3QJTB

The structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
166
structure length
166
Chain Sequence
DQHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structural changes that occur upon photolysis of the Fe(II)(a3)-CO complex in the cytochrome ba(3)-oxidase of Thermus thermophilus: A combined X-ray crystallographic and infrared spectral study demonstrates CO binding to Cu(B).
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 41
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3qjtB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qjtB02
4GBRA 1L9OA 1AS6A 4A2DA 2UXFA 4A68A 2AZAA 4WTQA 2NTWA 3OE6A 3CAPA 2VW7A 3REYA 3RYMA 2IH8A 3FYEB 4XT3A 2ZOOA 1SFHA 3FU8A 3PBLA 1HAUA 4AKQA 5B34A 5BR2A 5C1MA 1H2SA 2BHFA 2HX9A 3ABLB 1GY1A 1KGYE 1E65A 4HYJA 5B1JA 3V2YA 1JV6A 5JJJA 2IDSA 1B3IA 1QKPA 1KMEA 1OE3A 1X9UA 3CDZA 4WW3A 1ZDSA 4XTOA 5FJGA 1J9SA 1X9RA 3NJGA 3PAZA 2HRGA 1CWQA 3S3DB 2AFNA 4BEYA 4BDVA 1CYXA 4YSDA 3UACA 3QJTB 3WI9A 2G87A 2M3GA 3FSZA 4E9WA 3DIVA 4UHRA 4N8UA 1ET7A 1PZCA 3MX0B 1ET5A 2ZFEA 5B3SB 1M56B 1QLEB 2JXMA 3FQYA 3NJIA 2TSAA 3WNIA 1KGBA 1A3ZA 2WSDA 2YAFA 3FPXA 3NYKA 5I28A 2UX7A 4DP9X 3PQRA 5B7FA 5D4JA 5G53A 2XV3A 4EJ4A 2HXAA 1KBVA 2CUAA 3NJHA 2ZIYA 2F93A 3GDCA 4BWBA 1E5ZA 1N70A 5LDUA 2J4YA 2XX0A 3N2JA 4HCFA 1FBKA 4KO9A 2GSMB 5ANHA 4XTLA 1L9QA 2VT4A 3UGEA 5H2PA 1P8HA 1H68A 3N55A 3T71A 1NTDA 1HZXA 2R4RA 3UTWA 1ZIBA 5I5MA 1NWPA 4DP2X 4DP4X 2E86A 2ZZLA 2JAFA 2UX6A 5I6KA 1J9TA 2XUWA 2RH1A 2VW6A 4Y9HA 1QHJA 4RH4A 4MBSA 2YCXA 4X4KA 5D4HA 4F2FA 1BM1A 1MZZA 8PAZA 5E9NA 2IH9A 1QKOA 4WAVA 3PPSA 1P8UA 2NTUA 2P80A 5G2AA 5AZDA 5DHHA 1T5KA 4ZK8A 4A2EA 3AG1B 4CSZA 1CURA 2BP0B 4IB4A 4HHWA 5PCYA 4E9SA 5B7MA 3NT0A 1OE2A 1CC3A 4NAJA 1PLCA 1A8ZA 5A44A 2HRHA 1OE1A 1PMYA 1SF5A 5AX1A 3H56A 1ASOA 4DP1X 1W6WA 2ZONA 1AT9A 3T6XA 3IEAA 4PXKA 5BR5A 1GS7A 1PNDA 2YAMA 3C9MA 3FU7B 2ZWNA 4YL4A 3ZPRA 4A67A 3EH3B 1I53A 1ILUA 3NJJA 4NC3A 3FU9A 4W1TA 2J57A 1WA2X 2XXGA 1GS8A 1A4CA 1WA0X 4L0PB 1N68A 4A2FA 3C9LA 2PP7A 2PPFA 1TEGA 2I21A 2OV0A 4A66A 2CCWA 3PXLA 2I7SA 3X1EA 4GP4B 1GR7A 3FSVA 3PAVA 4HAKA 4W9ZA 3X3BA 1DZ0A 4QIDA 2A3TA 4E9VA 2YAOA 5B6WA 3AYNA 3FSAA 1ID2A 3OE9A 3X3CA 4N4WA 4BWUA 4XTNA 2YCWA 1U19A 4AMJA 1BQ5A 2AANA 2DYSB 2JAGA 2IWFA 5I6PA 4BWWA 4DP5X 3CDZB 1JZHA 3AG2B 2CJ3A 4UANA 3UG9A 2OCCB 5I26A 3U25A 5TK2A 2QPEB 4LDEA 5IY5B 2RACA 2I7OA 1KG9A 4K9JA 3CVBA 1A4AA 1JXGA 7PCYA 5I6MA 3NY9A 3VVKA 3SQRA 2VN3A 4KO7A 4E9YA 3KW7A 4BWTA 5I6LA 3VG9A 1L0MA 1NPNA 5B1BB 3VGAA 3JTBA 3QAKA 1BQRA 4AZUA 2VM3A 1EZLA 2AVFA 1S8JA 4HWLA 1AG6A 3NSYA 3WKQA 2VSMB 2HX8A 5B1JC 2IDUA 1ASQA 3DQBA 2GC4C 1J9RA 1KBWA 3FYIB 4G7SB 4XXJA 1XJIA 2XV0A 4G7RB 4YSPA 2Q9OA 1Q5JA 3H4FA 1MG3C 1C8SA 1WA1X 3VHZA 2DWSA 2EIKB 1E67A 1OCCB 2EIMB 2YDVA 4GP5B 3ABMB 4KOBA 1IKOP 4IARA 2LNLA 3ASNB 4YSCA 3PAUA 4YSAA 2Y01A 5PAZA 1CYWA 3CG8A 1SJMA 1JXDA 2PEDA 2PCYA 4GY4A 1PCSA 1WAEA 3NY8A 3IN0A 3QBLA 2TSBA 1C3WA 2XX1A 2GHZA 5AWZA 3UZAA 4A2HA 4YSUA 3WG7B 3T6ZA 3COCA 1KG8A 1QHQA 3SN6R 5H2OA 2R7EB 1IW9A 4KNTA 2WO3B 3NJMA 1C8RA 1KCWA 3SBQA 4ENZA 1JGJA 5DYSA 5B7EA 2XXFA 4N6HA 4DPBX 4BXSV 4TL3A 3AY2A 3PLYA 3FQ1A 4BV0A 2AZUA 1X0SA 5B6YA 5AHYA 5ITCA 3PCYA 1KDIA 2IWKA 5AX0A 4KNSA 3QBIA 1R84A 5H2HA 2CALA 2J55A 4JHVA 2PP9A 3UZCA 3ZEVA 1NPJA 2PCFA 2BZ7A 5J7AA 2QPDB 3OMNB 3KJ6A 2W88A 3OM3B 2PLTA 5AZUA 1KYAA 1HAWA 5G54A 2I20A 1XB6A 2OJ1A 5F7AA 4LDOA 5ETZA 3VW7A 1IW6A 4AI7A 4X1HA 2IAAC 3RFMA 1SDDB 3VI0A 1XMEB 3TBCA 6PAZA 2HX7A 3TA4D 1O0AA 4HIPA 1ET8A 4AX3A 4FAAB 2MRYA 2UXTA 1CUOA 4GYBA 4K5YA 3QJUB 1L9HA 1P8IA 3S8GB 2H3XC 2MTAA 4Q8BA 2Y04A 2I85A 3EHBB 1GYCA 3HARA 2X87A 1NINA 2QT6A 3D12B 3KW8A 4MFHA 3SBPA 1DYZA 2W8CA 2BP8A 1M57B 4DP6X 3NSDA 2FQGA 1F50A 1UATA 2WO2B 2QDWA 3PDSA 2FJSA 1SHWA 4M4RB 3UTYA 1IBZA 2KS9A 2B08A 2DV6A 2GI0A 1RZPA 5H2IA 2FT8A 4F7KA 4QLWA 4YSEA 1JZJA 3HEIB 3MBVA 4YSTA 3UABA 5ITEA 3ABGA 2VW4A 4HZ1A 2AT9A 1HFUA 2BWIA 2YAHA 3CZUB 5I5IA 3RZEA 2PPAA 3BQVA 1BYPA 2EILB 3HANA 3V9EA 2WJKA 4HHGA 1NIDA 2VSKB 3AZUA 2FT6A 1JV7A 2YCZA 2FT7A 1TEFA 5B6ZA 4DAJA 4DJHA 2BW5A 4MQSA 5AHZA 1JXFA 3WQJA 4UAHA 1OCOB 4AKOA 1TKWA 5A7EA 5AFAA 4PAZA 3P0GA 2YAEA 2Y02A 3S8FB 1R2NA 1OOWA 1BYOA 2CAKA 3ABKB 3NJKA 2GBAA 3MBWB 1V54B 2KSYA 1M9WA 2BW4A 1RZQA 1ETJA 1WS7A 2GIMA 5EHFA 2XLLA 3DTUB 3QJRB 3ZBMA 3QBGA 1PY0A 3UAEA 4BDVB 3OAXA 3X1BA 4IAQA 3NJLA 1L9PA 3GXUB 6PCYA 1FA4A 2FNWA 1AR1B 1DZEA 1EHKB 1BQKA 1YLBB 1LN6A 2L6XA 1BAWA 3ODUA 4KLYA 1GY2A 5B6VA 1AZBA 1PY6A 3CVDA 5B1AB 3HAQA 3UAAA 2Z73A 4L6RA 3V9CA 3UTVA 4PXFA 4WKXA 4BUOA 5B0WA 1OCZB 3HASA 4P5RA 1XB8A 3FSWA 4YVUA 1ILSA 2VMJA 2Y1AA 5B35A 3IN2A 4X31A 2X88A 4HALA 2QDVA 4G70B 3UONA 3FS9A 2IDFA 1X0K1 3NP3A 4BXVA 4DP0X 4JQ6A 3ZIYA 3WKPA 4YSQA 5I6NA 5A8EA 3OD3A 4YSRA 4KOCA 2GB2A 2XYBA 2BP0A 5G2DA 4QI1A 1AZNA 3AG3B 2BZCA 4E9XA 1AS8A 1ZV2A 3X1GA 3PXOA 1J9QA 2PPEA 1JERA 4MD1A 1BXVA 5TGZA 5F8UA 2NRDA 1SHXA 2XWZA 1FBBA 1QM8A 4X32A 3FU7A 1VLXA 2KSAA 3EMLA 4EF3A 4YSOA 4JKNA 5JJNA 1AQ8A 1M0LA 4BEZA 7PAZA 1JOIA 2CBPA 3DKHA 3QJVB 1GZMA 1UAZA 3T9WA 1E12A 1OCRB 4DP8X 2X72A 5G2CA 1BEXA 