXGA 4DP7X 1JZGA 2HXAA 2YCWA 4GY4A 4YL4A 1X0SA 1RKRA 1AG0A 2IDSA 3GDCA 5AX1A 4G7SB 5TK4A 3HARA 1PAZA 4GPOA 1KCBA 4GP5B 2FWLB 3NJLA 4HZ1A 3OE8A 2L6XA 3S3BB 1KGBA 3UABA 1N70A 1KG9A 1AZNA 1OF0A 3X1GA 2BO0A 2R4SA 1S8JA 2UX7A 2I7OA 4ZK8A 5KKHA 1QNIA 1SJMA 3COCA 2YDOA 4EJ4A 1ILUA 1EHKB 1F56A 1GY1A 2QDWA 5AZUA 3UG9A 1CWQA 1AZCA 1QHQA 1M56B 2JFCA 1BEXA 2F93A 3T6VA 2VT4A 5B3SB 1ASQA 4A2EA 4EIYA 2XV0A 3FPYA 3OMAB 3D4SA 1AZRA 2VM3A 5A7EA 3RFMA 1JERA 4HHGA 1BRXA 5H2OA 3C9LA 5ANHA 2N0MA 1MG2C 3L45A 5AHZA 5AWZA 1ZDSA 3RZEA 2IWFA 5PAZA 1JVOA 2I1XA 2CAKA 2J56A 5D4IA 1BYOA 2B08A 3DIVA 3PCYA 4KO6A 3JTBA 9PCYA 1CURA 2VW4A 7PAZA 1X0K1 4YSTA 3T71A 1NIAA 3SBPA 1VGOA 2Y01A 3QJTB 3TU6A 2LNLA 2XYBA 1NIEA 4KO9A 4E9YA 3REYA 2X72A 3IEAA 2ZZLA 1AG6A 3OD3A 5LDUA 1JZJA 1KBVA 2YAPA 3NJHA 4AX3A 2YAMA 1MG3C 1KCWA 4AZUA 5ITCA 4AI7A 1ZDQA 2PPEA 2DWTA 1JXDA 1ETJA 2UX6A 1FWXA 2YAQA 1KG8A 2YCXA 4G7RB 3NJIA 1J9TA 3AM6A 1AZUA 3AG1B 2YAOA 3TA4D 3NSBA 5H2KA 2WO2B 3WQJA 3CG8A 4QI1A 3NS0A 1H2SA 2DYRB 3S8GB 2H5UA 4NAJA 1GUEA 2RH1A 2Y02A 5B1AB 4NERA 4YSUA 4QRYA 4EF3A 3AG2B 3HB3B 2BWIA 3QJUB 3QJSB 2R4RA 1SFHA 1AS6A 3FS9A 4UAHA 5B1KA 3IBOA 3WNJA 2XWZA 2VW7A 2UXGA 4JQ6A 3C75A 1AOZA 4NC3A 2J57A 2PP7A 1BYPA 3V9CA 3NY8A 1P8UA 3QBIA 1HFUA 1NDTA 2IDFA 1MZYA 1AQ8A 4HIPA 5G28A 3PAVA 4X32A 1PXRA 5BR5A 2OCCB 2R7EB 4HCIA 4YVNA 6PAZA 2AVFA 5B7FA 5LWEA 1R1CA 1C8RA 1TU2A 2TSAA 1IC0A 1V54B 2QT6A 3AY2A 5J7AA 3VHZA 1OCRB 1WA0X 3FSZA 5I5IA 1DYZA 4X31A 3QJRB 4NB7A 3TASA 4HCFA 4L35A 3HAQA 1JZIA 1JZHA 2VSKB 5B1BB 2BW4A 4YSSA 4K5YA 3ABMB 1W6LA 1S8LA 3NY9A 1BQRA 2PPAA 2RACA 3H4HA 3V2WA 3OQRA 1KV7A 1UAZA 4DPBX 4G7QB 5D4JA 4HHWA 1PLCA 4E9SA 1N68A 4G70B 5PCYA 1VLXA 1TN0A 1A8ZA 2GBAA 2R7EA 1IW9A 1MGYA 5B0WA 6PCYA 4BVNA 1SFDA 2ZXWB 5H2JA 4KOBA 1ET5A 3UAAA 4F2EA 3HASA 4N4WA 4N6HA 3NYKA 4UF7C 2AFNA 3QBLA 2UXFA 4DPAX 3WNIA 2NTUA 1X9RA 3NSDA 3ZX1A 3VI0A 1NWOA 2XXFA 1MZZA 4ENZA 1PNCA 4JKNA 1W8EA 2OJ1A 5G36A 3IE9A 3WIAA 3ZPQA 2CALA 2P80D 2Y1AA 3CZUB 2CCWA 2Y03A 5DHGA 4OV0A 1NINA 4BXVA 4HYJA 2GIMA 2Q9OA 3AG4B 3CVDA 1ET7A 1AS8A 1WS8A 1NPNA 1BXVA 1QKOA 1A4BA 1AIZA 3AG3B 3WG7B 2P80A 1Q5IA 3GYRA 4UG2A 4E9TA 1J5CA 3FQYA 2BRDA 1E67A 3NJKA 2HPYA 4BV0A 2FT7A 3ZBMA 1IKOP 1DZEA 1KMEA 3S3CB 5I5MA 1T5KA 4AKQA 2PPFA 4A68A 5H2MA 1GSKA 5JJJA 2UXVA 4XTNA 5B1JC 3DTUB 5B34A 2X88A 3ZDWA 3ODUA 5B6ZA 4LDOA 5B2NA 5A8EA 1HAUA 1I53A 1HAWA 1P8IA 3BVDB 3FYEB 1A65A 5AHYA 1HZXA 1OCZB 1XIOA 1GU8A 2J4YA 3EMLA 3NT0A 1BRRA 3KJ6A 1GS7A 5B1JA 3WKPA 4KOCA 1SDDB 3QAPA 4MQSA 2YARA 2ZOOA 4XT1A 1L9TA 2XU9A 1GS8A 2Y04A 3OE0A 1L9OA 1SHWA 1Q5JA 4XT3A 3UZAA 1RZPA 4KLYA 1ZV2A 3G5WA 4JHUA 1FA4A 3MBWB 4BEYA 4XTLA 3ZEVA 1PZAA 5G2AA 4DP4X 4UANA 1PY0A 4YSPA 3MBVA 2H47C 2XX1A 2ZONA 4E9VA 2YCYA 1WA1X 1WA2X 4TL3A 2IDUA 1A4CA 1JZEA 4AMIA 1KYAA 3SN6R 1EZLA 4WKXA 1E30A 3C9MA 4IARA 3S8FB 2BZCA 2XUWA 3CVCA 1DZ0A 1ADWA 1JZFA 1PLBA 4A4MA 2IWEA 2EIMB 1MDAA 1SDDA 3PDSA 2BHFA 5JJNA 5AFAA 1NZRA 3WI9A 5I26A 4DP0X 1OE1A 4CSPA 1NPJA 1AT9A 2IH9A 4JKVA 1ZIAA 3NSCA 3AYNA 1X9UA 3AW5A 2I85A 4HYXA 5B6XA 1NIFA 1PZCA 4CSZA 5AKRA 3NSFA 4BWUA 1OE3A 2F95A 2NTWA 1ID2A 2BP8B 5E9NA 3SQRA 2I21A 4YSRA 1AACA 4AMJA 4YSDA 3TBCA 1XJIA 4PAZA 1AS7A 5I28A 1TEGA 2YAEA 4BWWA 2EINB 3VVKA 4M4RB 2HLEB 4E9WA 3OM3B 1AP9A 4MQTA 3P0GA 1ASPA 5C1MA 1YLBB 5I6NA 3UACA 4AKPA 4L6RA 1CYWA 3KW8A 3EH5B 1ET8A 3ABGA 1PXSA 1AZBA 1JV7A 3T45A 4BWBA 3HANA 2VW6A 1SF5A 2IAAC 4MBSA 4DP9X 4A2HA 3FQ1A 4GP8B 4WW3A 1L9PA 1XB6A 1PCSA 4E9XA 2MRYA 1XMEB 1ILSA 2BP8A 2DYSB 4W1TA 2YAFA 4BWTA 4YSEA 1OV8A 1F50A 3VG9A 2ZFEA 2H3XC 2PCFA 4KNFA 2HX9A 1CUOA 2GC7C 2IH8A 3N2JA 1JV6A 3QBGA 1QLEB 1TN5A 1B3IA 1KDIA 2B3IA 1P8HA 5H2LA 4GXFA 2IWKA 3NYAA 3OMIB 2YCZA 3FQ2A 3NJNA 4K9JA 5I5JA 1X0I1 4IAQA 4MD1A 2AZAA 2XV3A 4QLWA 4AKOA 2LLNA 2J5WA 3X1BA 2WJLA 4HWLA 3PXOA 5H2PA 2EILB 5H2HA 2HRGA 5FJGA 2CUAA 3NP4A 2AT9A 2YDVA 2FQEA 1H68A 3VGAA 4WAVA 2YQBA 4HCGA 4DP2X 3IN2A 2NRDA 1L9RA 3BQVA 4GRVA 3OE9A 4FAAB 1CC3A 1J5DA 5G53A 5B6WA 1SHXA 4EA3A 3ASNB 2PP8A 3EH3B 5DYSA 2KSAA 3VW7A 5A44A 1AANA
chains in the Genus database with same CATH superfamily
