3QJTB

The structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
166
structure length
166
Chain Sequence
b'DQHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structural changes that occur upon photolysis of the Fe(II)(a3)-CO complex in the cytochrome ba(3)-oxidase of Thermus thermophilus: A combined X-ray crystallographic and infrared spectral study demonstrates CO binding to Cu(B).
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 41
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3qjtB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qjtB02
2VT4A 1BXUA 4L35A 1KMEA 3NJNA 3PLYA 4WTQA 1CUOA 4X32A 1AP9A 2Y1AA 1DZEA 1Q5JA 3QBIA 1V54B 3SBRA 1GZMA 1JGJA 2YCXA 5AX1A 1BRDA 1E12A 1AZBA 2BP8B 1AG6A 4CSPA 5B1AB 2FQEA 2GB2A 4MD2A 2WJLA 3PBLA 1P8UA 3FSAA 1B3IA 3SBPA 4G7SB 1S51A 4BVNA 3HAQA 1AS8A 1FFTB 5B7FA 1L0MA 2JAFA 3NSBA 3AG4B 3D4SA 5D4IA 4E9QA 4NERA 3DDLA 2VW4A 3N2JA 1PZAA 3CVDA 1IUZA 3VW7A 4KO5A 3IN0A 3T6XA 2XUWA 4E9SA 1ADWA 2IWKA 2AANA 2Y02A 2KSBA 5PAZA 2CBPA 4XTNA 4JQ6A 4XT3A 2B08A 2P80D 1DYZA 1PMYA 1JZGA 1MZZA 4E9TA 1SNRA 2PCFA 2GSMB 4KNSA 4HIPA 4E9VA 4RH4A 4A2HA 3QJVB 4AMJA 2ZWNA 4MBSA 2DV6A 1VGOA 5TK2A 1WA0X 2LNLA 2EIJB 4HHGA 2HX7A 3EMLA 2OJ1A 2BHFA 3DKHA 1AZNA 3NT0A 3D12B 2ZZLA 3WKPA 1HZXA 1OE1A 4A67A 1F50A 4JHUA 1ASPA 1J9QA 3X3BA 1R1CA 3TU6A 3UACA 7PCYA 3KW8A 4BDVA 1ASQA 3PAUA 2PP9A 3UZCA 5ITCA 2R4RA 5H2PA 3MBVA 1JZFA 4N4YB 3H4FA 2BW4A 2FJSA 5I5JA 3UGEA 4XXJA 3CVBA 5B6ZA 2YQBA 3AG2B 1JZIA 2PPFA 4XTLA 1GUEA 4UHRA 4JKNA 1J9SA 2BO0A 4FBZA 1NDTA 1AIZA 4Y9HA 1QLEB 4EIYA 1HAUA 3CDZA 1NINA 1JXFA 3C75A 2L6XA 4GPOA 1E0PA 3QJRB 1ZPUA 1T5KA 3PAVA 1KBWA 1KCWA 5B6WA 3CODA 3JTBA 3GXUB 5H2KA 1PAZA 5H2IA 3H4HA 2P80A 4JKVA 3FU7A 1Q5IA 4A4MA 5FC9A 5IY5B 2HX9A 3PDSA 4F7KA 4K5YA 3ZPQA 4UANA 2PPAA 1M9WA 1ILUA 2FT7A 2HZHA 3OMNB 1GYCA 2CAKA 5DHGA 3DTUB 3P0GA 2KS9A 3QJUB 3EH5B 1TKWA 2HPYA 2NTUA 1J9TA 1NIFA 4GXFA 1XB6A 4UF7C 2HX8A 3PXLA 4M3HA 4BWWA 3NJHA 1VJMA 4G7QB 1PCSA 1RZQA 3CG8A 5B2NA 1CURA 3S3CB 1ZDQA 4FPDA 1F56A 2FQFA 1SDDA 4NB7A 2YAOA 1FWXA 3RYMA 5ETZA 5B1JC 1L9RA 3DQBA 2PP7A 3H56A 3NJFA 3NP3A 3ZX1A 1AZUA 5G36A 4BV0A 2J55A 1H2SA 4MQTA 5ITEA 1BYOA 4QLWA 1GS7A 2PPEA 3OE6A 2WSDA 4L0PB 1IBZA 1RZPA 2FQDA 2YARA 5AZDA 2J56A 3HB3B 1OOWA 3AW5A 3AY2A 4W1TA 1X9RA 2W88A 2R7EA 4QI1A 5I5MA 1GY1A 1JXDA 2IAAC 4CSZA 5B7MA 1CYXA 3FSVA 4DP5X 1QKOA 3ZBMA 5B3SB 2DYSB 3PAZA 3X1FA 2XVBA 5KKHA 3NSDA 4G7RB 1XIOA 4KLYA 1SF3A 3FYIB 2IDTA 1L9QA 3GDCA 1W6WA 1NIEA 4MQSA 3U25A 2GC7C 8PAZA 3MX0B 1NIBA 4NC3A 1A8ZA 3ZEVA 1X0I1 1CC3A 2HRHA 2XXGA 3ABGA 4QKTA 5LDUA 1S52A 1XMEB 4WAVA 5D4JA 1OCRB 1OE3A 1QHJA 2Y01A 3BQVA 5ANHA 3WNIA 2Q5BA 3TBBA 1BXVA 2PP8A 2IWEA 2Y00A 3FPYA 1NIDA 4A2GA 2JAGA 4BK5C 5H2MA 3NY8A 3RFMA 3TASA 3X2QB 1E5ZA 3HARA 1ET5A 4DP7X 2F93A 3CAPA 5J7AA 1GR7A 5H2OA 1TEFA 1XB3A 4N4WA 1ASOA 2CCWA 4HWLA 3CZUB 4Q89A 2AVFA 3NJMA 4K9JA 3C9LA 2IH8A 2I35A 2YAQA 3AZUA 1RCYA 2YDOA 1S54A 5AKRA 3V9CA 4DPBX 1AT9A 2FT6A 2FTAA 1BM1A 3VHZA 2BP0B 2NRDA 2Y03A 4QIDA 4KNFA 1EHKB 1PY6A 1FBKA 2GIMA 5B1JA 1ETJA 1NZRA 5F7BA 1WA1X 1JXGA 3L45A 3QBGA 4PXFA 3VG9A 1AR1B 3ODUA 4KO7A 2W8CA 3QJTB 5EN0A 3EH3B 4J4QA 1KDJA 2TSAA 2I20A 3QJSB 5E9NA 4KO9A 1DZ0A 1AACA 1PLCA 1KG9A 1KGYE 1BEXA 3UONA 1NWPA 1V10A 2DWTA 3ABMB 3NSCA 4AKPA 3OE0A 2BW5A 1NTDA 3HANA 1SDDB 2GHZA 1RKRA 3FSZA 1C3WA 3AYMA 2YXVA 4XT1A 3AYNA 2AT9A 2CUAA 4KOCA 4JR8A 1X9UA 5H2LA 4GY4A 4E9WA 2F95A 5A7EA 5G2CA 3FPXA 3PPSA 1A4BA 2HRGA 4PCYA 4HCGA 2YAEA 4AKQA 4A2DA 3FS9A 4A68A 1NWOA 3VVKA 2HXAA 2H5UA 4G71B 4XTOA 4X1HA 4X4KA 2NTWA 3WI9A 4YSRA 3QJQB 3N55A 4W9ZA 4BXVA 1L9SA 1L9PA 5DHHA 3S3BB 2R7EB 3FQ2A 1I53A 4YSCA 3S8GB 2UX6A 5B1KA 4GP5B 1OCZB 2RACA 3QAPA 1JZHA 2XV2A 5I6PA 2XU9A 2QT6A 3COCA 3NJJA 2I7OA 1M57B 3UTXA 2PPCA 4TL3A 1AZRA 1IBYA 4UG2A 3IBOA 3TA4D 3X1EA 1N70A 1KGBA 3NJGA 4A66A 4BWTA 2J57A 2JFCA 1FBBA 1X0K1 2BP8A 3BVDB 2J5WA 1O0AA 1UAZA 4OV0A 1SHWA 2TSBA 3AG3B 3MBWB 1YLBB 3REYA 2LLNA 2IH9A 1BRRA 3NJIA 1OV8A 3OE9A 1HAWA 3QBLA 4E9RA 2X87A 4DPAX 2PLTA 2M3GA 5AHYA 1MZYA 1WS8A 3T9WA 3VGAA 3OMAB 4DP9X 5I28A 3PCYA 2Z55A 1AANA 2YAHA 3HEIB 4YSQA 1PZCA 2IDSA 2JXMA 4HHWA 4DKLA 1L9HA 1AS7A 1OF0A 1X0SA 3ABWA 2XX1A 3SBQA 3T45A 2QDWA 5I26A 1S8JA 1C8RA 4EJ4A 3ERXA 4DJHA 2RH1A 4N6HA 1TN5A 1OCCB 2IDFA 4GP4B 2WO3B 5LWEA 1JVOA 4BXSV 2AZUA 2UXFA 4E9XA 3NSFA 2YCWA 1BQRA 3QDCA 1L9OA 5D4HA 3X1BA 5B34A 7PAZA 4X31A 1GS6X 1J5DA 5AFAA 5DYSA 2FT8A 1NICA 1GY2A 1PF3A 1M0LA 2VSMB 5AHZA 3ABKB 3CVCA 5C1MA 5B0WA 1N68A 2IWFA 4YSPA 2ZFEA 2VN3A 2XX0A 1E30A 3FT0A 3NJKA 3PXOA 3G5WA 5JJJA 5JJEA 4DAJA 5I6OA 5BR2A 4LDOA 2UXTA 4DP8X 4BWUA 1PNDA 1H68A 3WIAA 5G2AA 1SJMA 3NJLA 4EF3A 2VSKB 1LN6A 2MRYA 2YXWA 3TBCA 2A3TA 1AG0A 5PCYA 3EH4B 4M4RB 2Q9OA 4BDVB 2OV0A 1KG8A 1PXRA 2QPDB 5BR5A 5A44A 1EZLA 3JT2A 3AM6A 4BEZA 2YAFA 4PXKA 1AAJA 4AI7A 3OMIB 1IC0A 1SFDA 5G53A 1XJIA 1JFPA 1F88A 1PLBA 1FA4A 1AS6A 1UCQA 4G72B 4YVNA 1XB8A 2J4YA 1ZV2A 2GI0A 1CWQA 4HYXA 5B1BB 1ET8A 5TK4A 3CDZB 3WQJA 1NPNA 2VW6A 2YDVA 4HCFA 1BRXA 4MD1A 4HCIA 4E9YA 1BAWA 4ZK8A 4DP1X 3NY9A 3UG9A 3QBKA 