1GSKA 3ERXA 3OMIB 3DDLA 1OF0A 2HZHA 4E9RA 3C75A 5H2LA 3OE0A 1PZBA 3TU6A 1ADWA 1M0MA 2J56A 3L45A 3T6VA 3NJFA 3TBBA 1IUZA 2YCYA 1SFDA 5B1KA 4M3HA 3QPKA 1AANA 2XU9A 5H2KA 3EH4B 1FFTB 3T6WA 1XB3A 4G7QB 5KKHA 4GXFA 1V10A 1JZFA 2B3IA 3NS0A 3EF4A 4KO6A 2WJLA 2DYRB 3ZDWA 4DPCX 1AP9A 3HAOA 4MQTA 1KDJA 4Q89A 2J5WA 1TU2A 3FT0A 5LWEA 4J4QA 1IBYA 1BXUA 1E30A 1BXAA 4L35A 3QJQB 1F88A 4HYXA 5G28A 2HLEB 2Z55A 1ZPUA 3NJNA 4KNFA 3D4SA 4GRVA 1TN0A 1KV7A 1NIEA 1J5DA 4OV0A 2P80D 3NSCA 1BRRA 2YARA 3OE8A 3AYMA 1SF3A 4BK5C 2Q5BA 3GYRA 2DY2A 1E0PA 2Y03A 2GC7C 3HB3B 5H2NA 3AG4B 2KSBA 1PXRA 1AACA 4DP7X 4DKLA 1GS6X 1NICA 2JFCA 4EIYA 2VM4A 3TASA 4NERA 2IDTA 4TXVB 4N4YB 5TK4A 3WIAA 1NWOA 4PCYA 4G72B 5D4IA 1AG0A 1UCQA 2PPDA 2H47C 1S51A 5A45A 3A7KA 2YAPA 1V55B 3V2WA 5B6XA 1ZDQA 3ASOB 3FPYA 3G5WA 5JJEA 1AOZA 1PAZA 2N0MA 2YAQA 3AM6A 5G36A 1IXFA 4AKPA 4EA3A 3X1NA 1AAJA 2Y69B 2YQBA 3JT2A 1L9TA 3UTXA 4FA7B 3UADA 4QKTA 3PWHA 4NB7A 2BRDA 4GP8B 5DHGA 4YVNA 5F7BA 1F56A 2FQDA 3QJSB 3FQ2A 2I35A 4FPDA 5FC9A 1NIFA 3CVCA 2FQFA 1E5YA 1NIBA 3AW5A 4KNUA 2R7EA 1S8LA 1PLBA 2PP8A 1IC0A 4JR8A 4GPOA 4JKVA 1TN5A 5AKRA 1X0I1 1KCBA 4JHUA 3S3BB 1S54A 1GW0A 4F2EA 4QRYA 3CODA 3ZPQA 1VJMA 1FWXA 2BWDA 2ZXWB 3X1FA 3QQXA 1AIZA 4HCGA 4MD2A 1BRXA 1NIAA 1GU8A 2UXGA 1PF3A 3OMAB 2Y00A 1PNCA 3H4HA 3T45A 3HAPA 1XIOA 2IWEA 1W6LA 1A4BA 1QNIA 2YXWA 1WS8A 3NSFA 4DPAX 1MGYA 4E9QA 3NSBA 2F95A 1F4ZA 1S52A 4LDLA 5EN0A 1JFPA 1AZRA 1NZRA 3BVDB 1AS7A 1L9SA 1AZUA 2H5UA 3OQRA 4UF7C 4A4MA 3EH5B 3QDCA 1JVLA 2EIJB 2EINB 3X2QB 4E9TA 1PLAA 1L9RA 1BRDA 2IDQA 2HPYA 3ABWA 4CSPA 1MDAA 1PXSA 1MG2C 4P5SA 1SDDA 4GYCA 3NYAA 4YSSA 3IE9A 1A65A 2XV2A 3NP4A 4G71B 1MZYA 1URIA 1S53A 4HCIA 2FQEA 2BO0A 5H2JA 3WNJA 1NDTA 2LLNA 2UXVA 2DWTA 2YDOA 2JKWA 3QBKA 1VGOA 2EI4A 1GUEA 1Q5IA 4KO5A 4AMIA 3SBRA 1M0KA 4UG2A 5H2MA 1JZEA 1RCYA 2FWLB 1JZGA 1JZIA 2XVBA 5I6OA 3IBOA 3ZX1A 4A2GA 1J5CA 4BVNA 5I5JA 3QAPA 2I1XA 1ZIAA 1PZAA 9PCYA 2R4SA 1SNRA 1OV8A 2BP8B 3S3CB 4FBZA 1R1CA 2PPCA 1RKRA 1AZCA 1JVOA 1ASPA 2YXVA 2FTAA 1W8EA 4XT1A 5B2NA
chains in the Genus database with same CATH superfamily
3GNML 3RWIB 3U7WL 1AVAA 4H20L 2MWCA 4XMPL 4F7PA 2FYYB 5AUMA 3AQXA 4IDLA 5AZ2L 1BECA 2ZXEB 4N8CH 1E9OB 3CSYB 4G7YH 1FAKT 3HBPA 1RJYB 3KS0H 4IRZH 1OP3K 3WIHH 3HNTH 4UT6A 1XIWB 4O9HH 5LBVA 4MAYD 2C9PA 5I18L 2QMKA 5A2IH 3CQQA 4CVWA 4BEIA 4FNUA 4Z95H 1UT9A 3DX3A 3D85D 4PCKA 1U36A 2ROXA 4HYJA 4P59L 1E8ZA 5JJJA 4K8RH 2C3VA 3KPMB 4U0QB 1OE3A 3LN5A 3L4VA 1DFBL 4I3SL 3V0FA 4LLMB 1S9VA 1JDAA 4R5XA 4XP4H 5I75B 3VWKD 1Q0XH 3DMMB 4C56D 4GRMB 4XAKE 2C9XA 4AITA 3VXUA 1RZIB 3HOGA 5TE4H 4MA7L 4N8UA 1CGTA 3P0GB 1LILA 4CUCA 4FTVB 1PZCA 4OFKA 1ET5A 5CU5A 1B2WH 1D5RA 2JXMA 3SDAC 1MF2L 2TSAA 3OX8B 4Y5VB 2C4FT 3Q6GH 3NYKA 5I28A 4O4YL 3V52H 1BM3H 4L3EE 4L1TA 2D31A 3Q8BA 3U83A 1IAIL 2QSCH 4ZQTA 2V9QA 4FFYL 4GINA 2EDMA 2VR7A 1N70A 1UFUA 1UD3A 1SUJA 1YNKH 1KUMA 3EFFB 4YHNB 5JXAH 1Z1WA 3GMLA 1OGAB 1IGYA 3H8NA 1BZOA 5ADPL 3EBIA 2QHRH 4OZGE 2AQ3A 3VFUA 3F6LA 3LH2H 4LSRL 1F58L 1HZHL 2E86A 4KKRA 4FL4C 1UVQA 3KLAA 3U9WA 4RH4A 1NC4A 4K0OA 4F2FA 5D1ZC 3REVB 5I76B 1LWJA 1PFCA 2Q86B 3UJJL 4LCVA 3QQ3A 2BSSB 3GXTA 3RWEB 3KPSE 1UTDA 4FULA 2DD8H 1NMAH 1S7VA 4R84A 1JV5A 1IVTA 3QUZB 1U95B 2ZCKL 3NT0A 4AH2A 4E9LA 4NKOA 4PLJC 1LDSA 3HG1E 4AYID 3AXLB 5D96C 2VZUA 1E90A 1YY8B 2YFNA 2DEYX 1S8DB 2HT3C 5T5NF 4NKIH 1ZK5A 1WA2X 2L4OA 1YEIH 5FYJD 1CDIA 2BJML 3B5HA 4NBYB 1QBBA 3GUFA 4JMXA 4JZJA 5GSRB 3WMQA 1JMZA 5EMYA 4P23A 5KTEH 4A66A 5JR1L 1A0QH 4IRZA 3WFEH 3WIHA 3JTSB 2K7QA 4Z6AT 4X42A 3U0PA 4ODSH 1GR7A 4B9KC 5E8NA 3SO3B 3MDJA 1A1OB 3CLEL 4Z1PA 1YPZF 2E59A 3NA9H 5FA3A 2IH1B 1QLEL 4E2OA 4M4PA 1F3JB 3Q8CA 1UUSA 3VXNB 4UANA 4AENB 3CXFA 4WV1C 2MPAL 2BFVH 1JCVA 5FF6A 2ZAHA 4ZAKB 2WGNB 3QZPA 4DHLA 3KVPA 2GJPA 1II4E 1F2XK 4WENB 4UNVA 4JKPL 3D2UD 2YD0A 1PYWB 2AJUH 3CFNA 1QR1B 4QUOA 2F15A 5AW5B 1VJSA 2PCXA 4LCWD 4HJ0D 3DV6B 4DK3A 1MCCA 4OCRH 5H37H 1HYRC 2LE9A 2Q8AL 4N20A 1CLCA 3QR1A 1FJ1A 3I75A 1KN4H 5C2BL 1C5BL 2AVFA 4OI9A 4KKQA 4YHMH 3V5KA 5B1JC 2X6AA 4OY9A 4PJ7E 3FYIB 1MJ7L 4Z7UF 3GZOA 3QUYC 4Y4FB 4QRQB 1AFVL 4F9LA 1Q0YL 5J12C 1I7TB 1F11B 3TO2B 4U6HA 4K3JH 3ILQC 3G6AA 3NVQA 2EIZB 3CZEA 4GI9A 5MENB 3BDYH 4JFVA 3TA3C 4QRPD 4RESB 3IPEA 1TOXA 5F7HA 1CYWA 2JSFA 3OKNA 3Q2VA 5BRZB 3BZDA 4OAWB 3IN0A 5IMMB 2WKOF 4QTIL 1M2OA 5CCKH 1HH9A 1HEZB 4JE0A 1IMHC 3E6HB 3JTTB 2ZZUT 5G4MA 3SN6R 3LIZL 4LAJH 1L5GB 3KCPA 1YYML 2A77H 4ZMVA 2EXSA 2PXYA 3H42H 3KH3A 2KLRA 2KKQA 3VH8G 5BVPL 5IROD 2GEQA 2ZJSH 2AZUA 5B6YA 5AHYA 5DQDH 4D0DB 1KDIA 1Q4NX 1IO4C 4IQHA 1RK1B 3T4AA 2IBZY 2VLLB 3NOIA 1RJLB 4X6BB 4QPEA 3UC0H 3B9AA 2M83A 3V9FA 4M6OL 1XGYL 1IFGA 3F5WA 2YFOA 3T5WA 2VXUL 4OGQC 3VU1A 4DGVH 5D7IF 1COBA 4MAYA 3PUUA 4L3FA 2IWGA 3RWFB 1AHKA 2WB1A 4QTFA 5DZVA 4GKSA 3D85A 1T4WA 3GMNB 4LLUB 2WXNA 1L0XA 6PAZA 3VI0A 1BCIA 3TBCA 2ODIA 1IM3D 2FSEB 3E1ZA 1DBKH 3NCXA 4P5MA 3O6FB 3H1ZA 3MRIA 3VXQB 3VWKA 3HMWH 1XWVA 2EEDA 2W5PA 2ZNXA 4C56A 3SPHA 4OCSL 5CN1A 2YQ3A 3WFHB 5BW7C 4HWEH 3I74A 1NINA 1JFQL 4JHWH 5GGSA 2DQJH 2EDYA 4P06A 2AI0L 3NSDA 3Q06A 5FLUA 3TEXA 