2XX0A 2WTPA 3GC3A 4XI5C 3C60A 4FQXB 1XV8A 2VJ0A 2D8KA 1UM5L 2ZWNA 4GBXD 1JZ7A 1DVTA 2OQJB 3D08A 5K39B 4KFMA 4IRZL 4GT0A 3JTTA 1KJ3H 1BQKA 5KJ7E 2WXPA 1A6WL 5AG9A 3CFKB 4DPRA 4ABUA 4LP5A 3DETC 1JS4A 5HSFA 1NC4D 5SWZD 1TZGL 3PGCB 4W93A 3FUJA 5TPWH 3PIQB 3F5WA 1PMYA 4L5FE 4UUJB 3NJMA 2W9DH 3MLZH 5ISZE 1BOGA 1VJMA 4ZZKA 3BFWA 4BXSV 2XA8L 4JKMA 4LHUB 5LGJB 1TQCB 3ARFA 4LLMB 3FU7B 4KKLC 3CK0L 5CN2A 5DQ9B 2AITA 3BGMB 3GSUA 4URTB 4MJ4A 3D06A 1P0SE 4N2OA 3ZTCC 4DHLA 2X7LB 2XC8A 3KYAA 2P46B 3L3GA 5TF1H 4V1DD 4HQQL 5FM5M 4ATWA 3G04B 4XNQA 4PJHE 3QHTC 3VXOA 5DI8A 3RNQB 5I66A 4LLVB 2NZ9C 5HI3D 4K9EC 2ZIYA 3KR3L 4WO4A 2R29L 2XZAH 1HWWA 2AJVH 5DHMC 1VEPA 3PAZA 4LPCA 5ECJE 1KEGL 2A77H 3IFLL 3O41A 3EF4A 2AXGB 1A4KB 4M8QA 3FTGB 5IQ7H 2OR8A 3DBXB 1Q9OA 3X17A 3CH1B 4KDTC 3M46A 4MQTB 5JMOC 3SO5A 2JAGA 5LBSH 1VGEH 4ZUSB 5IR1B 1DQJB 2KDYA 3MV8B 4GG6F 4UHRA 4ORGA 3HOGA 3L3OA 4JE0A 3DOSA 3DPBA 5GJTL 4KKZA 2WLLB 4HFWB 3TS8A 5D5MF 4ZMQA 2Z31D 1P5UB 4GW1B 1R5VB 2VLJA 4DUVA 3CXHK 4P5MA 4Z7VA 4GKSA 3TYFA 3HC4H 4DGIL 1TTRA 5I6MA 1XB8A 2VNCA 1OGAD 1CDBA 1F1DA 3LKPA 2W1NA 4FEMA 1UXWA 3PAUA 1DL7H 3JT2A 1MJUH 1LO3L 3LEYL 4FTVD 2PPDA 4DEPB 2BMKA 2XWBA 4FKHA 4Y5XC 5AVSB 2TSBA 5E8PA 3GO1H 4YDVB 4EN3B 4A66A 3EH4B 1PD0A 1HNYA 3EOTH 2QQNH 3FUEA 4TL5A 3SDDA 5C0RL 1DJGA 3U0TA 4IIQA 3A47A 3FCTB 4RLDA 1BMGA 3L6FB 3QYNA 1BHGA 1S7SB 3AABA 1MXGA 4LLWB 4YDIL 4LZKA 5I16B 5IWLA 3QAKA 3TNMB 1CGSH 1A7QL 1IC5H 4N5EC 3JZYA 4I18C 4M43L 3IGUA 5FO2A 4RIRA 2ZUQB 5F6HI 4KI5E 4L0YA 4E41A 2L7QA 4HA1A 2PYED 2WXOA 2QSTA 4Q52A 2IG2L 3IKCB 4FQHB 1GW0A 1ORQA 4PJEF 5F7KC 1WHOA 5CEZE 5JPNC 3AWGA 1N18A 5CILH 3HRZC 1NGWA 2V9QA 1I9IH 4KTEL 1S53A 3WNPA 4YZFF 5GSRA 4BZ2H 4W4OA 4A67A 1G6VK 4RMBA 5IW1B 5LN4A 3PBLA 3CZLA 1HCFX 3B43A 5KN5B 1A7NH 1J9SA 2A73A 5EORH 4JQVA 3MJ8B 3BAJA 3KYNB 4MD5B 5F3HA 1WTGT 4I5BA 2W07B 3MGOA 3UBXA 4J3OF 3H7BA 1DQVA 1FFPA 3BPOC 4OFIA 2M2DA 2NMSA 2OMTB 3D4ZA 5FCUH 1K5NB 2FX9L 2ZWLT 3NVQA 3VXMA 4M6NL 1F02I 2NNFA 4D3CL 1OW0C 1UHVA 3DK0A 4Q2ZA 2KSBA 4ZXBB 1I1CA 3BGAA 3CVHA 3FFDA 4XB8A 5T5NF 3TH4T 4YIQA 1QG3A 4E9QA 5E6IA 5FV2A 1QYGL 1FFQA 3FCBA 5JMRA 3GHBL 3RKDD 1PAZA 2KKQA 4DH2A 2A7BA 3TVMC 2ENSA 1E4WH 2VXSL 4FLHA 2BO0A 2AQTA 3F58L 3BQUD 1ZLVH 2XWEA 4TOYH 1HHKB 5JHLL 2CUHA 3V5KA 2VDLH 4TPRH 1K4CA 3P3SA 5CIPB 1WAAF 1T89C 4PRNB 2ATKB 4LLQB 4RAVA 1M56B 4ABWA 3Q6FA 2EH8L 1DEEB 4GG6B 5TJWK 3NPZB 1ZLUK 1MH5A 2FLRT 3H6JA 4WEBH 1EAQA 5E9DD 2CCLA 3HBPA 3A22A 5D7LE 1A0QH 4IMLB 5D5MB 1MG2C 4P2OC 2UYLB 1R5IA 3BUDA 4HEMA 3TT1L 2J56A 3RL2B 4GSQA 5E2JA 1G5AA 2B08A 5B38G 3RVUC 2R56L 3K81A 1TTBA 1IIKA 2E7BA 3WUWB 4N26A 5DRNA 3LZPA 1NIAA 3MLUL 3VCLB 2E6JA 3QIUB 2B3RA 4AMKH 5I17A 3J2PA 2EABA 4WUKL 3W9EA 2Z4QB 4F37F 5ECGA 3V6OC 5HHPA 2EIZB 3WTSA 1N0XH 4JPQA 3H3PH 4IJ3C 1UB5A 3PWUA 1SLWA 4B9KC 3VXSE 1WBXB 4YXLL 5HY9B 1A4JB 5J13C 4H1LG 3DTDA 1KFGA 3BH8A 1SYSA 1KWGA 1XF2A 3BIKA 4LRIA 4ABQA 4K5LA 1USZA 3DURA 2ICCA 2HH0L 3MLXL 1P4LB 5DJ6A 3KGRA 4N3UA 5HDBE 3AM6A 2D2OA 3FL7A 3STLB 2XBDA 3DX8A 2EXWC 2CKBH 4C8XA 5EUOF 2IH3A 5JHDB 1H2SA 5C0FA 2OULB 3HI1B 4LIQL 3RKPA 5I73B 1DVFB 1BOYA 2OL3A 2V7NB 3BWZA 3RNKA 4DESA 3VWKC 4PJEB 1U93B 4KKCC 2CDFA 1TJIL 5F8QC 3LCYA 2X0VA 3HZKA 3BKCH 5E1QA 4BQ6A 3L5WB 3MROB 3O3BA 5D1QC 3WNJA 2R4SH 4U3XA 4MAYC 2OJZH 3V9CA 4AQEA 2PETA 3AM8A 3TBTA 2X2YA 1J1XH 4OF3A 3UTSA 1JGLL 1KY7A 2A9ML 4JY5H 2Y06L 3V6ZB 3BEVA 5DWUL 3C8KA 4IBLT 5D71L 2OW7A 4BH7A 4AGMA 1CD1B 4YHIB 1HEZA 3UC0H 3UC2A 4HCFA 4LLUB 4QRPB 2WTRA 4IEFA 4BKSC 3QCUH 5ID0B 3U7AA 4MJID 4Z78B 5KZCB 1OSZA 1NCAH 3N1MC 1H3TA 2EEAA 5CCGE 4OBRA 3N9GL 3S5ZA 4TQHA 3WFCL 3JXAA 4G7QB 5D4JA 4NQXA 1AYOA 1SLVA 5DRZA 3IJHB 4JGMA 4D0CA 1DUYB 5B0WA 5D70H 3MREB 2IAMB 2B16A 3TIEA 2VXQH 3VXTB 4DS7E 3UP6A 3B9EA 3RGVA 2W94A 2DJ4A 5HDQH 1FL3A 3IDIB 5DS8B 3VXQA 4JO1H 2VZUA 2JV6A 3K1DA 4MSWB 1PQZA 5EOQL 5DMIH 5T5FH 2Y1AA 3LKRB 2CCWA 4KZDL 4JRFA 2L0DA 4G8GB 3VXUB 5GZOA 1LDPL 2DWXA 4KXZH 4PJCA 1U58B 2D0HA 3UTPD 1GGCL 1AS8A 5EB9A 4LSUH 2OJEB 3QCVL 4XMXA 4XPHH 4X4XB 2BSTA 1E8ZA 3FQYA 1U9KA 2WLKA 1TETL 5HDOA 4JS7A 1NCNA 3PUUA 1UD6A 3ZMNA 5D1ZD 4CMHB 4PMEA 4ZUVA 4Z6AT 4Z95H 1WBYB 4KZEH 4R0LB 4M1GL 1KGWA 3BYTA 4PWFA 1YMME 4KKNA 4FCHA 1HOCA 4Q6IB 1EK3A 4BK5A 4Y2DC 4ZMTA 1I3GH 2ZJSL 2C3VA 4PRBB 3FQTA 3PNWB 4XHJC 1E3ZA 3L9RB 4UTBA 4YDKL 1N6VA 5IB5A 3MFGB 2BIQA 1D9KD 1IL1A 1ZA3A 2Y7QB 4Q9RH 5BOPA 3B9KC 1DLFL 2VO5A 5KSUB 4GQ9H 3D5OF 5EUOB 5L0QC 2WO4A 2X4NA 1AI1L 1KBPA 3OXSB 1WRFA 3ZDXF 1B2WH 1FNEB 2WXNA 2CQVA 2ZONA 4HH9B 4ZSOE 4K3DH 2K1MA 2ZF9A 1PX8A 5I9QB 3EBAA 3WL9A 2G2RB 3FQWB 3P9WB 4PVMA 3MNVB 1E30A 2F8XC 4UAOC 3OLGA 4PGCA 4YBQD 2MOVA 4ZO9A 4GKLA 3U9WA 1CD8A 4H26B 5IVXE 5JIMA 3GRWH 2YA2A 5TDPB 3PDSA 1WITA 1VA9A 2EKJA 2PO6D 4KAQL 4RQQA 4TRPL 3HZMA 2ZNWA 4Q0XH 5GGTA 2JKSA 4KI5C 2VE6B 4OFQA 2NUPA 3QO1B 1RZJL 1SEQL 3FONB 3WTXA 4PWJA 1F00I 1NBZA 4OFDA 4XP1H 4MB5A 5D1XB 5HHOD 4Y19A 4XMUA 4WDIB 4OLXH 5D93C 4LNVA 3UAJD 4BWWA 2OSWA 12E8H 1KN2H 5CJXC 2JH2A 3QJFA 4Z76B 1L7TL 1YAIA 5F7FA 3VG0L 2X3BA 1IFHL 4J7RA 1J0ZA 4JZNB 3MRIA 1KZQA 3BSZH 1E9QA 2VXVL 1NM9A 1IGCH 2R2EB 3L1GA 3P9MA 3K80A 3Q48A 5DHVH 4JFFD 1JGUL 4AW7A 2DD8H 4DP9X 1UZ6E 5ANME 4EI5C 5DHYA 2DYSB 5IB3A 2W5PA 2PCFA 3SYQA 1CUOA 5KS9A 2ZKXA 1I8LA 1FO0L 2MWCA 4GXFA 3EIFA 3SY6A 4QRSB 5BS0B 1U36A 2ICWI 