3WG7B 4YSEA 1ILSA 2QDVA 3QAKA 1BYPA 3FU7B 4GRVA 1QKPA 2X72A 1VLXA 1E67A 2GC4C 2DY2A 2VMJA 3QPKA 1JVLA 3UTWA 1SFHA 4TXVB 1GSKA 3WKQA 2ZIYA 3IE9A 3ABLB 5AWZA 3UTYA 5G28A 4FA7B 2IDUA 2ZOOA 1IXFA 1R84A 1JOIA 1AOZA 1A3ZA 4LDEA 1J5CA 2AZAA 3QQXA 2Z73A 4YSAA 2BWDA 4YVUA 9PCYA 5A45A 3PQRA 1M0KA 1WA2X 5H2NA 4IAQA 3OE8A 2FWLB 2ZXWB 3NSYA 1ET7A 4Q8BA 4F2EA 4HYJA 3OQRA 2R4SA 2G87A 1MG2C 1MGYA 2VW7A 4DP0X 3NYKA 4NAJA 2FNWA 1A4CA 3V9EA 4YSSA 1CYWA 4EA3A 1TEGA 4DP4X 1OE2A 2OCCB 3UTVA 2ZONA 4QRYA 2UXVA 1A65A 1L9TA 1U19A 3OAXA 2E86A 2IDQA 3HAOA 3S3DB 2XLLA 2WJKA 4AX3A 3HAPA 5B6YA 3ZDWA 4F2FA 4WKXA 5TGZA 2MTAA 4AMIA 3EHBB 2H3XC 4GYBA 1MDAA 1ZIAA 1URIA 3SN6R 2H47C 3S8FB 2BZCA 2QPEB 4PAZA 3FSWA 4IB4A 1PLAA 1QM8A 1GU8A 1M56B 1PY0A 5EHFA 4L6RA 3OD3A 5B7EA 2JKWA 2KSAA 2X88A 5JJNA 2YCZA 3C9MA 4ENZA 4DP2X 4G70B 4HAKA 5B6XA 5I6KA 1C8SA 3A7KA 4IARA 1UATA 3NS0A 1E65A 1J9RA 2CALA 3AG1B 3KW7A 4YSDA 3ZIYA 1S53A 1WS7A 5F7AA 5F8UA 1E5YA 1NIAA 4YSUA 3FU9A 2XWZA 2I21A 2BRDA 1KDIA 4GP8B 1ZIBA 3IEAA 3WNJA 1QHQA 4UAHA 2PEDA 2XXFA 2B3IA 1R2NA 3RZEA 6PCYA 3EF4A 3X1GA 4GBRA 1MG3C 1IW9A 2Y04A 4BEYA 1JZEA 2BP0A 5I6LA 1JV7A 1HFUA 1WAEA 1QNIA 2EILB 4HALA 2EIMB 2CJ3A 3GYRA 4YSOA 1JERA 2BWIA 5G54A 5I6NA 2DYRB 1IKOP 1A4AA 3KJ6A 1OCOB 1P8IA 2EIKB 5G2DA 2UXGA 3X1NA 3FYEB 1KV7A 1PXSA 2I1XA 1GS8A 3DIVA 4BWBA 1ID2A 3FU8A 4MFHA 4BUOA 5B35A 1PZBA 1M0MA 2BZ7A 2XYBA 3V2YA 2VM3A 4N8UA 1JV6A 3UABA 4A2EA 4AZUA 2XV3A 2Y69B 1AZCA 5AX0A 1W8EA 2N0MA 5I5IA 3IN2A 3UADA 2WO2B 4FAAB 1W6LA 2I85A 3ASOB 3ASNB 1BQ5A 4KOBA 3T6WA 2HLEB 2AFNA 3T71A 2UX7A 1IW6A 1V55B 3UAAA 4WW3A 2YAPA 5I6MA 3UZAA 2EI4A 5AZUA 2PPDA 1F4ZA 3ZPRA 3X3CA 1SF5A 2DWSA 2GBAA 3OM3B 4AKOA 4DP6X 4P5SA 5H2HA 4P5RA 3HASA 2VM4A 5B6VA 1KYAA 1BQKA 1KCBA 1ZDSA 2KSYA 3FQYA 4HZ1A 6PAZA 4JHVA 5A8EA 4YL4A 5H2JA 3SQRA 4KO6A 3T6VA 2FQGA 4KNUA 1NPJA 1AQ8A 1KBVA 3VI0A 2EINB 2PCYA 4LDLA 4A2FA 3NYAA 1PNCA 4YSTA 3UAEA 5FJGA 3V2WA 1JZJA 3FQ1A 1TN0A 1TU2A 2I7SA 2XV0A 3NP4A 2YAMA 1P8HA 3PWHA 4KNTA 1S8LA 1BXAA 1SHXA 3T6ZA 4DPCX 4GYCA 1GW0A 2YCYA
chains in the Genus database with same CATH superfamily
2MH4A 4OR1A 5KAQF 4OKVA 3QIUD 5IV2B 4PVBA 3BX7C 4D2NA 3FB7A 5TQ0L 3FUKA 1AP9A 2ADGA 2LW3A 1Y0LB 4XVTL 3GXMA 3GSQA 4X7TB 5HDBB 4WCYH 2EEFA 3OB8A 1Q9OB 1AZBA 4KVPA 2AQ1A 5DVKA 4G3YH 3BWUC 3PBLA 4WI6A 3FSAA 3W9EA 2XQYK 4EDXB 5IFHH 2IGLA 4XRCB 3MRNA 4GINA 5F7FA 3IMRA 3J2PA 1YPZE 2NX5B 2J1WA 3SKJH 2YWZA 2Q8AH 1CYGA 4JHWL 4LRIA 4MVBC 2VT0A 2M8XA 3SDCD 5H2BB 3TYFA 3WJMB 5JW4Q 5LBSH 1S9YA 5LGHL 4HC1L 5CD3A 1BQHG 2C7UB 1WLHA 1X5ZA 3ZTJG 1GC1C 2ZSWB 3ETBF 2JE8A 3NEEA 3GTNA 1UOWA 5K1VA 2JXMB 5I1GH 1YYLH 1USQA 5GJTH 1WV7T 1QQDB 3B8SA 2DLHA 1HILA 1XIWD 1IQDB 2QV2A 2F08A 4GXUN 4RNRA 2VR6A 4X5RA 4DKEL 4WK4B 1UJTA 2EC9T 2ICCA 2OZ4L 3IS0X 4NSKA 2WAHA 1KTKE 2A0LC 2MOQA 1RIUL 1RHHB 4B27A 1ZV5A 3LS5L 4LOUC 5IHWA 3VJ6A 4RISL 1AGCB 3O9WA 3DKHA 3RWCB 2OMXA 2K0RA 4NC0B 1KC5L 1MW2A 1FFPB 5IKCB 2EO7A 4HK0A 2XJLA 5C86A 3L5JA 1R3IH 2VXVH 3OV6A 4B9YA 2RFXA 4AGNA 2VMCA 1WTGT 4TM9A 2FGWL 1FO0L 3RQ3A 4M6NH 1RUMH 3KGRA 2FJSA 3UGEA 2W0FB 3Q5TA 3GI9H 5GS2D 1JZIA 4XTLA 3FUHA 2VDML 3BP4B 1EO7A 3U4BL 1FCCA 4UV7H 1NDTA 2HVJA 5JDSB 2WVVA 2D7TL 5IP4A 3DTXA 5BQ7A 1I85A 5JIHA 4Z3IA 4BQCA 2AMGA 5CGYC 2J5LB 4QRRD 2WCGA 3ARGC 4F9LC 2QVFB 4HEME 3BISA 3IDGA 3ZQ9A 3MCYA 4UOZA 3D08A 1Q0EA 3PPEA 2D4FA 4N0UE 1VGKB 3KPOA 1IAKB 4ORGA 3QJUB 5EIVA 1UASA 1J9TA 1RAMA 3V7AE 5E4IA 5F7UA 3QXDA 2YKKA 4H8WH 3HVDA 5IB5A 3RVXC 1U8LA 1S9XA 1D9KB 1IAOB 2ITDB 2JB5H 2Y3NA 3FT3A 1WISA 3IAPA 2NOYA 2B9BA 3FHEA 2VDLB 4PB0L 4HIHB 3QUXD 1IU1A 4Z7WA 3VGFA 4UQ2A 4CILA 4Z7VB 1F8TH 1X9RA 3PIQA 4YXLL 4OZGB 1AGDB 1AHWB 1H5BA 4MZ3A 1ZSHA 1KJMA 3O8XD 1VADB 3A23A 5IW1A 4XC1L 5GISL 4MD4B 3HUJB 4KJQC 3VWJB 4YFEA 4LMQI 4N2AA 5JPMA 3ULUH 1TJIL 2F7IA 2NQCA 2ZYHA 1XX9C 2KZBA 4PJDA 4MNGE 4XXDB 2C3XA 5I1EL 3EYFB 2MOVA 5AOKA 3TP4A 3MRQA 4EOWL 3D39E 5LDUA 4QNPE 3E1F1 1XF3B 3CZSA 4RX4D 2JI1A 1G1OA 1QHJA 2VZ3A 4PJDF 3REVA 1SUJA 1Q1JL 4U1GB 3H2QA 1FZMA 4OCXH 1DUZB 2VXTL 3FH7A 1IFHH 2WBXA 3ZE1E 4HP5A 3B7TA 1E5ZA 3OKDA 2HVKA 2H1PH 1GR7A 1MNNA 3KR3L 3KBHE 2DI9A 1DEDA 4ODHH 1CXLA 5E4AA 3TXAA 4G8FB 1XF4A 3KMDA 4G5ZL 3DETD 1A6PA 1XGZA 2W07B 5F88B 1B6UA 4N1EA 2YAQA 2WHVA 4W70A 1P4IL 1GOFA 1T2JA 3GPSA 3SDDA 1T0MA 1JGEA 4GUOA 1IC5L 1HINH 4EIBA 4PBVC 1WWCA 1NZRA 1BZ7B 1X4ZA 1H8OA 3QIWD 2HG5B 5ESVA 1RPUA 4FQCL 4K5LA 1BSIA 2GKIA 1IFRA 3DX7B 4QDGA 4QWWC 4H0GA 1X4XA 2V5MA 5ALCH 3LZQA 4BZ1H 4X80L 3RY5A 4R97B 1M2OA 2ZX5A 2C3VA 3UONA 1AQKH 1WZ1L 2BW5A 4C83B 4DJMA 1BLNA 1FNLA 2OJEA 1FVDB 3QEQD 3TV8A 2NNAA 4OTXH 3V0VA 3OAZH 3QSKB 1MSPA 3QNZA 2ZWKA 5B22A 5D72L 2CU9A 1TVBA 3LNDA 1VGEL 2NR6C 5B39A 5D1QB 2ZXQA 3VRJB 1BMGA 5C6PB 1L9PA 4R2GD 3OKEA 2FK9A 2ZTBA 3RIFK 1SMOA 3QG7H 4HS6B 5IUCA 1AHMA 3HTLX 4WWKD 3MO1A 4OFVA 3V0IA 1Z0MA 4Y0GA 3RPKA 2DQTL 1JPST 3LB6D 1ED3B 4IRZA 1TU2B 2E27L 1N4XH 1X5MA 1SJHB 3MYJB 3EXJA 1DBBL 4PS4H 5K59E 3ISWA 1IFGA 4ZS6C 3P9LA 2HT3D 4Y19E 4BRJA 5E5MB 1M1XA 3ATDA 5TF1H 1DO5A 2HFFB 3MBWB 1AOHA 1ZOXA 2WWKT 2OP4L 1HN1A 1UZGA 4EEEA 5HHVH 3L4VA 5EOQH 3TNNA 