1G87A 4LAQL 5B39B 5EZJA 2VL4A 1OM3L 4B96A 4QHNB 4PRAA 4YSEA 4J3OD 1NMCB 3ETSA 3BZ4B 3FB6B 4ZOBA 4Q6IA 5FCUL 5JHAA 1XSKA 2X4RB 4TOYH 3BE1L 4JGNA 5H37A 3M17B 4JREC 2W07B 4LNRA 5EEUA 3LKOB 3RZEA 3PIQA 4BRJA 1PQZA 5IOKA 2DTMH 4RFEA 3V9EA 1SY6L 2B20A 1NIDA 4WW2B 4M93B 2NZ1A 5H8DA 1NAKH 2BERA 4F8QA 3H9YA 3OGCB 2D7QA 5B6ZA 4M7ZB 3ZKSD 4M00A 1S46A 1E8YA 3B5GA 2ORBH 3I9GH 1ZLVH 2BS9A 3ZE2F 4H13C 4BQ6A 5IVXE 5EN2B 1I9EA 3BIKB 2H0EA 2UZYA 3Q13A 4NFDA 3BGMA 1QG3A 4PLOB 3VG9C 5K69A 3OSKA 3MXVH 4FGMA 2FR4B 4MHHG 4LZKA 4JHAL 5D2LA 1SXNA 3LZQA 4S0SD 1YMMB 5DU7A 5TE7L 1X5ZA 3EDKA 4JM2C 5IBLC 3BKJL 1BQKA 3MBXL 2FX8L 4OCLC 5F21B 3WTYA 5GISH 2AQ2A 1W0VB 4MNHB 3WMSA 4KMQA 3THMH 3EDFA 4PJHE 4UB0L 3S3PA 3L5JA 3RVUC 4DGIL 4ANUA 4HXBL 4PXFA 4BUOA 5CUSH 3T65B 3O3EB 2UUDK 5LN8A 1ILSA 4W9EC 4F1ZA 4YE4H 4X31A 2XETA 3P40A 4HALA 2QDVA 4OB5H 3ABZA 1YQ2A 4L3CA 4WCYH 2ZXAA 4NZRL 3S5ZA 3AABA 1T5WA 3RL1A 2NTFB 4RGNC 2VC2L 1A25A 1MHPL 1T20A 2GY7B 3Q1EA 1BIHA 2VMEA 1AI1L 3SYCA 3X1GA 4LPXA 1ZHKA 2PPEA 3V2AR 4W6WB 5F8UA 3IFLH 4IGBC 4N90E 4Y2OA 5I1GH 4GIOA 2VO5A 4UTAL 4ABUA 2OJEA 4I48A 4J3OH 4PJ5B 1CDHA 4ZUWA 3D2UA 5GSVB 4D9QE 3TNNB 1F4YL 2VMFA 2WXPA 3GK8L 3IGKA 4NJAH 4JZNA 1LO5B 2QVMA 4JM4L 2BDNL 2JB5L 4M02A 1VFAB 4LCWA 4NDMB 3MCKA 2NLJA 3UAJC 1CIUA 2LOEA 1GGYA 4E9RA 5HVWA 2E4TA 2EUXA 3F12B 1O6SB 2IPKA 3PGFH 1M0MA 4JUSA 4WJG3 2J88L 3RG1C 3ZZLA 3HZMB 4HCRH 1UWEH 3ARFB 4DVBA 3H9SB 3BEWA 4PGEB 3QWRD 5JHDE 3ZKQD 5E2VH 2WB7A 4HIEA 5E7FA 4GUCA 2QR0A 2X4NA 2EIBA 3KXFE 4Q56A 2NX5E 5FW6A 2HMIC 1AP9A 1FP5A 3NQIA 1CFTB 4R4BA 3QI9D 4Y4KC 3UYOD 4QRPA 4NM8H 1OAZH 2GJZA 5L2KB 5ECJE 1K5WA 2CIKB 2YD4A 5GRZA 4E0RA 1U8PB 1WJ3A 4G6FB 4JO2L 5CR1A 1INQB 4MTMA 2OMZA 4I2XA 4OV0A 4ZUUB 4PJXE 4UUJB 5GGUB 3TNMA 4MJIE 4CADB 2VXTH 3SSGA 2VJXA 1BVKB 4MNGA 2QSQA 1O9VA 1KIPB 5E1AB 5IROA 4DUVA 3JZYA 1A8JH 5C7XH 1NICA 2L04A 1AD0B 2Y07L 2HJKB 5IJKA 3G6DL 1U3HC 5DJCA 3ZRSA 4LVOB 5GS1C 3TVMB 1RU9L 3S3SA 5LGKA 1ZANH 4NT6B 4FKKA 5LDSA 3QQDA 5HHMB 3MYJB 4HFUL 1ERNA 1DQMH 1L9TA 4FA7B 1LO2L 5E08H 2ZOKB 3AQZA 1IM3A 3MN8A 1U8LB 2FECI 4PY7A 1HNFA 3HPJB 2G60L 3IGUA 4Y9EA 3UMTA 4Z9KB 4GPOA 4AC2A 4L9LB 5KVEH 1IEHA 3CVIL 4TSCL 1ECZA 2MFNA 3W38A 1DE4A 4XZUA 4MD2A 3EO0B 1CVSC 4MB1A 3BVWA 3JWDC 1Z66A 2VDNL 4HV8A 2PWHA 3H85A 4FTVE 5DMGC 3VD2A 1JBJA 1E7VA 1GC1H 4XNZB 4GQQA 1E6OL 1CTOA 2AJXL 2XQYA 3KWUA 5E4EC 1I9JH 3FUHA 4NUMA 4K3HA 2RQ8A 1NCBL 2YPKA 3IDIB 4U05A 3KL3A 5F9OL 4F33B 2XV2A 4ZXBB 1MFNA 4HCRA 3GXNA 3C60B 3PNRB 2LQRA 2EDKA 2FUQA 1K2DB 4XCNA 5I19L 1HWHB 4X83A 3KPOA 4UQEA 4OF6A 1JG9A 5ADOH 5FK9A 4M6NH 1CL7L 1HXMA 1JI2A 1JTTA 1MIML 1NGXA 1OANA 2M8XA 2WQXA 3A6CL 3D25B 1VGKA 4D7BA 3DO3A 2VDPH 5DFVD 2CMRH 3WNNA 2JK5A 1NC2B 1TSRA 4GT0A 2A6DA 3G5XB 4BZ2L 1CZ8H 1PAMA 4ODUB 1T89A 1NCNA 3BWAA 3CXHK 3ZX1A 1CDBA 4KBPA 3VSTA 5HVHC 2DM7A 4B3VA 3H7BA 1H5BB 3K6NA 3O6KH 1DJGA 2P5WE 2BRQA 4Y88A 5CGMA 2ERJC 4OF0A 2UXFA 2E8YA 3KWWA 3KWXA 3OZ9L 3VD0A 1R5IB 3WEXA 4BV1A 2ED7A 2HSIA 2R1WA 3MUUA 3ZZSA 4HVBA 2CJUH 3FU8A 3OKDA 4KKZA 3DETD 4PD4K 4XNXH 1J18A 4UT7L 1FLRH 4WLCA 5AB0A 1HKLH 2R8SL 1I8KA 2V3EA 5EEVA 3BN3B 1H9DA 4HWUA 3WD5L 3IETB 4NRXA 1CWQA 1A6AA 4MKMA 5DD0H 3QG6A 3WEMA 1GXEA 3E1F1 2ZOLB 4XTRD 3EGSB 4HH9B 4E9WA 2R2CA 4HULB 1ETZB 4K94C 1YEGL 1EJOL 2K3HA 4UAOB 2YEQA 4H88H 5HI3D 4F7CA 1NCAL 2PO6D 3APNA 3FQYA 3FO0H 2FCBA 4X7TB 3RJQB 2QQNH 4N2AA 4FMKA 2BIPA 3I9AA 1T21B 4KJYB 1JNHA 4J3TA 3V5HB 1KB9K 1N8OE 3ALPA 3DUSA 4QHMA 2PN5A 3RL2A 2GBTA 2EXYC 1I7RB 1MNUL 3IDUA 1NH6A 5EF1A 2GSMB 2H41A 3QWRA 3O3AB 4JFPA 2E9GA 5D1XC 5SX5K 5HGDB 1T1ZA 3D0VA 2MNWA 1WHPA 4PVNA 4F37K 1KXHA 3ZRCC 4P46D 1I4FB 3QI9A 3D39B 4TULH 1W8NA 2RFXA 5D1ZI 3FFCB 1J9TA 3K5RA 4F5CA 1BQLL 4ZFGH 4Z76B 3RUGF 5MENE 3ZK0A 5JQIB 3CFKA 2NY7L 1ZHBB 2ICEC 5DUPL 3COOA 4WAVA 3L3IA 4U1HA 3RWCB 5BRZE 1V7NH 1LHZA 3FTGA 1AKPA 3GLEA 1MCLA 2VLRD 3IJ7A 1T5KA 3I6GA 2CZNA 2K1MA 4I0CC 5BOPA 5GGSY 4I1NB 4NZTH 4MNQD 43CAB 3JV5A 4LLYA 1OB1A 5AX1A 3PWPB 4N2CA 1A6VL 4DP1X 1ZK9A 3Q5YA 2NUTA 4YHOL 4YL4A 3HS8A 2FLRT 2L8AA 4W4NA 3AWGA 1T2QH 3UYPA 5AW3B 1YNTF 4H1LH 3FB7A 3IMRA 2FL5A 4PRIB 1V7ML 1TYJA 2F54D 3PWLA 3DO7B 4HIHA 1F90L 4M1CD 4MZ3A 2F8XC 3NABH 1LO0H 1XH2A 3LSOA 3T8XA 4HBCH 1XCXA 1E4WH 1UEYA 4IRSB 3WE6B 3IU3B 3QA3A 4RISH 2OTPA 5CWSA 4Z0XA 1G7HB 1MHHA 1U41A 3EGDB 3AU1A 2N56A 4AMJA 2OJZL 3NDZE 1OHQA 2CJ3A 1EIBA 5I26A 2OM5A 1KBGL 1RZJH 2RACA 3ULUD 3D0LB 5JPNB 1RIUH 5CLWA 4FFZH 1IM9B 3D2TA 5FYKE 3MRNA 4DUXA 5DS1A 5HPOA 2EYTB 3DVNB 3S35L 1NPNA 3ARRA 3BZFA 4U1IA 3ULVH 1OAXL 4YFDB 5MHSD 2E5EA 2VR6A 4RVBA 3MOAL 3O4OC 1CFQB 1AG6A 2GG1A 4Z7IA 3U9UA 5BQ7B 1RURH 1XX9C 2PUQT 3LH9A 4IIQC 2I5YL 4BINA 2Z1KA 1KBWA 5I8KH 2JKJA 4AQ1C 1ZHNA 2NTSP 4OJDH 4PIBA 1M7IB 2ZUQB 1G9HA 3ZTDC 3TBYB 3MLYL 5A3ID 2J8UB 5IESL 4MA3B 3U9PL 5HXMA 1CWVA 1AQKL 5T33H 3VX1A 1NCWL 1JZ5A 1G7QB 2ZTBA 2D3VA 5IVNA 2H1LM 4LBEA 5KG9A 4OF7A 1LEGB 3ILDA 1L7TH 4S1RL 4Y2NA 5DHEA 1U8IA 1OO2A 3O3BB 1H8NA 2AP2A 4DCQA 1BDYA 4IW4C 1KG8A 5IUCA 3QZOA 4HYTB 4ZMYA 1Z5YD 3CZFA 2WIIB 2AXHA 3NSXA 3ZMRA 1MRDH 2DJUA 3QCVL 2P43B 1YMME 4UIMA 5DZOA 2QADD 1XF5A 