5D6DC 3WUZA 2J5WA 3DSFH 4XMTA 2ITEA 1TQUA 2VITA 1OZUA 3QYMA 4LU5L 3E1F1 5FUOH 5JYLA 5DMJB 3LIZH 3TZVB 2C7FA 4IYKA 2F74B 1PJ9A 3EBIA 5IIEA 3ZUNC 5KAQF 3RWGB 2KSAA 3DPDA 4XXDA 1FL6B 1IAKB 2EDWA 3T04D 1M0KA 1MY7A 3OAYK 3VMOA 3QJQB 5JQHC 1PY6A 4M9PA 4NRZB 1WT5C 1RL1A 2WYZA 3KXFA 2FNBA 4BFEA 5BVPH 2AANA 1U8KB 4Y4KC 3Q6GL 1QNZL 4EUPH 2VN3A 5DJ0B 4B9IA 1PZBA 1NWPA 1DVSA 3A7KA 2YAHA 4YNYA 1UJ3B 1VB9A 4BEZA 4QDGA 2DQEH 3L17A 3QJXA 2BZ7A 2QSCH 5DXWA 3IDNA 1J1PH 1DDTA 2QFRA 4WFFD 1OAXH 4P23C 2VR6A 4HXAH 4JRYE 3DVIA 3ZDXB 2XIBA 3H9HA 2O5ZH 3OGOE 3SPCA 1Z66A 2W8CA 2VDPH 5IMOB 1OCCB 3C5ZD 3CVIL 3PQYD 1ZLUH 2DH2A 3OQ3B 4JFEA 5DVNA 3T09A 4JFQB 3C6SB 4HCRA 4BFOA 2B20A 2ZYHA 5HJGA 3ZIYA 2PTUA 3RWIA 5DJYB 2E56A 2WKOF 5J6GA 3H42L 3F84A 4Z3FA 5C09B 3T2NH 1TQBB 5CP7B 1UYWL 3OL2A 4F33B 3T1FB 5MENE 3ULUL 3BP5A 1YNLH 3DARA 2R2HB 2IPKB 4JO5A 4OCLC 3HS0B 1F3JB 2AV7B 2PWHA 5DO2D 1G9HA 4G59C 2ITFA 4QHLB 3N1QC 2X9WA 1Q72L 4UV4L 1LL1A 3ARYA 4TNWK 4F57L 1E8XA 2PPCA 1DN0B 3KD4A 3NCFB 3K91A 4Q89A 5KOVC 1X5AA 3UBFA 3CLFL 5ETUA 4A2FA 4JQIL 2Y9RT 4N2LA 3IJ9A 3KL5A 1JPTH 3QGVA 3M6DA 3ETSA 1JFQL 5ILTL 3GKWL 4GBRA 2X4SB 4R26L 3AXHA 3A6OA 3AU1B 2IGTA 1S5IH 1CR9L 2BOCB 5E8EB 4KNTA 2DLTA 4DP6X 1EIBA 1C16B 2I27N 1YUHA 1S9VA 3VVWA 1OTSC 4HV8A 4WEMB 4X4KA 5JIIA 5LJYH 3CDZB 3WY1A 4DCQB 4EQ2A 2Y3AA 3PGDA 1JI2A 3IMUA 5E7BA 4X5XB 1JGVH 1HH6B 3M8OH 1IGIH 5BRZD 2Z7YA 1CE1H 1HU8A 3MX0B 3CXDL 2B5IB 2ED6A 1KELH 3NJGA 2EVFA 4A7SA 3QZPA 1KOAA 4NJ9H 1MAMH 1DTUA 4P4KD 2IJ0C 3V4UL 2M3GA 3P40A 2JCWA 2SEBB 5IFJB 4QWWC 4RRPG 1T3FB 5KSVA 3QDMB 1ZS8A 1HESA 1IBFA 4F7KA 4O02H 2JKWA 3KPOB 2F08A 1KXQE 4OJFH 3OSKA 2EH7L 2HX7A 3I6GB 4Q6YA 2YLKA 4UNUA 3X1NA 1BLNA 1J8HE 1PG7H 1QHPA 1U8HB 4KTDL 2IDTA 1EEYB 1N8ZB 1SJHA 2NY4C 5D2LE 2UWEA 5AAWC 1LEKB 2YEQA 4DPCX 4PG2A 1QSFD 4HIXL 4K7FB 3D87B 3FOLB 4UINL 4DN3L 3S2AA 1J9QA 1NAMH 4QXVA 2FGZA 3BPCB 3GSWA 7FABL 3C5JA 1K2DA 1FVDA 4OQTA 4QXTB 4G8FA 3NJVA 3MYZA 4Q8BA 4L37A 1BZDA 2CRMA 2VABB 5F7MC 3SKUD 1CLOH 4WW2A 3O45B 1WAEA 1LNUB 3MOQA 3QFJD 3U46B 4K9EH 3T4YB 5KANG 3DRQA 2Y4SA 2YA1A 1UGNA 2LTQC 2X6CA 4N8VA 3ZHNA 4KK5D 3TA3A 4WNQA 4ZMPA 5DMGD 6FABH 2EVGA 2EJ1A 4F7MB 4ZW5A 2MH4A 2H9GA 5J3HD 1VERA 4R7DB 1YYMH 5GHWL 5LGKA 1CICC 2JKLA 3QIWA 4HPYL 4W68A 3PHAA 4W9ZA 5FO8B 1J5OH 2JJWA 2LR4A 1X5GA 3L3HB 3LSOA 4UNIA 1BWMA 1UCQA 1RZ7H 3Q2NA 4KROC 3NSYA 4PFEA 4ZUWB 3U0WH 1H8NA 1T21B 5DD1L 4H20L 5CLWA 5MHSD 1RZGA 3WU1A 1V10A 4WSKA 2I60H 2G3ZA 5IQOA 3CPLB 4AGLA 5EOCH 3L4VA 4P9HC 1VGKA 3R06A 4GQPH 2DAVA 4OFVA 5AEAA 1CMOA 1DHKA 2OTUB 3CFCH 1FJ1B 2VDQH 3O9WC 2FEDD 2X0WA 4LVHC 4NUPA 4NQVA 4G83A 4JHAL 5IVNA 2B1AL 2IANE 3A4DA 2ILLA 2BOBA 3QVAA 1UXSA 2V5RA 4U1MA 3KPMB 3MLWL 2JWYA 5IVZB 3SJVB 3TEYA 5D8JH 4N90E 3WFBH 4QGYA 4ODHL 4F58H 1BEXA 4GKZB 3CU1A 4U0RC 4S2SA 1T2XA 1CJYA 1G7LB 3TNNA 3W9DA 2FBJL 3ZTNH 4DFHA 1JD9A 5FLUA 3FRPB 3HFML 1JERA 4FHBD 4XVSL 3RWCB 2WVUA 2EE3A 3U2IA 2OKMA 3FHEA 3O2DA 4U6HA 5HYIA 1Z9NA 2BNUB 3WN5B 2D03L 2CAKA 5E00B 4YK4C 4NEHB 3PCYA 1YECL 1CGWA 4KO6A 2Q76A 5KVDE 4AM0A 1YPZE 2VISA 1B0GB 5KYNA 4M02A 3GPEA 4CU7A 4OV5B 5FYJE 2X72A 3ARBB 1JPST 2XPGA 3GS0A 1LP9A 4AL8L 4HGMA 2HKHH 1XR9B 4Y9GA 2X6MA 5DMKB 1KBVA 3EXLA 3NJHA 1XGQB 5C0CD 1JPGB 2MIZA 1THAA 3VXPB 1YNTA 4H2CA 5JR1H 4GIAA 3W56A 1LDSA 4PRHE 1F5WA 5D2NE 1AH1A 4OZIA 4OGYH 5JXAH 5FYKU 1E90A 3S0PA 2OFQA 1U6AL 4Y4HA 4AQOA 1NGYB 5DQJB 5AVUB 4PHZA 4DUXA 1AIFA 3QUXD 5TF0A 3VGGA 4ABVA 4XPTL 3IDMB 4QI1A 2XVKA 5I1HH 4TUOB 1MUJB 5HVWA 2I5YL 2FH8A 1MEXH 2ESVD 3S8GB 2F2HA 5INDB 3QEQA 1S8DA 2ITDA 1XF4A 3DVNB 4K71C 5HGBA 3S35L 4F8PA 3IK2A 1IAIH 4W9EC 3SO3B 4HK0A 3O3EB 1M2VB 2Y5QA 4WCYL 5HGDA 3RL1A 4JGJA 1NSNL 3DHMA 5F0PB 2A83B 3ZHLA 3GB7B 4L8CA 3LH9A 2KMWA 1NC2D 3ULVE 1P5VB 2DYPA 4QD2E 5KBLA 4JDTL 3HB3D 4FXKB 1WIUA 2KPWA 4X32A 3GT6A 4IOFC 2ZXDA 3DIFB 4UQ9A 4XCEB 1OAUL 3OKLB 3HS9A 2GBVA 3L4YA 4ZAKC 3S9DB 4YHMH 4ZYKB 3HG4A 3OB0K 3PXHA 4OF5A 3DXAD 1PG7X 4FLSA 4OLZH 4Z0BL 4JN2A 5BO0D 1WWWX 3T0EC 1J5HA 1MFUA 1T22A 1UWEL 3P11L 1FNFA 1UM4H 2EYTB 3R1GL 2CO7B 2HFGL 2JIXA 2A9CA 3QUML 1WICA 1MFNA 1NCBL 1L5GA 4AE1A 4ANUA 4NO2A 2XETA 1PKOA 3K5RA 2XV6B 1HL8A 1MFVA 3OAYH 4NKMA 4Q4EA 9CGTA 1KB5A 4M7JL 2X1QA 4AG4L 1RHHB 2B7DT 3MU3A 4HFUH 4JUTA 1G0YR 4KOBA 5KW9L 1KCRH 3OLDA 1XX9C 3W81A 4N4WA 4N6HA 3F12A 5HP5A 3IDXL 4IKNA 1UA3A 4UDTA 3FB7B 1NMAH 4P2QA 3T2LA 3HBGA 4M62H 2IPTL 2JQZA 3CZUB 3NAAL 1OGTB 1HE7A 1WEJL 3IB4A 3FZUD 3V4PL 4S1QL 4FG6C 3QS3A 3VFMA 4TSCH 1NPNA 4J28A 4RDQF 3A6CL 4KRNA 2OX5A 5L8KB 2P80A 3A21A 1RJZA 4HGWA 5J9PB 1SJVA 2BOLA 2FT7A 5FV1L 1FYHB 4BFIB 1U8MB 1DZEA 4YHLL 1MRCL 2QBWA 2EDNA 3CIAA 5FGSA 4NPJA 4ZTOL 2P5WB 3A23A 2X88A 2AHIA 3I50L 4N1CA 3KBPA 4IRZA 3DV4B 1P8IA 