3U4KA 3LIZL 2OXHA 2H0FA 4FQIL 3QCVH 4CSSA 3T4AC 3B1TA 3CFCH 4M1GL 4RAUA 4X7DC 3T9WA 3R8BB 35C8H 3C60B 2ITFA 3OSKA 3TS8A 3MZGB 1U8OB 4N87A 4NRYA 5LXVA 2VQTA 1AS7A 4TVSa 3MRFB 3N1QC 4Y4FD 3FO9A 2R1YA 3T45A 2FX8H 1UEYA 4UNIA 5HI4D 3U1PA 2WWKO 4LIQH 1ANUA 4OFYD 4JKPH 5I15H 4AW4A 2IDFA 3QFDA 1PW3A 1P4LB 1I8MA 5IESL 3O0RL 4X2UA 1PDKB 2WK2A 3O3BA 5ILTH 2E74C 1JNNL 2VUOA 5E9DB 1Z3GL 2Y7MA 5AFAA 3WN5A 1BYNA 2WM0A 4MB3A 1MIML 2Y7OA 5HVWA 3TBTA 3D50A 2VERA 2YBGA 4OKDA 2DAVA 2ICEB 5H35A 2ZFEA 1NQBA 3ETTA 3DUSA 3UROR 1A4JA 1MAML 4R26H 2Z7UA 1GVIA 2BSSB 4JFPB 1AGFB 2NY3B 3D5OF 3HNVH 2VSKB 2YXWA 4BFOA 4O2CA 5GGUA 3GSOA 3V0EA 1NMCB 3BWSA 1XGQA 3OHXB 4QY8B 3RB5A 3UTPD 4OV5A 3QA3A 1G9MH 1AJ7H 3LXBA 3MMEB 2AXWA 3D30A 4DEUA 3HG3A 3EIFA 1YDPA 2FIKA 1JFPA 3I50H 3CN1A 1FA4A 4P3CH 5DS2A 1UCQA 1ZLWK 1DQIA 1Z1WA 3FTSA 2HH0L 3OXSB 4G59C 3UYPA 2X3CA 3SE8H 2Q76A 1NGWA 1AD0A 3CDZB 3WQJA 3GSNH 4OIIL 4OIFA 5EO0A 2VW6A 5ADOL 4N2IA 2XG4A 4HCIA 3T0XA 4D3CL 1R3KA 4NZDA 2VKXA 4L4VE 4LL1A 5EZLA 2QSQA 4X0NA 3BPNB 1B88A 5D7LE 3V6OA 3RWGA 1JF1A 4KQ3H 1B4RA 2RA1A 1G7IB 2V8MA 1V5JA 4ZFFB 4QF1B 3AVEA 4MXWL 2MPAL 1MCDA 1U3NA 1OZTG 2IDUA 4GQQA 3P0GB 1QRNA 4ZMLA 1Q9KB 2RQ8A 3AT8A 4CAGA 4NKOB 1DQDH 4YZWA 1MJJA 3D4YA 4IAQA 3UZVA 5CXPA 1X5LA 3NZSA 4HJUA 1KY7A 2NXYB 3PJSB 5HJDA 2ZKXA 1KZYA 2J8UE 2XNAA 1NFDF 2DLIA 1JS4A 1HVXA 2CKBA 5C09E 3HR5A 5AVYB 1U19A 1LO4L 3HMXA 4HJJL 1CFSA 2IMMA 4N0CC 1S7WA 3BSZA 1ZY9A 4B9CA 1BVNT 2DOCA 4L5FE 4WFED 4LSTH 3TESA 1B0RA 2QEJA 3IETB 4ONGH 4LQFH 1F90H 1MDAA 2R2HA 3NTCH 4HV8A 5TFSH 3WS6C 3S8FB 3VB9A 4FHBD 4IB4A 3UTZA 4XPHL 3TBSA 2W60B 2C26A 1HX0A 1QEWB 2NY5H 1HKLH 1UM6H 5KYNA 2AJXL 4DP2X 3CXHK 3LKQB 1Q38A 1BECA 5KOVC 4NNYB 3D3VD 4BCXA 1I8LA 5B8CA 2WLHA 2RH0A 4L3CA 5ESQB 4Y9BA 2RR3A 1U95A 4KFMA 2VAJA 5D7JB 1DVFB 1FNHA 4GP8B 1JRHI 2YA2A 4LEXH 4OQTL 2OX5B 4KZEL 3FOMA 4HBCL 1S7QB 1H3PL 4PP1C 2VSCA 4ZQKA 3HMWL 4JKKA 3WIFB 2J6WA 1L5GB 3DPBA 5I1KL 4BEYA 4U6XB 5EU6E 5C0EB 1Y6KR 1J05A 1OAXH 1WAEA 1TOXA 1KB9K 4MZ2A 4AYFA 5GGVH 3K6OA 5GSVB 4GAAA 3LNGA 4RIRB 1A3LL 1IILE 5IJVA 4Q9RL 3AY4A 3V2YA 4P4RA 4PG2C 1E3XA 2Y2TA 3UADA 5M94B 2AAAA 5C7XL 4P4KC 5I9QC 1YAIA 4YLBA 2X9ZA 1FAIH 5D7SH 2Z35A 2CHNA 2UX7A 2X40A 3SOBH 3BSGA 2QGEA 4H26A 4M1DL 1FBIH 2R51A 2ZXDA 4I0PA 3VW3H 3OX8A 4NQDE 1F4ZA 1AGEB 4LCWB 3KJ4C 4OGYL 5KAQG 1T1YA 4JPSA 1JTPA 1F00I 3N41B 5KOMC 4DN4L 5HHQA 1FL3A 4E5XG 5C0BE 4TOYL 3W9DB 4NNXA 2IQ9H 4LHQB 3U7YH 2EABA 3ZN6A 1GZQA 4LCUA 4UM9A 5DTFB 4L4VA 4TNFA 3KYKL 1EZVX 2D8KA 1IV8A 4FYTA 1BZ9B 2KDYA 3BEVB 3R1GH 3BP7B 5ALBH 4QR7A 2W80C 5DMIH 3MJ7B 3VI4A 4F3FA 1IBDA 3CK0L 4JRYE 1S4IA 3O9WD 3OAUL 5HHNB 4F20A 5I75C 3S4SB 3P77A 4AC4A 2R2BB 4UYPA 5GS1C 4OZIB 1NUDA 2XWEA 4L3EE 2XC8A 3FFDA 4PJ5E 4GW1B 1ONQB 2X42A 1BZDA 2ZG3A 2J8UA 1CGSH 2EYTA 3GUFA 4YHYB 3DHJA 3HAQA 4PREB 1PG7L 2WCSA 1AS8A 1FFTB 5B7FA 4RWYL 3FTUA 3RFZB 4LKXB 4KDVA 2XFGB 1MCHA 3AU0A 1XBDA 4ZQTA 5L7XL 5EZIL 4KITB 5DK2B 2V6HA 2YFOA 1NCWH 4MJIE 1BM3L 3QFGA 1UB6A 4B3EA 3BAWA 1YSOA 2B39A 2DQDH 3MLSH 5DUBA 2XZCH 3P4OA 3WELA 3L17A 2WKOA 1QTYT 4BH7B 3FMGH 1WO2A 3ZKNC 3W11C 1T83C 4MNQB 5DSCA 5LCVA 3ILEA 1P1ZA 3CV5A 4TPRL 5CR8A 4HHGA 5TK2A 4JY5L 1XGTA 3QRLA 1CXFA 4XPFH 5F7MC 1TJHH 4Z0XA 2YWYA 3HHSB 3MFGB 1KEML 2IQAA 1I1AC 3EYSH 5IB1B 4Y4HB 1MHEA 3SY0B 3EYQC 3WE6B 4JZJB 4GRLB 2OA9A 4U1KB 1K9TA 4PI0A 1KULA 3UBXB 3WNNA 3VQLA 2XPGA 2Y07L 5GZNC 4DKDC 1FL5B 2ILLA 2VDRL 2NUPA 3CSTA 3K2UL 2AXFB 2R56L 4N90E 5B6ZA 2YGPA 4ESKA 3H9HA 1P5VB 4FTDA 1CF8H 4FXKC 3ROOB 3FTZA 1NINA 4B9GA 3FCTA 4LHUB 1TPXC 2FWSA 4LSRL 1YMHA 4OGAC 1E0PA 1I1FB 1ZPUA 2BXZA 2WWMC 2Z34A 3QJFB 4NM4H 1KCWA 3GUTB 3S35L 5H2KA 5EULV 3Q8BA 2C1OA 2FEDD 4AQ1A 1GHFL 1IGCL 2XTSA 4TVPD 2IH1A 4R7DA 2CBTA 4XMKL 2HX9A 3ARDC 5E6UB 5IY5B 3K6DA 3EFOA 4PG9B 4ZUVB 5KVMC 3F7KA 3TIDA 1DFXA 2DTSA 5EN3A 1E4XL 4A7GF 3FK3A 3DTUB 1H19A 1TUPA 5GRWA 4PJBF 5L2KA 1TQVA 2HWZL 3BQUA 4M3HA 4OF8A 3NJHA 1RIHH 4HIXH 4HKBA 2FJHB 1QLFB 1NAKH 4HH8A 2FQFA 3KPPA 4JANA 4JE4B 1U8QB 1IIKA 3D48R 3V4PH 4ZOAA 3NCCB 2XKNA 4DAGL 1QKZH 3IDYC 3C5ZA 2C34A 3NP3A 5J57B 1AZUA 4YBLB 4YXHL 2GTQA 2E46A 1GS7A 2VDOL 4L0PB 2FQDA 2C8NA 1SUHA 3MTXA 4IBVA 2D9QB 4L1BA 2PF6A 2ARJB 4MCMA 5K9JL 1ACZA 5F7LB 3LZNA 3AUWB 3I74A 3LQAH 3FUFA 1UTDA 1G9HA 4XT1C 4N1CA 2HP4A 4GQ9H 5F1OB 5MEOA 3SDDD 5L2JB 4NKDB 5B3SB 4NM8H 1CF1A 1IGTA 4A55A 1YC7A 1KXTB 4JO8A 1IM3A 1N3NA 3IJEB 2EIBA 3SYPA 3DA0A 5DJXA 4F7CB 3P3UA 2FX7H 3CBRA 1QI5A 1F58H 4L3EA 4L2YA 5CJOL 4M1CD 4X4MA 3V4LA 4HJ0D 1DQQA 2CIIA 1OCRB 2BJML 4B9PA 3AACA 4FYSA 5L6YH 4YDJA 1TNNA 3B2UD 1SJEA 4OLYH 1D7BA 2IADB 2VUYA 5D6CA 2NW3A 1W0VB 2R0ZL 4NN6B 2WQVA 4DGVL 1HKFA 3RFRA 1GYUA 3VXPA 5C08A 4MQXD 5DEFA 3CZUB 4C55A 4HXBL 5AW2B 4DGYH 2K6WA 4U1SA 3SPIA 1T89C 3NJVA 2A2QT 1ETZB 4JBSA 5F3HA 2FT6A 1C16B 3MLVH 1NCGA 1OTUC 4DPBX 3N9GL 2GT9A 3HI6H 1S9WA 4Q6IA 1KIPA 4QIDA 5K59F 2UZPA 1MRFL 1P5UB 1CD8A 3O2WL 2I32A 4KVCL 4ODSL 4RQQA 1IJ9A 2AERT 5KS9A 4OH2A 5AB1A 1CDYA 3CSBA 4Z95H 1S8DA 4LLQA 1P9MC 4WZ9A 2Z91A 1SHSA 2QPUA 5KS9F 4J6RL 1BEXA 1TZ8A 3QC6X 3OZLA 1HH9A 1QSEB 2X4TA 3KYMB 1HXYA 4PRHA 