3DYMA 4JKLA 3V7MA 4RRPG 1A7BA 3BESR 5FUZL 5J56B 3FONA 4AJ0A 5D2NC 3WTWA 3RHWK 5CU9A 5AOJA 3TCLA 4IRJD 4MDRA 1P6AB 1MOEA 5SX4H 1CGSH 4H1LA 1FL6B 1OVZA 1Q1JL 5AZUA 2H3KA 2NNAB 3GMQB 2GYSA 1CXIA 4X6FB 2A6KA 2WCPA 4PREA 2IAAC 3ZKXC 3MLXH 3WNPA 4LQFH 5E6IB 5JORA 1HHHB 1AGEB 1BPVA 5CEYA 3CXDL 4WI9A 3M86A 1FPTL 4NQUA 2IOIA 2FHFA 3QJUB 1VFMA 3ULUH 2X1PA 2J6EH 3N9GH 4NS0A 5E4IA 4RGMC 3SJVD 3LEYH 1ZHLA 5LXVA 1G6RB 3FN9A 3CIQA 3TO4D 2XY1A 3IMTA 3A4AA 4ZPVA 3DI3B 4KJQC 2LU7A 4BKLA 2PO6A 4JVWA 2VE6A 2ZG3A 3W39A 1OTTC 1SHWA 4PJ5E 3V8OA 2WYHA 4FFZA 1DSFL 1YECH 2DV6A 4I0PC 4IHOA 35C8L 1HI6A 3NFNB 1TT6A 1GTFA 1NBQA 4B0MM 4K7PH 2CRIA 4YO0A 2MCPL 3UABA 3ET9F 2BC4B 2UWEE 3L3JB 3S96A 1T03L 2PNDA 4ZSOA 1KIQB 3ARED 3BCFA 1PEWA 3WO4B 2PCPA 4XNMA 1BYPA 5I1LA 4S1DD 3ZL2A 2DQEL 4HETA 4QLRA 2CO6A 3ARDB 4KKCC 4P46A 5IB1B 3MJ8B 2EE6A 4PWGA 4PJCF 2NY6B 4GQ9L 3HI6H 4Z7VA 2YA1A 1HNGA 5AFAA 1LGVA 3WJJC 1AXTL 1D6EA 1QABA 1TTAA 4YDKH 4PJDB 1M9WA 1DJIA 2VLRA 4OUUB 3RWGB 5I1JL 3TCTA 2GIMA 4XXCC 4IKJA 4MNQA 4ABVA 1QYGH 1EA9C 2XICA 3JBG7 2JB6A 2V5SA 4K15A 2DQCH 2GSIA 3EYFB 2EE9A 1A5FL 2MHAB 3RQ3A 1A1MB 1JN6A 3DSFL 4EN3D 3D1MC 1DVFB 5MEPB 1AMXA 4RX4D 2ATPA 2F54A 3LHPL 1E4XH 4XAWH 5FM4A 1TVHA 3V9CA 2Q3ZA 4EZKA 3UTVA 4PRHD 1XCTA 4J1UB 4XNQB 5B0WA 1LEIB 5F6HJ 4P5RA 5HHME 3IN2A 5LG1A 5DHYA 1CD1A 3GJEB 3E8VA 5AB1A 2WBJC 1RSYA 4PGZA 4G5ZL 5AOMA 1I8LA 1NPUA 4FLHA 2R0ZL 4KKLC 1NCJA 3EDJA 2JQAA 2WNXA 4FMFA 5C0GB 3HI5H 3UL4A 4H26B 4NNPH 3K81A 2FE0A 4Q0XH 2J6EA 4OD1H 4MD4A 4X32A 4XXWA 2XZQH 3E0GA 4YDVB 2C9QA 2X5PA 3MRBA 3TEUA 4RMQA 1XH3A 2M1KA 4E68A 3IT8D 2H26A 2JKRM 4LEXH 4AQAB 2X0VA 2WKGA 3ZT5A 4OZIB 4JQVA 4FYTA 4UDTA 1N3NA 2YSSA 4FNLL 1PGRB 3GFUA 4CKQA 5C6TH 2Y24A 3AADB 1BZ9A 1F00I 3MMEB 3TBBA 3HPLB 3LTVA 1A7OL 1T5XA 4WK0B 2NOYA 2G5BB 1M6OB 2YRBA 5IFJB 4OV5A 2LU3A 1V3MA 1OLZA 3KM1A 1YEKL 1A9BB 2DYPB 3OHXC 4G5AA 4P2QB 3LN4B 3EJCA 4Z7OF 5ISZD 5LWEA 2Q0ZX 3C5ZB 5A2FA 3LQAH 4WNSA 4KK9C 5JA8B 1P84J 4A6YH 5FOBA 3GSRB 4U1KA 2HLEB 3NJNA 1DBBL 4H7VA 4MDIB 4ISVA 3UTQA 2DI9A 4QKXB 2E7HA 5HGGS 4I77L 1HC1A 1XR8B 2IAMB 4N2DA 4EDXA 1NEZA 1MQKH 4Q2ZA 1ODAA 1Z9MA 2Q5BA 5IVOA 3WFDL 2GC7C 4NYLA 1BJ8A 5DZLA 3GNMH 2EKSA 3HB3B 4H20H 5GGTH 3O11A 3L5IA 4XMXA 3C12A 3LV3A 5DHVB 4MMYB 3U30B 2OX5B 3TASA 1VFBA 4F2MB 1UYWL 2FO8A 3IKKA 2H2SC 5D4IA 1AG0A 1NLDL 4N5ED 3N04A 4M56A 4P4KC 1SMOA 4HP5A 4QTHB 4IRJA 4UQDA 5H37G 5B6XA 3T0WA 1S5HA 4ZUSA 4ZD3L 4JG1L 3G5ZB 3VGBA 3R19A 1JPFB 1CF8L 4EA3A 3AJ7A 4GSXA 3X1NA 2NW3B 5ICUA 1ZJAA 2G2NA 4HUCA 1YDPA 5F7KC 3TC9A 1Z5LB 2Z35A 1MSPA 5D2LF 3UJIH 4QOKD 1MHCB 1S7RA 4FNPA 1E28A 3BSZL 1KYFA 3VVWA 4PJGA 5D7JC 5DVOA 3AGWA 3EHBD 1S3KH 1TFPA 3UTSB 4W9FC 1E27A 3BUBA 1RZGB 3N85L 4MA1B 4JHUA 3LZFL 3CHSA 4LSSH 4UINL 5IHUH 3SJVA 4WVRA 2D2CC 4F2EA 3TO4A 2BWDA 3PJNA 1ZCRA 2E7MA 4KFMA 1BRXA 5C07D 1ND0B 1WC7A 3MNVB 4D0CB 5GHWH 2XWJA 2K70A 1A4BA 1FNGA 4JY4B 5D7LD 3LCYA 4YFLF 5IW1B 1KIUB 2EZ0D 1NZRA 3IAQA 5D7KD 1L9SA 3QFDB 2WVSA 1MHEA 5D4QA 1S9XB 2AEQL 1SDYA 3BFQG 4YUEL 3VGHA 2RD0A 4OFPA 3OZKA 5BS0D 2DBJA 1MDAA 4HLJA 4HX1B 1RH8A 3AREA 4Q9RL 4P5SA 4RMVA 2DL2A 1OT4A 1F58H 3PJLA 3PUCA 4R2GC 2Z8SA 1IX2A 3V6FA 2QPFA 2XIBA 3DJRA 2PYFA 3LQMA 1WBXA 4JFOB 2HFEB 3UZVA 2H8PB 1H3WM 3H54A 2WTOA 3D39E 1M7DA 1A6WL 1EEZB 4KH9A 3FFCE 1A7QH 2CBMA 1RULL 3TZVD 4NCDA 3N40F 2HH0H 2JJTC 2EI4A 4MJ6A 3VGDA 4K2UL 3WSQL 4J8QA 5F89A 4DN3H 12E8H 3EYQD 3GINA 4A6YA 1YUHA 3HFML 4G9DB 4MX7A 3BLBA 3VXPA 2GTZB 2QV2A 4NGHH 4U3SB 1ZIAA 1PFOA 2XA3A 2Y1ZA 4MCYA 5EIQA 4UQBA 5ID0B 4FBZA 3DIDA 2JKTM 5D71H 5C7ZA 3B37A 5T1MB 1BVLB 1C8QA 3PWPE 5GGTA 4WY7L 4EN3A 3EJRA 1KYOJ 1KBKA 1UWYA 4J2QA 4KVCH 2NY1B 4NUGL 3P3TA 4RX4A 2F6AA 1A4JA 5JR1H 3MV9D 1EAPA 3RFZC 5EULV 4PRHA 4UNIA 4JFWA 1RPQA 3L16A 4QY8B 5DHMC 4AY0A 4DZBB 4XO9A 5CJBA 4EDWL 1NFIA 2ZP9A 2MQ3A 3DLQR 5DRNB 1PZUB 3V0IA 2HJLA 3Q1SL 3DPDA 4QRTA 3TIDB 1Q90A 2VR8A 3WELA 1X9RA 3B2UD 3K74B 2FWSA 1AXSB 3S3DB 3ETBJ 5CEXB 2C3GA 1JF5A 1WV7T 4JKPH 4XMKH 4JNXA 2X2UA 5ID1B 4HDIB 3CCHA 1FC2D 3LXBA 5BRQA 4I5BA 3ILPB 2HLAB 4OIBA 4BCXA 1CE6B 4FHBD 1BFTA 3ZW3A 2CGRH 5T3XE 3LEVL 3WNIA 2VXSH 4KQ4L 2VABB 4OFQA 4PTTB 1UD2A 3NCJH 3CFIC 2GTWB 1T3FB 3SYPA 3ZDXF 3OKMB 1T7WA 4YXKL 2P8MB 1ZLSH 3ZE0F 1R24A 4G8FB 1R3KA 4ICXA 4O2EA 2XRAH 3HHSB 1FNEB 5F6IC 1WFIA 4NPKA 4HJSA 5FO7A 2OL3B 3SOBH 1O75A 2X2IA 1JUFA 2ZXDA 4U6XB 1ZWIB 4R7XA 4QHLA 3QORB 5DFAA 5ISZA 3IFOA 2CNYA 5JA9A 1P4LB 2J8UE 5EZLA 3RIAK 3NG5A 3H0TB 2YIHA 5KBDA 3ZU8A 1RZ7H 1BM1A 3MUZ1 3D69B 8PAZA 4JQXA 3L9RA 5AZEH 3S88H 1Q0EA 5FGBC 1SGKA 3NH7H 3E7JA 2NTUA 2LTQB 3VXTA 4ZK8A 1ML0A 5BVPH 1U8CA 3PHOA 1MFVA 3LZNA 3ZHFA 1M2VA 3MRJA 3J2PA 4D9LL 5FFLA 2XA8H 2AMGA 1PMYA 2HRPL 1YPZB 2N3JA 3DX9B 3S5LA 4Z0BL 2ZWSA 3FOMA 3MV01 4W4OA 4EIBA 4PN6A 1G6VK 1I53A 1WFOA 2V9RA 1RLWA 2YN5A 3CX5K 1F6LL 2C1PB 4U1MB 2K78A 5BZZA 1XF3B 5KYYA 2BZDA 2R0LH 1DQLL 1SYVA 2FBRA 4BGDA 5IV2A 3Q5TA 5HI5D 3UTTA 4KPHH 2CXGA 2GK0B 2ZPKL 4L8DB 4NQDD 3KPPB 1BQHA 1AO7B 4QOKA 3V55A 1G94A 5KOMC 1XQ4A 3A6BH 1J5OL 4NUJB 3BVXA 2IEPA 5EV7A 1U19A 3KPRD 1C5CH 1B0RB 3L8QA 1DVZA 1GGCH 2RHEA 4DIXA 4LDEA 