4BUHA 1A3LL 1S9YB 1X44A 3GSQA 5SWQB 2OMVA 3S36L 3P30H 4P2RD 4Z1PA 1OAZH 1LMIA 4K7PL 2K6WA 3G5WA 4AUYA 1RZPA 4MRCA 1IM3A 3HKFA 4KPHL 4BZYA 1EDYA 5CGYC 2X05A 1F1GA 3B9AA 3ETBJ 1MREH 4CVWA 4FRWA 4DAGH 4K3EH 4YE4L 2EVIA 1TYJA 1G0XA 3HTLX 3OAUL 1QUNB 5TE7L 5EBWA 2NYZA 1E27B 4AV0A 3MLRL 4GAFB 3C9MA 4IARA 2FECL 2GI7A 1DZ0A 4UV7L 2XZCH 5IP4A 2O5XH 2V5TA 3KPNA 4JY4A 3FB8B 2X70A 4NLHA 4LSTL 1RZFH 1P4IH 2EE2A 1TZ8A 2X6VA 3KPSB 3P9LB 2WUCL 4HJUA 1NPJA 1ERNA 2DH3A 1AT9A 3DX6B 1PDKA 1UADC 3KHOA 4H0LC 1T83A 2R29A 1SHMA 3KDPB 3LHPL 3QORA 4MASA 1ID2A 2NQ3A 2L04A 2F19L 2BSSA 1F42A 2GT9A 1EERB 1BLIA 4OZGA 3VG9B 2YD3A 3T3MF 2HJKA 3A4EA 2FD6L 3QNZA 1PIGA 4IDLA 1DBML 2NLJA 1K4DA 2EYSA 2X4PB 1A6AB 1T7ZA 2VO8A 1L4IA 4LOEA 4QTHB 5EU3B 2VLJE 2R27A 2YKLH 2YS4A 4DKEH 4Z7VE 1EO8H 43CAB 4X0KB 4NLAA 1AZBA 4R5XA 1JV7A 3CV5A 4ODTH 1XR8A 4N0YL 1PSKL 5CJOH 1HQ4A 5K93A 2XG5A 5MEOA 3DMMA 4HP5A 1L9PA 4JGUA 1KUMA 4QCIB 1XMEB 2YAFA 5C71A 1NANI 3VGHA 4Z18A 1XSJA 3VFTB 4APQC 3GRBA 1A1OA 5DYOB 2H3NA 4XPAL 3QBGA 5FO7A 1ZJBA 3LRGA 2B3IA 1XH2A 1JF5A 3D33A 3VA2C 4JFSA 4Z7UF 5KYXB 3NJNA 1LE9B 1E8YA 3CQPA 3GMQA 3MXVL 2LLNA 2X44D 4XVUD 2YBRA 5BUAA 5EEZA 3MFFB 4MMXC 2R2CA 1ZRUA 3IPEA 2CJSA 2QVIA 5BZWA 4BQBA 5BMFH 2PW2A 4AZ8B 5B39B 5IEHB 2JI3A 4GBXB 3BQVA 4NKOA 3P3TA 3ECVA 1P7QA 3QQ4A 3HG2A 4E41E 5LXGH 4EA3A 4MA3A 3F7QA 3EH3B 5I1KH 3D2UD 2K8QA 5ICUA 1LEIA 4KC3B 2R8SH 2PXYC 1CFSA 1THCA 3HAEA 4XI5D 35C8H 4NS0A 3BUYA 5DQDH 1S7XA 4C56D 1NC4B 3MRNB 2D73A 5SWZB 5TGZA 2DM2A 4I0PA 4ELDA 1ZANL 1OB1A 3D51A 4QLRA 1OWWA 3OAZH 2OK0H 1G7QB 3IXAB 3TM6A 1NEZB 3BWAB 4GAGL 3POCA 3DETD 3N85H 1G7JB 2ZP8A 4AC2A 3VXME 2RCSH 4FFZH 4XZUA 2Z8WC 1BD2A 1IC1A 5A45A 3QEHB 4OCRL 2DL9A 3OKEA 5G4NA 3WTYA 4V1DB 1GJWA 2C8NA 3CFUA 5EFIB 1RPUA 1I7UB 5SWSD 1NKGA 3N43F 4KKLD 4XNUL 1JPFA 2Q87A 2VL5A 4YDJA 2J72A 1RIVH 1IGMH 1SOSA 2BSED 2VR5A 5AZ2L 4ENEC 4Z7IA 1EANA 1QFWM 4M7ZC 1KPVB 1CGYA 5F8RC 3DA0A 2I35A 3VXNB 1AMYA 4AQ1A 2NDGA 4R5TA 1BP3B 1NGPL 4JAMA 4NYLA 5FF6A 2VGLM 2WXMA 4PXKA 1I3VA 3GHEH 3QEGH 4HWZB 4TN9A 3EW3B 1T66D 1R3HA 2NZ9D 2WXFA 4WFGD 3RVXC 5IESH 4B9PA 4D0DB 1OD7A 1EMTL 4UYPA 1ASOA 2DIJA 2J71A 2YUWA 3CFBA 5CD3A 2EEDA 2DV6A 4IRSD 3TH3T 3T3MB 1G7IB 1QEWA 1JWMA 4NQDA 2W88A 4WTQA 1FVEA 5JHLA 2Z31B 2FNWA 4NHUA 4WWPA 4YHNB 3ILQC 3CHOA 5ITBL 4XWGH 2HLAA 3WJJA 3UZQB 4HEME 4FA8A 4PRIA 3EBHA 4JG0H 5AB1A 1OGAB 4LSSL 2DQTH 1YJDL 2A6KB 1A22B 1W72H 4M6OH 2PTVA 5D96B 2OA9A 3UTWA 4JRLA 2AJSL 5TQ0L 4FTVB 2KERA 4ODXB 5L2KA 2P52A 4ZD3H 2EUVA 3AC0A 4G3YH 3VYNA 2EVJA 3OHXC 2QQQA 1V7ML 2VIRA 4JZJB 2XIIA 3QJHA 1LMKA 4PV1C 1I9RH 4Z7UB 5H35B 3RJQB 4OCYL 4XNMA 4DEWA 2HJFA 1JGEB 4HHAA 5I1AA 2ICWA 5J6HA 4NQSA 4JANA 3GGWB 3KGSA 3TBVA 5K1NA 5GS0L 3OSVA 2BC4B 3OMNB 2J6EL 4XNYH 3AYMA 4G80B 1MIEH 4MA8H 3VI3F 2F9BT 2F15A 2PYEB 1HYSD 2OMBA 1FBIL 2XN9B 5C0BB 3NA9L 1OGPA 3KPRA 3OB0H 4DEUA 1ML0A 2L4OA 4FQQA 5EF0A 3BSGA 3Q1EA 1O7DE 3OX8A 4Z8FL 5JW3L 2FL5A 1XSKA 4UB0H 4N5ED 3LXUX 2C1PB 1T5XB 4DK3A 2DQFB 4FFWC 3ARGC 4X7TB 4F80A 1ADQL 3OC8A 4P5TC 1QQDA 2QR0B 4X4ZA 1B4TA 3FO1A 1E8WA 3C60C 1AXIB 3GSXB 1OCWL 1X9QA 4FLQA 4PJGA 2W60B 1DLHB 5LUMA 3QB7C 2EDXA 3UTSE 2PCYA 2FECI 5GIRA 5FM5O 2LABA 3KEHA 3LPFA 3RB7A 4FQCH 1HILA 3BHBB 1IGJB 2GEQA 3GK8H 3W0WA 4NHCL 4EEEA 1VENA 3DJZA 5AYTA 2CMRH 2OV0A 3LRSB 2X6BA 1BECA 5F96H 1D5BA 2AC0A 3EGDB 3WIFA 4POYA 1T1XB 3LDBC 2A9AA 2P5ED 3KVPA 2R1XA 4L3EA 3N43B 2JKRM 3CCHB 4DWHA 3TTSA 2BFGA 2NR6D 5FDYA 4X4YB 4J1UA 1S7TB 4X7SL 1H3WM 2J43A 3ISWA 3P4OB 3CAFA 4PY7B 3B7SA 1C3WA 3QI9A 3UEZA 1G1CA 4GUOA 4JPVH 3E8UH 1A6UH 4RFEB 1FNSL 4BCZA 1MHHB 3B9DA 3BQUB 3T4AB 1C08B 1B9ZA 4QKXB 1EVUA 4X1HA 1SJXA 3FXIC 2XVLA 5DRWA 4DP7X 4AEIL 5I1GH 1BIIA 1E9PA 3VD3A 3FH5A 4QT5B 2DLFH 1YEIH 2ZAIA 5GSVA 1KJMB 1NBVL 3CWGA 2ADYA 5BPPA 2RBLA 2F53B 3TVMD 3Q44A 3WLWC 3K72A 1HOEA 5E70A 2A74B 1Z7JA 4OCWL 4WO4C 4PJCE 5E9DB 4LGSB 1MCSA 2HJLB 2FK9A 4J27A 3SKJH 2NXZC 3C09B 3NCCB 4BK4A 2ZX6A 2QDWA 4G6AC 4O2FA 5LAPA 4E2OA 5ICYB 3RZCD 4QJ4B 4NSKB 3T6VA 2DQGH 3D9AH 4XNDA 2CDGA 2CBOA 2JB6B 3OMAB 2JJSC 5KJRH 5D6CB 4ANKA 5BOJA 4J3SA 4NNXB 1RU9L 1MRFL 4P2OD 4R96B 1CG9B 2NYKA 4TNEA 3K2KA 5EC1B 1JGDB 2VLKD 3CFDA 3X11A 5F0JB 3RVUD 3D69A 3IETB 3O2VL 1FZKA 2Y6SD 3PPEA 4N1HB 5GRYA 4YEFA 2ZUSA 3GUTA 1HYRC 3VFSA 4MA1B 4PVBA 4K5MA 3KNBB 4PJXF 5EEUA 1NFDF 1EZUA 3N0PB 2VRQA 3MRMA 1A7RL 1LEGB 4P57A 4AVIA 4MB4A 2XTLA 4X99A 3ZT6A 2V6HA 4QXGH 3ILPB 3VI3B 1UC6A 1FL5A 4GMTH 3TN0D 3DECA 4G7VH 1JXDA 2DF3A 3L8QA 4PW4A 5FCSH 3DROA 2QGBA 4PREB 5EBGA 4LSVL 3UEQA 1FNGA 5LQBL 4NM4L 2TAAA 4P46D 2XN0A 1LO4H 3FFCA 4P99A 2EXWD 2WIIA 3KJ4C 4O2EA 3L81A 3O6FC 5FAAA 5DJXB 4BYHA 4AH2B 4FP8L 1GUEA 3AB0B 4L0ZA 3AY4A 3VWKD 4KKCD 5IWLC 