4UTBL 4JFHD 2CUAA 1C8QA 2EIZA 2OL3A 2XQBL 3NFNB 4QHNA 4GY4A 5A7EA 1JK9B 4FI8A 4Z0BL 4HCGA 1OWWA 3V6BR 4AKQA 1YCSA 1N26A 1MFMA 1FLTX 4HPOH 4LCCB 2C9AA 5D5MF 4ZPVB 4Y9FA 3X14A 3KLQA 2OBGA 1FRGH 2VN6A 4H8UA 1NCAL 1FNSL 3F7VB 3VYPA 4N25A 5F6HJ 1OWRM 4Z7VE 2ZKHH 2NZ9D 5F7WC 2VLRA 4WTXA 4WTWA 3OZ9H 5H37A 1EEUA 3MLXL 4ETYA 1JRHL 4OZGE 1BVLB 5E2WL 4U2YA 3CUPB 4HSCX 3VXRA 3A47A 2OTUB 4BSVB 1YC8A 1CDCA 2B0SH 3CPUA 2C4XA 3MUGB 1A6AA 2JKIS 1UWXH 2QQKH 5IV2A 1M57B 3IBOA 1THCA 2BH0A 3B9DA 3TA4D 2NY7H 1N70A 1Y0LA 3L7EB 4X7TA 5BVJB 1W8OA 1FIEA 1O9VA 3GBML 3MGTB 1Q9OA 2CDGB 4LU5L 1YJDC 4Y16B 4Q7DA 3IJ8A 3S88L 1S7SB 5EDXA 3BUQA 3IE4A 3T65B 2G2RB 3Q13A 4EDXA 2F19L 4IMLB 4XRCA 4GIAA 1E43A 4MMXB 5DD0L 1F11B 2NX5A 2IIJA 1OSYA 2EXTA 4LARH 3C6LC 3WJMA 3QBLA 3S9DB 5KVDE 2ODHA 4FNSA 1F86A 2ZSWA 3PCYA 3I3DA 4ZNEE 1YEEL 4KRPB 3HEIB 5C7ZA 1PZCA 2DB8A 2JXMA 1L9HA 4IOFD 1QQDA 4EZKA 1MRDH 1PKOA 3X11B 3TFBA 3O45B 1NBVL 3MV7B 4Q56A 4JS7A 3VD7A 3FZUD 2XN2A 4HS3B 1PY9A 2FJFB 4AIEA 1RHHA 2KBGA 1MCCA 2GBUA 3X1BA 1AGCA 3O4OC 3KLHD 2EDDA 5JO5B 5AYUH 1OAYH 4ZFOB 4MB4A 1FE8L 4LPCA 2VMDA 2H6PB 4AYDC 4A2LA 1FFPA 4MA8L 4JN1H 1Z9MA 5HYSB 1QRND 3CN2A 5EFIB 3WJJA 4Y9EA 1ZHLB 2KZWA 2FYVA 3MRGB 3QE5A 2OYKA 3EDEA 4GW5B 5AENA 1NBZB 2X4QA 4RDQG 4Y4KC 2D0FA 5T5FH 2C9XA 1A7QH 4DO4A 5I66B 2EDRA 3FH8A 3LMJH 2IG2L 1PXRA 1CLYL 3ARZA 4LP5A 3JT2A 3BP4A 3HAEH 4N68A 4TNWK 2X6UA 1PX3A 5JDSA 1A0QH 5CCHE 1YEGH 3BXNB 5AVZB 4NBXB 3TEZA 3CXDL 3FBQA 1CN4A 3NPSC 4XN8A 3ZU8A 3ECVA 2HJKA 3VFPB 5GRJH 1JV5A 2QSCL 4UNUA 2DMGA 4N2LA 1OT4A 2XG5A 3P11H 4FD0A 3ZKQD 4YGAB 1W72A 2CKNA 1YEFH 4ZK8A 3EO9L 4PIBA 2MCG1 4KXBA 2VL5A 1YUKB 3GM0A 4PRNB 4OVVA 4KQ4H 1E67A 1MAKA 2Y1VA 2G9HB 2ITCA 1C1EL 1SN5A 5BRQA 1JDCA 3JXAA 4AMKH 5IGXH 4TXVB 2OW7A 1GSKA 3WKQA 2KQNA 2NY2C 5IG7B 4JFEE 5G28A 1D9KA 1DFBL 4L8SB 1IAOA 1JOIA 5DUJA 1A3ZA 4W9IC 2HB0A 1J5CA 1XSOA 3Q2CA 3QQXA 2Z73A 4F1ZA 1KLUB 2GPZA 1AR1C 2BHZA 1R75A 1HQRB 2VAAB 3ULVD 3V10A 2YGVA 1HOEA 4HIHA 1YEHL 2GTZB 4JHAH 2ZOTA 1A4CA 5F9AC 4FQ2L 2AJUH 1C12B 2BINA 5DU7A 4Z7VA 1OE2A 4AL8H 3CU7A 3UCRA 3UTVA 4IBQA 3M07A 3WO4B 2QBWA 1YN7B 3LPPA 3JWDL 3QDGA 5CCKH 3ILDA 4Y2OB 2XLLA 3VD2A 2GJ6E 2FGZA 2WJKA 4HJGB 4JRXA 5CNHA 5L8LB 1U8MB 4MD4A 3HUJA 3ZDWA 3G04B 5K9OA 2EO9A 5EOCL 1F4XH 1DJIA 4XXDA 1ZIAA 1ZT4B 2HFTA 5F97E 3EYFA 3RX9A 4ZXBC 5KYXA 3PP3H 1PLAA 2MCMA 1GU8A 1PY0A 3BZEB 1ZE3C 4L8CB 4GSDL 1VFOA 2PXYB 1ROWA 2HFEB 1UKSA 2P48B 1GA2A 3L4YA 1MI5B 3A7KA 4PMFA 3HMXL 3NA9H 4TUOA 2NSQA 4YHKH 3V0JA 3ZKMD 5KSAB 4I0PD 4W4OA 3STBA 3QUML 3BSZL 4NQCB 3LDBC 1CI5A 1ULVA 4B9KC 1JPTH 2MPVA 1OD7A 1CL7H 3KVPA 4ZNEA 2PO6B 3ZHDA 3JQOB 3FN0H 4W93A 4G8FA 5IVXA 4BFGA 2W07A 3L3IB 4JREC 5F88A 3FFOA 5CEYA 3X1GA 2KYIA 3O6ML 4XI5D 1A02N 1MG3C 1QTSA 4MX7B 1I9RH 4UM9D 4XO9A 4MXVE 4L4VD 5IVXF 1OSPL 2EIMB 4XB3A 5D7LD 1CBVL 4QAMB 2BHUA 2X4PB 1P69B 2HG5A 5IWLC 3KJ6A 1OCOB 1T4WA 4BQ8A 3CZGA 5I1HL 3D69B 4JDEA 3NAAH 3UPRB 4D7BA 4OIAA 3U9WA 3WDJA 1P6AB 3UO8B 2K7PA 5AX0A 3RIKA 4C83A 3PWVB 7FABL 5K1NA 3OKOB 3R0MA 1FVDA 2WINA 3T6WA 4ELKB 1QFOA 2WWOA 2HLEB 1KGXA 3OPZH 1IW6A 4WW3A 2ZG2A 1E8XA 2YAPA 3QDMB 3PRZA 3QEHB 3V0WH 4AVIA 1RZKL 4H20H 1XTLA 1CR9H 3OL2A 1CE6B 2ARWA 5D1QA 3HE6B 2NY1B 2JJSC 2NW2B 3A6CH 3B43A 3VB8A 4HZ1A 4OD3L 4PJ7E 1WWBX 5DFTA 3CSFA 2EUXA 2YD6A 4K9EH 3L3JA 5A2FA 3T6VA 3RL2B 4HS6A 4AW7A 1TTUA 3G9VA 5D93C 1TYRA 1TTBA 3DUUB 3HBPA 3INOA 4BE6A 1KN2H 2APXA 4FQLH 4AE0A 4YSTA 3WNKA 5C6TH 4DO6A 5F9JB 4LP4A 2JIXA 4N8VB 5DZVA 1E5AA 2DQ6A 1ED3A 4NCDA 1TU2A 4K94C 2Z31A 1RD6A 1SJHA 1N7ML 1RXLA 2W92A 3MROB 4NHUB 5DZNA 4PJAA 4F7TB 4JEGB 2ZOLB 3CFIC 2MCAA 2HFFA 2Y1AA 3MBWA 1GZMA 4XXCC 3NCEB 3H0TB 5IVOA 3U30C 4XN7A 3ZMEA 1AG6A 5G55A 3NPZB 2CLVB 1AYOA 2VYRE 1NBCA 1P8UA 5IBLD 1JG9A 4M5YL 2BSEA 3Q2LA 4D0BB 4Y88A 2YMOA 3C60A 1LHZA 4RMUA 2FLBT 1U8OA 5DD6B 1BF8A 1I9JL 3MRFA 4FFVD 2QVKA 1NCNA 5H4ZA 3P69A 3I9IA 3RGVC 2EDMA 1P4LA 4S1DC 4XT3A 2B08A 1PDKA 3ZZ1A 4KH9A 5E9DA 4PJGB 2FH6A 3NCFB 3N0AA 3RLSA 3UJTH 2F5BL 4O2FB 1RUPH 4K0OA 4Z77B 2H6UA 3QJVB 3BVUA 2ZWNA 3BSHA 3TBYB 4U1IB 3RJDA 1N8ZB 3S98A 3EMLA 3P4NA 3WFZA 3IK2A 5L2KD 1VACB 2K3TA 2BSSA 5E23A 4JFPA 1AGFA 4WHTB 1R1CA 2VDQH 3L4ZA 4L5FL 4EXPX 4ZMPA 4QY8A 3AU1A 5ITCA 1XQ4A 2R4RA 3FCGA 5B38B 3ARUA 3C5ZD 2XN9A 4J3OF 1K4CB 2CZNA 3MMEA 9CGTA 5EH1A 2MKLC 3H4FA 2BW4A 5I5JA 5ACLA 3O6FB 3SOTA 3TA3B 5GRZA 5IB4B 2YQBA 4LIQE 5CAYB 4CMHC 2CBMA 2IC2A 1ACXA 5HHME 3OXSA 2XQYA 1YHPA 6FABH 5I1LB 2ENQA 2Y25A 1HI6B 3CDZA 3O4LB 1DQLL 4LB8A 1GMEA 2WZ5A 4L29B 5AQ0A 1QI3A 2DIJA 3PAVA 3NN8B 4HLJA 2VDPH 4FG4A 1NDMB 4U6VL 4JKVA 2WNGA 4JKMA 1LK3L 3N85H 4JRYD 1OAZL 1IM3D 4HF5L 4UANA 1G7IA 3RP1A 4ZFFA 4QF1A 3ZE2B 4R5TA 3WIHA 3KWWB 1RUKL 2YRPA 2DLTA 3P0GA 2HPYA 2JB6A 1Q9KA 4L3ED 3D0AA 3B83A 4NKOA 2H26B 1DVXA 1A5FH 3RDJA 4OZIE 5JHBA 2G0LA 3N43B 3S3CB 3MKGA 4OFKA 3H6AA 3PJSA 4ZOCA 1QHOA 4HEPA 3Q5OA 1ZGLP 2BSCA 1KOAA 3E9TA 4NOBA 2D7PA 2IANB 3EJRA 2WN3A 4HIEA 4KGLA 4NQXB 4WI2A 1MFDH 4LRNL 5C08D 5FO7A 4XC3L 4MHHI 2FIRT 1HHHB 2P4AB 5C8JB 2WZAA 1HL5A 1CT8B 3GTTA 3KYNB 2BVOB 4M7JL 2R69A 4JFDB 4PPTA 4Y5YC 3IETA 4QI1A 