4N5UA 4Z7UB 5K39A 5IR1A 1FRGL 1OM3H 5C07A 2NZ9C 3VRLE 1WITA 3ARPA 4G3YL 5D7LA 3PL6B 1EO8L 3ZO9A 3FU3A 1UM6H 3MBEB 4KO7A 4NUQA 4LMQE 2NY3C 2KQNA 1NKOA 1M53A 4LSUH 5IQ9A 3EZ8A 4XC1L 2CR3A 5BS0A 1TZ8A 3P77B 4NHCH 5KWYC 3BWUC 4PRPB 4YHLL 1SJHA 4KK6C 4KROD 1KB3A 2NSQA 2JCCE 1KB5L 5KYUB 2D9QB 1KENH 5B38G 2ZOWA 2VITB 3CH8A 5CN2A 1BF5A 3MGTA 1KN2H 1JF1B 1YN7B 4YBQD 2BSRA 2FZ3B 5HGHA 2FJHA 4HS3B 4XAKD 1NANI 4GAJL 4GP5B 1SUHA 3QQ4A 4G6JH 2WV3A 3F65A 2YUVA 4PJ9B 3C5SA 2YJQA 5DRZA 2OTUA 2VN4A 3TZVA 5C9JA 1EZVX 4N6RA 2R2EA 1NBYB 5DMJB 4JO4H 2PCYA 3NZ8B 1SLUA 4R26H 1FHGA 1C3WA 3B9KB 1BJMA 2NPLX 4YR6B 1DN0B 4YSUA 3WG7B 2I9LA 4L3ED 5DVMA 4PJDE 5F7NC 2Y1YA 3BKJH 3WENA 3RKPA 1G9NH 3IRZA 4DVRH 3WXWL 3FJTA 2BS71 1QFWI 2FJFA 3TBWB 1HXKA 2NYYD 4LPVA 4ONHA 3L4WA 4P2OD 2FIRT 5DGQA 5T1KB 2BP5M 4FABH 3MV9A 1MFBL 2PWFA 1A7RH 3MJGX 4L23A 3CZNA 3D18B 3NN8B 4RZCA 4L8BB 1IGFL 3BAXA 5IOPA 4K7PY 5G54A 2NCEA 2I20A 4OCWL 1HE7A 1GGTA 2YEVB 1IW6A 2RQEA 5LGJB 1HL8A 5DD3L 2ZKHH 1WFTA 3P0YL 4LOUC 1GZPA 4JY6B 1T1XB 2PW2B 4ZFOA 5LXGL 2ZX6A 5EEXA 4QWWD 3S4SG 3G5YA 5DMYA 1FHNA 3CVHB 4MJJA 2WANA 4NP4L 3FRPB 1JP5A 2HN7B 2I85A 4FQ2H 4UU9B 3P2DA 3HG1D 1YZZA 2YD3A 1WIOA 5C0BB 2R1XA 1V5JA 4ZFZB 3O9WD 2X1XR 3MUY1 5EBGA 4GG6F 4OKDA 5FB8B 5FO8B 2AXFB 1F50A 3VGEA 2GI7A 3PFUA 1OSZA 4F3FA 1I8AA 2Y7LA 4K3EH 5CJXA 5C0DB 4F15C 1IQWL 1OP3H 4QLWA 3AQDA 3WCYA 2EKJA 1MFCL 1JWMB 4WRLA 3ZE2B 43C9B 4OZIE 1JZJA 2DWDA 2F7QA 2OK0H 3B43A 4QT5B 1P5VA 1KPUB 1NCDL 3P2TA 3QNZA 4JG0H 4I18B 3CDCA 3IJ9A 4NUPA 3VU2A 3BQVA 4GRLB 4PLKC 4MSWA 2EDTA 4DK5A 4Z18A 4KQ3H 3L9BA 4HXAH 4JW3A 1U92A 5ITFA 1EHLL 3GI9H 3HUJE 1QAWA 2G5RA 5CKAA 3P54A 3DX8B 4HFWB 1IGIH 3S37X 5HYSG 4R7LA 4JDVA 3NCMA 1TQSA 1TJIH 2H45A 5A7EA 4HIXH 4FG6C 1OTUC 1PCXA 1F2QA 4P2QE 4OCNC 3VW3H 2YEZA 1AP2B 1IBGH 4HGWB 5HY9A 4NN7C 3LKPA 1P1ZB 3DGCR 1PEZA 4HAGA 1Z9LA 2GBAA 3SY0A 1IZJA 1VKXA 2QSTA 3MGAA 1ZRUA 4U1JB 2YD2A 5E8OB 2NT1A 5AYUH 4WDIA 3V6OC 2AMUA 2ZUYA 4GLRI 1TPXC 2XWTA 4H44C 1P7BA 4B0MB 2DLTA 4YC2C 3DHMA 2R0KL 3M6DA 3KWTA 1J1OL 2CPCA 1T7YA 1N67A 4FC3E 5DS8A 4F2ME 1DVSA 1VACB 2XWBA 2CDEB 1NDGA 5D72H 1Z9OA 1ZGLP 3ETBF 5D5ME 4X4XB 3TV3H 3KGUA 3PDGA 3WS3A 1JZ7A 4HHAB 5IF0A 3VI4A 4NQDA 2Y1AA 2UVFA 4WTZA 1O5DT 1FYHB 1T2XA 4ZW7A 4EKXA 3LNHA 3UX9B 4KZEL 5G5DA 4RAVB 3WKPA 3KPRA 1MCBA 1BPLB 1EGJL 5EU3B 4ZMTA 5G2DA 4LLWB 2Q7YA 3VQ2C 5L0QB 3UTSE 1QSFD 3U2JA 2GQHA 3JVGC 1FBBA 4JN2A 2APFA 3D5OF 1KGXA 1UACH 2HAZA 1LEKB 1IAII 4YBLB 2Y6TE 3U4EB 1T0MA 5HGBB 3ESOA 1MREH 2ZNWA 4P57B 4OT1L 4CU6A 2LT9A 4UYQA 1YNLL 3X3FL 1NCBH 1GA2A 3MO1B 2MNJB 3JWNC 2HZHA 2QEJA 3C75A 4AMKH 2Q6WB 3BT0A 4FXKC 1LQBC 3O45A 1IUZA 3QPKA 5I1CL 1YEJH 3STLA 4FQCL 3CH1B 4IJ3B 5H2KA 5I19H 2PR9A 4MS6A 4XP6L 4PW9A 2B1AL 2HFFA 4HD5A 2BCKA 2WM0A 1GYWA 2VLME 2WPGA 3WEOA 3A3YB 2LGNA 1QFUH 3LAFA 4I3GA 4W68A 3C6LC 4DW2H 2FEEI 1XH0A 2F5BL 4R7NB 2DQIH 1ZVNA 3B3IB 3O0RL 4L3EA 1KV7A 1KSRA 1NIEA 2BY0A 5E5UB 5LQBH 3TL5A 3MA7A 2NW2A 3MJ7B 5H2NA 1EQWA 1BX2B 32C2A 3RLSA 3NQKA 4DP7X 4JRFA 4G11A 2G3XA 4XO4A 4YHIB 5T5FL 1OOAA 1TITA 4P2OA 1KG0A 1XGUB 3L3KB 5KVDL 4AE0A 3QDGB 3WU1A 2OMWB 3X14B 2NY4B 3D9AH 4JRYD 3O81A 2C7UB 1KTRL 3O4LD 4BSWB 4JFEB 1OB0A 4Z3IA 5CLXA 2BCMA 4DN4L 4HIIB 4IBWA 4U1SA 1CR9L 3IMWA 3HBGA 3EOBB 4LCCC 4XPBH 1KJ2H 4CMMB 4OLYL 1EAQA 1SXBA 1VCAA 3HG1A 4LARH 4HW6A 4QO1B 5DJ2B 1F02I 1GW0A 5F7DB 2OSWA 4DWHA 3DSNA 1NCAH 3LKRB 4QRYA 3O9WA 4Y5XA 1VJMA 3BPNB 3S3JA 3ZN6A 4P4RA 1SJEB 3RWJB 5A43C 7TAAA 4CGUB 3T45A 2VAJA 4UILH 1SYSB 4KGJA 1EZUA 3ASWA 1G7LA 4GMTH 4Y5YA 4J7RA 4AUYA 1JAEA 4FKEA 3QXUA 1LLAA 2EINB 3L4CA 2M26A 4IBVA 1P6WA 2E7DA 5EORH 4MXVF 2OMVA 1G7IB 1D9KC 1AHWB 2A9NH 2FD6L 4KKAD 5TD4A 2WLMA 1UCBH 3DROA 4LRNL 3EJZD 2G9KA 1C12B 1NSNH 2IADB 2GCYA 4WGVB 1M6UA 5AALA 1B0GB 4NZDA 1G7MA 2RTTA 3ROLB 4WUKL 1QASA 3AB0C 4N90D 3WJMA 2L7QA 4FEMA 4FHKA 3DDFA 2LLNA 5T1DH 3NRPA 3BKYH 4D9QD 4Y9GA 2IMNA 3PWJB 2VLJB 4XRCA 1DEDA 4LF3A 4Y2DC 1RCYA 4MS8C 3KR3H 2EH7H 4HUWB 3ULSA 5KYWA 3MRPA 4ILDA 5DF0A 3QUYD 3HNVL 3QJFB 3KHOA 1Q38A 3MLTB 3UDWA 3VRJA 4TNEA 4B9FA 1AY1L 4GSQA 1RUPH 3UBXB 1R3JA 3S2AA 4V1DB 1AZCA 2CK0H 1YPZE 2NY2B 3FW6A 1N59A 3DTUB 4J3UA 1DQVA 1F90H 1KTBA 3KCWA 1HHIB 4I9XA 2Y5EA 4NO5A 3KXFD 5LG6A 2ADFH 3BOVA 1QEWA 3JZ7A 3RVWD 1W9XA 1Y0LB 4LVHB 4X9YA 3CFEA 4KHXH 1IKNC 5JIHA 1SFHA 1HAUA 3MKGA 1FFQA 3ZT6A 2H1PL 2EUZA 4R0LA 5E7BA 4ENED 4DERA 4WWKD 4G8GB 3REWB 5EIIB 4LPCA 2GHWB 1AO7E 1MCDA 1FC1A 4JPKL 4HJGA 3CDZA 4HK3N 4MJID 5L4IA 3ZKNC 4MRCA 4O51B 1J9SA 1FH2A 3IMVA 2UZIH 4POZD 3FRUB 1RK0A 4PM1A 3HI1B 1QSFA 3WKMH 5L9DL 3GT6A 2O93L 4B9JA 4NENA 1KJ2A 3ARBD 5EWIL 4E5XG 4F7EB 5K9KA 2YGQA 1L9NA 4Z7UE 3AVEA 1RMFL 1F3DH 2WHVA 2O6FA 3MOBL 5JW5A 3NFPB 1IQDB 5I23A 1OSYA 1IBBA 1S9WB 2D7TH 2XTLA 3RUGB 5IG7B 4WIQA 1WVZA 4UM9B 2Z91A 5EO1A 1E8XA 4OI8A 1A6TB 1XIWD 2UUDH 2G9HB 4UQ3B 3U4BH 2DWXA 2FIKB 1CFSA 3P73A 1IKFL 3ESVF 4HAFA 4HA1A 4G8IA 3LPPA 4PRPE 4BKSC 1GCFA 4XTLA 4G6KH 5IESH 3QDMB 4LOFA 4W9DC 2V7HA 1OZUA 3AAZA 1NCWH 3DMMD 5FHBH 1JNLL 1VEOA 3PG2A 1YNTB 2XN9E 3MVSA 1Y6NR 1RSFA 4KJPC 5C0RH 3QXDA 5KVGH 5I1DA 3RY6A 1DHKA 