3UZVB 2CGZA 4QRYA 3NSXA 1J86A 2D3JA 4N20A 4Z3IA 3A4AA 3I75B 3QJUB 3QPQD 1EZVX 3L1OH 5C0GA 3WNKA 1JF1B 1SFHA 2O6CA 2YLHA 2VOTA 1WD8A 4AGOA 5D1QD 3GSRB 4ZODA 4C83B 2UXGA 5DGQA 5E2WH 2WVVB 4Y19E 3NK4A 1DANU 1ZSDB 3SDXF 4F7CA 3JV6B 4MBRA 3LB6C 5E5MB 3SDCA 3CQFA 3EOAA 2JF1A 2YRLA 3LEVH 4OJCA 4MJIB 3BPLC 5KYUA 3CHPA 1LWRA 2R23A 4QRAA 1KCUH 3VHZA 5CCHE 2K4WA 3VRJA 4Z7WA 2ICEB 4U1GB 4XODA 3SN6N 2HT2D 3SQBB 4M56A 2Y6TE 4JHWL 1YDPA 2D3VA 2YPKA 1FPTL 4G6ML 4RETB 2AQ2A 5E2VH 5HHVH 3RWEA 3VFOA 3WXVH 1GHFL 4BGLA 4D9QE 3UJIL 5LDSA 3TO4A 2VSCA 5KS9E 1UG9A 2F7PA 5T1JA 5AAMC 5C07D 3ZRSA 1P6WA 5FWRA 1IKNC 1ET5A 2X4TB 4PI2A 5E6IC 5E8NB 5DK2A 1A1MA 3L5XL 3MJ9H 5LGHH 4NUGL 5AWNH 3NSDA 3QZOA 1WCBB 1F2XK 4ENZA 5IKCA 1W8EA 3NZ8B 4XB7A 1KZYA 2DBLH 1F4YH 1FO0A 4YXKH 3U0PB 5FFGA 1QR1B 1FGVH 1HTYA 4KKAC 1M42A 3FTXA 4O58H 1MRDH 2XNAB 5T1LA 3OZ9L 1U30A 3GMRB 1ET7A 5D1ZB 3G6DH 4K3HA 2V3FA 2NT0A 4KUCD 3K4ZA 4PS8A 5IUSA 3UPAA 3G5YB 3NABH 4XC3H 3WE6A 5TE6L 1T1WB 3KXFE 3P4NB 4PRPB 3FHQA 1S7RA 3DX3A 1MDTA 1CLZL 3RTQC 3ZDYE 4Y5YA 3ETBF 2Y36H 3SYPA 4IU2A 4DZ8A 4N9GB 2IV9A 3LH8A 3WCYA 2B77A 8CGTA 1MCWM 4PJXB 2UXVA 1D9KB 5AVVB 3HNSH 4MWFB 4RA0C 1NFDB 4WV1A 5ESVA 1TPXC 2DKUA 1Y18A 2DTMH 4JVPA 3HNTL 1MSPA 2ORBH 4Y2DD 2PABA 3F7VB 1HZXA 3IS0X 5BJTB 4XHJD 3UO1H 5MP6L 4EIBA 1P9MC 2VDMH 1JWSA 4P8QA 2R0KH 1R3LB 1UACH 4XT3A 2DDQH 3B9KD 4NZUH 4JFEE 4PR5B 5FHBL 1RUKL 5HJ3A 3V5HA 4CVZA 1IILE 1VFAB 3ECWA 4XTLA 2N59A 4N2NA 4LRIC 2ZWYA 4HS8H 4JK0D 2NY2C 2PO6B 4PTTA 3Q8AA 3BWUF 2ADGA 5BV7L 3S6CA 3CFNA 3GIVB 4WKXA 2BZCA 5LGYA 3ATAA 4BQ8A 4TM9A 1PLBA 5CZKA 5HHOB 5AW6B 4C4BA 3GSOA 4DGUA 1HSBA 2AXFB 5JJNA 5FO9B 3JWOL 1WZKA 4UT9H 4IKJA 3SDXB 2X4QB 1X9UA 4KI5D 3KLDA 4LXFA 5C8JA 2K9UA 1JNNL 5M95B 3PHOB 4YSRA 1FLTX 3WY2A 1YMHA 3X13A 1U8PA 4UQ3B 1TJMA 4CSSA 3OJVC 4JFFB 5ABAA 3QE5A 4M4RB 1UURA 1GAFL 4JQIA 4H4NA 3LMJL 4XVOA 4UTAH 3P0GA 3WY4A 1RPQA 4GIPD 1DQDH 5JYMA 1JYVA 2BVPA 4YDZA 3TJHD 1IKFL 3H54A 3LS5H 4IOIA 2YWZA 4J3XA 4PGEA 3MRKB 1NGQH 4EI5D 5E8DL 4FI6A 4BWTA 4P5KB 4FQ2H 2AV1A 5D7SL 4OD3L 4NZTL 4OFKA 3B6SB 4W9JC 3BE1H 4LCYA 3SDAA 3VGAC 1J10A 4JM4H 1T7XA 4DO6A 4OH2A 3GBML 4PGDA 1I8MA 2A2QT 4I8DA 1CFQB 4NO3A 3PWJB 3ELAT 4RZKA 1MNNA 1MHEA 3QG6B 3L4UA 3D3VD 5G53A 2UWEE 3GSNH 3QAZB 1YC7A 2Z35A 4HIIA 1MQ8A 2LU5A 4M03A 4M61A 4XOCA 1LXMA 2NX5D 4XOEA 5DJ2A 4KQ3H 3KYMA 3AQDA 5DUJA 4HIHA 2X1PA 5C0AA 3GEWB 5GPRA 4BFNA 4HALA 1MI5A 2EEXA 1ZSHA 4P3CH 4Y4KD 4ZUTA 4BRJA 3LRMA 3WXWH 3LN4A 3RDTB 4LL1A 1OP3K 4F7TA 2OMWA 5FUZL 1M1SA 1T2JA 1T2QH 1T6VN 1BMZA 4J3UA 2Q86B 3KLHC 2GW5A 1CDJA 3IS1X 5E08L 4ZO6A 4F2MA 5L88H 4GW4B 5G4MA 4XP5H 3Q5TA 5GRVL 3C5ZB 2FZ3B 2I69A 4BK5C 1RULH 5MERA 4O5LL 4GYBA 1GTFA 1CK0H 2GPZA 1NFIB 4FQXA 2CBPA 3FB5A 4N8UA 2G0KA 1CVSC 4U1LB 2QFPA 4HLZG 2OQJA 3IM1A 3MRJB 4WIQA 3U4EB 4QHUA 3BCDA 5K39A 4BK8A 2WNKA 4CA4A 5H2NA 3MJ7B 4MMZA 2CK0H 4Y9HA 1CZ8L 1K8IB 1FV1B 1AJ7L 5JJEA 2C9VA 4MBOA 4UCFA 3QUZB 1OSPH 4XN5A 2ZZUT 3PGCA 5FHAL 2FRGP 3PIQA 4UUJA 2IH1B 3WMQA 3NQKA 2E7DA 1J8SA 3FUMA 4TUKL 5LNDA 3R7RA 8PAZA 1ETB1 2O72A 4H1LH 3R8BB 4LHUA 5LGJA 4LLMA 3BPNC 3FU7A 1UKTA 2CJUL 3J8F7 1BGXH 1I4FB 4K7PY 2VN7A 2QELA 3BO8A 3BGMA 5DQ9A 2XFGB 1Y7VA 4DSYA 1ZHLB 1UWGH 5I1EH 1MFBH 2X7LA 4EZLA 1JRHI 3G04A 3PWVB 1FN4B 2MQCA 1WHPA 3K2MC 4LCIH 2Q0ZX 2DS4A 4DOHE 4OT1H 5HD8C 1L3WA 4NUJB 3VDAA 5F2FA 3RNQA 1KEMH 4LLVA 2HKFL 2EXTA 5BRZB 4JR9L 2VDLB 1KLGB 1BG9A 2Y00A 1NAKL 2RTTA 2E3VA 4OUUB 2ROYA 2HTKC 4P4KB 2AXGA 3UJJH 1A4KA 1F6AB 3FTGA 5CBEB 4Z7QE 1LP9E 1S7UB 5D7EA 1F4XH 3TBWB 1G7HB 3HG0A 3DBXA 2BS9A 1V55B 4YC2C 3ZHFA 3TJEH 1NLDL 1BXUA 2Z64C 3CH1A 4BUGA 5KBPA 2K9FB 4ZUSA 5IR1A 1DQJA 4WFHE 3C08H 4KJWD 3D05A 3MV8A 2FX7H 4OZIE 1QMUA 2NTFB 4OJEH 4GQZA 3KEDA 3SCMC 1X5KA 1I8LC 4QWWD 2WLLA 4HFWA 5DLML 2KQNA 4X80L 1ZWIB 3L9BA 2MCAA 1P5UA 4GW1A 1HWGB 1R5VA 1QSFB 3NFSH 5C0JB 3I2CL 4NQCD 2ZUTA 3UL4A 4JL1A 4DP1X 1M0MA 4BV1A 5AENA 4ETQB 2W0FB 2I20A 3QEQE 4ZOEA 4ZX4A 1HJBC 5G2CA 2CNYA 4XN8A 4PB0H 3A4FA 4OVUA 2NY4D 1NKOA 2GB2A 3QFJB 2X53A 3QS2A 3K3QA 4YDVA 1OP5K 4X2UA 4EN3A 4OB5H 2A6IB 2CKBB 4U1NB 1T80A 2OCJA 4OW6A 2I32A 4WWOA 1A5FH 2AK4D 3CDCA 3FCTA 3ZE0E 2D4DA 1JI1A 3L6FA 3MLSL 4XXCA 4P5RA 1S7SA 5EDSA 4LLWA 2ZYRA 2ZICA 1RUML 5I16A 1MLCB 3TWCL 3VFVB 2O93L 3TNMA 1TO5A 1QZNA 1BFTA 3LIUA 4ZTPH 3R4DA 5J89A 4AC4A 5HHXH 3IKCA 3V10A 4FQHA 3UROR 4ZFGH 4N2GA 4ZO7A 4MXVF 1CICD 1ZS2A 3OZKA 2YOAA 3FJTA 3IJ8A 4ONGH 1GGBL 4F9LA 4G11A 2Z73A 4QAWA 1K8DB 5E1AB 3SPVB 2R9HC 3CJJA 3ZY7A 3ZYZA 4DQAA 5T8IA 1OVZA 1DFBL 4KROD 3VGFA 5IW1A 5KN5A 3O6MH 5FA3A 1SRDA 5ICXB 2WZ6A 3MJ8A 3KYNA 1H3PL 1OOWA 4MD5A 2J88L 3QUMA 4MNHB 3HG1E 2W07A 4EDXB 1EXUB 1XCQB 4GP5B 2OMTA 4P2QE 2YRZA 2VAAB 3O9WD 1K5NA 4G7YL 