4NQVB 3RL1B 3FSVA 3JUZA 1EHLL 4KXCA 3U9PH 3FO1B 3PAZA 1N18A 5GS0L 5KSVB 5B1CA 4JPWH 1N6UA 4G7RB 2V2TB 4JDTL 3FYIB 1QEWA 2K3HA 4CDGC 3B6SA 3VCLA 1K6QL 5DVPA 4KZDL 4NNYA 1VERA 5F6IB 5CEZE 4JLRB 5D71H 5TGBB 2ZE0A 3FNKA 4FQHB 2VR8A 1ZHBB 4N2OA 4PRHD 5AVQB 1RVFL 4NGHH 1JNHB 2WO4A 1BXVA 2F2HA 4OCWL 5ESQA 1ZLVH 3VFOB 1DN0A 3AJ7A 2F15A 4G6ML 4BK5C 3BGFB 4WV1C 2OX5A 5L9DL 1TXKA 1S7QA 3BZ5A 2VE6A 3R4RA 4N2GA 1L7IL 2Y9RT 5E4EB 2F93A 1NGQL 1OQXA 4UB0L 5FHBL 3WIFA 4JK0D 1EXHA 1L5GA 1SN0A 3INUH 5C07B 4U6XA 1IE4A 1TQBB 1TCMA 5C0EA 4HWLA 1NM4A 2YD2A 5IK3B 2VLRD 1RZJL 5DR5L 2PMZA 4K9JA 1FPTL 4U4IA 5EIQA 3AZUA 3CFJB 2IFFL 3VXRD 5FECB 5GSVA 3A6BH 3G6DL 4JFFE 1YNLH 3ARRA 3N04A 4U3HA 4RIRA 1L0PA 4U3CA 3RUGF 2M2DA 3RTLA 1QLEL 2CQVA 1H6UA 1FBKA 1XL6A 2DJ4A 5F7BA 1N0XH 1JXGA 4FG6D 4XWGH 2ICWA 3OAYK 2XV6B 3OWRA 2YOCA 3FQRB 3MLZL 1IMHC 3EOBB 3B5GA 5E24E 1DZ0A 3F8UB 1UACL 3BGAA 1CDHA 2DWTA 3SEPA 1JCVA 4OD1L 5GSRA 2RGSA 5FO9B 3HANA 2E8YA 2YXVA 1AGEA 2NX5D 1HIML 4LCWA 4BK8A 1EEZB 1NAML 1IGMH 3GZPA 3ZGHA 3CZEA 4W81A 5H37G 4F57L 5G2CA 1BQLH 1CBJA 1MCPH 3O3AA 3W9DA 4YHPB 1YQVL 4A2DA 1HHJB 3DV6A 4PSRA 3EJZC 4NUMA 3ML9A 4UIKL 4UTAA 3S5YA 4LOFA 1L9SA 3NH7L 5LLIC 3QWQB 4KJWD 4JRFA 1LWRA 4HFUL 3BP7A 4JG5A 1PG7X 3HZMA 1N9PA 2OL3L 3MJ7A 3D85B 1M71B 4FG2A 3T0EB 1KBKA 2HKFL 2VR7A 5HHNA 2R29A 3S4SA 3UTXA 1CDUA 5DT1H 5JHDB 4WTZA 1JZ7A 2R2BA 4JM2F 2WBJB 4FP8L 3ARBB 1TTRA 3BLKA 4OZIA 2R8SH 3CN3A 2P8PB 1PPIA 1U8KB 4GW1A 1ONQA 4LT7A 5CO1A 4O51A 1YLBB 5E5UB 2O5YH 1ZA3A 4OCSL 3RFZA 3UYRL 3L4UA 4BK4A 1J0ZA 1WJ3A 2BCKB 3PDOA 1DVYA 1NFIB 1WS8A 3TJHD 4WRLA 5DK2A 3UFIA 4XP5H 2VDPB 3KYOB 4KH2A 1NBQA 3CVHA 5F9DC 2Q2EB 4KK5D 3N1PC 4CC4C 2YZ8A 4RSVA 2YUZA 4IJ3B 5JORB 5DDHB 1MY5A 3V5KB 1TN5A 1M7XA 1N2RB 4GP4B 2TAAA 4L3AA 2WZ0A 3KPRB 1TQWA 4MNQA 1BQRA 3STZB 3SDAC 1GOGA 5FYLE 1GKEA 5BW7C 3CLWA 3CFKB 1DJSA 4FNPA 3HHSA 4P9MH 5KEZA 3QCTL 1N68A 1D9KD 1JD7A 1FFRA 3GJEA 2XZZA 4IRJC 5IB1A 3SY0A 3QUYA 3WE6A 4JZJA 3RIFF 4GRLA 4U1KA 3DJRA 5ICZB 4EF3A 1EZVY 2GUOB 3MFFB 1FL5A 4ANKA 1CVSC 2AXFA 3EH4B 4M48L 4M4RB 4OFQA 4G7YH 2CO6B 12E8L 4PWIA 1UFGA 5DYOA 4HJSA 3FXIC 2YXMA 4LHUA 1U3HB 1KCSH 1F88A 1L6XA 2ZCHH 4WEMB 3QJFA 4S1SH 4FOMA 3GUTA 4DFHA 4JRXD 4O9HH 2XHNA 5D2NB 1BRXA 2KZKA 1MCOL 2WAQA 5DMGD 4ZUVA 3QAZC 1P84J 3M7OA 4HLEA 3J07A 4YSEA 5ADPH 1MJ7L 3OJDB 5G2NA 5BV7C 2PETA 5F44A 5ENWB 5F70A 4LLDB 2WOBA 2H2PC 4JO2H 1H3WM 3X17A 4TRPH 4YHML 5AWZA 1QLFA 2FJHA 1YRKA 1R84A 4WEBL 2D31B 5HGGS 3OKMB 4IOIB 5IQLA 3MVSA 4EMZA 4P59L 3RZCB 3GSXB 4WAFA 2VLJA 2FWLB 2LVEA 4N5UA 3SBWA 5T1LA 1OAUH 5ICUA 1AXTH 3U9UB 5IJKA 2ARJA 4EN3B 1INEH 2QR0B 3C5SB 3TJEL 3GJFK 4AWJC 2UZIH 1KYDA 5T33L 4MQTB 2UXVA 1TTFA 3N40F 5C0DB 4BA0A 3OAXA 3OR7B 3BHBB 3I9AA 5IM7B 5L2JA 4UINH 4POZD 3WFEH 5DMKB 2IDQA 1ITBB 2ZNWA 4RSYA 1T1XB 4M8VA 5DHYB 5J4MA 4KVNL 3N91A 4JZNA 3CZNA 4X6DA 3EHBB 4AMIA 3IJEA 5C0FB 4AT6A 4MHHG 4F7CA 5IHHA 1WFOA 4LASH 5EHFA 1AHKA 4NXSA 3IMSA 2E7LC 4ODTL 1YY8B 1VESA 2X88A 2Y1YA 1T2QH 4IRSB 3B56A 5T3ZH 3F85A 2XI9A 1E9OB 1OB0A 4MQSB 4HAKA 3GEFA 3KH4A 3OAZK 4AE1A 3EJYD 4YGVB 4X6CB 2QGDA 1PSKL 2QKIB 4B9FA 2IADA 1J9RA 4OBRA 4Z78B 1FYTE 2ICWI 3L5HA 4KRNA 1U3YA 1OAQH 1E5YA 3K6SB 1OP4A 4QT5A 4TULL 2X7LB 4WI9A 5D1QD 4YSUA 4TSAH 2XJKA 1LE9B 1BJ1H 2V9RA 3RY4A 3GNMH 2L7JA 1TQTA 3GLEA 3G6JF 4M9PA 5EBLB 3SPVB 4MJHA 4JKWA 2Q86B 2RMNA 5IMKB 1ETZA 4AGLA 5EF1A 3IDNB 3HLAB 1C16A 7CGTA 3TO4C 1LO0H 3L4CA 5FUOH 3T8MA 5L4JA 5IBTH 1U8HB 2JIXD 4J6IA 4XX1G 4PS8A 1TFPA 2BWIA 4YDIL 5C9JB 3BKJH 5HD8C 2OQJB 5KVDL 4G9DB 5J12C 3EBHA 4KKLC 2IH3A 1D5MA 2VRKA 4R4FH 1JFQH 3GS4A 3D8MA 1LMKA 4A2EA 3L9YA 4FZ8H 2X2JA 2J43A 1AZCA 2B8OT 2A74C 2NY0B 1QSEA 3VG9B 3KYMA 2O5ZH 4HIJB 3HKZA 1PGRB 2YPVL 3OKLB 4LLWA 1M53A 2NYKA 2OMNA 1JK9A 2Y36L 2J7LA 2BSED 5DWUH 1RZGA 3C60D 4LCCA 5D1ZB 3S2AA 5HXMA 4F37F 5DD5H 4R90L 1R34A 4KUZH 4M8UA 1M7UA 4ZPVA 2BP5M 4PTUB 1I8KA 2LAAA 4G3YL 3F7VA 2E6PA 1GGIH 3RJQB 5IFHL 2FEEI 1BVLA 1TO4A 2K6YA 2OTUA 3SKJL 5E0FA 2Q8AL 4BSVA 2CJTA 1U6AH 1PG7W 2FHCA 5E9DD 5LBSL 4W9DC 2EUWA 5LAPA 1WCQA 3R19A 4X6FA 2O61B 4K3DH 1QUNB 1YPZF 5E9AA 3BVTA 1LJMA 5BVJA 1YYLL 3LHAA 3MGTA 5I1GL 5L8KB 5GJTL 3GDBA 1BXUA 3CLEH 2IPKB 2CDGA 2YMTA 1N6VA 2VB5A 3NJNA 4WTQA 4Y16A 3G5ZB 4LQ1A 3W5NA 1S7SA 5EPMA 1O6TA 4KFZC 1FNEB 2G2RA 1H8LA 3FAXA 4JE0A 2NY3D 3UG3A 1MI5E 3BN9C 5KZCB 1E12A 1DQTA 3HS9A 5J8OA 4JX0A 4YAQB 5B1AB 3D6GA 2O4EA 4NQCE 2WJLA 5D8JH 2P49B 3VRIB 2CD0A 4J2QA 4LLVB 1U3JA 1YG9A 2B20A 1Z6JT 3ZTDC 3DLQR 1R3IL 3GXNA 4OLVL 4HK3J 3WV0A 4YHNB 4GKSB 3O45A 4KO5A 4XO8A 4PY8J 1KTJA 3MV7A 4M6NL 1RUML 4XN5A 3IVKB 3MRCB 2ATPB 3GI9L 3L2LA 4KKRA 1OCWH 2FJFA 5C2BH 2D7OA 3NIGE 5JO5A 4G5AA 1E4HA 2F6AA 2P1YA 2VZSA 2Y7QA 2F68X 3DSFL 5EFIA 3ZK0A 3WKYA 5J6HA 1ZHLA 2WKLA 4H5SB 1AZNA 1INQB 3MRGA 4R4NC 5CIPB 4GKOA 3LH8A 1NBZA 1RH8A 5BZWA 4OLWH 2NXYD 2XQYG 5EEUA 5I66A 2D3LA 3KCPB 4P23C 3IJYB 3PREA 3QDME 4JO4H 5EU5B 1A7PL 3HPLB 4FKKA 1F4AA 3MZTA 3LJ3A 5TF0A 1KY6A 3BXNA 1D5BB 2I24N 1QW9A 2B4CH 3RPBA 3CPLB 4G9FA 4F24A 2PR9A 2XKUA 2JB5L 4JKNA 3VFPA 4BM7A 4LLMB 1OK0A 1B2WH 3V9FA 5HHPB 1ZVNA 