3OL2A 5MI0B 5D7IE 3QCVH 1UT1A 5ANMB 3AG1B 1NEUA 2FBJL 5AOIA 3CHPA 3QEHB 5FGSA 4FG4A 5KBNC 1OE1A 4ALAH 4G1MA 3MA9H 3I84A 4ORGA 2R1YB 4PJ8B 5DQ9A 3SOTA 2ZWNA 2Y3NA 4R7DA 1OGAD 4JGUA 2RIKA 4XVTL 3VXOA 5IHBA 1TQCB 3ISWA 3FSOA 2QPSA 1I1FB 1K4CA 2XXCB 4JRYA 2NQ3A 4R8WH 5TGBA 3O4LA 1FSKC 1IAKB 2W80C 3W0WB 5IVXA 4KDTA 4G82A 3MUJA 4UQAA 3ARZA 2Q2EB 3QP3A 4L29B 1Z9SA 5MEQB 5I1AA 2A3TA 4KXZH 1LE9B 4Z3JA 2OSLB 4QAMB 4O02L 4ZTPL 4JDTL 2DYSB 1BQ5A 2GITA 2IQAB 2JAGA 3LN5B 2XYCA 2GJJA 3HHRB 3QUZD 4EOWL 5E8EA 1T0NB 1NUDA 4BELD 4BSVA 2X0UA 4XHJC 3BUYB 2WXFA 1X9LA 5C0BE 5AW2B 3TYFA 3G5VA 1RZKL 2XBZA 4OGAD 3RWDA 5DR5H 4PJHA 3MZGB 4IS6A 4NZ8A 3S2CA 5HHQA 2OTWB 2J43A 3HE6C 1KPVA 3BUPA 1S7WB 4TQHA 1HX0A 4XOEA 3AQYA 1VERA 3ZE2E 1C08A 1HU8A 4WFEE 3ZO0A 3ZSTA 1YA5A 2X70B 5JXEC 4ICWA 3LNDA 5ILTH 1E9PB 4FZEH 3ULAB 3GUTB 4BZ1L 3DVIA 5AVRB 4KZDH 1LK2B 1IGYB 2W0FB 3V4VL 3MRFA 4PB9L 1SLXA 1RUKH 2YDVA 5E6UB 4HS6B 3WY1A 4OD2A 5HHXH 2Z31B 5I1JH 5JPMA 3D05A 2VGLM 2ZYIA 2FWOA 4ZAKD 5LBGA 1NC4B 3TWCL 4LU5L 4PR5A 4TVPL 1JGUL 5AWZA 1GJIA 2VTFA 1ZLWK 3QEUB 3U0TB 3BKML 4ODBD 2KLTA 1S7TA 4GAGH 3NJMA 2N0KA 4Z7AA 5DTFB 1JGJA 3U1QA 4N6HA 5F3BA 4DPBX 2R29H 2XDHA 5EEZA 4AYBA 5KS9F 1LMKA 1DLHA 4NKOB 1NUNB 4BFOA 3VRIB 3QBIA 2BK8A 3KXFA 4Y4FD 3L3DB 1HCZA 1OAUH 2OZ4L 3ARTA 4YQXH 5CBEB 3HG2A 1KYAA 5DWUL 5MEND 2OJ1A 3QHTC 4J8RB 5JLZA 5IBUG 3X3GL 5CSZA 3IJYA 4G43B 4TLKA 2EO1A 4CC4C 5BRZD 2CO4A 4FLQA 4OZ4A 4YN3A 2XWEA 4WWKA 1XMEB 1CE1L 1Z7JA 3KYMA 5A16A 4MJIA 4LPWA 4AX3A 1OD9A 4NWTL 1CGWA 4K5YA 3N6YA 5TDNA 2IALA 1VRSA 2VQ1B 4YEEA 4A2LA 2AXGB 3ARBA 2BPBA 1B88A 5DJ8A 4OM0L 4MFHA 1MFMA 2W8CA 2BP8A 5LGHH 1D6VL 2FQGA 3RWIA 4FOMA 2FYYA 4PJCB 3VWJB 5C8JB 3A21A 5D7SL 4TS6A 5C70A 1E9OA 3CSYA 4FI8A 3ZQWA 1HT6A 1RJYA 2GI0A 3HVDA 3I6LD 4LNVA 1MJJB 4HOMA 3IAGC 4FLOA 5M7QA 1XIWA 1DBAL 5ECGA 3R1GH 5BW7A 1X44A 4M5ZL 3I75B 3SYOA 2A4EA 2HLFC 5F1SA 1CL7I 3DOSB 5AVZB 3V5KB 5M94B 3KPMA 5AD0B 4LLMA 3PWNB 3O6FD 3VG0H 2YCZA 1BQHG 2VM9A 3SYQA 1SBBA 4JKWA 3DMMA 1R6VA 4GRMA 1MCEA 5HI4C 3ROOB 2VUYA 1JZ6A 4DAJA 1ZEAH 3MR9B 1TTGA 1VZIA 4OZHF 4C4KT 5HDWA 4WFFE 1RZIA 5L8KB 1WEJH 3G6AB 3O2WL 2VWEE 1YEDB 3P0GA 2Y02A 1SPDA 4FE9A 4WO4B 5FYKD 4J3BA 2CAKA 1KIRB 3EH2A 3MBWB 2E9IA 3OX8A 4Y5VA 4A63A 4DKEL 1OHZA 1FE8L 3LKNB 1N0XL 1MFAH 2OMNA 1WS7A 4KI5C 3OKLA 4N2OA 1UYWH 4IK6A 2Z0UA 2WBKA 3RA7L 1XBRA 1NLDH 3ZLQC 1FA4A 4XN9A 3EFFA 4YHNA 5EH1A 1OGAA 2R29A 4GS7B 5SX5H 4M7ZC 5B8CB 3GI8L 3L13A 5CGYD 5F3HB 4XP5L 3HAQA 2BVTA 1WH0A 3QDGE 3MROB 1PU0A 4RGOL 2O72A 5ES4B 4OLEA 3REVA 5I76A 4UT9H 3HA0A 3FO9B 2Q86A 4MLIA 4JFEE 5KSAB 3ECVA 2BSSA 1CQKA 2FB4H 5MEOB 3RWEA 4UQCA 4LESA 1DP0A 5F2FA 4KOCA 2VDQL 4MAUL 4QIRA 3TBSB 4QI1A 3QUZA 1U95A 4Y9FA 4LASH 4JPVH 1LDPH 2CHNA 3VWKB 1S7QB 3AXLA 1N7MH 1HCVA 4AIEA 1D7CA 1UURA 1YY8A 1H3TA 5GGSB 3GSVB 1S8DA 2AEQH 3WXVL 1QFHA 3FUIA 4Z7OB 1GZMA 1B0WA 3PGCB 5GSRA 4D7PA 1BEXA 3T1FB 4OM1L 3ERXA 1G9MC 3D7PA 1MCNA 3IMBA 2EDEA 1NGQL 2CA4A 3JTSA 1PZBA 5B4MD 3WLBB 1CK0H 2ZP8A 1A1OA 2BIQA 2FX7H 1HHJB 2IH1A 1GPOH 3CN4A 1J0YA 4APXB 1EAJA 5IHWA 1I82A 1F3JA 1BOGA 2EIEA 4RFEB 3VXNA 2IOOA 3IAPA 2DYRB 5E99H 4AENA 3LRHA 3LNEA 1R33A 4IBQA 5FYKH 5I30H 5LLIC 1KCUH 4NQTA 3Q2CA 3V79C 3FT0A 2O5YH 4P5KB 1VB9A 3SD2A 4ZAKA 5L7XL 3MODL 1H15A 3HTLX 1XGRB 5TE6L 3FH8A 2EVFA 4PJ5D 1PYWA 4Z78B 1QR1A 2VLJE 2COVD 3QB7C 1J8SA 2UZYB 5E2TH 3DV6A 5ACZB 4G42B 3AYMA 5F1KC 2WTPA 3V4UL 5EUKB 3NUKA 1WP6A 3PDOB 3R7QA 5C0EA 1N5YH 4N9GA 2DQTH 4AE1A 1AACA 1C7TA 4DKLA 2VN7A 3ARFD 4V1DE 1ORQB 3H9SD 4S1SL 4Y4FA 1MJUL 3SCMC 1I7TA 4MMZC 1F11A 5H2BB 3TO2A 2AJ3B 2WBXA 3BGFB 1TTBA 3MXWL 2EIZA 3KG5A 4UTBL 4WGKA 5JUEH 5MENA 3VGAB 4AKPA 1GL4B 2Y69B 1S78D 5BRZA 5EZPA 5IMMA 2O5XL 3PWHA 1EJ8A 2CKNA 4GO8A 4NB7A 4XMZA 2K45A 4LP5A 2W9DL 4FPDA 1HEZA 2P44B 3E6HA 2VLKB 3IDYB 3CVCA 3JTTA 1NIBA 4UT9A 4UCFA 4G8GE 1L5GA 4DAGH 1TG8A 4Z3FA 1CDGA 3U1SH 2VXVH 5GZNC 5B21A 1KY7A 5IWLA 1KCVL 4WW1B 3L5WB 1Q1PA 1BG9A 3OZLA 1MCWM 2CR0A 4KQ4H 3T2NH 4D0DA 3VSQA 1CXFA 1RK1A 2VLLA 3A67L 3ESMA 1RJLA 2ENQA 3ES6B 4X6BA 3LNGA 1W6LA 1G1YA 1WS8A 2FATH 3TVMD 1O0VA 2DQUL 2FWUA 5CP7B 1T0OA 3K2KA 4N22A 4JZNB 5CO1A 2OMBA 2YO3A 3FF7A 1F4AA 3EH5B 4E9TA 5HHMD 4XMLH 3RUGE 2NLJB 3RWFA 1EXUB 2XCMC 1M05B 3GMNA 4LLUA 3VJ6A 4KJWC 4OKVB 2FSEA 1G7JB 4P2AA 4UM8B 3O6FA 3NP4A 3VXQA 4DVBB 5I1EL 4L4VB 4WTZG 4CKVX 4OH2A 4NRZB 4YGAB 1UASA 2IIJA 3QDME 3FDWA 3MQIA 4M7KH 3WFHA 4LHQB 1OAKH 1DBJH 3AMLA 2QR0B 4HQQL 4F58H 3RVVD 3UZEA 1Q72L 3T8VA 7FABH 4PP1C 4TUKL 3BYTA 4LCYB 2GJ6E 1H6EA 1HL4A 2GJZB 5B39A 4AMIA 1WFJA 4QHNA 3AACA 1JRHH 4ES9A 4P9HL 5IHLB 2O6CA 3FB6A 4ANXA 3GHBL 2X4RA 2WUCL 2AJVL 1SBSL 3M17A 3GSNL 2W07A 1HINH 3QARA 3TN0C 3LKOA 4ODTH 4MNGB 1KTLB 4GPVA 2P45B 3ATEA 3LMJH 4WW2A 4F8PA 3C60D 2OCFD 1T7XA 3QRLA 1LE5B 4OBRA 4Y16B 2DQ6A 5TFSH 3EYUL 5HYFA 1XGZA 1WCBA 1FH5L 5KBLA 4AKQA 3PBLA 4S1QL 5EZOL 1QPKA 5E0QA 3ATDA 3QQDB 3TLRA 1J8KA 1ZV5A 4KKPA 3W0WE 2P47B 5EN2A 3BIKA 4GEJA 3V0EA 4AXWB 4F80A 2ICWI 2YBRA 4Z7QF 1E65A 5AQ0A 3M45A 3V2YA 1IU1A 1NC2D 3ZL1A 1DUZB 3ZDXB 2FR4A 3TH2T 5FJGA 4UV7H 5AOKA 1U4EA 2A9AA 2F0CA 