3UABA 1H6FA 3NIGF 2HB0A 2WANA 5I30L 4NN6B 3R8QA 4EDWH 4PJBF 4WWKD 3QK0A 3Q2LA 4ZXBA 4X42A 2CJTA 2LE9A 4BH8B 4XO8A 2VDNH 3JWDC 3V4PA 1LO5B 2P8PB 2XA3A 1A9EB 3S2CA 1PX3A 3ES6B 1M6UA 4KV5E 4OD1H 3VFRB 1TJGL 3EDEA 5AZEL 1FG2A 3RIKA 2OZ4H 1HHKA 2WPGA 4PB9H 3LY6A 2VW4A 1CFVL 3LRLA 3P3RA 5C0CB 1JNHB 2ATPB 2Y01A 3AWFA 4OZFG 1F3DH 2PCXA 2ATKA 2YRBA 4LLQA 3CHSA 4PRNA 2NSQA 4GG6A 1DEEA 2DMHA 5TFSH 2Y0SA 5JOPD 3Q06A 3QUXB 3VSVA 3ZOAA 2Z9TA 4JUSA 1XVSA 3CPUA 3PP4L 2ESVB 3BI9X 4IMLA 5D5MA 4XBEL 3KWUA 4L1TA 5A2JH 3RL2A 1TTAA 4N8CL 4FMKA 1FORL 3WUWA 4ODVL 4MQXC 2R15A 1JZ3A 4I3SH 2Y3NA 3VCLA 1N19A 3QIUA 3HJEA 4RFOH 1JK8B 2Z4QA 3H9ZA 4XVJH 1DQMH 4FD0A 2EIZA 3DLQR 1IE4A 4GEIA 1NC2B 3S5LB 1EUUA 2APSA 1IQDB 2M83A 5AW2B 4UQIM 3HB3B 4W6WB 5F44A 2LLLA 1WBXA 3BMWA 1A4JA 5HY9A 1O9ZA 3SE8H 2LU4A 4PD4K 4HOZA 1JZ6A 4UAHA 3DXAB 2W95A 1WGVA 4NC3A 2C34A 1P4LA 4LARH 4S1RL 4OZGE 1HFUA 3EFDL 3MCLH 3DJRA 3STLA 5JHDA 4IOFD 2OCCB 3N5AA 1SVCP 3HI1A 3EJRA 1DVFA 3INOA 5DCCA 3AU0A 2V7NA 4ZAKD 3ZXAC 4K15A 1LK2B 1U93A 4OKVB 1CI5A 5JUEL 3KAAA 4UMGA 1TZHB 4D94A 1DYZA 3T0ED 4H44C 4X31A 2NW2A 4MNQA 4KVCL 4NBXB 4PIRF 4Q58C 3EJPA 4DW2H 1VFMA 1UOKA 2BHZA 2XQBH 2YC1B 3MROA 4LEBA 4NGHH 4JZOB 2YMXL 1AC0A 1WPCA 2FE0A 1S2EA 3II3A 5D72H 3V2WA 1RIUL 1GXEA 1INDL 1PLCA 2R69H 3KLKA 5GGVL 2E9BA 2ZUYA 3V6ZA 1XSIA 2W0PA 2ZXWB 5IVOA 1I3UA 1SMDA 3NIGB 1Q94B 1EXHA 1OP3H 1CD1A 4YHIA 3IRCA 5L6YH 3PHQB 3T2PA 1X9RA 4L4TD 4LLUA 4QRPA 2EC8A 4MA7L 4PJBB 1I7ZB 5DHVB 3ZQXA 4PP1C 3VW3L 2NNRA 1UFGA 3QWNA 3QHZH 5ID0A 4MHHI 4FCAA 1PYWB 2D7TH 1DBKH 3ZTDC 2NY6C 3WMSA 3ZYJA 2BHUA 5E03A 1IX2A 5EO9B 1IRAY 3IJHA 5JLZB 1DUYA 1BJMA 1YQVH 3L4TA 4F15C 3MREA 3VXTA 1GPOH 4MQSB 1SM3L 4CKVX 3IDIA 5DS8A 3LKSB 1CL7I 1LWJA 4DVRL 1WAAA 1W8NA 2X40A 1MW2A 4MSWA 1UUSA 3LKRA 3B5TA 4R90L 4P2RB 1BF2A 1QX1A 4Q97A 1GYUA 4G8GA 1G9NL 2BS8A 3VXUA 5DMYA 3T1WA 1SBSH 4HKJB 1U58A 3RVWC 4Z9KB 2K78A 1J1OH 2GBUA 3ZL4L 1W9XA 5AB9A 4FNPA 1BD2E 1QACA 2ZOKB 3SBWA 4X4XA 3EMLA 5CSBA 3VO0A 5B1JA 4C57C 1SDDB 3B2UC 3NEEA 1E4XI 1UGKA 4EUPB 2GAZB 4F20A 2CRZA 1N4XL 4DTGL 3IDJA 4IK6A 3PWPD 2WOYA 2XJKA 5E99H 1WBYA 3D0VA 4R0LA 4Y4HC 3ZHDA 1FYTA 3B5HA 4HKBB 4AMIA 4Q6IA 3SN6R 3ECBB 3PABB 4U1SB 4B5EA 4FZEH 3K0WA 2RGSA 5IG7B 4PRBA 3PNWA 3L9RA 3V0GA 1JIBA 1LD9B 3MACH 2IWEA 4N2KA 2MHAB 2VH5L 4LVOC 3UJTL 1F8TL 2EO9A 3WTWA 2VDPB 3B8YA 1U2CA 4XNXL 3BAYA 4FG2A 4JFHE 5E0FA 5EUOA 5K9JL 4NQDE 2I85A 5GS1B 3OXSA 2EDFA 5I15L 4X7DC 1QSED 1FNEA 4B6ZA 4TNGA 4X5PA 4HH9A 5I1IL 4PRIE 4E5XB 3E9UA 4JREC 1CF8H 4PAZA 2G2RA 3FQWA 1ZLDA 4YMPA 3MNVA 4RGNC 4PPTA 2ALAA 2HG5B 1MAJA 4Y7MA 4JLRB 3QXVA 4H26A 4M1CC 5TDPA 5CU9A 3MRLB 3UACA 3NGBB 1A2YB 3IRPX 2EE9A 3GIZL 3N06B 3ME0B 3AUWB 5L2KE 4KXCA 3WDJA 1GH7A 4IBWA 2VE6A 3QO1A 3ULSB 4LPWA 1CE6B 4OJYA 1PCSA 1YEFH 3UO8B 2MRYA 4J6IA 5D1XA 2CH8A 4RMVA 1S78C 3WFHB 1NUDA 2WQ8A 2EACA 4WDIA 1OP5H 4APQD 4TQIA 4AMXA 2ZCHL 1F4WH 5BQ7A 2BVYA 4Z76A 5JW4Q 2F54D 5I19L 1AY1H 3OKKA 2AZAA 4RRPM 2J5LB 4YHYC 4M6ML 3KPRE 1NCWL 4QNPE 1GCYA 2XKUA 2HRGA 2R2EA 1XXFC 3OF6A 4HKZB 4M7KL 1NBYB 3ARDC 3WSQH 1OGSA 4HCGA 2J6EA 3OE9A 1SHXA 4C56B 1J5DA 5B6WA 2JXMB 2IAND 4LIQE 5HJBA 2WOBA 4EZKA 5BVJB 2HWZL 4QY8B 3CU7A 2Q8AH 3DQBA 1GGYA 2VKWA 2PXYD 4K8RC 4PJGE 2AGJH 4X5RA 4DN4H 2V33A 2UZYB 4QRSA 5BS0A 1N6QH 1LK3L 3H2PA 4F37K 4O02B 2WQUA 5EA0L 1ADQA 1MJJB 2AQPA 3V4VH 3W0WE 1CDGA 1Y07A 4WU7B 3Q1SH 5FKAB 3QG7H 3TZVA 5K1JA 2F74A 5SWSB 4A2GA 1IC7H 1MOEA 2E7HA 1ZTXH 3B7UX 2CU9A 3D07A 3O4LD 4M7LL 3PJSB 3UYPB 5IEKB 5LNEA 4XPGH 5G54A 1Z6JT 4L3EE 1WUNT 4TULL 1FL6A 1IAKA 1NAMB 5LB1A 1KGIA 2EADA 3NCMA 2KSYA 4NRZA 3JV0A 2WVSA 1OAKL 3PL6D 1U8KA 3LV3B 3KS0J 4AV4A 5DJ0A 1LLAA 4NC1E 4OR1A 5T1KD 1LTXA 4FA7B 5JHMA 1FIGH 4LASH 4XXWA 1GZMA 2E9IA 5EIIB 3LEXB 4L9DA 5H37A 1BZEA 1UJ3A 2WN2A 2XZQL 4FHJA 4AUUA 4PJIF 1RCYA 3U4AA 1CXEA 4LQFH 1KJ3L 5I2IB 3S3DB 3LQAH 3KWTA 3C6EA 5E6UB 2Y5EA 5EDXA 5AW1B 5HHMB 3RVXD 3UG4A 1J0YA 3N42F 2X9XA 1EGJH 2ED8A 3HCVB 2CO1A 4PY8J 5TPWL 4YXHH 5IMOA 1PGRB 4NT6B 1Y6KR 5J11C 2Q5BA 2W9DL 3MLZL 4KRLB 4JFQA 3C6SA 1JJUA 3C8DA 1Z9MA 3ECUA 1KB9K 1PAMA 1ESOA 3QORC 5BZXA 3SKNB 4DP8X 4DT2A 3ILQD 4H7VA 1IJ9A 1PF3A 2VDQB 5BNXD 5C09A 1AZZC 1O7VA 2APFA 5CP7A 4F33A 3T1FA 3DDLA 1YY8B 2BFVH 4AIZB 1IZKA 1W80A 3FT4B 2R2HA 1U8JB 2D31B 4JX0A 3HS0A 5TF1L 1F3JA 2AV7A 3ZE1E 4QHLA 2E75C 1DBAH 3MDJA 3PXLA 5KVEH 2WW8A 1DN0A 2X3AA 4Y5XB 5DURD 2XZAL 2AJVL 3QQDB 2A77L 3QWRA 2X4SA 3L7EB 1WFNA 2ADJB 3GWJA 3AU1A 5IQ7L 2BNQD 1AOHA 1TQWA 2H6UA 2JK5B 1XWVA 1WP6A 3X1EA 1BF5A 3L1EA 4I18B 3FFCE 5LBSL 1VGEL 4BZ1H 1C16A 3OJMB 3NRPA 3UZEC 5LBGA 3CQQA 3O8XC 3CDZA 4DCQA 1QWHA 5F8UA 3ZHKA 4X5XA 1RP9A 3HRZB 1HH6A 3MRFB 1QZ1A 3EHBC 1NCJA 1WZ1H 4TKWA 3QDAA 1USQA 