4ONFH 3RWFB 1R24B 4J7RA 3P9WB 2EXWD 3WENA 1DE4B 3PGFH 4OCYH 4J27A 1BFOB 5F7KC 4TF4A 2IV8A 1Y18B 4F5CE 4PRNA 3RVVC 3WDIA 4ZZKA 2DICA 2G9HA 3T0DA 3IDXH 1F8TL 3B5HA 4HEPG 5IG7A 3OMNB 1UOLA 2JF1A 4I9XA 4L8SA 2K6ZA 3KLKA 2FO8A 3N3EA 2EEXA 4GXFA 4V33A 3PXLA 1KLUA 4DHLA 3SODB 2EH8L 3NG5A 2VAAA 1KWGA 4KX7A 1FVCB 5D7JD 2P5WB 2X0VA 3NRQA 2GTZA 3NZ8B 4MXQD 4P3WA 3GRWH 4B53A 4AEIH 3JYCA 5B4MC 2PP7A 3ESOA 1PX4A 2DMKA 1C12A 2CCLA 1HWWA 1WH0A 1BW8A 4TTDC 5ITEA 3DO7B 4AXWB 2WXNA 2PPEA 32C2B 3U4EB 1YN7A 2Q0ZX 4OCXL 4F9PA 1IFHL 4QNPF 4AYGA 4Y2OA 1GCYA 4HJGA 3CQPA 3MUY1 3TWCL 4ZFGH 5LNDA 4ES9A 1G43A 1J5HA 1X9LA 1MVUB 2WSKA 1RJZB 3G04A 4PJXB 3BVNB 4P2AA 2R7EA 4CSZA 1CYXA 1QKOA 1U8NB 1ZT4A 4ODHL 3G7TA 4N3UA 4XN1A 2XVGA 3ZE1F 4HKZB 2XA8H 4KUCF 4G43A 3HOGA 1JWMB 1SF3A 1TF4A 3NACL 4C54A 1AQMA 2PXYA 2Z92B 3SGEI 3TH3T 1RP8A 3L4TA 4NP9A 4RMRA 2HFEA 2VR5A 3IDUA 4JO5A 2M26A 1MI5A 1E7UA 1ETB1 1GPOH 1RI8A 2X44D 2D0HA 3ZMRA 5KSAA 4QXTB 1NCDL 4NQCA 4DZ8B 4NC2B 3BQVA 4DKAA 4LCWD 5DVOA 3HBZA 4FQ1H 1VDGA 3EG9A 2A9CA 2JAGA 3CLFL 4M3JA 1EXUB 5ABAA 3ZGIA 1AH1A 3L3IA 4LPXA 5GGTA 3CHOA 5JPNC 2D2CC 4B9ZA 1H0DB 4XE0A 2F8IA 3NQIA 5EN2B 3O4LE 4Q89A 1UD6A 43CAB 2HT2D 4UQAA 3DHUA 4WHYH 2X4PA 1N8OE 2QMJA 5F96L 2P8MB 3D69A 2YK1H 3DIFB 2NRDA 4ZFZB 3WKMH 1OTSC 4NYLA 3ZJAA 3GB7B 5B1JA 3CHSA 4G82A 4Q9BA 1ZTXE 3L4XA 2EDYA 3PWVA 3QDAA 4Z7UB 1NMAH 3FCBA 3GHPA 4L8DB 3QJTB 5AOIA 5EMYA 3WGVB 4IBUA 2QVTA 4Y1SA 4ELKA 3CFMA 1JGLL 1AACA 1PLCA 2WC7A 5DEGB 3CDYA 3MLPA 3ZDZB 3QEHA 4HAFA 5EZJB 1IC7H 3ETBJ 4JAMB 1N4XL 1CE6A 3BI9X 1OIOA 1X4YA 4IOSA 4PD4K 3HE6A 4P2RB 2ED6A 3F62A 4NEHB 3PPSA 3T3ME 3HN5A 5L88L 1JZ3A 5TF1L 1V3MA 3FS9A 4JO3H 2R2EB 5EF0A 3NIFF 4OZHF 5HHVL 4H25B 3RL2A 3MUJA 1MUJB 3DUUA 3QHFH 4UOW0 5EOQL 5HDWA 5J06A 5IF0B 1Q8MA 3UZQA 4WTZG 2V4LA 4PJIB 5F9JA 1T4KB 3QCVL 2BY3A 4S1RL 4N8VA 1BMWA 4JFDE 4F5CA 3NRPA 3CU1A 2UVFA 1BD2B 4ELME 3ME0B 2DQEH 3PWLB 4ANVA 4MNQD 4ZW8A 3MROA 4NHUA 1TCRA 5JIKA 1B90A 4BFJA 4LIQL 4F7TA 2ZOLA 5I15L 2BIMA 5CEZD 3S48A 3SO3B 3U1QA 4A66A 1WZAA 2JQZA 3MXWH 3H0TA 2X1XR 3QUYD 4R7VA 3FCUB 4OIBA 5ILTL 3WJLC 2CLVA 4GRLD 2AJZB 1AC6A 4UTAL 1SHWA 3GF8A 1MWOA 4LVOB 4FMFA 4D0BA 3RILA 4M6AA 5DD6A 1SXSA 1G7LA 2YGQA 4Y7OC 4L9LC 1CGVA 2BERA 2HKHH 2V37A 2PLTA 2FUQA 1MZYA 4R26L 5K39B 2ZUTA 4LE8A 3AREB 3APMA 4LHUD 3X3FH 5I28A 2KI6A 5IHUL 1WHOA 1R3LB 1X0SA 3C8DA 1F45A 1WFUA 1FUNA 2LLLA 3FHQA 5IEKB 1J0JA 4JVPA 4N1HB 1G9ML 1KPRA 2YXFA 4EJ4A 4PJGA 4LOVA 1QFWI 4O2FA 3FONB 5FA3B 4Z77A 1AD9B 2R2CA 1G7QA 1O7VA 1RIVH 2CBOA 3KL0A 2FEEL 4GAFB 5E70A 4F2MB 4UNTA 1KGCD 3MOQA 5JLZB 3TBYA 4MA1C 1N8ZA 2X2HA 4L2LA 1A25A 5DURB 2J6EA 3A4EA 3UZEA 2ZP8A 1PF3A 4EIUA 4D9LL 3RWHB 4BFNA 2GYSA 2XX0A 3QPQC 3PXOA 2BVQA 3UAJA 4KQ3L 2XTLA 3G5WA 5JJEA 5DHEA 3SKMB 4DO5A 5B38A 1I9EA 3EO0B 3KG5A 1HJCA 4QTIH 1K4CA 2VLJD 5HI5C 5BQDA 2ZX9A 3E3QC 3TA3A 2JJTC 1A9EB 1ES0B 2Q9OA 5IB4A 1EBAA 4OZFH 4J3OC 4NO5A 1ZVHA 3B7YA 5I1LA 4RGOH 4MAYB 4DKFL 1A6UH 3O4LA 1Z9LA 2L8AA 4L29A 3HE7C 5CEZL 1PLBA 3OLIA 5E1QA 3RI5K 3PGDB 1NDMA 5DQDL 3MA7B 4PTTA 2JKRM 3D34A 4GMSH 1VFAA 1S78C 1SMAA 3KWWA 1FV1B 1TQSA 5DVNA 1EANA 5IB2A 3AAZB 1K2DB 1B9ZA 2H26A 5IFJB 2JJWA 1B4JL 2C9RA 4E41B 4IU2A 3ABLB 4LQFL 1F90L 3NTCL 1TKWB 1MXGA 4YSAA 4DIXA 4GBXC 2BWDA 5J7CC 5E51A 3OE8A 1HKLL 1UM6L 2IANA 2NY5L 4UAOC 1H6EA 2UWEF 4NQXA 3WN6A 1CGTA 2VW7A 4J3WA 3R06B 5JOPE 3FFCE 1THAA 3HG1A 3KYNA 4KROC 2BVOA 2R0LL 4L37B 3ZLQC 1A65A 2LHAA 4NQVA 3RL1A 4FTVA 1UADC 3K2KA 1A7NL 4K73A 4TQHA 5TQ0H 3FO1A 4W6YB 5CLZA 4LEXL 3ZRCC 3EBIA 4MJ4A 2HT3C 2CK0L 5FYLD 5IMOB 2V2TA 1FZOB 1Z5YD 1Q0YH 2H3XC 4QXWA 4TNWF 4NWTL 4EQ3A 4ABQA 1OAXL 3JWNG 1O75A 3DX9B 4TVUA 1CFVH 4JLRA 3MRLB 5DJAB 1QSED 2KSAA 4LGSB 1ZHBA 3VGGA 2CJUH 3EBAA 5K9QI 2HT4D 4G70B 1JNHA 1M2VB 2WTOA 4W6XB 3VFOA 1C8SA 1KJ2A 2VNCA 3GHBH 4IARA 4CVZA 4ZMTA 1T80A 1CGWA 3F12B 3FRPB 3WEAA 2CLRB 3FTYA 3D0VA 1ZVSB 5FB8A 4CUCA 3IDIB 2OMZA 5T1MB 1G6RB 2EDKA 3IPBA 1FAIL 5CBAA 5C07A 3SOBL 3U7AA 5F89B 1J86A 5IK3A 2OZ4H 2WYIA 1NGYB 2OYPA 1RIUH 1ZA6B 3P4LA 3VW3L 5E2VL 3CFJA 3Q6GH 1SOXA 5FECA 2ZYSA 1JI1A 1SEBA 5DQ9A 4UUJB 3UX9B 3E9UA 3BJ91 5I6LA 1UWXK 1A66A 1WBXB 1WHPA 1DZBA 5DQJB 1JWSB 3RHWK 4UYQA 3LRGA 1JZ2A 1MH5B 1G4RA 3U7YL 3FYEB 4P2YA 1JDDA 5CEXB 5JYMA 3U2IA 3FQRA 3GMNB 1BWWA 1X5GA 1YY9D 3EOBA 1ZCRA 1ZLUH 4Y16D 1M0MA 2DEWX 2EEBA 3L9BA 1LEIB 1FO0H 1GYWA 1WVZA 4G8AC 5CKGA 5DRXA 5T1JA 3CC1A 4X7EC 5ALBL 4KDWA 5JXEC 2EYSA 5BZDB 1U0QA 3ASOB 5EZOL 2NLJB 2VDMH 4YLCA 5T1KB 1BQ5A 1EEZA 1X9QA 4JQIH 1BX2B 1FVEB 2D7TH 4GRWH 7TAAA 4DWHA 1O6VA 4YHPA 3QZMA 2HMID 1HHJA 5AZUA 3DVNB 5FYLL 4KRPD 1AP2B 2WLLB 5FV1L 1CQYA 1C8PA 2JCCA 3HHRB 1CGSL 4GFTB 3MV7D 4FL4C 4HT1H 5FO8A 1JJUA 1JF5A 5G5DB 5IUSA 2JCCF 4GT0A 3D85A 1M71A 1RQ5A 4GKNA 3T0EA 5KTEH 3OHMB 5JHDA 1H3XA 5I17A 3S0PA 4XNMB 2YPLE 3WUZA 3QYCA 3IJSB 1CIUA 2DQDL 3MLSL 5AEAA 3DX2A 2P8PA 4KI5E 1JP5A 3WL9B 1U8KA 4JM2C 4NP4L 5HDLA 2ATKB 3FMGL 4PYGA 5AX1A 3S7GA 4X6CE 3GS7A 1T0PB 3LSOB 2OSXA 2FQEA 2BCKA 1WGVA 4MD2A 3MLTB 5HPMB 4XPFL 3H9YA 2FD6H 4W9HC 1A1MA 2BNRB 1TJHL 3TJPA 1IAIH 5E8PB 4U49A 4GIOA 3EYSL 5DK3A 