1V05A 3FCUB 3INUH 3ZE0B 4M3KB 5IIEA 2A74C 2AFNA 3D0AA 1HE8A 5ALCL 5I9QC 3MOQA 2CHWA 4LK4A 1SDAB 4L5FE 2PTTB 2WQSA 1DE4B 1M56B 2XZAL 4MNHA 4JM0A 1P4BH 4ETQB 4BJLA 1KGBA 1SMAA 3L3OB 1E4HA 2ENPA 4RMSA 5E2UH 3MLSL 3KLKA 4OTXL 1DQDH 3T65A 3O3EA 2WC7A 2ATAA 5AL8A 2F93A 4BWBA 2B4CH 1E5ZA 4AUJA 5GQBA 2AJZB 2A1WL 2H7WA 5DHXB 1ONQB 2LFEA 2P5EB 1MDTA 2YPKB 1FNFA 5DWPA 3UTWA 2Y5QA 4APQB 1ACCA 1LL1A 2Q8BH 4U7MA 2GJRA 4D94A 5I6KA 2YKKA 3X17A 4M8VA 2D9CA 3LIUA 1OARL 4DH2A 4HPHA 4PJ5A 5GSVA 4YXHL 3FQRB 1BD2B 3TNNA 1QKOA 1FQ9C 3B34A 1LO5A 4OFDA 1VFAA 2Y2TA 1PTZA 4HS8L 1HILB 4NDMA 5AZDA 4OD3H 3ZPDA 3APCA 1E4KA 4QHUB 2VRKA 4K3DH 1CC3A 2I25N 5I71B 4PY8I 3BWAB 3F12A 1O6SA 3T0XA 3TF7C 3ARFA 4LKXB 2OMYB 1MNNA 3H9SA 4PGEA 4L2LA 1PNDA 1J12A 2XWDA 3ZPRA 1FO0B 3EH3B 2VR3A 4U0RB 1TZGH 3S7GA 1TUPA 4RLDA 1S2EA 4XN1A 4V2BA 1CFTA 4X7EC 4XI5C 3WGUB 4B3EA 2NXYC 3D39D 3RTQB 2NY0B 2JELL 1TETL 2CCWA 2R1WB 5HGAB 3S34L 5IJBC 4OLZH 2KZKA 3V5DB 4YE0A 3RVXD 1G1OA 1U8PA 4F9PA 1UM4L 5J1AB 3CPUA 4FFVC 4ZUUA 4UUJA 4IK7A 5GGUA 4UMGA 1YQVH 1FUNA 2LABA 4CADA 4YLCA 5CBAB 4DP5X 1E7UA 3B2PA 3MJ9L 1U91B 1BVKA 3CFMA 1KEGH 2JIXB 2QKIB 1KIPA 5E1AA 2CDFB 1A6AB 1PY4A 4G59C 3PWPD 3QK0A 4XBPB 5IBTH 1AD0A 1CYGA 4M4RA 2WLYA 4PSPA 2HJKA 5CCJA 3ZE1F 3B7RL 1Z3GH 3TVMA 3MI6A 4E9YA 4UV4L 4NO3B 4PJCE 4NT6A 4PRID 1L0MA 4D9RE 4ZX4A 5JQ6L 2IBGA 1AR2A 3L4UA 4OJEH 4HUUB 2ZOKA 4LXFA 2WOBA 5IMOB 1U8LA 1NDMB 4KC3B 3HPJA 4IRSD 1MWOA 1OT1A 1XZ0B 3E2HB 3F7RA 3K2UL 4HPOH 1XCQB 2EYSB 2V9TA 3JUZA 2PF6A 2HVKB 4P3DB 3ABMB 1YJDH 2AW2A 5AYTA 1JPSH 4YSCA 3ECQA 4K71C 5DI8B 1W72B 4GY4A 1IM9D 4X80L 5T3XD 2X40A 1G0DA 4J6RL 4AQ1A 4PJAF 4U1HB 3HKFA 3IS1X 1LP9F 2WO3B 3C08H 4DFIA 3AWEA 4MQXC 2FJGB 3L48A 3R0NA 1IC5H 4XMVA 4LLYB 3IDIA 1F5WA 4F33A 2COQA 4ZXBA 3V0WH 4JGJA 4MMXC 2DM4A 2J55A 3C60A 1OM9A 2PP9A 3JWNG 3T0ED 1OK0A 3UYPB 2WJ7A 1K2DA 5J7AA 4PMEA 4GG6B 3SDXB 1P53A 1MFDL 4PJBF 1F8TH 4FQIL 1JYXA 1OF2B 1CICB 3D25A 4AI7A 1KYUA 1AE6H 4X1HA 4NBZB 1WPCA 1NC2A 4JN1L 5J0BA 3G5XA 4QRBA 2P8LB 2YPVL 1AOHA 1OAQL 4NKMB 1AGBB 4ODUA 3M1BB 4XPTH 3KBHE 2Y7NA 4XPAH 3OLGA 5CR8A 4EKJA 5K5YA 4WJKB 1H5BA 1P1VA 3POHA 5CEZL 3LDBB 2KMWA 3CFCL 1C5DB 2EE2A 2HFGH 1P9MA 1I1AC 5F0LB 3BH8A 5F7MC 4D2NA 1R5IA 4N1EA 4YDIH 4FKHA 4Z7OE 1FZOB 2FT8A 2FGWL 2D8KA 4JL2A 3NBNA 4BK5A 2J2ZB 3EZJB 3TJPA 3N1PC 1H19A 1XSIA 3CSBA 3MTXA 3FQNB 2IANB 4GAFB 5CJQH 5E6ID 3WKNA 1QTSA 1QHPA 1TJHH 3QAZC 1E5CA 4XMWA 4NI6A 3PP4H 2VSKB 3AZUA 1MN4A 1N4XH 1QNZL 1JV7A 3IETA 3KYAA 2EAEA 2EO7A 3EJPA 3S35X 3GXDA 4OQTL 5AKTA 1I9RH 1JXFA 4OLXH 2ZOLA 5T3XH 4E41B 3EGSA 4HH9A 4N0YH 1ETZA 5E51A 3LXCA 4WZ9A 3HLKA 1I7UB 1I3GL 2JE8A 3H9ZA 3WFBL 1BYOA 3MLPA 3NJKA 2WINB 2A83A 2DW5A 4Y4HC 3WIIL 3IU4H 4X7TA 4HWZB 1JK9B 2V5YA 4XOAA 1T21A 4KJYA 2Z1PA 3CBRA 1SRDA 3QJRB 4P04A 2YD7A 1PY0A 3B1UA 3H6JA 1I7RA 3CZFB 4KK8D 1XBDA 5D2LE 1AR1B 1T83C 3O3AA 1LNUB 3P11L 4KVNL 5ENWB 3DUHA 5HGDA 2A9CA 2DI8A 1BEYL 2NY6C 1QKZH 4B27A 3ARDD 1I4FA 3FOLA 3L3HB 3RX7A 3OXSB 3D39A 1O7DC 4AYDC 2J72A 5FYJE 2OXHB 4CJ0A 4IOIB 3NGBB 5FV2A 5F70A 4Z76A 4RIRB 2DKSA 5ICZB 4L8SC 1ZHBA 5EEYA 3RWCA 5BV7B 1X0K1 2A6KB 4AG4H 1LWHA 1ZPLA 3KGSA 3NPSC 3OD3A 2E7CA 2QVTA 4GXVL 2VLKE 4R4ND 3TTSA 1P5UC 1EMTL 4MD1A 1BXVA 1QEXA 3PWPA 3HRZC 4AYFB 1QA9B 4JZOB 1WSST 2R4SL 4EF3A 3CZGA 1MKFA 3S36H 1UA6H 4ZPVB 4BEZA 7PAZA 1DVFD 3GHEH 4UZUA 4PRIA 1DO6A 2YLHA 1KMGA 4R96B 3FT9A 3DO7A 4RDQF 2XWRA 3FTYA 1QWUA 4IHOB 4CJ1A 1OF0A 1ZSDB 1K4DB 4LCWE 1NBVL 2J1KA 3R4DA 4UT6L 3AWFA 2DQHL 3UJTL 4AEIL 1UWGL 4IRSA 3IU3A 1UQSB 4GSDL 1AANA 3S96B 3WE6A 1G7HA 5DJ6B 3N1GC 4IBTA 3EGDA 3WHE0 3WV0A 3K6FA 1DTUA 1BZQK 4Z77B 1G6RH 2E8ZA 4KO6A 2QQKH 2N7AA 1KDJA 4P46B 4V2CB 5IFAH 3VTMA 1IBYA 3D0LA 4TSAH 5K93A 5JPNA 1E30A 2BVOB 1IM9A 1BXAA 2CLZB 1TCMA 3U7YH 3M8OL 4Y9CA 1ZLVK 3V0JA 4IOFD 4RSYA 2EYTA 3DVNA 3MLZL 2P80D 2WYTA 5J57B 5EU4B 1FFNA 3RJDA 5DMIH 2H0JA 1CFQA 1CLZL 1ROCA 1J0ZA 1J48A 3BSHA 1CMOA 3F2LA 4HEPG 1FORL 1MFEH 4TSBL 1N10A 1X7QB 4LVNB 4MNGE 3T0BA 1MJ8L 1NWOA 1M7IA 2F74B 3QH3B 3FTXA 3T0EA 1HOCA 3A7KA 3ZDYF 5I73B 1ZDQA 3BAEL 2J8UA 3V4PB 4MA3A 3QEGH 4P2QD 4TTDC 3ZSSA 4P5TC 1IXFA 4JVPA 1UH4A 3C5ZD 2TRHA 4JKKA 5E1GA 4F8NA 4MJHA 3EADA 1LEGA 4ADGA 2BRDA 1G7PB 3QZLA 4MZRA 5DJXB 3O3BA 2W0PA 2FQFA 2HVJB 2IAMD 1PZ5A 4AGMA 3ZDXE 3U30C 1SJXA 4HLZG 2WIIA 5AKRA 1GGUA 1RZKC 4IYKA 3MLUL 5E94B 3ZE0E 2APBA 3HB3D 3MOBH 3PS6A 2ZWZA 1UM5H 4D8PA 1NIAA 2MSPA 1MAJA 1PF3A 1PNCA 1I85C 3HAPA 4RFOL 5DD6A 4OJFH 1FL6A 3WN5B 4F8OA 4JM2F 2NNAA 1CI5A 1BRDA 1BMGA 1EJFA 4X6FA 4YDLC 1BJ1J 3UO1H 4GO6B 5IQMA 3ZTNH 3SKJH 4UDTB 5SV4A 3GIZH 4G7YL 4N8CL 1HHHA 5E6IA 1AGEA 4IRZL 3WIHL 3U0WH 3P4NB 1DZBA 3HNTL 3IE9A 2R69H 1JNLH 1T5XB 2Y25A 4O9HL 2P5EE 3EJYD 1J10A 4Z95L 3UTSD 2PCFB 3VH8B 1ZTXE 4PJ6A 3CMOH 4HF5H 1QBLH 2XQBH 3OPUA 4K8RL 1G6RA 1NDTA 2WK2A 2G3ZA 3EJJX 1TQWA 4XP4L 4FP8H 4GQZA 2EUVA 1Q0XL 3EJQA 3MLRH 3ZZQA 1BD2E 2W91A 4M7LH 5CZXC 2YD9A 2OP4H 3KLHC 3NFNA 3TH3T 4F1SA 1EBPA 5TE4L 5IQ7H 4UIKH 1T1WA 5J3HC 3QIBB 1B2WL 3L3JA 5JZ7D 3S3CB 3CFBB 5KOVC 5TH2B 5DO8A 1KIQA 3II1A 5JYMA 3WTVA 1L4IA 1SEQL 3GS0A 3Q6GL 3V52L 