3MX0A 2DMBA 4FFWD 4H8VA 4LCCC 4C55A 2EDKA 4IW4C 2EICA 3RLSA 3HC4L 4PJ5D 4DGVH 1K6QH 2SEBA 2JLLA 1WFIA 3X2QB 5IFJA 1R84A 1HJCA 1T3FA 3TPKA 3OKOB 5TK2A 1DL7L 4FABH 1MJUL 3BPOB 1QLRB 4N2AA 3QJVB 3VNZA 3GI9H 2KUTA 4XCFH 4G72B 8FABB 4ONFH 3TX4A 3KPOA 3WD5H 3CBRA 3WFEH 3I6GA 5IHBA 3MKKA 1U8HA 3FTSA 3KGTA 2QQNL 4G43A 1N8ZA 2I9TB 5ACZA 4KVNH 3QQNA 1YG9A 3O6LH 4K7FA 3FOLA 3LKNB 4KRPC 1RZQA 4K3GA 3ZKND 3MA9H 1CGSL 1IC5L 4YFEA 1EV2E 5TDOB 4QXTA 4HU8A 3T6XA 2WCPA 2VABA 3AREC 5JORB 3TVMB 3F00A 5EU5B 3O45A 3TT3H 3U46A 2WY3B 2X1OA 4PJIB 4YHKH 3T4YA 3VRIB 1GJIA 4OZHF 3AS3A 3QZMA 4BZ2L 1I9IL 2VLME 3RZCB 4AQ1C 2VC2L 4JCLA 1KCBA 4OGQC 2L7EA 2WUBL 1A7NL 3N42B 4FQJH 4HZ1A 4F7MA 1KGBA 1C8QA 2YEZB 1N70A 3MCG1 4R7DA 5EORL 3TONA 5FUCC 3JQOB 3L2MA 4X9BA 2I7OA 5FO8A 5T3ZH 4KUCF 5DA4A 3L3HA 5I8OH 1JMXA 4NNPH 5F9WC 1O5PA 4EJ4A 2NXZD 1ILUA 1T4KB 4ZUWA 3LZRA 3FN3A 4P2OB 5EU4B 2WKOA 2OXGB 1T21A 4XX5A 1AZCA 4Z7NE 1MF2H 3CPLA 3DI2B 1G9MC 5JQIB 2XJLA 5C3LD 3RFMA 3L3IB 1Q0YH 2OTUA 4RMRA 2G2NA 1FJ1A 4WTXA 4F7PB 2FHCA 3C2SA 1IM9D 1A3QA 4G9FD 1ND0B 2ENJA 1QTSA 4IJ3B 1PFOA 4ALAH 4LEOA 3BUIA 3KPMA 3QJZA 3T71A 5IVZA 5J13B 1AGFB 1EO5A 3AQXA 4KJQD 3TN0B 1E4WL 4KO9A 3REYA 4J3WA 4GKZA 4N2FA 5I76B 2E9JA 4TOYL 1AG6A 1G7LA 1JUFB 5D1ZI 2VDLL 4TPRL 1IEBB 5IB4B 4P46B 4BGDA 3FRPA 3RWCA 5F89B 4Q7DA 4IMKC 5DS1A 4WY7H 2BNUA 3WN5A 1MCOL 4MAUH 4U7MA 5A7BA 3VWKB 5E00A 1ETJA 3AT9A 3GXPA 4IKKA 4GKOA 4BEIA 4WEBL 4LOFA 2YAOA 4LSQH 3VD4A 2O5NA 1A0QL 1B0GA 3NS0A 1KB3A 4NN7B 4OV5A 5ESAB 3A67H 5ICZB 5D1QB 3O6FD 1OTTC 3ARBA 1PTZA 2DN7A 2MNWA 4MAYB 4NAJA 1INEH 3RBGA 3V0IA 1I9JL 5EULV 3QC6X 4NDMB 4OGXH 4WI8A 4EXPX 5DMKA 3F7PC 4R83A 1B0RB 1XGQA 1JPGA 1LM8V 4KI5F 1NL0H 4XO5A 3VXPA 4AMKL 1TCMA 3AQZA 1F45A 5AOJA 3ULUE 1SOKA 1N0XL 2I07B 2EDBA 3K6OA 5B1KA 3LNFA 4EIZC 3PFQA 5AKSA 3H3PL 1I1AA 1AO7D 1NGYA 5DQJA 5AW8B 5HYEA 3CX5K 4LHJB 1HL4A 1S7WB 3IDMA 3U7WH 1R34A 1UT9A 1ACXA 4RISH 4TUOA 1MUJA 3FULA 1BFOB 1NEUA 5INDA 2EDYA 1IIIA 4A7GF 4ADGA 2TRYA 4KQ4H 3F65A 6PAZA 2DPKA 1TVDA 3BC9A 2ZXBA 3ZSSA 3AS2A 4DUWA 3DVNA 3MRRB 5DD3H 3HZYA 2CKBL 1W0VB 1RERA 3QJRB 4FL4C 3S96B 3HAQA 3LYRA 3O3EA 5CZRA 1M2VA 5C07B 5EN2B 4JGNA 2A83A 3SEPA 4M4PA 3DUSA 3GB7A 1S8LA 3FQXB 4OZHB 1P5VA 4Z3EA 2EIEA 2RH0A 5C2BH 3K2UH 3FO9B 3LD8C 4FXKA 5FA4B 1YZZA 3QI9C 1X5ZA 3U7YH 4HLEA 5IHLB 1URZA 3IWVA 4XCEA 2XFXB 3OKLA 2R4SL 4XMLL 4NC1C 4Y9BA 2OJZL 4N6QA 4ZYKA 5CF3A 2QVFB 2IEPA 4W9FC 3LQMA 1J1XL 4NC2B 5JXEC 4JY5L 1MZZA 2EYTA 1R0AH 1QUPA 1M7IB 2CO7A 3BP6B 4MJ6B 3U30C 1F86A 1R3JB 3ZPQA 2CALA 1EHLH 3U2JA 4AK1A 4KKAD 4ZPTB 1RI8A 2IALB 3UC0L 1XGYH 1WS8A 2B1OA 3UMTA 5EZOH 3HLKA 5F71A 5DZNA 5C0AE 3QCUL 2VJ8A 1RHHA 1UXLA 3SD5A 1EAOA 1ID5I 1KCVL 1JDDA 4GO8A 2DI7A 4N5UA 1MI5E 4X8JB 1NCAL 5DR5H 2WWKO 2DQHH 5IBUG 3KDMB 4YO0A 3GJEA 3MRGB 2VAJA 3RTQD 1RXLA 4I9WE 4G2AA 2JVUA 4TSAH 3BP4A 4Y2DB 3FB7A 1DJXA 1XZWA 5D70L 3MUZ1 4F2ME 1DVXA 1OGTA 1MKFA 2WZPD 2OMUB 4P59H 5HDQL 1FH5H 3LKOB 3B9KB 2DIEA 5GGRB 4JO1L 4NKDB 1ZT1B 5JHBA 3JZ7A 5L0QB 4IJTA 5DMIL 2XTJC 2H41A 2K8MA 3K1KC 4I4WB 4NM8H 5AW3B 5T5FL 2J4YA 1H3VA 1S7QB 5J9PA 2XZZA 1AHKA 4FXLA 4KOCA 3GSVA 4FOMA 3QISA 4I48B 1G7PA 2Y04A 1GS8A 4LSUL 4PJDF 4BFIA 1U8MA 3AMKA 4K07A 4UAOB 2VM9A 4YSPA 2WB7A 3VFNB 5J12B 2P5WA 1I1YB 1WA1X 4JVWA 4C4UA 4R2GC 3ASWA 4F5CA 5AB2A 2CLVB 2QADD 1TCRB 5J1SC 4N2BA 1S9YA 2J73A 4ZW3A 4YFLF 4Z95L 3VD0A 1H5BC 4KZEL 4H88H 3DNKA 1P53A 4UM8A 4WSJA 2WJ5A 4X4MA 3IJSB 4X7FC 3PUCA 2Z7WA 4PGBB 5D93B 5DEJA 4CSPA 1I3GL 1MELA 3NSCA 1J0KA 4ONOA 1A21A 1UD8A 1E9OB 1AR2A 1DDHA 3BP7B 1AE6H 3UH8A 4Q9RL 1A7PH 2V2WB 4XMPH 4GQ9L 1QUNA 3TBCA 1S9WB 2VRAA 1CI3M 1CD9B 1Q9LB 2X28A 1HCZA 2ENYA 3SDCC 1E27A 4WSGA 4BSVB 1B2WL 4QRRD 1RZJC 1BBJB 4FXGC 3CFEB 4EI5B 4LPXA 4HIEB 3ORJA 3TEXA 1GVIA 3P9LA 3TO2B 2CLZB 3L2NA 2G3MA 2MKWA 3CLWA 3RI5F 3DX6A 4MD4B 4B9ZA 3N40P 4PN6A 4W1TA 2DM7A 3MV8E 4Q0XL 3GTVA 5SX4I 3VG9A 2V5YA 4AV5A 2UUDH 5GS2H 3QZWG 4TUJB 1W72B 3D3VB 2X4PA 2AAAA 1A6AA 4QTHA 4XP1L 3TCLB 1SDAB 2BS71 2EO1A 1TTUA 1M7DB 1BPLB 2NX5B 5C08D 4RMWA 43CAA 4OLXL 3DYMA 4KX9A 4X0KA 12E8L 1KN2L 3MV7D 4QRUB 2O61B 2D7QA 4K0OA 4PU2A 1DQKA 1U8LB 2YQBA 1Q4NX 1GYWA 3LKQB 3IN2A 1FE8H 2ZCZA 5LHDA 2XWJB 2YGVA 4QCIA 4Y4KB 1KC5H 3BSZL 2E4FA 1IGCL 2WXHA 5DEFB 3VFTA 1U41A 1V5JA 5DYOA 1KIUB 2NCMA 4I0KA 5GGVY 1KGYE 2DD8L 2H32H 3U48A 4ZZFA 5GRVK 3TBSB 5KYXA 4UU9B 1R24B 3SKMB 2WSDA 1DBJH 1LE9A 1J88A 4NFBA 1O0AA 3EDJA 5K9KB 3MFFA 4CDGC 4KJYB 4DP5X 2YPLD 5AX0A 3B5GA 4JDEA 4Y5YC 4AZ8A 2X12A 5B39A 3W5MA 4PJFF 5IEHA 4GBXA 2EI4A 3MCKB 3V0WH 2AZUA 3DSFL 2FQGA 4KDVA 3MN8A 4WV1C 2F8IA 5I71C 2X42A 3MLYH 4ZMZA 1FP5A 1QBAA 2RALA 4FERA 5FUOL 3EOBB 1RV6X 2XPZA 3BLKA 3LIZL 4PJDB 1A66A 4NZRH 2FEEL 