1HEZB 3D4SA 3KYOA 5TTRA 4XC1H 5GISH 4GFXA 1T04B 3EYUH 3UP1A 4Y2DC 4DK5A 1XO8A 2MCPH 1S7VB 3IDMB 5I1EH 5JORA 3V5KA 1N2RA 3TVMC 5GS2H 3NIDB 2KSBA 4XO5A 3KPRA 2GVYA 3D25B 1PMYA 2H32H 3GSWB 3STZA 1MZZA 3C8HA 3L16A 4GG6E 2QSVA 2Y6TE 4NM4L 3CFKA 2V5SA 5JMRA 2XWCA 4Q58C 5KSUA 4EKJA 2IAMC 5EA0H 3NCBB 2ZZLA 3D06A 1DLFH 2OMVA 4XAWL 3KR3H 4KXZI 3UC0H 5ICZA 2X0WA 4XOBA 3MFFA 3QQDA 3TU6A 4M4RA 1IVTA 4ZW3A 3BH9A 1ASQA 2EJ1A 5HYEA 3TYGH 2CO6A 3C8KB 4X4ZA 5H2PA 2PTTB 3BIKB 3VFRB 1RIHL 2YR3A 4ZFOL 1U3HA 3HZ3A 1EEYA 5HYQA 1NAKL 4XXJA 1UYWH 3VI3F 3VFGH 3V4PL 1PIGA 4UHRA 4FQCH 3CX5J 1QKZL 3K6IA 4TLSA 5D2NA 3O2DH 2GUYA 4X80H 1JIBA 5CZKA 5EU7E 4QRTB 4I85A 5C71A 3PP3K 3BWAB 3FCSB 1JNLH 1LO2H 1HL9A 3OJDA 2PN5A 1EA9C 5HGBB 4LLDA 2PXYD 1EZUA 1QFWL 5SWSE 4P04A 1MI5D 5D72H 4NM8L 2D31A 4TQPA 1F02I 1VGEH 4Q0XL 4IOIA 5KSAD 3T4AB 4NQCD 4WENB 3X3GH 3RZCA 3GSXA 1SY6A 1Y07A 4PGBB 5ITBH 4JL1A 3HNTL 1D5XA 2ICES 3QO1B 5DLMH 2OR9H 5DWPA 1KFGA 4M7LT 2FX7L 3RYMA 3VXQB 3U9UA 3L08A 4AYID 3C5SA 2PABA 1BM7A 1H3TA 4MWFB 2J55A 4MQTA 1BYOA 5C0DA 5FR3A 1JPEA 4LNRB 3OR7A 5A3ID 1XFPA 3BHBA 4Y8AA 5IM7A 4PJ8C 5DMKA 4M8QB 1T1XA 5DHYA 4HSQA 5FW7A 3AM8C 1Y6NR 3CQQA 4MMYB 5DS8A 5C0FA 5DZLA 2ENPA 4NS0A 4JFZL 1E9QB 4GXVH 4B5EA 1ZSDB 5AALA 1YY8A 4R6UA 1I1YB 1ZLDA 4IRSA 1KNOB 3H3PH 5CD5D 4BUHA 2QGBA 3FO2B 4CVXB 1E9OA 4MQSA 5FDWA 4FQIH 3ZKXC 3KPSB 3HI6L 4GRWB 5HYJB 4M1GH 4UBDD 4YGVA 4X6CA 1ZGLB 1XWVA 1QOKA 2QKIA 2ZWLT 3ILQD 5I24A 4NT6A 4Z78A 2B15A 5TPWH 4A7QA 4U0QB 5EC2B 4Z95L 2Q5BA 3K6SA 4IOSD 3REWA 3AUVA 3HE6D 3LOWA 2NY1D 2IWEA 1LE9A 1NIDA 2BFGA 2GSGB 4PLOB 4JRWA 2WQ8A 3KWVA 3SPVA 5IESH 2Q86A 1QSFB 3CAPA 3GMQB 3HLAA 1P6FA 2EE3A 2CCWA 3ARYA 3OGCB 4HJIA 4FN0A 1JTOA 3R7QA 1KXQE 2IH8A 2CGRH 3QHTC 3QULB 1KTCA 4KX8A 3B37A 2OQJA 5CLYA 2ZWYA 4G9DA 5F9OL 2XTJD 2H4EA 4TV3A 1FRGL 3EAKA 4YFLI 1TETH 3ATBA 5T3ZE 1P53A 2ZKHL 3LV3B 4QRBA 3PQYB 1SYVA 5CGMA 1HXMB 3VG9A 2OAAA 1JTTA 4QYOB 4HIJA 2BSDA 1L7TH 4GJTB 3MOBH 3OKLA 5E08H 1ZD6A 4E2OA 2E7CA 4RCAA 3S96A 1U8PB 1QW8A 2AKRB 2FZ3B 1TDQA 1CG9B 1CICC 1SDDB 2NY7L 5CFHA 5D1ZA 1MFBL 3WS3B 1VCBC 2P5WE 1M9SA 3QEUB 2PW2B 3I9GL 4N8VG 4OIIH 2VDKB 3H2WA 1S3KH 5BZXA 4MJ2A 1LMIA 3N50A 2G5UA 5DJYA 3T2LA 4A68A 4ERSH 1V27A 3POCA 4X1HA 4YSRA 1J8SA 1EUTA 3KL3A 4H0IA 4Y1AB 5E8EB 5CN2A 2NCEA 4MXWH 4PJXE 2IPUK 2MPAH 2O61A 4L1SA 2VXQL 3A5VA 4X4YA 1H8SA 3B2DC 1QUNA 1C9SA 5AD0B 3ZL4H 2NUTB 2ZXEB 1UGKA 1ZPLA 3DECA 4AQAB 2IPKA 1MRDL 4NKIH 5E8NB 3US9A 4H1LA 3G5ZA 1UD8A 4TL3A 1R5VB 3BC9A 1FNEA 3EJQA 4L8BB 3VVVA 1SXZA 1JN6B 1Y7VA 3ISRA 2JFCA 4UQEA 1FBBA 3HG4A 1X0K1 3JT0A 1R6VA 4EZLA 3UAJD 4YAQA 5AYUL 3QIBC 1OAYL 4HKXB 1OGTB 3REYA 4LLVA 4P0DA 3VA2C 2AEQH 2WY3B 4JN1L 3TA3D 1QBMH 2GHWB 1KPVB 2HTKD 2K8MA 5HVFB 3V8OA 2RTTA 4YLQT 4GKSA 4NJAH 3O4LD 4YHNA 1BBDL 4DOHB 1KXVC 2XPYA 4IKNA 1KTLA 3QUXB 5T5FL 3V8CA 4GAJH 3IVKA 4AK2A 2CMRH 3MBEC 3MRCA 4NZUH 4XPHH 3VD9A 4KQ0A 4M93C 5FS5A 2XX1A 1TTGA 4YE0A 1MCSA 1A0QL 2AJXH 3BZFB 3LZFH 3ZSSA 2VITB 1T6VN 3O8XB 3MJ9A 2R9HC 5I9QB 4WSKA 5B38G 2CNZA 5JIMA 1JZ4A 4H5SA 3P11L 4GSUA 5CIPA 2EVJA 2V0AA 3POHA 3QO0B 4I1RA 5BS0E 2IBZY 1YEFL 1T7WA 5D6DA 1O6SB 1JI2A 2O6PA 3KCPA 4QJ3B 3ZDZE 3H55A 5EU5A 3HPLA 4KQ4L 4DK6A 1UZ6E 2VSDA 4MQXC 5IGXL 2KHAA 2RIKA 1YVLA 4AMKL 2IAND 3E6FB 1SBBA 1UA3A 4N5EC 5ELIA 3LPWA 1D5BA 1PS3A 4CADB 5I1JL 2OV0A 1Z9NA 1GRWA 2B2XL 3CPLA 3TO2B 3VFUB 1HNGA 4LLMA 3CE1A 5E1AB 1OXYA 1VEOA 1JMZA 2PCPA 1ROCA 2HLAB 1A3LH 1XJIA 1R24A 4JFDD 3IKCB 1BZEA 5JZ7D 5FYKD 1DE4A 4FTVD 3PU7A 4N0YH 1BFOA 4PJIE 5LGYA 3WY1A 1Y18A 4BYHA 5I75B 4JHAL 4MD5B 1BD2E 1MW3A 2UZXB 3M8OH 5FFOA 2AJUL 4DCQB 5C7XH 4AL8L 4LVEA 3K1DA 1I7TB 2FSDA 5I73C 3UBFA 5CCKL 1N59A 2X72A 2LV4A 4UV4H 1ZLVK 1MRCL 1SVZA 1ADQA 4ES8A 2ZIYA 1F4XL 2DN7A 3BLPX 4H8VA 3ZDXE 4RFNC 3HRZC 2ZOOA 5KBNC 1FVCA 3U0TB 1Q1PA 1L6ZA 5EV7A 2P5WA 3GKWH 4PQXA 3NZ8A 5D7HA 5JW4N 1SOQA 1M0KA 2Y5QA 1PKQE 5H2NA 2QFRA 1FHGA 4XZ4A 5LUMA 3KYKH 4AXWA 3U4EA 1ZTXL 4LO9A 3KEDA 4IDJH 5C07D 3VGAB 3NA9L 1K85A 4WJG3 4YHKL 4YSSA 4WWID 2Y22A 3SE4A 2A9BA 2E7HA 1MVUA 4X8GA 1RJZA 1JPTL 1KEGH 1SVCP 3BVNA 3CD4A 4PGEB 5D1XA 4UT7H 1A6VH 1U8NA 1Q9WB 3RDTC 5F3FA 5BUAA 3PXHA 4HKZA 3N5AA 3UTQB 1BA9A 4F8LA 2MTAA 2Z92A 1OB1B 4JQVA 3ZRSA 1I9RL 8FABB 1GXEA 1EVTC 2WZ6A 3FSWA 4LHJB 1M56B 1PG7H 1NH6A 4TQIA 2W95A 3DSNA 5D70L 1UOVA 2F53A 4QXTA 1JGDB 4DZ8A 1I3RB 4H44C 4RAHA 4MXVF 1GZHC 3ULUF 5EZIH 5CZRA 1UATA 3L3OC 2GEQA 5F0LB 4FXKB 5CSGA 3QZWB 5FF6A 1TPXB 1T7YA 5F8UA 4E42B 1HNYA 5HJ3A 1OW0C 2FBOJ 3OPZL 5EN2A 3G9AB 3NFSH 3DXAE 3BLBA 3W56A 5CMAB 3V0WL 43CAA 5D1ZI 3ARDB 2ZJSH 1CR9L 1AMXA 1DSFH 1EERB 3CNKA 2P44B 1HU8A 1VFUA 4GBRA 1X5JA 4JY5H 2P8MA 2WXQA 1JZEA 3DIFA 2R15A 3CFQA 3D85D 3JWDC 1WICA 3T0ED 4HALA 1P7KB 3GJFA 2OYMA 5E6ZA 3GB7A 3GYRA 3I6LD 4R7NB 5JHDD 5I6NA 5HHOE 4K9EL 3IWUA 4Z7UA 4L8DA 3IYLW 3DIVA 2NZ1A 1NOFA 2V3DA 2IO5A 1PZBA 4PJ7F 5SWZB 5C6TL 2VM3A 3H7BB 5DEGA 1LE5B 2VDRH 4E41E 4QRSB 3IDYB 5I5IA 5EZJA 4HZAA 2QQNH 4HJTA 1K5WA 2VN7A 3ASNB 1YEKH 4P2RA 5EORH 3T71A 3UAAA 1CU4H 4E9LA 3V5DA 3UZAA 1TVHA 3CWGA 1XGYH 2IXQB 4AV4A 5A2JH 2A6JB 5E5LA 2DWSA 2NXZD 