1VFUA 1BM3L 4XT1A 2EEAA 4OLWH 2AJSH 2CR6A 3BUQA 4AEEA 5HHPA 1RPUA 2AZAA 3ARDA 5IB1A 2VLMD 3MJ8A 3OE6A 3QIWC 4IRJB 1YNKL 1YY9C 5JXAL 1AKJB 1FL5B 1XTMA 5B34A 5HYQB 3QG7H 4GSUA 2QHRL 4JDTH 1GZQB 3LH2L 4PJDA 3RWGA 2GBUA 1P84K 4OUUA 3HC0A 1WCQA 4MVBC 2PMZA 3VD5A 4OLVH 1A3LH 4AV4A 1K8IB 3N1QC 4A7VA 5DHVH 2DRUA 4LFHG 3A5VA 1DO5A 3EYFA 4FMVA 2G87A 2DD8L 1NMAL 2MHAA 2MPVA 1A1MA 2V5MA 3MX0B 3OVUB 4EBQH 1DVFA 3FH5A 2NY1D 5MEPA 2VDMB 2YAFA 2QHLA 1FNGB 2KDYA 1G4RA 2XV3A 4OCYH 1LEIA 1L6XA 2H6PB 3SN6N 4PG9B 3TJHC 4BZ1H 4NKIL 1YEIL 4HCFA 3B7UX 5IZ7A 1FBKA 5I2IA 5KTEL 5H2PA 1Y1UA 3N55A 3O6LL 4L48A 4EXPX 5GS3A 2E7LA 1A0QL 3WFEL 4JFXB 2N01B 1X9QA 2R69A 4DP4X 5C0GA 4H26A 1JGUH 1UKQA 5CSBA 3NA9L 2YCXA 1LO3H 3GQFA 4YDVA 5KSUB 3MV7B 3AM8A 3WLWD 3UP6A 1YG9A 4AQAA 4F5CE 2P80A 2XVGA 4OZIA 5G2AA 1K6QH 4AQ8A 3L95B 1CURA 4AEFA 3BPOB 4WU7B 5F9AC 2EDBA 5I0ZA 1QD0A 2AJUL 1RUAH 1SF5A 2P28B 4FJZA 3MMEA 3TP4A 3VD4A 3HPLA 4JFDB 1OTUD 2WW8A 1MRCH 4IJTA 5D55A 2G5BA 1M6OA 5IFJA 4OCRL 1OALA 4BHUI 3IKCB 3NJJA 4EN3B 2AQTA 1KN4L 2DYPA 3X3GH 1GS8A 2ZCHL 1A4CA 4YHML 4X5WA 2XPYA 4P2QA 3LN4A 3QORD 2XC8A 5K9JH 3C5ZA 2CXKA 4GG6E 1EAPB 4G6AD 2XZCH 5GZOC 3LB6D 4WWID 3CPLB 2B5IC 1MPAH 4MDIA 5L2JB 4QIDA 4K3JL 2DMBA 3Q7JA 5F71A 1XR8A 2IAMA 3KLSA 3X3CA 1ZT4B 3BDYL 3QFGA 2R2HB 2O4EA 3NJXA 5EB9A 5I6PA 5JYLA 3OPZH 4ZMLA 3MYZA 1OEZW 4P49A 4YLQT 3BPLB 3BW9B 4ZT1A 4M6MH 1M3IA 5DHVA 3BAYA 4MMYA 5CCKL 2OX5A 4F2MA 1JXGA 2A77L 4I5BB 4EI5B 3VVKA 4QTHA 3WDHA 3OB0K 1KYOK 1JV2B 2IFFH 2ZXCA 2RCSH 3G5ZA 3K6IA 5FYJL 4ZDHB 2ZJSL 1JPFA 5DQDL 1BXXA 4YX2H 1QPPA 1CCZA 1OZTG 1QOKA 2OR9L 3FQTB 5DUMH 3UC0L 3W9EB 1BIIB 2EC8A 1NGZB 5EDSA 2GC4C 3QXVA 1AO7D 1MHCA 2VDLB 4BZ1A 2IANE 3NACH 4DGVL 1ZY9A 5DEZA 4Y2LA 4GI6A 4FFWD 4XNUH 3UTSA 1C8SA 3WUWG 1RZGA 3MRKB 5KS9B 1PX4A 4GBXB 2XT1B 4DKEH 1DBKL 2Y01A 1X5LA 5H94B 1ND0A 4E41E 3CG8A 3HMWL 2WO4A 4IU3B 5EZLB 4D0CA 5T3ZE 1JWSB 4ZFQA 3H3BC 1A3RH 2OSXA 4KV5F 2A0LC 4JY4A 3PL6D 1QFPA 2GHZA 2FRGP 3QZMA 4HWEL 3F84A 4RSVA 5IW1A 1KIUA 3WN6A 4U49A 4JHWL 1A66A 2DQJL 3QFDA 5HDQH 3BH4A 1S9XA 4XPHH 3JT0A 5B7EA 5E1HB 3GF8A 4HX1A 3BP4B 3NTCH 4PRPD 1B9KA 1UEMA 3QDJD 2OL3H 4AT6B 3C6LD 5DO2C 5ITCA 3VUAA 4BFIB 4HG4J 1XZWA 4BH8B 4K23H 4I89A 4TOYL 3UZCA 2HFEA 1NPJA 4HK0B 4KTEL 1NLBH 2H8PA 1F86A 4PJ9D 2DTML 1EEZA 5CMAB 4GFXA 5KYYB 2NR6C 4KITB 4MXQD 4U6TA 3OJMB 2H2PD 3RFMA 1NAKL 5IV2B 3B9KD 5BJTB 3OXRB 3O8XB 4FAAB 4UQIM 2OI9B 4F8TA 2ORBL 5FM5M 3I9GL 2GTZA 3UPRB 1UHVA 4U3SA 5E1IA 2VQTA 1OP5K 2IC2A 3EHBB 3J7HA 5ID0A 2X87A 5MERB 2TAAA 3EDDA 1BGXH 1BVLA 3MXVL 4TNWF 4LCIH 5K39B 3Q0HA 3GRWH 4QRSB 1MQ8A 1ZA6B 2QDWA 4HJIA 5T1KD 3OG4B 4OZHB 3L1EA 1ANUA 1U8HB 3CN0A 5I15H 1D5ZA 4YSTA 2WAHA 3I3EA 4DZBA 5GISL 1IBHA 5IQ9B 4EQ3A 1HFUA 3FTVA 2WN3A 5DRNA 1O9ZA 3QSKB 2MOQA 2DQGH 3AUVA 3TIDA 4N26A 1QW8A 4FCAA 3UG5A 4ZSOE 3MODH 1INDH 1ZS2A 1AXSA 4YE4L 5CEXA 2AEOA 2H3NB 4OB5L 1VPOH 5ID1A 4HDIA 4WCYL 4JY5H 2R9HD 3FXIC 5KJRH 4P9HC 3ILPA 3UZQB 2HLAA 5DRZB 3TZVB 1U6AH 3W3BA 3UIZA 4AW4A 2JKSA 2ZUSA 4X5XB 2KSYA 2YJLA 2VABA 3IFLL 3MCLH 4PTTA 5IJDC 5FX3A 2DKMA 3V7AG 5KYXB 1ACZA 2GTWA 1T3FA 4WFED 3O6MH 2VLRE 5AVWB 4ZYKB 3OSVA 2P8MA 4NJAL 1UJTA 4OZFB 4G8FA 3SDDC 3HHSA 1FNEA 5EC2B 3N06B 5JW4M 2WZ6A 5F97E 4HEME 3DTXA 2OL3A 3US1A 4U6XA 1X4YA 1ZWIA 4H8WH 1KCKA 4ONHB 2ATKB 3PGFL 3QORA 1UWEL 1UZ6F 2KERA 2OYMA 3DV4B 1P4LA 2JQZA 4W70A 3H0TA 1NBZA 3D69A 5E2VL 5TQ0H 3UONA 1VSCA 2BNUB 3ZIYA 3SEPA 4NM8L 5A8EA 1OAZL 5I6NA 5DZNA 1AZNA 1M3JA 2W60A 2A4CA 3D4CA 4F57H 5I0XA 1DR9A 3II3A 1T1YB 3SE4C 1YPZA 4J5VA 3DX9A 4MXVE 3RDTB 4JPWH 4RCAA 2DQUH 3PGDB 3SE8H 1AZZC 1NFDF 5DC4B 4L4TB 2XTJB 3CDGB 5K9QI 5KW9H 4QCIB 3S0PA 4F3FB 5K9OB 4NNYB 2C1PA 3S5YA 3GRWA 4U1MA 1QATA 5AW0B 1XF3A 3S8WA 3SYAA 2E27H 3ALXA 1FNSH 3GMMB 3GSWB 5KUKA 4P3CH 4L8DA 2GK0A 2QQLH 3L45A 2DQDH 3KPPA 3SQBB 1PG7H 1AO7A 1FZJB 1ZANL 3I2CH 3CVHH 2LR4A 3GIVA 4NUJA 3T6WA 3G9VA 2RH0A 3HN8A 1ZE3C 1DQML 1MCQA 4TUKH 3BPCB 5E08L 1O6TA 4JFYB 3QHFH 3SB3A 4Z7UA 4R4FH 3B7SA 4JDVB 1SZNA 1F88A 3QCUH 3PL6A 5KVEL 3GKWH 3QUXB 1J5IA 1H8OA 3MBEA 1VEPA 1VKXB 3SY0B 2J5LB 3GYRA 2WKOA 1ECYA 3P77A 4ZX6A 3HR5B 4PRPA 1RL1A 3DPBB 3QO0B 1TR7A 3ATFA 1GC1L 3V4LA 1XGTB 1S9YA 4NERA 4TXVB 2VITA 3EYUH 2YZ1A 1BG1A 1JF1A 1X5FA 1YN7A 4B9ZA 1I9JL 2FZ3A 2JJSC 4HS3A 1BVZA 2P5PA 1CFBA 4PJ9A 1RIHH 3HS0C 4WFFD 3DURA 1JFHA 3FFOA 4FQXC 4ZQKB 1I8MB 3D06A 3NZ8A 2A73B 4BSJA 5IM7A 3OAUL 3B9KA 1CF1A 5E2WH 4YR6A 5F7BA 1DN0A 2NNFA 4WK2B 2QFRA 1JZDC 1ZLWH 2I35A 2QMJA 2ZYRA 2IGFL 4M6NL 4HISA 4MYWB 3HZYB 5G5DB 2XBDA 4WI5A 2VDPL 5EUOA 1T7VA 1KEMH 2CMRL 2XZAH 4KMTH 4H5SB 3KGRA 4JFHE 5EU5B 3HE7D 1WUZA 2DJ4A 1CZ8L 3SKOB 1FIEA 2ZT9C 4HCGA 3TBWA 3SJVE 4LSVH 5T1KA 4Q6KA 3MV11 4BM7A 1MGYA 3SGEH 5KEZA 3D18A 3NN8A 3QDGD 4L8BA 3O6KL 4X9FA 2B1HH 3PP3K 2NY4D 3BLPX 4GFTB 1BQSA 5GS0D 4YIQB 2AGJH 1YYCA 2Q7NA 5LGJA 1YEWA 3CN3A 2R4RH 4KZCA 4JY6A 1T1XA 2CUIA 2PW2A 3IXAB 2N7BA 2CJUL 5AB9A 5JNYB 1D5IH 3DJ9A 2Q87A 1THCA 3CVHA 4FXGB 4AGQA 4E36A 5IMKB 1DSYA 2HN7A 3FRPA 3P1VA 4XNXL 3HE6D 4HCIA 2HFFB 4UU9A 1FLRL 1HKLL 4ZFZA 5IB3B 5JW3H 5DJZB 3QUHA 3RX5A 3A0OA