3ZDZF 2FT6A 3EYQC 1HCYA 1NC4A 3MRNA 5SWZA 5JOEA 1A3ZA 5LG6A 4FA6A 4HUXB 4N0FB 4UOW1 1PJWA 4B9YA 2VDKH 2WYHA 1S51A 4WEEA 1B90A 1G7QA 3IXAA 3RIAK 3X1FA 5BVPL 4WFED 1NEZA 3BWAA 2FATL 3GZQA 1G7JA 5D55A 4F8TA 2CM6A 2FYYB 2IQ9H 5FC9A 4K23H 2BIIA 3WHE0 3QEHA 5IVXF 3NG5A 4V1DA 3RDJA 5EFIA 1I7UA 5D7KD 4GEJA 2DQEL 4YR6B 2QSCL 1DVZA 1NICA 1Z9OA 5IV2B 4CC0A 1J1PL 3ZZQA 3B83A 1OAXL 3P4LA 3I85A 3ULUC 3FB6A 4ZMLA 2X89D 4CGUB 2XN1A 1FC2D 2C9XA 3VXNA 1GZPB 4WHCA 3FYIB 2CD0A 3RIFK 5GRXG 1HHHB 4HWZA 3BAEH 1B2YA 5BRQA 1N8OE 3FF8A 3NP3A 3FT0A 4D0DA 3UMNA 3BZEB 3T2NL 2CXKA 3HI5H 2DQCL 2E47A 3KCWA 4GG6E 2IDQA 3ENEA 3KPQB 5IGXH 1G7IA 4K8RH 4EXKA 4Y16D 4B41A 1R33A 5T3ZD 3FOMB 5JDJA 2Z31A 3NCXA 4YHNA 2CLRB 3DGDA 3MLTA 5D5ME 4NQCB 1X4ZA 2ADIB 3UZQA 3N0AA 4D9QD 1OGAA 3MBXH 5H2IA 4L4VD 3SCMD 2A6KA 4KXDA 2NY4B 3IJ7A 1KIRA 5DFVD 5FIEA 4LCWD 2DKMA 4GFXA 1HKLL 2IPUG 4FTVA 1GR7A 1S5IL 3PP3K 1L9HA 3HBZA 3E0GA 1JZ5A 4H2AA 4ODXA 4LKCB 1XB3A 3B8SA 1CLYH 2BWDA 3JV5A 1FZJB 1QW9A 1A6WH 2MCPH 5SV4A 4JZJA 5H35A 4KXBA 5D7JA 2AK4B 5FYKH 1JGEA 3JWNG 3Q8EA 4TYUA 1JGVL 2ITCA 2F58L 5F72S 3M8OL 4L1BA 1CE1L 1QI4A 4WNJA 2YR3A 3T6ZA 4PJFB 3EYUH 4G80A 1KELL 5JHDE 3QJOA 4NJ9L 4L8SC 4WF7A 1MAML 4U6TA 2Q6WB 3QXAA 3MRCB 4YDLC 1ITBB 1BJ1H 1CICB 4JPKL 3QT2A 5EEXA 3O3AA 4PGZA 1M57B 2NW3B 3HE6C 3OLIA 4IBQA 4MNQE 2UY7A 2C1PA 1P1ZB 1T5XA 3QPXH 3ZIMA 2DQFA 4KROB 4YZFE 2HZHA 4O02L 3ZDZB 4X7TA 2K3HA 4GUCA 2QR0A 4GYCA 2YD7A 3GFUA 1AGBB 2W80C 2EVHA 4FQXC 2R29H 2ENQA 1E4KC 3GSXA 2W60A 1DLHA 3BUPA 3TFKD 3O9WB 3RGBA 4JFPB 3HZ3A 2VSMB 3BHBA 3MXWH 1IGJA 4LVHB 3OPZH 1NAML 4GRLD 5AW9B 1MCCA 4MMZC 2IAMD 3EJQA 1I31A 3PF2A 4Q9QH 3LRSA 4WWKB 5IVXB 4QRPE 3EGDA 3A6BH 3HARA 1T1XA 4OBSA 1T0PB 1IEAA 1KG9A 1B4JH 3CCHA 4K9EL 2DMGA 3M07A 1WDAA 4U0RB 4X4YA 3S8WA 1TTFA 1S7TA 4U05A 4XH2B 3D4CA 3P4OA 5JO5B 2G3XA 2K45A 1ZK9A 4PY7A 1LYQA 2WNGA 4NZFA 6FABL 1P69B 5E6ZA 2OAAA 5FECA 1FRGH 1YYML 4RFEA 1MHHA 2V37A 3BQUA 5I1CH 4YK4B 1M71B 1J5OL 1C08A 5F7UA 5KEZA 1X5JA 1ZA6B 3S88H 2ZYSA 1LQSR 1RZ7L 4QT5A 3U0WL 1KJMA 3LEYH 3C9LA 5ANHA 1WAAE 1CGTA 3LZQA 5AHZA 1HX0A 3V8CA 2I60L 1BCIA 3L3KB 5DZ9A 4G8GE 3VXUE 5EOCL 5HVFB 1CF1A 4OJDH 3GF8A 2CBTA 2IOOA 1KPRB 5E9DA 2ZSWB 3CFCL 2HJLA 4YSTA 4HXBL 5I0XA 2VDQL 3CHXA 2P3YA 2LNLA 3FNKA 2VSDA 4BKTC 3PWNB 1UEYA 4NSKA 4ES9A 1R5WB 3RX8A 2LHAA 1W8OA 2G4GA 2JB6A 1RSYA 5A16B 1N5AB 1WFOA 4AX3A 1J9CT 5D6CA 1ITCA 3C6LC 4M43H 4NNXA 4XMKH 3WO4C 3WFBL 4F58L 1CIDA 4O4YH 1F0LA 4R96A 1CG9A 2IG2H 1UD2A 3I3EA 1BQSA 1JGDA 3F01A 2CIIB 5EC1A 4GW5B 4AL8C 1FYTE 1IGFH 1TZOA 4K71B 4G7RB 2CA3A 3ZTNL 3WELA 3IETA 3TA4D 1VKXB 2VQTA 1P5UC 4C4KO 4NO0D 3F6LA 1AGDB 1MFDH 3GKZA 2FUQA 2FEEI 3DRTB 4R7LA 2Y02A 2RH1A 2E76C 3IFOB 1YEJH 1BYNA 2RA1A 4PEEA 1G87A 1LEGA 2VDMB 4F1ZA 1SY6H 4ZBJA 4HX1A 3CN3A 3ILPA 1I8KB 2JJTA 5CJQH 5EUOE 3VI3A 3RB5A 2WLHA 1AS6A 2C9UA 3FS9A 1E2ZA 4ZAKB 4Y1AD 2HKHL 4XP6H 2HT4D 4PREA 3NY8A 2N1KA 3T0EB 2Z93B 3QDJD 2AP2A 5G28A 4UOQA 4C47A 1JWUB 4N85A 4YVNA 1AD9B 1JL8A 4OGYL 2N7AA 2YD8A 5JXAL 4M1DL 5DJXA 4AH2A 4MXWH 1CS6A 1R1CA 1N5YL 1N3NA 3HPJB 5AVYB 2TSAA 1ZGLB 3UZVA 1MLBB 1ZKAA 3U4BL 4D9RE 1YYLH 3P1VA 4JRYB 2PMZA 3I75A 4I3RH 5I1HL 2BXYA 2HSIA 2ZUQC 3KBFA 5DHDA 1MEXL 4HF5L 1JF1A 3RP1A 3H1ZA 5B1BB 1V05A 3E9TA 4U3CA 4K3JL 1X3DA 4YSSA 2DJSA 3GSRA 4C83A 4NOBA 1DN2A 2B59B 3M7OA 5D1XE 1G9MH 2WVVA 1IAIL 1F2QA 5AUMB 1ZSDA 4L4TB 5J56B 3O11B 4F27A 4HHWA 1GOHA 4Q56A 3JV6A 5E5MA 1B88A 5D7IE 2P4AB 4KK8C 2A0LC 4LSRL 4QEGA 4MJIA 1JXKA 1B0IA 3VRLF 3E6FB 4BFBD 3NZUA 4EAEA 4F2EA 4CN1A 1J0IA 3TURA 4Y1TA 2ZF8A 4FS0A 4JPIB 4K73A 4RMTA 5E2TH 1H15B 1KWKA 1AGEB 5EU6D 3MNZA 3KHQA 3U6XA 2OCFD 5ENWB 3WNIA 1GGTA 2ICEA 1OOAA 2NCEA 3SQBA 2EUWA 4YHML 4OAWA 4HLZH 1OAJA 2XCMC 4OLZL 3WDIA 2EAEA 4PRDA 2Q20A 4WI0B 1UM4L 4LDOB 3C9NB 3AG3B 4ZXBC 4CW1B 3WKNA 3Q3GB 1Q9WA 5BS0E 2X4TA 3WO3B 4DK5A 4N2MA 3EO1B 2BRDA 5E8NA 3WAKA 5IMLA 1MCHA 3IMTA 5CD5D 1MCRA 1WCBA 4AVHA 1XMWA 4HFUL 1T5KA 5GS2D 3UBXI 1NQBA 1G4RA 2ZKMX 3PGFH 4NFDA 1KCRL 5HI4D 1QR1A 3GSNB 4OCNC 3ZUCA 4YAQB 1QRKA 2XNAA 4U1KB 3GMRA 2OM5A 5D1ZA 3RVWD 2ZX9A 3I9IA 3VSQA 1HAUA 2DLEA 3PWPB 4Z3JA 1NMAL 3D85D 4FFVC 4R8WL 4JVUA 4LIQH 4M62L 5IHUL 4UILH 3UFIA 1OCZB 1GU8A 2C9PA 2EDDA 1XL6A 3ZKQD 1T1WA 5I18H 3P4NA 1EHXA 3K8KA 3QR2A 3B2UD 3S7GA 2FGWH 4TSCL 5IB2B 4RDBA 2DLIA 4WO0A 2DQ6A 5CN1A 3MBWB 3V7AE 5I6XC 1K5WA 5L8JB 4N9GA 1YNKH 5BZDB 3HC0B 4PJXA 3NESA 4WK0B 1ZLWH 1D9KA 3UX9B 4E9VA 4MWFA 1NFDA 4J39A 4GO6B 4O9HH 1KYAA 4AY0A 4MHHG 1II4E 3F7VA 2BZDA 2J8UF 5DTFB 5BJTA 1QSEB 1ZVSB 4N3TA 3ZDXE 3Q9QA 3JV4B 5IJKC 2W92A 2H2SC 2VB5A 3GNMH 4M5ZH 1R3LA 4PR5A 5B38B 4HS6B 1UKSA 4MLIA 1VFAA 2V7HB 4HUMB 2XRAH 5CS7A 5AKRA 3ARUA 3P30L 1QHOA 1A7OH 3DTXB 3H53A