2R2EA 3TCLB 3GMPB 4H25A 1IGCH 1MUJA 1WK0A 2L04A 5IHLB 3FUJA 2X4RB 1ND0B 5IF0A 1X5YA 3GINA 2YLKA 2A4ZA 1T4KA 2MWCA 1J87A 4GUCA 2O5XL 4KO6A 1SPDA 1BD2A 3KPRD 3PWLA 3T8XB 3QXWA 2HWZH 3BUPA 4PJHF 4POUB 1QFWM 3OVUB 3RX5A 3V2WA 4JY4A 2NNFA 3SGJA 3L8QA 4NI6A 2XV0A 3KLAB 1PZ2A 4GYCA 1U41A 1IGIH 4XVUD 2AJZA 4M00A 3L3KA 2F54B 4ZODA 1RUPL 1YNTA 4EJ1C 4EO5A 1F3RB 1GYVA 4CSPA 1CB4A 2AI0H 4ZMVA 5J3HC 4JR9H 3QNXB 4JB9H 5I6XC 2H1XA 5K39A 1YNTF 3AREA 4LK4A 1U3HD 4PBDA 1PTZA 4KV5F 3VMOA 2WMPB 3TT3H 2JAFA 2VDQL 1QZ1A 1R3LA 4EZJA 3F7LA 4GS7C 1FFNA 4H40A 3UTSE 4LLAA 4JPQA 2G5BA 4RMVA 3VW7A 4ZOEA 4GO6B 5HGDB 5EBWB 1LEGB 5FA3A 4Q2ZB 4X99B 2Z8SA 3QZBA 1W8NA 4PM1A 1XCQB 4M61B 2LTQC 4F2MA 2WXLA 1R0AL 5JLZA 4B60A 1MLBB 3LH2L 2E7DA 3QS3A 2VDPL 5TH2B 3RWHA 4QRQB 3QYMA 2OMUB 4TVPH 4NN5C 3U83A 3N85L 4HFWB 5CR1A 2EVFA 1MQ8A 2WUBL 1OP9A 3RVTC 3C09C 3RZCD 3RWIB 5EO9B 3D3VB 4MJ6A 2F1BA 4YQXH 1A9EA 1ES0A 4WHCA 1P6WA 4APQC 2PP9A 4EN3D 3MBVA 4LL9A 4AZ8B 4MAYA 4LEEA 3N9GH 4C56E 2J3SA 4ZUWA 4Z7AA 1KB5A 2ESVA 3PGDA 3O2WH 3ZHFA 4B5ZA 4Z7QE 3FT2B 2BO0A 4K7FA 4DEWA 4PWEA 3F58L 3OLGA 1JXFA 5AOMA 2W5PA 3CSGA 3VFVA 4ZUUB 3WHXA 3GSNA 4M29A 3M88A 3K46A 5E94A 3CODA 2ZUQC 1KJVA 1PAZA 3BRDA 1FV1A 1OGAE 1COBA 4YDLC 4E5XB 1Q5IA 4A4MA 4RRPA 1K2DA 4AJVA 4DKTA 4J3VA 1EJ8A 3LN4A 4IRSD 5IFJA 1M7IB 4E41A 3WTYA 2NYYD 4OKVB 1E4KC 4J3SA 1VKXA 4XP9L 2H2SC 2ENJA 3WY4A 3FB7B 3VD0A 3C6LB 3KXFB 1TKWA 3U9PL 4EI5C 4BFBD 3VQ2C 2DEXX 3EJPA 3GSQB 4JPWL 2H41A 2HX8A 2K8QA 1BBJB 1LWJA 3FT4B 4ZO8A 2EDOA 1FNSH 1HH6A 4YDKL 3UMTA 1FWXA 4YFDB 4LDEB 1IJNA 3MLXH 4JUTA 1JRHH 2WQRA 5E2WH 5D71L 5E8DH 5LN8A 1TJMA 1U33A 2YOAA 5E6SB 1U2CA 3R06A 1PY4A 2H9GA 3ATEA 2WP3T 4NGHL 2V17H 1OQOA 2WSDA 1IBZA 1P1VA 4JJHA 2X70B 4NRXA 4F33B 4YR6A 5B3JE 5KBLA 2J56A 1RPQA 4FF9A 4B9JA 4LSSH 1TZHB 3T2PA 4LAJH 1JHTB 3AW5A 3AY2A 5DHXB 3HKFA 1FZOA 5BRZB 1SY6L 4RNRB 3UMNA 3X1FA 1BAFH 2Y06H 3DX9A 3BAEH 2RHEA 2F19H 4NSKB 4WUKL 3MRLA 4IEFA 2NY0D 2WP3O 5DJAA 3VXSE 4Y4KB 2ADIB 3A6BL 1YNLL 1M2VA 3GSVB 2BS71 4UQIM 4IRZH 4WFHE 1PCXA 3NABH 4WSGA 3APNA 3GZQA 3FUDA 4HK0B 3F12A 3FRPA 4LESA 4XWGL 5D1ZD 3NJXA 4PWHA 3G3LA 4GAGH 4NPKA 2BIHA 4DFIA 3NPSB 1G6RA 1WUNT 1DVTA 1UWEL 3ARGA 1W80A 4BFRA 4F9LA 4J2XA 4LL4A 4AIOA 4J3UA 1ZA6A 4XPTH 3ZTNH 2VC2B 3MV9A 3SDYH 5H2OA 1IGML 3B9VA 4UUJA 3SE3C 3DDGA 2WVVB 2NQ3A 4PJCF 3DTXB 1WBXA 2ZCKL 3BESR 2AABH 3ET9F 3GMRA 5BQ7B 1T0OA 3MBXL 4MA8H 1B0WA 1MH5A 4O00A 3HZKA 4JPKH 1Q94B 5C9KA 3CSPA 5DFVC 2NY2B 5CEXA 2WXHA 2LFEA 1X5FA 3GMNA 4KNFA 4KKQA 4M7ZC 1CTNA 1HTYA 5GS0C 4G6AC 3V4VB 3KPOB 1AR1B 3ODUA 3VU1A 5BZDA 5KZCD 4NQQA 2NLJA 2AF2A 4ILDA 5T1KA 4XCYA 4WGWB 3OTTA 1FQ9C 4GPVA 4X0KB 5DT1L 4CU8A 1S9XB 3DVNA 5C70A 2R8SL 3V95A 1AP2A 2BPBA 1S7TB 2QSCH 2WLLA 3M1BB 5T1DH 2G4EA 1ESOA 3FPXA 5FCUH 3JV6B 4PJ9C 5J1TC 4Z18A 2O5YL 2XVLA 4H1LG 5CLWA 3LEYL 4LP8A 1D2OA 3KVQA 4BXVA 3MNDA 3PIQB 3FQ2A 1RZJC 3CH8A 1KJMB 4K3GA 4XNMA 4P99A 5IW1B 3IJSA 2GEEA 4ZMYA 3S97C 4PJDB 1A4KB 2NPLX 3WTVA 3F7RA 3X1EA 3LDBB 2ATKA 4GRWE 5HYJE 2D2OA 5JHAA 1CO1A 3V0GA 3LSOA 4K8RD 2QQLL 3EGSB 3REVB 5HPMA 4JREB 2KERA 4IBLT 3WXWL 2BNRA 2LLNA 4YPGB 5K5YA 1RK1B 5E8PA 4P9ML 1J18A 5F6IC 1HEZA 2CO1A 1T04A 3QFJB 2VKWA 5DEZA 5D2LA 3ALWA 2HVKB 4ZAKC 1XD0A 1N10A 1KCVH 3ESPA 3IDMA 1TG8A 4FA6A 1OF0A 3NMEA 1EHAA 1J0IA 4G7YL 1KLGB 3D25A 3BKYL 4KZCA 5D2LF 1WT5C 3GSWA 3QVAA 2CKBH 4JJ5A 2Z1PA 1Q4NX 3ORJA 3HC2A 2ZCHL 2CO3A 3HMXH 1QI4A 4S1SL 2XXCB 1OOAA 7PAZA 1K3ZA 3BSZH 4O9HL 2PCFB 5J13C 4IJTA 1BGXH 3G08B 5IOPB 2NR6A 4ZBJA 3BUBA 2C3VB 2Y6SD 4YN3A 3LTVA 2P5WD 4FE9A 5LG1A 3UEZA 3C8KA 3O6MH 1H68A 4GW4A 3VFRA 4JO2L 4AVKA 1LP9E 2FATL 5D93B 1OSPH 4CU7A 3L13A 1YNKL 3N1MC 3MJ9L 3I6KB 2ZXCA 4BH8B 1UH4A 4A6YA 4AI7A 1LILA 2UZYA 3JVFC 3T0VA 2CH8A 5JW4R 1CGYA 3ULVH 2CR6A 5D1XD 1RK7A 4QRTA 4AYSA 2HVBA 1TTAA 3S8WA 4Y1AE 1OAUL 5B1BB 1AXTL 1OALA 2AEIT 7FABH 3NK4A 4FJ6A 2IDCA 2EO1A 5ESAB 1ICTA 5AB9A 3TPKA 4KJYA 2V9QA 1WGOA 3P2DA 3LEXB 4DN3H 2W1NA 1H3GA 5MERA 5MEQB 4Z7NF 3U30B 1KIUA 2DKMA 4AEEA 1RZKH 1QKPA 1I31A 2VXUH 2WGNB 3T4AA 2F53D 3MV8A 1J1XH 2NDGA 4XN4A 3P9LB 3QO1A 1M1XB 3LX9A 3VXQA 4LASL 3CFDB 1BDYA 4NC1C 4JGUA 1WA2X 3K2MC 1LQSR 4U7MA 2WJ7A 4XMWA 5T3ZL 3RVUC 3TEXA 2X10A 3NSYA 5DZJA 1EFQA 2DLFH 4LNRA 1VIWA 2PWGA 4U1NB 5ECGA 2DPKA 1AMYA 4Y9GA 3U1SL 2NZIA 1N7MH 4I2XE 1U2HA 2OI9C 1OAQL 1RLWA 5CGBA 4TSAL 2FVNA 5E03A 4LLYB 1WIPA 3LN5A 4KK9D 5HDQL 4HCRA 1I8MB 2AQQA 1I1YA 3QORB 1EX0A 5TGZA 1KNOA 2ICWJ 4CVXA 4BKSC 1LO0L 3Q1EA 4FNUA 5CJXC 5FUOL 3KPSA 2BZCA 2HRPH 2EC9U 1YA5A 1NCJA 3QR0A 1ZGLA 3RBGA 3CH1B 2JKWA 4WVRA 3RI5F 5DD1H 1I9JH 4PB9H 3C9MA 1G0XA 1YYML 3JUYA 1A4JB 4FX5A 2CGYA 4XB7A 4R4FL 4P2RD 1JFQL 2Y2YA 4CMHB 4K71B 3KDMB 1E65A 2GSGA 3GTVA 4PV8A 4FZ8L 3WIIH 2HRLA 4U6HB 4O2CB 5GGUB 1LO5B 2OMYB 1U4EA 3GSOB 2QZ5A 4ENED 2O5ZL 5IW6A 5JW3H 4OV5B 3QA3B 1QSFA 4BUQA 3GMQA 2OTPA 2BRDA 2F5BH 3NK3A 4AQ8C 5I76B 3OGCA 3S36X 2Z8VC 5DWUL 2EQDA 3IFNL 3VXMB 3N40P 3F05A 1BD2D 3QULA 4URKA 2J2ZB 3EF4A 5DD5L 1AIFB 4IKJA 1NGWB 1JYVA 1HFUA 3OB0H 2AP2A 2EILB 1GGIL 4WDIB 1LO3H 3LV3A 3HS0C 3PQYA 3BKML 1HXMA 4IKIA 3CFEB 3WD5H